F496196
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1983 | 686 | 3966 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10006413|JGI25404J52841_100064133 |
| Length | 223 |
| Sequence | MIGSKGRASQATGFAPNSSLNLTAASRNQSMSRPLTATQSTPDEVLIERIAGGDRLAMQVLFARHHVRVYRFVLRLVRKPEVAEDLISEVFLDVWRQADRFEGRSAVTTWLLAIARFKALSALRRRPDEELDEDTAAAIEDPSDTPEVAIEKKDKGNVLRQCLDCLSPEHREIIDLVYYHEKSVEEAAEIVGIPANTVKTRMFYARKKLGELLKERGIERGWP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 135 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 136 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 137 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 156 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 157 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 158 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 159 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 160 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 178 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 179 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 252 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 253 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 275 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 280 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 281 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 283 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 285 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 286 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 287 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 288 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 289 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 290 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 292 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 293 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 294 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 295 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 296 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 297 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 298 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 299 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 300 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 302 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 303 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 304 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 305 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 306 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 307 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 308 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 309 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 310 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 311 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 312 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 313 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 314 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 316 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 317 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 318 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 319 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 320 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 322 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 324 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 325 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 326 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 327 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 328 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 329 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 330 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 331 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 332 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 333 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 334 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 335 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 337 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 338 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 339 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 341 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 342 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 343 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 344 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 345 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 347 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 348 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 349 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 350 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 351 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 352 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 353 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 354 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 355 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 356 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 357 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 358 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 359 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 360 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 361 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 362 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 363 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 364 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 365 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 366 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 367 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 370 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 371 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 372 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 373 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 374 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 375 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 376 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 377 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 378 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 379 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 380 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 381 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 382 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 383 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 384 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 385 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 386 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 387 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 388 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 389 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 390 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 391 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 392 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 393 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 394 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 395 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 396 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 397 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 398 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 399 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 488 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 489 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 490 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 491 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 492 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 493 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 494 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 495 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 496 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 497 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 498 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 499 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 500 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 501 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 502 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 503 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 504 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 505 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 506 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 507 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 508 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 509 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 510 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 511 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 543 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 544 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 545 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 546 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 547 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 548 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 549 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 550 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 559 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 560 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 564 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 568 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 570 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 571 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 572 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 573 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 574 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 575 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 576 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 577 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 578 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 579 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 580 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 581 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 582 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 583 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 584 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 585 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 586 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 587 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 588 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 589 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 590 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 591 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 592 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 593 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 594 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 595 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 596 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 597 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 598 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 599 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 600 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 601 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 602 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 603 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 604 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 605 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 606 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 607 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 608 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 609 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 610 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 611 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 612 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 613 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 614 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 615 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 616 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 617 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 619 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 621 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 622 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 623 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 624 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 625 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 626 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 627 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 628 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 629 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 630 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 631 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 632 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 633 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 634 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 635 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 636 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 637 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 638 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 639 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 640 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 641 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 642 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 643 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 644 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 645 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 646 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 647 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 648 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 649 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 650 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 651 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 652 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 653 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 654 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 655 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 656 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 657 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 658 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 659 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 660 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 661 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 662 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 663 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 664 | 2904699407 | |||
| 665 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 666 | 2906610324 | |||
| 667 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 668 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 669 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 670 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 671 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 672 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 673 | 2922425934 | |||
| 674 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 675 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 676 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 677 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 678 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 679 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 680 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 681 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 682 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 683 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 684 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 685 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 686 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0.56 |
| Isolates | 3.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.83 |
| Nodule | 1.82 |
| Rhizoplane | 8.27 |
| Rhizosphere | 75.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10006413 | 3300003659 | Bacteria | 2459 |
| 2 | RicEn_C2512 | 2010549000 | Bacteria | 2046 |
| 3 | 2214745216 | 2209111006 | Bacteria | 14541 |
| 4 | ARSoilYngRDRAFT_c00191 | 3300000042 | Bacteria | 10262 |
| 5 | ARcpr5yngRDRAFT_c000145 | 3300000043 | Bacteria | 11347 |
| 6 | ARSoilOldRDRAFT_c000016 | 3300000044 | Bacteria | 39308 |
| 7 | ARCol0oldRDRAFT_c00161 | 3300000045 | Bacteria | 6068 |
| 8 | ARCol0yngRDRAFT_1000187 | 3300000652 | Bacteria | 10522 |
| 9 | JGI24032J14994_102107 | 3300001430 | Bacteria | 730 |
| 10 | JGI24746J21847_1001112 | 3300001977 | Bacteria | 4234 |
| 11 | JGI24746J21847_1006035 | 3300001977 | Bacteria | 1883 |
| 12 | JGI24740J21852_10025456 | 3300001979 | Bacteria | 1994 |
| 13 | JGI24739J22299_10001106 | 3300001989 | Bacteria | 10054 |
| 14 | JGI24737J22298_10010720 | 3300001990 | Bacteria | 3016 |
| 15 | JGI24737J22298_10027266 | 3300001990 | Bacteria | 1802 |
| 16 | JGI24743J22301_10026795 | 3300001991 | Bacteria | 1123 |
| 17 | JGI24735J21928_10028666 | 3300002067 | Bacteria | 1662 |
| 18 | JGI24745J21846_1000214 | 3300002073 | Bacteria | 4700 |
| 19 | JGI24748J21848_1010542 | 3300002074 | Bacteria | 1087 |
| 20 | JGI24738J21930_10004532 | 3300002075 | Bacteria | 3395 |
| 21 | JGI24749J21850_1006566 | 3300002076 | Bacteria | 1620 |
| 22 | JGI24035J26624_1002401 | 3300002126 | Bacteria | 1747 |
| 23 | JGI24033J26618_1017191 | 3300002155 | Bacteria | 903 |
| 24 | JGI24034J26672_10007006 | 3300002239 | Bacteria | 1635 |
| 25 | JGI24742J22300_10002116 | 3300002244 | Bacteria | 3159 |
| 26 | JGI24742J22300_10002245 | 3300002244 | Bacteria | 3086 |
| 27 | JGI24742J22300_10006662 | 3300002244 | Bacteria | 1904 |
| 28 | JGI24742J22300_10007686 | 3300002244 | Bacteria | 1780 |
| 29 | JGI24742J22300_10039293 | 3300002244 | Bacteria | 841 |
| 30 | JGI24751J29686_10003559 | 3300002459 | Bacteria | 3139 |
| 31 | JGI24751J29686_10016566 | 3300002459 | Bacteria | 1520 |
| 32 | JGI24751J29686_10048232 | 3300002459 | Bacteria | 879 |
| 33 | Ga0006759J45824_1016848 | 3300003163 | Unclassified | 869 |
| 34 | JGI25406J46586_10002634 | 3300003203 | Bacteria | 8465 |
| 35 | JGI25153J46596_10000632 | 3300003215 | Bacteria | 21524 |
| 36 | JGI25153J46596_10003303 | 3300003215 | Bacteria | 9062 |
| 37 | JGI25160J50197_1007144 | 3300003354 | Bacteria | 4403 |
| 38 | JGI25160J50197_1016309 | 3300003354 | Bacteria | 2397 |
| 39 | Ga0058859_10005899 | 3300004798 | Bacteria | 913 |
| 40 | Ga0058860_10029185 | 3300004801 | Bacteria | 761 |
| 41 | Ga0065165_1001679 | 3300005262 | Bacteria | 22393 |
| 42 | Ga0065714_10032781 | 3300005288 | Bacteria | 939 |
| 43 | Ga0065704_10096121 | 3300005289 | Bacteria | 2457 |
| 44 | Ga0065712_10039456 | 3300005290 | Bacteria | 822 |
| 45 | Ga0065712_10072238 | 3300005290 | Bacteria | 4846 |
| 46 | Ga0065712_10121301 | 3300005290 | Bacteria | 1667 |
| 47 | Ga0065712_10147584 | 3300005290 | Bacteria | 1394 |
| 48 | Ga0065715_10056642 | 3300005293 | Bacteria | 773 |
| 49 | Ga0065715_10201834 | 3300005293 | Bacteria | 1357 |
| 50 | Ga0065715_10224079 | 3300005293 | Bacteria | 1260 |
| 51 | Ga0065707_10147313 | 3300005295 | Bacteria | 1698 |
| 52 | Ga0065707_10200827 | 3300005295 | Bacteria | 1311 |
| 53 | Ga0065707_10242627 | 3300005295 | Bacteria | 1150 |
| 54 | Ga0070658_10482792 | 3300005327 | Bacteria | 1069 |
| 55 | Ga0070676_10003681 | 3300005328 | Bacteria | 8025 |
| 56 | Ga0070676_10024186 | 3300005328 | Bacteria | 3419 |
| 57 | Ga0070676_10074811 | 3300005328 | Bacteria | 2041 |
| 58 | Ga0070676_10347673 | 3300005328 | Bacteria | 1019 |
| 59 | Ga0070676_10425296 | 3300005328 | Bacteria | 929 |
| 60 | Ga0070683_100010409 | 3300005329 | Bacteria | 7999 |
| 61 | Ga0070683_100019681 | 3300005329 | Bacteria | 5998 |
| 62 | Ga0070683_100307391 | 3300005329 | Bacteria | 1508 |
| 63 | Ga0070690_100005755 | 3300005330 | Bacteria | 6984 |
| 64 | Ga0070690_100104361 | 3300005330 | Bacteria | 1883 |
| 65 | Ga0070690_100303423 | 3300005330 | Bacteria | 1145 |
| 66 | Ga0070670_100014637 | 3300005331 | Bacteria | 6734 |
| 67 | Ga0070670_100035140 | 3300005331 | Bacteria | 4314 |
| 68 | Ga0070670_100035513 | 3300005331 | Bacteria | 4291 |
| 69 | Ga0070670_100036571 | 3300005331 | Bacteria | 4225 |
| 70 | Ga0070670_100857778 | 3300005331 | Bacteria | 822 |
| 71 | Ga0070670_101241656 | 3300005331 | Unclassified | 681 |
| 72 | Ga0070677_10000046 | 3300005333 | Bacteria | 38785 |
| 73 | Ga0070677_10004236 | 3300005333 | Bacteria | 4672 |
| 74 | Ga0070677_10010099 | 3300005333 | Unclassified | 3218 |
| 75 | Ga0068869_100000900 | 3300005334 | Bacteria | 17139 |
| 76 | Ga0068869_100319141 | 3300005334 | Bacteria | 1259 |
| 77 | Ga0068869_100438424 | 3300005334 | Bacteria | 1081 |
| 78 | Ga0068869_100861791 | 3300005334 | Bacteria | 782 |
| 79 | Ga0070666_10008419 | 3300005335 | Bacteria | 6405 |
| 80 | Ga0070666_10029279 | 3300005335 | Bacteria | 3619 |
| 81 | Ga0070666_10185925 | 3300005335 | Bacteria | 1459 |
| 82 | Ga0070666_10541099 | 3300005335 | Bacteria | 847 |
| 83 | Ga0070680_100013751 | 3300005336 | Bacteria | 6313 |
| 84 | Ga0070680_100314262 | 3300005336 | Bacteria | 1329 |
| 85 | Ga0070682_100000920 | 3300005337 | Bacteria | 17145 |
| 86 | Ga0070682_100065469 | 3300005337 | Bacteria | 2309 |
| 87 | Ga0070682_100112701 | 3300005337 | Bacteria | 1815 |
| 88 | Ga0068868_100074087 | 3300005338 | Bacteria | 2718 |
| 89 | Ga0068868_100163283 | 3300005338 | Bacteria | 1841 |
| 90 | Ga0068868_100199663 | 3300005338 | Bacteria | 1667 |
| 91 | Ga0068868_100326725 | 3300005338 | Bacteria | 1308 |
| 92 | Ga0070660_100002099 | 3300005339 | Bacteria | 13744 |
| 93 | Ga0070660_100021171 | 3300005339 | Bacteria | 4791 |
| 94 | Ga0070660_100060234 | 3300005339 | Unclassified | 2946 |
| 95 | Ga0070660_100255481 | 3300005339 | Bacteria | 1430 |
| 96 | Ga0070689_100031944 | 3300005340 | Bacteria | 4002 |
| 97 | Ga0070689_100036745 | 3300005340 | Bacteria | 3745 |
| 98 | Ga0070689_100061023 | 3300005340 | Unclassified | 2932 |
| 99 | Ga0070689_100162213 | 3300005340 | Bacteria | 1807 |
| 100 | Ga0070689_100806770 | 3300005340 | Bacteria | 826 |
| 101 | Ga0070687_100000217 | 3300005343 | Bacteria | 20090 |
| 102 | Ga0070687_100240828 | 3300005343 | Bacteria | 1118 |
| 103 | Ga0070687_100270606 | 3300005343 | Bacteria | 1065 |
| 104 | Ga0070661_100193041 | 3300005344 | Bacteria | 1554 |
| 105 | Ga0070661_100892389 | 3300005344 | Bacteria | 733 |
| 106 | Ga0070668_100126408 | 3300005347 | Bacteria | 2048 |
| 107 | Ga0070668_100327847 | 3300005347 | Bacteria | 1290 |
| 108 | Ga0070669_100040867 | 3300005353 | Bacteria | 3371 |
| 109 | Ga0070669_100043787 | 3300005353 | Unclassified | 3261 |
| 110 | Ga0070669_100199255 | 3300005353 | Bacteria | 1574 |
| 111 | Ga0070669_100956167 | 3300005353 | Bacteria | 733 |
| 112 | Ga0070675_100004785 | 3300005354 | Bacteria | 10323 |
| 113 | Ga0070675_100324326 | 3300005354 | Bacteria | 1361 |
| 114 | Ga0070675_100502510 | 3300005354 | Bacteria | 1093 |
| 115 | Ga0070675_100622786 | 3300005354 | Bacteria | 980 |
| 116 | Ga0070675_101276596 | 3300005354 | Unclassified | 676 |
| 117 | Ga0070671_100005407 | 3300005355 | Bacteria | 10186 |
| 118 | Ga0070671_100011957 | 3300005355 | Bacteria | 6983 |
| 119 | Ga0070671_100016718 | 3300005355 | Bacteria | 5932 |
| 120 | Ga0070671_100033894 | 3300005355 | Bacteria | 4225 |
| 121 | Ga0070671_100049957 | 3300005355 | Bacteria | 3479 |
| 122 | Ga0070671_100055944 | 3300005355 | Bacteria | 3282 |
| 123 | Ga0070671_100316123 | 3300005355 | Bacteria | 1330 |
| 124 | Ga0070674_100000375 | 3300005356 | Bacteria | 22468 |
| 125 | Ga0070674_100000893 | 3300005356 | Bacteria | 15592 |
| 126 | Ga0070674_100001474 | 3300005356 | Bacteria | 12549 |
| 127 | Ga0070674_100161671 | 3300005356 | Bacteria | 1699 |
| 128 | Ga0070674_100194081 | 3300005356 | Bacteria | 1564 |
| 129 | Ga0070674_100288239 | 3300005356 | Bacteria | 1304 |
| 130 | Ga0070674_100365945 | 3300005356 | Bacteria | 1169 |
| 131 | Ga0070674_100404699 | 3300005356 | Bacteria | 1116 |
| 132 | Ga0070673_100000470 | 3300005364 | Bacteria | 21421 |
| 133 | Ga0070673_100018635 | 3300005364 | Bacteria | 4964 |
| 134 | Ga0070688_100016929 | 3300005365 | Bacteria | 4175 |
| 135 | Ga0070688_100080542 | 3300005365 | Bacteria | 2106 |
| 136 | Ga0070688_100124721 | 3300005365 | Bacteria | 1730 |
| 137 | Ga0070688_100239881 | 3300005365 | Bacteria | 1286 |
| 138 | Ga0070688_100368375 | 3300005365 | Bacteria | 1056 |
| 139 | Ga0070659_100006204 | 3300005366 | Bacteria | 8635 |
| 140 | Ga0070667_100012633 | 3300005367 | Bacteria | 6984 |
| 141 | Ga0070667_100041130 | 3300005367 | Bacteria | 3878 |
| 142 | Ga0070667_100233536 | 3300005367 | Bacteria | 1640 |
| 143 | Ga0070667_100467640 | 3300005367 | Bacteria | 1153 |
| 144 | Ga0070667_100736038 | 3300005367 | Bacteria | 914 |
| 145 | Ga0070709_10005104 | 3300005434 | Bacteria | 7098 |
| 146 | Ga0070709_10006845 | 3300005434 | Bacteria | 6226 |
| 147 | Ga0070709_10080910 | 3300005434 | Bacteria | 2119 |
| 148 | Ga0070709_10141911 | 3300005434 | Bacteria | 1651 |
| 149 | Ga0070709_10392129 | 3300005434 | Bacteria | 1035 |
| 150 | Ga0070714_100002780 | 3300005435 | Bacteria | 12900 |
| 151 | Ga0070714_100018995 | 3300005435 | Bacteria | 5593 |
| 152 | Ga0070714_100111744 | 3300005435 | Bacteria | 2420 |
| 153 | Ga0070713_100017941 | 3300005436 | Bacteria | 5370 |
| 154 | Ga0070713_100181064 | 3300005436 | Bacteria | 1894 |
| 155 | Ga0070713_100469847 | 3300005436 | Bacteria | 1184 |
| 156 | Ga0070710_10016995 | 3300005437 | Bacteria | 3714 |
| 157 | Ga0070710_10023746 | 3300005437 | Bacteria | 3226 |
| 158 | Ga0070710_10088442 | 3300005437 | Bacteria | 1823 |
| 159 | Ga0070710_10124786 | 3300005437 | Bacteria | 1563 |
| 160 | Ga0070701_10186895 | 3300005438 | Bacteria | 1217 |
| 161 | Ga0070701_10231618 | 3300005438 | Bacteria | 1107 |
| 162 | Ga0070711_100244836 | 3300005439 | Bacteria | 1404 |
| 163 | Ga0070711_100486816 | 3300005439 | Bacteria | 1015 |
| 164 | Ga0070711_100548466 | 3300005439 | Bacteria | 959 |
| 165 | Ga0070705_100000204 | 3300005440 | Bacteria | 34961 |
| 166 | Ga0070705_100306506 | 3300005440 | Bacteria | 1140 |
| 167 | Ga0070705_100362657 | 3300005440 | Bacteria | 1060 |
| 168 | Ga0070705_100417666 | 3300005440 | Bacteria | 998 |
| 169 | Ga0070705_100751926 | 3300005440 | Bacteria | 771 |
| 170 | Ga0070700_100319833 | 3300005441 | Bacteria | 1140 |
| 171 | Ga0070700_100417222 | 3300005441 | Bacteria | 1013 |
| 172 | Ga0070700_100533032 | 3300005441 | Bacteria | 909 |
| 173 | Ga0070694_100450974 | 3300005444 | Bacteria | 1016 |
| 174 | Ga0070663_100026729 | 3300005455 | Bacteria | 3911 |
| 175 | Ga0070663_100328207 | 3300005455 | Bacteria | 1232 |
| 176 | Ga0070663_100726371 | 3300005455 | Bacteria | 846 |
| 177 | Ga0070678_100002319 | 3300005456 | Bacteria | 10389 |
| 178 | Ga0070678_100014852 | 3300005456 | Bacteria | 4928 |
| 179 | Ga0070678_100047057 | 3300005456 | Bacteria | 3097 |
| 180 | Ga0070662_100013235 | 3300005457 | Bacteria | 5486 |
| 181 | Ga0070662_100512516 | 3300005457 | Bacteria | 1001 |
| 182 | Ga0070681_10061201 | 3300005458 | Bacteria | 3741 |
| 183 | Ga0070681_10360321 | 3300005458 | Bacteria | 1364 |
| 184 | Ga0070681_10621943 | 3300005458 | Bacteria | 994 |
| 185 | Ga0068867_100004027 | 3300005459 | Bacteria | 10340 |
| 186 | Ga0068867_100006503 | 3300005459 | Bacteria | 8256 |
| 187 | Ga0068867_101246686 | 3300005459 | Bacteria | 684 |
| 188 | Ga0070685_10001617 | 3300005466 | Bacteria | 11892 |
| 189 | Ga0070685_10008570 | 3300005466 | Bacteria | 5262 |
| 190 | Ga0070685_10041027 | 3300005466 | Bacteria | 2636 |
| 191 | Ga0070685_10206947 | 3300005466 | Bacteria | 1278 |
| 192 | Ga0074259_10896662 | 3300005507 | Bacteria | 1191 |
| 193 | Ga0070699_100462520 | 3300005518 | Bacteria | 1151 |
| 194 | Ga0070699_100536465 | 3300005518 | Bacteria | 1064 |
| 195 | Ga0070699_100786324 | 3300005518 | Bacteria | 871 |
| 196 | Ga0070679_100025312 | 3300005530 | Bacteria | 5822 |
| 197 | Ga0070679_100159196 | 3300005530 | Bacteria | 2232 |
| 198 | Ga0070684_100008508 | 3300005535 | Bacteria | 8026 |
| 199 | Ga0070684_100029649 | 3300005535 | Bacteria | 4639 |
| 200 | Ga0070684_100112955 | 3300005535 | Bacteria | 2437 |
| 201 | Ga0070697_100132093 | 3300005536 | Bacteria | 2094 |
| 202 | Ga0068853_100033577 | 3300005539 | Bacteria | 4354 |
| 203 | Ga0068853_100067830 | 3300005539 | Bacteria | 3100 |
| 204 | Ga0068853_100092887 | 3300005539 | Bacteria | 2655 |
| 205 | Ga0068853_100234876 | 3300005539 | Bacteria | 1678 |
| 206 | Ga0068853_100351911 | 3300005539 | Bacteria | 1370 |
| 207 | Ga0068853_100356024 | 3300005539 | Bacteria | 1362 |
| 208 | Ga0068853_100484304 | 3300005539 | Bacteria | 1166 |
| 209 | Ga0068853_100630652 | 3300005539 | Bacteria | 1019 |
| 210 | Ga0070672_100015602 | 3300005543 | Bacteria | 5416 |
| 211 | Ga0070672_100046664 | 3300005543 | Bacteria | 3357 |
| 212 | Ga0070672_100216997 | 3300005543 | Bacteria | 1603 |
| 213 | Ga0070686_100018072 | 3300005544 | Bacteria | 4132 |
| 214 | Ga0070686_100048208 | 3300005544 | Bacteria | 2698 |
| 215 | Ga0070686_100119889 | 3300005544 | Unclassified | 1805 |
| 216 | Ga0070686_100231573 | 3300005544 | Bacteria | 1340 |
| 217 | Ga0070686_100305331 | 3300005544 | Bacteria | 1182 |
| 218 | Ga0070695_100114448 | 3300005545 | Bacteria | 1836 |
| 219 | Ga0070695_100561926 | 3300005545 | Bacteria | 891 |
| 220 | Ga0070696_100073889 | 3300005546 | Bacteria | 2403 |
| 221 | Ga0070696_100511780 | 3300005546 | Bacteria | 957 |
| 222 | Ga0070693_100025149 | 3300005547 | Bacteria | 3201 |
| 223 | Ga0070693_100238020 | 3300005547 | Bacteria | 1201 |
| 224 | Ga0070665_100136427 | 3300005548 | Bacteria | 2457 |
| 225 | Ga0070665_100159772 | 3300005548 | Bacteria | 2255 |
| 226 | Ga0070665_100168616 | 3300005548 | Bacteria | 2191 |
| 227 | Ga0070665_100172989 | 3300005548 | Bacteria | 2161 |
| 228 | Ga0070665_100213906 | 3300005548 | Bacteria | 1928 |
| 229 | Ga0070665_100551647 | 3300005548 | Bacteria | 1165 |
| 230 | Ga0070704_100158213 | 3300005549 | Bacteria | 1789 |
| 231 | Ga0068855_100007909 | 3300005563 | Bacteria | 12845 |
| 232 | Ga0068855_100087873 | 3300005563 | Bacteria | 3591 |
| 233 | Ga0068855_100232331 | 3300005563 | Bacteria | 2064 |
| 234 | Ga0070664_100003650 | 3300005564 | Bacteria | 12393 |
| 235 | Ga0070664_100160089 | 3300005564 | Bacteria | 1991 |
| 236 | Ga0070664_100218015 | 3300005564 | Bacteria | 1707 |
| 237 | Ga0068857_100002698 | 3300005577 | Bacteria | 14566 |
| 238 | Ga0068857_100051580 | 3300005577 | Bacteria | 3650 |
| 239 | Ga0068857_100097530 | 3300005577 | Bacteria | 2635 |
| 240 | Ga0068857_100165918 | 3300005577 | Unclassified | 2005 |
| 241 | Ga0068857_100670601 | 3300005577 | Bacteria | 984 |
| 242 | Ga0068854_100046914 | 3300005578 | Bacteria | 3078 |
| 243 | Ga0068854_100120058 | 3300005578 | Bacteria | 1994 |
| 244 | Ga0068854_100129469 | 3300005578 | Bacteria | 1925 |
| 245 | Ga0068854_100453231 | 3300005578 | Bacteria | 1072 |
| 246 | Ga0068856_100005538 | 3300005614 | Bacteria | 12434 |
| 247 | Ga0068856_100045821 | 3300005614 | Bacteria | 4306 |
| 248 | Ga0068856_100226569 | 3300005614 | Bacteria | 1885 |
| 249 | Ga0068856_100282875 | 3300005614 | Bacteria | 1675 |
| 250 | Ga0068856_100632430 | 3300005614 | Bacteria | 1091 |
| 251 | Ga0070702_100000758 | 3300005615 | Bacteria | 12227 |
| 252 | Ga0070702_100002474 | 3300005615 | Bacteria | 7990 |
| 253 | Ga0070702_100005458 | 3300005615 | Bacteria | 5924 |
| 254 | Ga0070702_100061626 | 3300005615 | Bacteria | 2185 |
| 255 | Ga0070702_100093906 | 3300005615 | Bacteria | 1825 |
| 256 | Ga0070702_100214701 | 3300005615 | Bacteria | 1283 |
| 257 | Ga0070702_100423573 | 3300005615 | Unclassified | 959 |
| 258 | Ga0068852_100025773 | 3300005616 | Bacteria | 4769 |
| 259 | Ga0068859_100020242 | 3300005617 | Bacteria | 6679 |
| 260 | Ga0068859_100023296 | 3300005617 | Bacteria | 6214 |
| 261 | Ga0068859_100078546 | 3300005617 | Bacteria | 3341 |
| 262 | Ga0068859_100752895 | 3300005617 | Bacteria | 1063 |
| 263 | Ga0068864_100000443 | 3300005618 | Bacteria | 35869 |
| 264 | Ga0068864_100004887 | 3300005618 | Bacteria | 10977 |
| 265 | Ga0068864_100020334 | 3300005618 | Bacteria | 5553 |
| 266 | Ga0068864_100033589 | 3300005618 | Bacteria | 4362 |
| 267 | Ga0068864_100048665 | 3300005618 | Bacteria | 3645 |
| 268 | Ga0068864_100644235 | 3300005618 | Bacteria | 1031 |
| 269 | Ga0068866_10000908 | 3300005718 | Bacteria | 12992 |
| 270 | Ga0068866_10164879 | 3300005718 | Unclassified | 1295 |
| 271 | Ga0068861_100007339 | 3300005719 | Bacteria | 7552 |
| 272 | Ga0068861_100033080 | 3300005719 | Bacteria | 3812 |
| 273 | Ga0068861_100679237 | 3300005719 | Unclassified | 954 |
| 274 | Ga0068870_10000734 | 3300005840 | Bacteria | 12617 |
| 275 | Ga0068870_10060901 | 3300005840 | Bacteria | 2027 |
| 276 | Ga0068870_10083312 | 3300005840 | Bacteria | 1773 |
| 277 | Ga0068863_100007663 | 3300005841 | Bacteria | 10561 |
| 278 | Ga0068863_100054632 | 3300005841 | Bacteria | 3783 |
| 279 | Ga0068863_100298475 | 3300005841 | Bacteria | 1562 |
| 280 | Ga0068863_100360320 | 3300005841 | Bacteria | 1417 |
| 281 | Ga0068863_100523151 | 3300005841 | Bacteria | 1170 |
| 282 | Ga0068863_100856859 | 3300005841 | Bacteria | 908 |
| 283 | Ga0068858_100003447 | 3300005842 | Bacteria | 15698 |
| 284 | Ga0068858_100060090 | 3300005842 | Bacteria | 3513 |
| 285 | Ga0068858_100085044 | 3300005842 | Bacteria | 2943 |
| 286 | Ga0068858_100095118 | 3300005842 | Bacteria | 2776 |
| 287 | Ga0068858_100533274 | 3300005842 | Bacteria | 1136 |
| 288 | Ga0068860_100354400 | 3300005843 | Bacteria | 1445 |
| 289 | Ga0068860_100417277 | 3300005843 | Bacteria | 1330 |
| 290 | Ga0068862_100008086 | 3300005844 | Bacteria | 8706 |
| 291 | Ga0068862_100352462 | 3300005844 | Bacteria | 1366 |
| 292 | Ga0081455_10019100 | 3300005937 | Bacteria | 6497 |
| 293 | Ga0081455_10024219 | 3300005937 | Bacteria | 5628 |
| 294 | Ga0081455_10221049 | 3300005937 | Unclassified | 1404 |
| 295 | Ga0081455_10247539 | 3300005937 | Bacteria | 1306 |
| 296 | Ga0081538_10002974 | 3300005981 | Bacteria | 16168 |
| 297 | Ga0081538_10125128 | 3300005981 | Bacteria | 1224 |
| 298 | Ga0081540_1000140 | 3300005983 | Bacteria | 75770 |
| 299 | Ga0081540_1008037 | 3300005983 | Bacteria | 7421 |
| 300 | Ga0081540_1041211 | 3300005983 | Bacteria | 2396 |
| 301 | Ga0081540_1134370 | 3300005983 | Bacteria | 1004 |
| 302 | Ga0081540_1182014 | 3300005983 | Bacteria | 785 |
| 303 | Ga0081539_10004161 | 3300005985 | Bacteria | 16415 |
| 304 | Ga0070717_10004047 | 3300006028 | Bacteria | 10561 |
| 305 | Ga0070717_10013853 | 3300006028 | Bacteria | 6192 |
| 306 | Ga0070717_10410194 | 3300006028 | Bacteria | 1218 |
| 307 | Ga0070717_10906302 | 3300006028 | Bacteria | 803 |
| 308 | Ga0075365_10048713 | 3300006038 | Bacteria | 2790 |
| 309 | Ga0075365_10062317 | 3300006038 | Bacteria | 2494 |
| 310 | Ga0075365_10063600 | 3300006038 | Unclassified | 2471 |
| 311 | Ga0075365_10151459 | 3300006038 | Bacteria | 1613 |
| 312 | Ga0075365_10175006 | 3300006038 | Bacteria | 1499 |
| 313 | Ga0075365_10250989 | 3300006038 | Bacteria | 1243 |
| 314 | Ga0075365_10343220 | 3300006038 | Bacteria | 1052 |
| 315 | Ga0075365_10522901 | 3300006038 | Bacteria | 839 |
| 316 | Ga0075368_10045053 | 3300006042 | Bacteria | 1742 |
| 317 | Ga0075368_10058301 | 3300006042 | Bacteria | 1543 |
| 318 | Ga0075368_10061023 | 3300006042 | Bacteria | 1509 |
| 319 | Ga0075363_100012895 | 3300006048 | Bacteria | 4036 |
| 320 | Ga0075363_100179641 | 3300006048 | Unclassified | 1203 |
| 321 | Ga0075363_100190585 | 3300006048 | Bacteria | 1169 |
| 322 | Ga0075363_100418033 | 3300006048 | Bacteria | 789 |
| 323 | Ga0075363_100498411 | 3300006048 | Bacteria | 723 |
| 324 | Ga0075364_10008807 | 3300006051 | Bacteria | 6039 |
| 325 | Ga0075364_10050422 | 3300006051 | Bacteria | 2717 |
| 326 | Ga0075364_10324493 | 3300006051 | Bacteria | 1048 |
| 327 | Ga0075364_10351445 | 3300006051 | Bacteria | 1005 |
| 328 | Ga0075364_10561853 | 3300006051 | Bacteria | 780 |
| 329 | Ga0075432_10046599 | 3300006058 | Bacteria | 1522 |
| 330 | Ga0075432_10053596 | 3300006058 | Bacteria | 1427 |
| 331 | Ga0070715_10000352 | 3300006163 | Bacteria | 11511 |
| 332 | Ga0070715_10003497 | 3300006163 | Bacteria | 5009 |
| 333 | Ga0070715_10177149 | 3300006163 | Bacteria | 1066 |
| 334 | Ga0070716_100000521 | 3300006173 | Bacteria | 16062 |
| 335 | Ga0070716_100007900 | 3300006173 | Bacteria | 5263 |
| 336 | Ga0070716_100244255 | 3300006173 | Bacteria | 1219 |
| 337 | Ga0070716_100319368 | 3300006173 | Bacteria | 1087 |
| 338 | Ga0070712_100053418 | 3300006175 | Bacteria | 2821 |
| 339 | Ga0070712_100112599 | 3300006175 | Bacteria | 2033 |
| 340 | Ga0070712_100225902 | 3300006175 | Bacteria | 1484 |
| 341 | Ga0070712_100356239 | 3300006175 | Bacteria | 1199 |
| 342 | Ga0070712_100598293 | 3300006175 | Bacteria | 933 |
| 343 | Ga0075362_10073571 | 3300006177 | Bacteria | 1564 |
| 344 | Ga0075367_10019468 | 3300006178 | Bacteria | 3764 |
| 345 | Ga0075367_10024342 | 3300006178 | Bacteria | 3413 |
| 346 | Ga0075367_10057607 | 3300006178 | Bacteria | 2310 |
| 347 | Ga0075367_10132826 | 3300006178 | Bacteria | 1539 |
| 348 | Ga0075367_10211134 | 3300006178 | Bacteria | 1214 |
| 349 | Ga0075367_10306161 | 3300006178 | Bacteria | 1000 |
| 350 | Ga0075369_10085867 | 3300006186 | Bacteria | 1400 |
| 351 | Ga0075366_10025202 | 3300006195 | Bacteria | 3473 |
| 352 | Ga0075366_10101432 | 3300006195 | Bacteria | 1727 |
| 353 | Ga0075366_10250736 | 3300006195 | Bacteria | 1080 |
| 354 | Ga0097621_100000435 | 3300006237 | Bacteria | 29115 |
| 355 | Ga0097621_100072099 | 3300006237 | Bacteria | 2856 |
| 356 | Ga0097621_100263162 | 3300006237 | Bacteria | 1513 |
| 357 | Ga0097621_100383900 | 3300006237 | Bacteria | 1255 |
| 358 | Ga0075370_10033603 | 3300006353 | Bacteria | 2872 |
| 359 | Ga0075370_10045809 | 3300006353 | Bacteria | 2474 |
| 360 | Ga0075370_10140482 | 3300006353 | Bacteria | 1412 |
| 361 | Ga0075370_10176599 | 3300006353 | Bacteria | 1256 |
| 362 | Ga0068871_100012417 | 3300006358 | Bacteria | 6278 |
| 363 | Ga0068871_100081619 | 3300006358 | Bacteria | 2679 |
| 364 | Ga0068871_100205915 | 3300006358 | Bacteria | 1700 |
| 365 | Ga0068871_100312046 | 3300006358 | Bacteria | 1383 |
| 366 | Ga0068871_100694977 | 3300006358 | Bacteria | 931 |
| 367 | Ga0075428_100191902 | 3300006844 | Bacteria | 2209 |
| 368 | Ga0075428_100332413 | 3300006844 | Bacteria | 1632 |
| 369 | Ga0075428_100342286 | 3300006844 | Unclassified | 1606 |
| 370 | Ga0075428_101026227 | 3300006844 | Bacteria | 873 |
| 371 | Ga0075428_101055374 | 3300006844 | Bacteria | 859 |
| 372 | Ga0075430_100010823 | 3300006846 | Bacteria | 7728 |
| 373 | Ga0075430_100231826 | 3300006846 | Bacteria | 1531 |
| 374 | Ga0075431_100000020 | 3300006847 | Bacteria | 82958 |
| 375 | Ga0075431_100008458 | 3300006847 | Bacteria | 10305 |
| 376 | Ga0075431_100208400 | 3300006847 | Bacteria | 1998 |
| 377 | Ga0075431_100277984 | 3300006847 | Unclassified | 1695 |
| 378 | Ga0075431_100366055 | 3300006847 | Bacteria | 1447 |
| 379 | Ga0075431_100468385 | 3300006847 | Bacteria | 1254 |
| 380 | Ga0075431_100982760 | 3300006847 | Bacteria | 811 |
| 381 | Ga0075431_101477921 | 3300006847 | Bacteria | 638 |
| 382 | Ga0075433_10018880 | 3300006852 | Bacteria | 5738 |
| 383 | Ga0075433_10062667 | 3300006852 | Bacteria | 3257 |
| 384 | Ga0075433_10289422 | 3300006852 | Bacteria | 1451 |
| 385 | Ga0075433_10805682 | 3300006852 | Bacteria | 821 |
| 386 | Ga0075434_100003352 | 3300006871 | Bacteria | 14332 |
| 387 | Ga0075434_100011154 | 3300006871 | Bacteria | 8456 |
| 388 | Ga0075434_100185713 | 3300006871 | Bacteria | 2099 |
| 389 | Ga0075429_100015669 | 3300006880 | Bacteria | 6569 |
| 390 | Ga0075429_100323427 | 3300006880 | Bacteria | 1350 |
| 391 | Ga0075429_100332978 | 3300006880 | Bacteria | 1329 |
| 392 | Ga0075429_100451746 | 3300006880 | Bacteria | 1126 |
| 393 | Ga0075429_100638716 | 3300006880 | Bacteria | 933 |
| 394 | Ga0068865_100000485 | 3300006881 | Bacteria | 22288 |
| 395 | Ga0068865_100012411 | 3300006881 | Bacteria | 5361 |
| 396 | Ga0068865_100053945 | 3300006881 | Unclassified | 2791 |
| 397 | Ga0068865_100059221 | 3300006881 | Bacteria | 2678 |
| 398 | Ga0068865_100157100 | 3300006881 | Bacteria | 1731 |
| 399 | Ga0068865_101250436 | 3300006881 | Unclassified | 658 |
| 400 | Ga0075436_100208924 | 3300006914 | Bacteria | 1384 |
| 401 | Ga0075436_100441214 | 3300006914 | Bacteria | 947 |
| 402 | Ga0097620_100020243 | 3300006931 | Bacteria | 6679 |
| 403 | Ga0097620_100023296 | 3300006931 | Bacteria | 6214 |
| 404 | Ga0097620_100078551 | 3300006931 | Bacteria | 3341 |
| 405 | Ga0097620_100752838 | 3300006931 | Bacteria | 1063 |
| 406 | Ga0075435_100089882 | 3300007076 | Bacteria | 2533 |
| 407 | Ga0075435_100494239 | 3300007076 | Bacteria | 1057 |
| 408 | Ga0099794_10015955 | 3300007265 | Bacteria | 3324 |
| 409 | Ga0099795_10000648 | 3300007788 | Bacteria | 6682 |
| 410 | Ga0099795_10024650 | 3300007788 | Bacteria | 2009 |
| 411 | Ga0099795_10034727 | 3300007788 | Bacteria | 1758 |
| 412 | Ga0099795_10063687 | 3300007788 | Bacteria | 1375 |
| 413 | Ga0099795_10108818 | 3300007788 | Bacteria | 1096 |
| 414 | Ga0099795_10148233 | 3300007788 | Bacteria | 959 |
| 415 | Ga0099795_10201972 | 3300007788 | Bacteria | 839 |
| 416 | Ga0105251_10030260 | 3300009011 | Bacteria | 2720 |
| 417 | Ga0105251_10050543 | 3300009011 | Bacteria | 1985 |
| 418 | Ga0105244_10108496 | 3300009036 | Bacteria | 1352 |
| 419 | Ga0105250_10033276 | 3300009092 | Bacteria | 2069 |
| 420 | Ga0105240_10130732 | 3300009093 | Bacteria | 3012 |
| 421 | Ga0105240_10352859 | 3300009093 | Bacteria | 1668 |
| 422 | Ga0111539_10000167 | 3300009094 | Bacteria | 75742 |
| 423 | Ga0111539_10027723 | 3300009094 | Bacteria | 6919 |
| 424 | Ga0111539_10038414 | 3300009094 | Bacteria | 5774 |
| 425 | Ga0111539_10050859 | 3300009094 | Bacteria | 4937 |
| 426 | Ga0111539_10334252 | 3300009094 | Bacteria | 1763 |
| 427 | Ga0111539_10497695 | 3300009094 | Bacteria | 1419 |
| 428 | Ga0111539_10522767 | 3300009094 | Bacteria | 1382 |
| 429 | Ga0111539_11254150 | 3300009094 | Bacteria | 860 |
| 430 | Ga0111539_11745084 | 3300009094 | Bacteria | 722 |
| 431 | Ga0105245_10004286 | 3300009098 | Bacteria | 12646 |
| 432 | Ga0105245_10008339 | 3300009098 | Bacteria | 9053 |
| 433 | Ga0105245_10065446 | 3300009098 | Bacteria | 3287 |
| 434 | Ga0105245_10079827 | 3300009098 | Bacteria | 2988 |
| 435 | Ga0105245_10115240 | 3300009098 | Bacteria | 2504 |
| 436 | Ga0105245_11718779 | 3300009098 | Bacteria | 680 |
| 437 | Ga0105245_11842643 | 3300009098 | Bacteria | 658 |
| 438 | Ga0105247_10009390 | 3300009101 | Bacteria | 5937 |
| 439 | Ga0105247_10028516 | 3300009101 | Bacteria | 3378 |
| 440 | Ga0105247_10046178 | 3300009101 | Bacteria | 2673 |
| 441 | Ga0105247_10233872 | 3300009101 | Bacteria | 1249 |
| 442 | Ga0105247_10498355 | 3300009101 | Bacteria | 887 |
| 443 | Ga0105247_10825026 | 3300009101 | Bacteria | 710 |
| 444 | Ga0114129_10003047 | 3300009147 | Bacteria | 23477 |
| 445 | Ga0114129_10015940 | 3300009147 | Bacteria | 10687 |
| 446 | Ga0114129_10056117 | 3300009147 | Bacteria | 5518 |
| 447 | Ga0114129_10192494 | 3300009147 | Bacteria | 2768 |
| 448 | Ga0114129_10244766 | 3300009147 | Bacteria | 2410 |
| 449 | Ga0114129_10508315 | 3300009147 | Bacteria | 1573 |
| 450 | Ga0114129_10794122 | 3300009147 | Bacteria | 1208 |
| 451 | Ga0114129_10846802 | 3300009147 | Bacteria | 1163 |
| 452 | Ga0114129_11145646 | 3300009147 | Bacteria | 971 |
| 453 | Ga0114129_11538054 | 3300009147 | Bacteria | 816 |
| 454 | Ga0105243_10033625 | 3300009148 | Bacteria | 3965 |
| 455 | Ga0105243_10121717 | 3300009148 | Bacteria | 2201 |
| 456 | Ga0105243_10148011 | 3300009148 | Bacteria | 2011 |
| 457 | Ga0105243_10151959 | 3300009148 | Unclassified | 1987 |
| 458 | Ga0105243_10169286 | 3300009148 | Bacteria | 1891 |
| 459 | Ga0105243_11462591 | 3300009148 | Bacteria | 706 |
| 460 | Ga0105241_10032007 | 3300009174 | Bacteria | 3938 |
| 461 | Ga0105241_10041491 | 3300009174 | Bacteria | 3477 |
| 462 | Ga0105241_10046934 | 3300009174 | Bacteria | 3282 |
| 463 | Ga0105241_10122616 | 3300009174 | Bacteria | 2095 |
| 464 | Ga0105241_10126944 | 3300009174 | Bacteria | 2061 |
| 465 | Ga0105241_10314966 | 3300009174 | Bacteria | 1347 |
| 466 | Ga0105241_10553089 | 3300009174 | Bacteria | 1033 |
| 467 | Ga0105242_10074853 | 3300009176 | Bacteria | 2818 |
| 468 | Ga0105242_10144189 | 3300009176 | Bacteria | 2070 |
| 469 | Ga0105242_10152776 | 3300009176 | Bacteria | 2015 |
| 470 | Ga0105242_10238535 | 3300009176 | Unclassified | 1633 |
| 471 | Ga0105242_10337825 | 3300009176 | Bacteria | 1387 |
| 472 | Ga0105242_10681706 | 3300009176 | Bacteria | 1003 |
| 473 | Ga0105242_11269755 | 3300009176 | Bacteria | 759 |
| 474 | Ga0105248_10096003 | 3300009177 | Bacteria | 3338 |
| 475 | Ga0105248_10125981 | 3300009177 | Unclassified | 2889 |
| 476 | Ga0105248_10232856 | 3300009177 | Bacteria | 2074 |
| 477 | Ga0105248_10599454 | 3300009177 | Bacteria | 1243 |
| 478 | Ga0105237_10032875 | 3300009545 | Bacteria | 5252 |
| 479 | Ga0105237_10044558 | 3300009545 | Bacteria | 4468 |
| 480 | Ga0105237_10058881 | 3300009545 | Bacteria | 3845 |
| 481 | Ga0105237_10087376 | 3300009545 | Bacteria | 3107 |
| 482 | Ga0105237_10101576 | 3300009545 | Bacteria | 2868 |
| 483 | Ga0105237_10107873 | 3300009545 | Bacteria | 2776 |
| 484 | Ga0105237_10132663 | 3300009545 | Bacteria | 2485 |
| 485 | Ga0105237_10164128 | 3300009545 | Bacteria | 2220 |
| 486 | Ga0105238_10011666 | 3300009551 | Bacteria | 8855 |
| 487 | Ga0105238_10014012 | 3300009551 | Bacteria | 8108 |
| 488 | Ga0105238_10030098 | 3300009551 | Bacteria | 5525 |
| 489 | Ga0105238_10064680 | 3300009551 | Bacteria | 3657 |
| 490 | Ga0105238_10200783 | 3300009551 | Bacteria | 1969 |
| 491 | Ga0105238_10248589 | 3300009551 | Bacteria | 1756 |
| 492 | Ga0105238_10296057 | 3300009551 | Bacteria | 1601 |
| 493 | Ga0105238_10303495 | 3300009551 | Bacteria | 1580 |
| 494 | Ga0105249_10057994 | 3300009553 | Bacteria | 3548 |
| 495 | Ga0105249_10122241 | 3300009553 | Bacteria | 2475 |
| 496 | Ga0105249_10197068 | 3300009553 | Bacteria | 1969 |
| 497 | Ga0105249_10700638 | 3300009553 | Bacteria | 1073 |
| 498 | Ga0105249_11043569 | 3300009553 | Bacteria | 887 |
| 499 | Ga0099796_10000265 | 3300010159 | Bacteria | 8288 |
| 500 | Ga0099796_10007182 | 3300010159 | Unclassified | 2900 |
| 501 | Ga0099796_10024637 | 3300010159 | Bacteria | 1890 |
| 502 | Ga0099796_10034554 | 3300010159 | Bacteria | 1671 |
| 503 | Ga0099796_10137756 | 3300010159 | Bacteria | 951 |
| 504 | Ga0105239_10004659 | 3300010375 | Bacteria | 16304 |
| 505 | Ga0105239_10013269 | 3300010375 | Bacteria | 9155 |
| 506 | Ga0105239_10093866 | 3300010375 | Bacteria | 3313 |
| 507 | Ga0105239_10102663 | 3300010375 | Bacteria | 3164 |
| 508 | Ga0105239_10133836 | 3300010375 | Bacteria | 2759 |
| 509 | Ga0105239_10143653 | 3300010375 | Bacteria | 2660 |
| 510 | Ga0105239_10176938 | 3300010375 | Unclassified | 2386 |
| 511 | Ga0105239_10440731 | 3300010375 | Bacteria | 1477 |
| 512 | Ga0105239_10688221 | 3300010375 | Bacteria | 1169 |
| 513 | Ga0105246_10025897 | 3300011119 | Bacteria | 3826 |
| 514 | Ga0105246_10084828 | 3300011119 | Bacteria | 2267 |
| 515 | Ga0105246_10659942 | 3300011119 | Bacteria | 912 |
| 516 | Ga0105246_10893052 | 3300011119 | Bacteria | 796 |
| 517 | Ga0157346_1003509 | 3300012480 | Bacteria | 880 |
| 518 | Ga0157341_1002432 | 3300012494 | Bacteria | 1228 |
| 519 | Ga0157323_1002561 | 3300012495 | Bacteria | 1023 |
| 520 | Ga0157313_1009676 | 3300012503 | Bacteria | 803 |
| 521 | Ga0157342_1000683 | 3300012507 | Bacteria | 2210 |
| 522 | Ga0157316_1023090 | 3300012510 | Bacteria | 697 |
| 523 | Ga0157371_10133354 | 3300013102 | Bacteria | 1767 |
| 524 | Ga0157371_10209600 | 3300013102 | Bacteria | 1398 |
| 525 | Ga0157371_10271568 | 3300013102 | Bacteria | 1224 |
| 526 | Ga0157370_10127401 | 3300013104 | Bacteria | 2376 |
| 527 | Ga0157370_10132132 | 3300013104 | Bacteria | 2328 |
| 528 | Ga0157370_10199482 | 3300013104 | Bacteria | 1856 |
| 529 | Ga0157369_10016835 | 3300013105 | Bacteria | 8214 |
| 530 | Ga0157369_10269640 | 3300013105 | Bacteria | 1774 |
| 531 | Ga0157369_10577588 | 3300013105 | Bacteria | 1161 |
| 532 | Ga0157374_10004303 | 3300013296 | Bacteria | 11970 |
| 533 | Ga0157374_10039082 | 3300013296 | Bacteria | 4365 |
| 534 | Ga0157374_10067422 | 3300013296 | Bacteria | 3364 |
| 535 | Ga0157374_10187920 | 3300013296 | Bacteria | 2020 |
| 536 | Ga0157374_10953995 | 3300013296 | Bacteria | 876 |
| 537 | Ga0157378_10003893 | 3300013297 | Bacteria | 13222 |
| 538 | Ga0157378_10009387 | 3300013297 | Bacteria | 8523 |
| 539 | Ga0157378_10030439 | 3300013297 | Bacteria | 4769 |
| 540 | Ga0157378_10030828 | 3300013297 | Bacteria | 4734 |
| 541 | Ga0157378_10032444 | 3300013297 | Bacteria | 4615 |
| 542 | Ga0157378_10109632 | 3300013297 | Unclassified | 2529 |
| 543 | Ga0157378_10120946 | 3300013297 | Bacteria | 2413 |
| 544 | Ga0157378_10271919 | 3300013297 | Bacteria | 1630 |
| 545 | Ga0157378_10353221 | 3300013297 | Bacteria | 1436 |
| 546 | Ga0157378_10653726 | 3300013297 | Bacteria | 1067 |
| 547 | Ga0163162_10183755 | 3300013306 | Bacteria | 2217 |
| 548 | Ga0163162_10205336 | 3300013306 | Bacteria | 2099 |
| 549 | Ga0163162_10801032 | 3300013306 | Bacteria | 1060 |
| 550 | Ga0163162_11429929 | 3300013306 | Bacteria | 787 |
| 551 | Ga0157372_10302570 | 3300013307 | Bacteria | 1860 |
| 552 | Ga0157372_11454882 | 3300013307 | Bacteria | 790 |
| 553 | Ga0157375_10050882 | 3300013308 | Bacteria | 4065 |
| 554 | Ga0157375_10313984 | 3300013308 | Bacteria | 1732 |
| 555 | Ga0157375_10682618 | 3300013308 | Bacteria | 1182 |
| 556 | Ga0157375_10750634 | 3300013308 | Bacteria | 1127 |
| 557 | Ga0157375_11847156 | 3300013308 | Bacteria | 717 |
| 558 | Ga0163163_10007071 | 3300014325 | Bacteria | 9863 |
| 559 | Ga0163163_10020427 | 3300014325 | Bacteria | 6235 |
| 560 | Ga0163163_10030125 | 3300014325 | Bacteria | 5224 |
| 561 | Ga0163163_10034989 | 3300014325 | Bacteria | 4870 |
| 562 | Ga0163163_10035700 | 3300014325 | Bacteria | 4824 |
| 563 | Ga0163163_10140778 | 3300014325 | Bacteria | 2455 |
| 564 | Ga0163163_10614641 | 3300014325 | Bacteria | 1150 |
| 565 | Ga0157380_10003632 | 3300014326 | Bacteria | 10605 |
| 566 | Ga0157380_10133478 | 3300014326 | Bacteria | 2121 |
| 567 | Ga0157380_10185561 | 3300014326 | Bacteria | 1831 |
| 568 | Ga0157380_10236115 | 3300014326 | Unclassified | 1645 |
| 569 | Ga0157377_10000432 | 3300014745 | Bacteria | 18095 |
| 570 | Ga0157377_10081564 | 3300014745 | Bacteria | 1892 |
| 571 | Ga0157377_10220246 | 3300014745 | Bacteria | 1214 |
| 572 | Ga0157377_10399894 | 3300014745 | Bacteria | 935 |
| 573 | Ga0157379_10148279 | 3300014968 | Bacteria | 2116 |
| 574 | Ga0157379_10333519 | 3300014968 | Bacteria | 1386 |
| 575 | Ga0157379_10480655 | 3300014968 | Bacteria | 1149 |
| 576 | Ga0157379_10896128 | 3300014968 | Bacteria | 841 |
| 577 | Ga0157376_10032211 | 3300014969 | Bacteria | 4207 |
| 578 | Ga0157376_10048633 | 3300014969 | Bacteria | 3509 |
| 579 | Ga0157376_10254265 | 3300014969 | Bacteria | 1642 |
| 580 | Ga0182007_10064525 | 3300015262 | Bacteria | 1200 |
| 581 | Ga0163161_10002081 | 3300017792 | Bacteria | 14502 |
| 582 | Ga0163161_10022770 | 3300017792 | Bacteria | 4414 |
| 583 | Ga0163161_10686903 | 3300017792 | Bacteria | 851 |
| 584 | Ga0206356_10720898 | 3300020070 | Bacteria | 3145 |
| 585 | Ga0213873_10016781 | 3300021358 | Bacteria | 1660 |
| 586 | Ga0213875_10072544 | 3300021388 | Bacteria | 1607 |
| 587 | Ga0207666_1000028 | 3300025271 | Bacteria | 32086 |
| 588 | Ga0209130_1031527 | 3300025284 | Bacteria | 1086 |
| 589 | Ga0207673_1003204 | 3300025290 | Bacteria | 1907 |
| 590 | Ga0209758_1000365 | 3300025297 | Bacteria | 80645 |
| 591 | Ga0209256_1027726 | 3300025299 | Bacteria | 1609 |
| 592 | Ga0207426_1000620 | 3300025302 | Bacteria | 45305 |
| 593 | Ga0207426_1091643 | 3300025302 | Bacteria | 803 |
| 594 | Ga0209257_1024757 | 3300025304 | Bacteria | 2069 |
| 595 | Ga0209257_1038323 | 3300025304 | Bacteria | 1453 |
| 596 | Ga0207697_10043143 | 3300025315 | Bacteria | 1854 |
| 597 | Ga0207697_10117666 | 3300025315 | Bacteria | 1142 |
| 598 | Ga0207656_10095591 | 3300025321 | Bacteria | 1355 |
| 599 | Ga0207656_10138308 | 3300025321 | Bacteria | 1146 |
| 600 | Ga0207696_1029645 | 3300025711 | Bacteria | 1669 |
| 601 | Ga0207655_1116701 | 3300025728 | Bacteria | 891 |
| 602 | Ga0207653_10006097 | 3300025885 | Bacteria | 3757 |
| 603 | Ga0207682_10000640 | 3300025893 | Bacteria | 16315 |
| 604 | Ga0207682_10002485 | 3300025893 | Bacteria | 8251 |
| 605 | Ga0207682_10009098 | 3300025893 | Bacteria | 3923 |
| 606 | Ga0207692_10003023 | 3300025898 | Bacteria | 6521 |
| 607 | Ga0207692_10037773 | 3300025898 | Bacteria | 2364 |
| 608 | Ga0207642_10022716 | 3300025899 | Bacteria | 2493 |
| 609 | Ga0207642_10119391 | 3300025899 | Bacteria | 1357 |
| 610 | Ga0207642_10417167 | 3300025899 | Bacteria | 806 |
| 611 | Ga0207710_10004196 | 3300025900 | Bacteria | 6317 |
| 612 | Ga0207710_10008402 | 3300025900 | Bacteria | 4354 |
| 613 | Ga0207710_10046025 | 3300025900 | Bacteria | 1947 |
| 614 | Ga0207710_10106992 | 3300025900 | Bacteria | 1325 |
| 615 | Ga0207710_10225945 | 3300025900 | Bacteria | 931 |
| 616 | Ga0207688_10000088 | 3300025901 | Bacteria | 35438 |
| 617 | Ga0207688_10007354 | 3300025901 | Bacteria | 5995 |
| 618 | Ga0207688_10026961 | 3300025901 | Bacteria | 3160 |
| 619 | Ga0207688_10066454 | 3300025901 | Bacteria | 2039 |
| 620 | Ga0207688_10096042 | 3300025901 | Bacteria | 1706 |
| 621 | Ga0207688_10480997 | 3300025901 | Bacteria | 776 |
| 622 | Ga0207680_10060673 | 3300025903 | Bacteria | 2303 |
| 623 | Ga0207680_10128477 | 3300025903 | Bacteria | 1667 |
| 624 | Ga0207680_10311273 | 3300025903 | Bacteria | 1099 |
| 625 | Ga0207680_10418409 | 3300025903 | Bacteria | 949 |
| 626 | Ga0207647_10030620 | 3300025904 | Bacteria | 3469 |
| 627 | Ga0207647_10227752 | 3300025904 | Bacteria | 1073 |
| 628 | Ga0207699_10025289 | 3300025906 | Bacteria | 3257 |
| 629 | Ga0207699_10120198 | 3300025906 | Bacteria | 1698 |
| 630 | Ga0207645_10002863 | 3300025907 | Bacteria | 13368 |
| 631 | Ga0207645_10115125 | 3300025907 | Bacteria | 1743 |
| 632 | Ga0207645_10146462 | 3300025907 | Bacteria | 1540 |
| 633 | Ga0207645_10373518 | 3300025907 | Bacteria | 956 |
| 634 | Ga0207643_10000085 | 3300025908 | Bacteria | 61372 |
| 635 | Ga0207643_10024148 | 3300025908 | Unclassified | 3354 |
| 636 | Ga0207643_10037649 | 3300025908 | Bacteria | 2714 |
| 637 | Ga0207684_10046815 | 3300025910 | Plasmid | 3669 |
| 638 | Ga0207654_10000373 | 3300025911 | Bacteria | 26098 |
| 639 | Ga0207654_10245862 | 3300025911 | Bacteria | 1197 |
| 640 | Ga0207654_10553910 | 3300025911 | Bacteria | 817 |
| 641 | Ga0207695_10106623 | 3300025913 | Bacteria | 2788 |
| 642 | Ga0207671_10160163 | 3300025914 | Bacteria | 1742 |
| 643 | Ga0207671_10391560 | 3300025914 | Bacteria | 1105 |
| 644 | Ga0207671_10484080 | 3300025914 | Bacteria | 986 |
| 645 | Ga0207693_10003902 | 3300025915 | Bacteria | 12694 |
| 646 | Ga0207693_10019378 | 3300025915 | Bacteria | 5413 |
| 647 | Ga0207693_10161394 | 3300025915 | Bacteria | 1763 |
| 648 | Ga0207660_10220496 | 3300025917 | Bacteria | 1488 |
| 649 | Ga0207662_10000339 | 3300025918 | Bacteria | 21125 |
| 650 | Ga0207662_10020438 | 3300025918 | Bacteria | 3778 |
| 651 | Ga0207662_10052177 | 3300025918 | Bacteria | 2433 |
| 652 | Ga0207662_10067003 | 3300025918 | Bacteria | 2164 |
| 653 | Ga0207657_10040320 | 3300025919 | Bacteria | 4138 |
| 654 | Ga0207657_10066425 | 3300025919 | Bacteria | 3070 |
| 655 | Ga0207657_10155102 | 3300025919 | Bacteria | 1862 |
| 656 | Ga0207657_10439651 | 3300025919 | Bacteria | 1024 |
| 657 | Ga0207657_10617051 | 3300025919 | Bacteria | 845 |
| 658 | Ga0207649_10151151 | 3300025920 | Bacteria | 1599 |
| 659 | Ga0207649_10263137 | 3300025920 | Bacteria | 1247 |
| 660 | Ga0207649_10315794 | 3300025920 | Bacteria | 1146 |
| 661 | Ga0207649_10483364 | 3300025920 | Bacteria | 939 |
| 662 | Ga0207652_10328765 | 3300025921 | Bacteria | 1380 |
| 663 | Ga0207652_10382514 | 3300025921 | Bacteria | 1270 |
| 664 | Ga0207681_10002232 | 3300025923 | Bacteria | 12316 |
| 665 | Ga0207681_10055014 | 3300025923 | Unclassified | 2708 |
| 666 | Ga0207681_10151240 | 3300025923 | Unclassified | 1740 |
| 667 | Ga0207681_10217859 | 3300025923 | Bacteria | 1475 |
| 668 | Ga0207681_10357048 | 3300025923 | Bacteria | 1171 |
| 669 | Ga0207681_10387612 | 3300025923 | Bacteria | 1126 |
| 670 | Ga0207681_10773471 | 3300025923 | Bacteria | 801 |
| 671 | Ga0207694_10065814 | 3300025924 | Bacteria | 2826 |
| 672 | Ga0207694_10307947 | 3300025924 | Bacteria | 1305 |
| 673 | Ga0207650_10004558 | 3300025925 | Bacteria | 9475 |
| 674 | Ga0207650_10019027 | 3300025925 | Bacteria | 4827 |
| 675 | Ga0207650_10073393 | 3300025925 | Bacteria | 2577 |
| 676 | Ga0207650_10542726 | 3300025925 | Bacteria | 974 |
| 677 | Ga0207659_10000200 | 3300025926 | Bacteria | 35764 |
| 678 | Ga0207659_10057893 | 3300025926 | Bacteria | 2781 |
| 679 | Ga0207659_10094040 | 3300025926 | Bacteria | 2245 |
| 680 | Ga0207659_10153311 | 3300025926 | Bacteria | 1801 |
| 681 | Ga0207659_10776934 | 3300025926 | Bacteria | 822 |
| 682 | Ga0207687_10015071 | 3300025927 | Bacteria | 5064 |
| 683 | Ga0207687_10039006 | 3300025927 | Bacteria | 3250 |
| 684 | Ga0207687_10127218 | 3300025927 | Bacteria | 1915 |
| 685 | Ga0207687_10602183 | 3300025927 | Bacteria | 926 |
| 686 | Ga0207700_10051991 | 3300025928 | Bacteria | 3061 |
| 687 | Ga0207700_10121169 | 3300025928 | Bacteria | 2121 |
| 688 | Ga0207700_10584548 | 3300025928 | Bacteria | 993 |
| 689 | Ga0207664_10012242 | 3300025929 | Bacteria | 6130 |
| 690 | Ga0207664_10042377 | 3300025929 | Bacteria | 3553 |
| 691 | Ga0207664_10181896 | 3300025929 | Bacteria | 1805 |
| 692 | Ga0207644_10000867 | 3300025931 | Bacteria | 19095 |
| 693 | Ga0207644_10223595 | 3300025931 | Bacteria | 1493 |
| 694 | Ga0207644_10431864 | 3300025931 | Bacteria | 1080 |
| 695 | Ga0207644_10614865 | 3300025931 | Bacteria | 903 |
| 696 | Ga0207644_11029016 | 3300025931 | Unclassified | 691 |
| 697 | Ga0207690_10003950 | 3300025932 | Bacteria | 8770 |
| 698 | Ga0207690_10011516 | 3300025932 | Bacteria | 5284 |
| 699 | Ga0207690_10409120 | 3300025932 | Bacteria | 1083 |
| 700 | Ga0207706_10017547 | 3300025933 | Bacteria | 6450 |
| 701 | Ga0207706_10132071 | 3300025933 | Bacteria | 2196 |
| 702 | Ga0207686_10001404 | 3300025934 | Bacteria | 13700 |
| 703 | Ga0207686_10109020 | 3300025934 | Bacteria | 1864 |
| 704 | Ga0207686_10220609 | 3300025934 | Bacteria | 1369 |
| 705 | Ga0207686_10391527 | 3300025934 | Unclassified | 1056 |
| 706 | Ga0207709_10001343 | 3300025935 | Bacteria | 17343 |
| 707 | Ga0207709_10010649 | 3300025935 | Bacteria | 5065 |
| 708 | Ga0207709_10081472 | 3300025935 | Bacteria | 2087 |
| 709 | Ga0207709_10170268 | 3300025935 | Unclassified | 1528 |
| 710 | Ga0207709_10214736 | 3300025935 | Unclassified | 1383 |
| 711 | Ga0207709_10250423 | 3300025935 | Bacteria | 1293 |
| 712 | Ga0207709_10780686 | 3300025935 | Bacteria | 770 |
| 713 | Ga0207670_10000398 | 3300025936 | Bacteria | 25046 |
| 714 | Ga0207670_10049599 | 3300025936 | Unclassified | 2809 |
| 715 | Ga0207670_10137623 | 3300025936 | Bacteria | 1797 |
| 716 | Ga0207669_10000129 | 3300025937 | Bacteria | 37620 |
| 717 | Ga0207669_10003951 | 3300025937 | Bacteria | 6468 |
| 718 | Ga0207669_10004285 | 3300025937 | Bacteria | 6267 |
| 719 | Ga0207669_10022028 | 3300025937 | Bacteria | 3377 |
| 720 | Ga0207669_10101901 | 3300025937 | Bacteria | 1900 |
| 721 | Ga0207669_10141449 | 3300025937 | Bacteria | 1671 |
| 722 | Ga0207669_10571335 | 3300025937 | Bacteria | 915 |
| 723 | Ga0207704_10001904 | 3300025938 | Bacteria | 9350 |
| 724 | Ga0207704_10012182 | 3300025938 | Bacteria | 4261 |
| 725 | Ga0207704_10048853 | 3300025938 | Bacteria | 2540 |
| 726 | Ga0207704_10356655 | 3300025938 | Unclassified | 1140 |
| 727 | Ga0207704_10848757 | 3300025938 | Unclassified | 765 |
| 728 | Ga0207665_10001387 | 3300025939 | Bacteria | 16312 |
| 729 | Ga0207665_10049257 | 3300025939 | Bacteria | 2830 |
| 730 | Ga0207665_10078193 | 3300025939 | Bacteria | 2272 |
| 731 | Ga0207665_10391624 | 3300025939 | Bacteria | 1056 |
| 732 | Ga0207691_10069299 | 3300025940 | Bacteria | 3186 |
| 733 | Ga0207691_10916550 | 3300025940 | Bacteria | 733 |
| 734 | Ga0207711_10017080 | 3300025941 | Bacteria | 6028 |
| 735 | Ga0207711_10199467 | 3300025941 | Bacteria | 1826 |
| 736 | Ga0207711_10763488 | 3300025941 | Bacteria | 901 |
| 737 | Ga0207689_10000547 | 3300025942 | Bacteria | 35807 |
| 738 | Ga0207689_10339556 | 3300025942 | Bacteria | 1248 |
| 739 | Ga0207661_10004288 | 3300025944 | Bacteria | 9982 |
| 740 | Ga0207661_10050124 | 3300025944 | Bacteria | 3325 |
| 741 | Ga0207661_10079137 | 3300025944 | Bacteria | 2709 |
| 742 | Ga0207679_10000558 | 3300025945 | Bacteria | 25037 |
| 743 | Ga0207679_10030376 | 3300025945 | Bacteria | 3773 |
| 744 | Ga0207679_10206653 | 3300025945 | Bacteria | 1644 |
| 745 | Ga0207667_10007300 | 3300025949 | Bacteria | 13319 |
| 746 | Ga0207667_10119406 | 3300025949 | Bacteria | 2717 |
| 747 | Ga0207667_10120691 | 3300025949 | Bacteria | 2701 |
| 748 | Ga0207651_10000790 | 3300025960 | Bacteria | 13595 |
| 749 | Ga0207651_10009960 | 3300025960 | Bacteria | 5239 |
| 750 | Ga0207651_10055107 | 3300025960 | Unclassified | 2728 |
| 751 | Ga0207651_10210802 | 3300025960 | Bacteria | 1564 |
| 752 | Ga0207651_10331489 | 3300025960 | Unclassified | 1275 |
| 753 | Ga0207651_10610433 | 3300025960 | Bacteria | 954 |
| 754 | Ga0207712_10007058 | 3300025961 | Bacteria | 7086 |
| 755 | Ga0207712_10071902 | 3300025961 | Bacteria | 2489 |
| 756 | Ga0207712_10399669 | 3300025961 | Bacteria | 1155 |
| 757 | Ga0207668_10002729 | 3300025972 | Bacteria | 10324 |
| 758 | Ga0207640_10058086 | 3300025981 | Bacteria | 2547 |
| 759 | Ga0207640_10296952 | 3300025981 | Bacteria | 1276 |
| 760 | Ga0207640_10455943 | 3300025981 | Bacteria | 1055 |
| 761 | Ga0207658_10003874 | 3300025986 | Bacteria | 10534 |
| 762 | Ga0207658_10016875 | 3300025986 | Bacteria | 5025 |
| 763 | Ga0207658_10152763 | 3300025986 | Bacteria | 1883 |
| 764 | Ga0207658_10549181 | 3300025986 | Bacteria | 1033 |
| 765 | Ga0207658_11141663 | 3300025986 | Bacteria | 712 |
| 766 | Ga0207677_10005171 | 3300026023 | Bacteria | 7063 |
| 767 | Ga0207677_10045803 | 3300026023 | Bacteria | 2923 |
| 768 | Ga0207677_10313952 | 3300026023 | Bacteria | 1300 |
| 769 | Ga0207677_10406995 | 3300026023 | Bacteria | 1155 |
| 770 | Ga0207703_10000644 | 3300026035 | Bacteria | 35023 |
| 771 | Ga0207703_10320184 | 3300026035 | Bacteria | 1420 |
| 772 | Ga0207703_10567591 | 3300026035 | Bacteria | 1071 |
| 773 | Ga0207703_10629172 | 3300026035 | Bacteria | 1017 |
| 774 | Ga0207639_10034810 | 3300026041 | Bacteria | 3725 |
| 775 | Ga0207678_10016400 | 3300026067 | Bacteria | 6504 |
| 776 | Ga0207678_10020707 | 3300026067 | Bacteria | 5765 |
| 777 | Ga0207678_10260816 | 3300026067 | Bacteria | 1485 |
| 778 | Ga0207678_11113786 | 3300026067 | Bacteria | 699 |
| 779 | Ga0207708_10068669 | 3300026075 | Bacteria | 2712 |
| 780 | Ga0207708_10185080 | 3300026075 | Bacteria | 1655 |
| 781 | Ga0207708_10197695 | 3300026075 | Bacteria | 1603 |
| 782 | Ga0207708_10220307 | 3300026075 | Unclassified | 1520 |
| 783 | Ga0207702_10000243 | 3300026078 | Bacteria | 63718 |
| 784 | Ga0207702_10012908 | 3300026078 | Bacteria | 6948 |
| 785 | Ga0207702_10466793 | 3300026078 | Bacteria | 1227 |
| 786 | Ga0207702_10776128 | 3300026078 | Bacteria | 947 |
| 787 | Ga0207702_11295314 | 3300026078 | Bacteria | 723 |
| 788 | Ga0207641_10001185 | 3300026088 | Bacteria | 26147 |
| 789 | Ga0207641_10003587 | 3300026088 | Bacteria | 13709 |
| 790 | Ga0207641_10072216 | 3300026088 | Bacteria | 2971 |
| 791 | Ga0207641_10157664 | 3300026088 | Bacteria | 2061 |
| 792 | Ga0207641_10248173 | 3300026088 | Bacteria | 1661 |
| 793 | Ga0207641_10313507 | 3300026088 | Bacteria | 1485 |
| 794 | Ga0207648_10002538 | 3300026089 | Bacteria | 19586 |
| 795 | Ga0207648_10017413 | 3300026089 | Bacteria | 6539 |
| 796 | Ga0207648_11143643 | 3300026089 | Bacteria | 730 |
| 797 | Ga0207676_10003948 | 3300026095 | Bacteria | 10472 |
| 798 | Ga0207676_10007042 | 3300026095 | Bacteria | 7969 |
| 799 | Ga0207676_10057920 | 3300026095 | Bacteria | 3053 |
| 800 | Ga0207676_10064493 | 3300026095 | Bacteria | 2913 |
| 801 | Ga0207676_10112099 | 3300026095 | Bacteria | 2284 |
| 802 | Ga0207674_10018619 | 3300026116 | Bacteria | 7543 |
| 803 | Ga0207674_10124866 | 3300026116 | Bacteria | 2540 |
| 804 | Ga0207674_10606714 | 3300026116 | Bacteria | 1057 |
| 805 | Ga0207675_100008179 | 3300026118 | Bacteria | 9859 |
| 806 | Ga0207675_100061200 | 3300026118 | Bacteria | 3515 |
| 807 | Ga0207675_100070938 | 3300026118 | Bacteria | 3257 |
| 808 | Ga0207675_100077967 | 3300026118 | Bacteria | 3104 |
| 809 | Ga0207675_100396191 | 3300026118 | Bacteria | 1360 |
| 810 | Ga0207675_100699335 | 3300026118 | Unclassified | 1022 |
| 811 | Ga0207683_10003695 | 3300026121 | Bacteria | 13295 |
| 812 | Ga0207683_10005841 | 3300026121 | Bacteria | 10553 |
| 813 | Ga0207683_10012937 | 3300026121 | Bacteria | 7125 |
| 814 | Ga0207683_10022205 | 3300026121 | Bacteria | 5446 |
| 815 | Ga0207683_10056654 | 3300026121 | Bacteria | 3439 |
| 816 | Ga0207698_10065550 | 3300026142 | Bacteria | 2853 |
| 817 | Ga0207698_10852441 | 3300026142 | Bacteria | 916 |
| 818 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 819 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 820 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 821 | Ga0209489_111101 | 3300027361 | Bacteria | 9483 |
| 822 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 823 | Ga0209981_1022404 | 3300027378 | Bacteria | 906 |
| 824 | Ga0209996_1017111 | 3300027395 | Bacteria | 1000 |
| 825 | Ga0209984_1002986 | 3300027424 | Bacteria | 1913 |
| 826 | Ga0209995_1004548 | 3300027471 | Bacteria | 2218 |
| 827 | Ga0209179_1007538 | 3300027512 | Bacteria | 1800 |
| 828 | Ga0209999_1042680 | 3300027543 | Bacteria | 851 |
| 829 | Ga0209982_1004605 | 3300027552 | Bacteria | 1978 |
| 830 | Ga0209970_1025045 | 3300027614 | Bacteria | 1021 |
| 831 | Ga0210002_1002707 | 3300027617 | Bacteria | 2566 |
| 832 | Ga0209983_1021928 | 3300027665 | Bacteria | 1337 |
| 833 | Ga0209588_1017279 | 3300027671 | Bacteria | 2235 |
| 834 | Ga0209971_1011063 | 3300027682 | Bacteria | 2137 |
| 835 | Ga0209966_1000401 | 3300027695 | Bacteria | 12728 |
| 836 | Ga0209813_10014033 | 3300027866 | Bacteria | 2150 |
| 837 | Ga0209813_10066481 | 3300027866 | Bacteria | 1163 |
| 838 | Ga0209813_10074315 | 3300027866 | Bacteria | 1111 |
| 839 | Ga0207428_10000055 | 3300027907 | Bacteria | 166460 |
| 840 | Ga0207428_10000664 | 3300027907 | Bacteria | 40266 |
| 841 | Ga0207428_10004496 | 3300027907 | Bacteria | 13227 |
| 842 | Ga0207428_10013539 | 3300027907 | Bacteria | 7120 |
| 843 | Ga0207428_10038968 | 3300027907 | Bacteria | 3859 |
| 844 | Ga0207428_10181740 | 3300027907 | Bacteria | 1589 |
| 845 | Ga0207428_10231565 | 3300027907 | Bacteria | 1382 |
| 846 | Ga0268266_10034374 | 3300028379 | Bacteria | 4311 |
| 847 | Ga0268266_10075860 | 3300028379 | Bacteria | 2921 |
| 848 | Ga0268266_10250329 | 3300028379 | Bacteria | 1638 |
| 849 | Ga0268266_10271509 | 3300028379 | Bacteria | 1574 |
| 850 | Ga0268266_10575926 | 3300028379 | Bacteria | 1080 |
| 851 | Ga0268266_10773313 | 3300028379 | Bacteria | 927 |
| 852 | Ga0268266_10898176 | 3300028379 | Bacteria | 857 |
| 853 | Ga0268265_10011790 | 3300028380 | Bacteria | 5910 |
| 854 | Ga0268265_10076192 | 3300028380 | Unclassified | 2630 |
| 855 | Ga0268265_10699873 | 3300028380 | Bacteria | 979 |
| 856 | Ga0268265_10739965 | 3300028380 | Bacteria | 953 |
| 857 | Ga0268264_10049815 | 3300028381 | Bacteria | 3486 |
| 858 | Ga0268264_10246818 | 3300028381 | Bacteria | 1657 |
| 859 | Ga0268264_10840666 | 3300028381 | Bacteria | 919 |
| 860 | Ga0265318_10008361 | 3300028577 | Bacteria | 4613 |
| 861 | Ga0307515_10573132 | 3300028794 | Bacteria | 739 |
| 862 | Ga0265338_10040637 | 3300028800 | Bacteria | 4365 |
| 863 | Ga0265338_10243378 | 3300028800 | Bacteria | 1331 |
| 864 | Ga0265338_10271405 | 3300028800 | Bacteria | 1243 |
| 865 | Ga0265771_1001725 | 3300031010 | Bacteria | 1080 |
| 866 | Ga0265330_10005858 | 3300031235 | Bacteria | 6094 |
| 867 | Ga0265332_10000641 | 3300031238 | Bacteria | 22774 |
| 868 | Ga0265332_10095195 | 3300031238 | Bacteria | 1258 |
| 869 | Ga0265332_10201261 | 3300031238 | Bacteria | 827 |
| 870 | Ga0265320_10012872 | 3300031240 | Bacteria | 4839 |
| 871 | Ga0265325_10005224 | 3300031241 | Bacteria | 8061 |
| 872 | Ga0265325_10017063 | 3300031241 | Bacteria | 4040 |
| 873 | Ga0265325_10035241 | 3300031241 | Bacteria | 2659 |
| 874 | Ga0265329_10007481 | 3300031242 | Bacteria | 4216 |
| 875 | Ga0265340_10004511 | 3300031247 | Bacteria | 7768 |
| 876 | Ga0265340_10004663 | 3300031247 | Bacteria | 7625 |
| 877 | Ga0265340_10010325 | 3300031247 | Bacteria | 4994 |
| 878 | Ga0265340_10137825 | 3300031247 | Bacteria | 1117 |
| 879 | Ga0265339_10003204 | 3300031249 | Bacteria | 11487 |
| 880 | Ga0265339_10006269 | 3300031249 | Bacteria | 7824 |
| 881 | Ga0265339_10086100 | 3300031249 | Bacteria | 1653 |
| 882 | Ga0265331_10056584 | 3300031250 | Bacteria | 1861 |
| 883 | Ga0265331_10069200 | 3300031250 | Bacteria | 1654 |
| 884 | Ga0265316_10082491 | 3300031344 | Unclassified | 2463 |
| 885 | Ga0265316_10153653 | 3300031344 | Bacteria | 1723 |
| 886 | Ga0265316_10562091 | 3300031344 | Bacteria | 811 |
| 887 | Ga0265316_10574905 | 3300031344 | Bacteria | 800 |
| 888 | Ga0307513_10481132 | 3300031456 | Bacteria | 961 |
| 889 | Ga0307408_100265679 | 3300031548 | Bacteria | 1422 |
| 890 | Ga0265313_10010495 | 3300031595 | Bacteria | 5846 |
| 891 | Ga0265313_10020356 | 3300031595 | Bacteria | 3662 |
| 892 | Ga0265313_10021730 | 3300031595 | Bacteria | 3501 |
| 893 | Ga0265313_10050212 | 3300031595 | Bacteria | 2003 |
| 894 | Ga0316575_10042005 | 3300031665 | Bacteria | 1810 |
| 895 | Ga0265314_10012502 | 3300031711 | Bacteria | 6921 |
| 896 | Ga0265342_10000282 | 3300031712 | Bacteria | 57360 |
| 897 | Ga0265342_10011053 | 3300031712 | Bacteria | 6198 |
| 898 | Ga0265342_10020118 | 3300031712 | Bacteria | 4289 |
| 899 | Ga0265342_10343505 | 3300031712 | Bacteria | 778 |
| 900 | Ga0316576_10157407 | 3300031727 | Bacteria | 1713 |
| 901 | Ga0316578_10034384 | 3300031728 | Bacteria | 2910 |
| 902 | Ga0307516_10305913 | 3300031730 | Bacteria | 1264 |
| 903 | Ga0316577_10230631 | 3300031733 | Bacteria | 1047 |
| 904 | Ga0307413_10040352 | 3300031824 | Bacteria | 2723 |
| 905 | Ga0307410_10024175 | 3300031852 | Bacteria | 3792 |
| 906 | Ga0307410_10900364 | 3300031852 | Bacteria | 758 |
| 907 | Ga0307406_10031987 | 3300031901 | Bacteria | 3208 |
| 908 | Ga0307406_11151487 | 3300031901 | Bacteria | 672 |
| 909 | Ga0307407_10053100 | 3300031903 | Bacteria | 2331 |
| 910 | Ga0307412_10837602 | 3300031911 | Bacteria | 801 |
| 911 | Ga0307412_10917064 | 3300031911 | Bacteria | 769 |
| 912 | Ga0307409_100091683 | 3300031995 | Bacteria | 2491 |
| 913 | Ga0307409_100521271 | 3300031995 | Bacteria | 1161 |
| 914 | Ga0307409_100991263 | 3300031995 | Bacteria | 858 |
| 915 | Ga0307416_100098002 | 3300032002 | Bacteria | 2541 |
| 916 | Ga0307411_10050524 | 3300032005 | Bacteria | 2708 |
| 917 | Ga0307411_10521142 | 3300032005 | Bacteria | 1009 |
| 918 | Ga0307411_10726885 | 3300032005 | Bacteria | 867 |
| 919 | Ga0307415_100636557 | 3300032126 | Bacteria | 954 |
| 920 | Ga0316583_10000114 | 3300032133 | Bacteria | 18718 |
| 921 | Ga0307507_10164021 | 3300033179 | Bacteria | 1633 |
| 922 | Ga0307510_10041923 | 3300033180 | Bacteria | 4995 |
| 923 | Ga0373930_0000142 | 3300034816 | Bacteria | 8077 |
| 924 | Ga0373948_0085747 | 3300034817 | Bacteria | 725 |
| 925 | Ga0373950_0000162 | 3300034818 | Bacteria | 9703 |
| 926 | Ga0373958_0000310 | 3300034819 | Bacteria | 5880 |
| 927 | Ga0373959_0001515 | 3300034820 | Bacteria | 3706 |
| 928 | Ga0373959_0048333 | 3300034820 | Bacteria | 912 |
| 929 | Ga0373938_0000124 | 3300034957 | Bacteria | 10815 |
| 930 | Ga0373938_0046958 | 3300034957 | Bacteria | 976 |
| 931 | Ga0373928_0000366 | 3300035084 | Bacteria | 9008 |
| 932 | Ga0373928_0023056 | 3300035084 | Bacteria | 1325 |
| 933 | Ga0373929_0000321 | 3300035085 | Bacteria | 8891 |
| 934 | Ga0373934_0005198 | 3300035086 | Bacteria | 4815 |
| 935 | Ga0373934_0136381 | 3300035086 | Bacteria | 1002 |
| 936 | Ga0373940_0000053 | 3300035088 | Bacteria | 13004 |
| 937 | Ga0373944_0158725 | 3300035089 | Bacteria | 801 |
| 938 | Ga0373949_0000761 | 3300035090 | Bacteria | 10377 |
| 939 | Ga0373949_0043436 | 3300035090 | Bacteria | 1112 |
| 940 | Ga0373951_0005041 | 3300035091 | Bacteria | 3090 |
| 941 | Ga0373951_0115354 | 3300035091 | Bacteria | 726 |
| 942 | Ga0373952_0000668 | 3300035092 | Bacteria | 6060 |
| 943 | Ga0373952_0049121 | 3300035092 | Bacteria | 1000 |
| 944 | Ga0373923_0003286 | 3300035111 | Bacteria | 5158 |
| 945 | Ga0373923_0193464 | 3300035111 | Bacteria | 938 |
| 946 | Ga0373932_0137000 | 3300035112 | Bacteria | 829 |
| 947 | Ga0373932_0228937 | 3300035112 | Bacteria | 671 |
| 948 | Ga0373936_0013171 | 3300035113 | Bacteria | 3155 |
| 949 | Ga0373936_0036262 | 3300035113 | Bacteria | 1966 |
| 950 | Ga0373936_0049667 | 3300035113 | Bacteria | 1695 |
| 951 | Ga0373936_0125661 | 3300035113 | Bacteria | 1099 |
| 952 | Ga0373936_0313487 | 3300035113 | Bacteria | 710 |
| 953 | Ga0373939_0000855 | 3300035114 | Bacteria | 7531 |
| 954 | Ga0373939_0011251 | 3300035114 | Bacteria | 2253 |
| 955 | Ga0373939_0084704 | 3300035114 | Bacteria | 1060 |
| 956 | Ga0373939_0108185 | 3300035114 | Bacteria | 964 |
| 957 | Ga0373945_0084067 | 3300035116 | Bacteria | 1223 |
| 958 | Ga0373953_0008645 | 3300035117 | Bacteria | 3468 |
| 959 | Ga0373953_0012266 | 3300035117 | Bacteria | 3031 |
| 960 | Ga0373953_0016153 | 3300035117 | Bacteria | 2721 |
| 961 | Ga0373953_0029442 | 3300035117 | Bacteria | 2123 |
| 962 | Ga0373953_0074233 | 3300035117 | Bacteria | 1407 |
| 963 | Ga0373954_0001141 | 3300035118 | Bacteria | 10672 |
| 964 | Ga0373954_0012463 | 3300035118 | Bacteria | 3780 |
| 965 | Ga0373954_0014468 | 3300035118 | Bacteria | 3517 |
| 966 | Ga0373954_0015482 | 3300035118 | Bacteria | 3409 |
| 967 | Ga0373956_0001770 | 3300035119 | Bacteria | 8897 |
| 968 | Ga0373956_0007856 | 3300035119 | Bacteria | 4304 |
| 969 | Ga0373956_0081040 | 3300035119 | Bacteria | 1489 |
| 970 | Ga0373957_0003776 | 3300035120 | Bacteria | 4535 |
| 971 | Ga0373957_0042367 | 3300035120 | Bacteria | 1717 |
| 972 | Ga0373960_0001357 | 3300035121 | Bacteria | 5398 |
| 973 | Ga0373960_0030810 | 3300035121 | Bacteria | 1496 |
| 974 | Ga0373943_0124400 | 3300035170 | Bacteria | 1374 |
| 975 | Ga0373943_0154707 | 3300035170 | Bacteria | 1244 |
| 976 | Ga0373943_0244481 | 3300035170 | Bacteria | 1006 |
| 977 | Ga0373946_0071296 | 3300035171 | Bacteria | 1501 |
| 978 | Ga0373946_0081077 | 3300035171 | Bacteria | 1421 |
| 979 | Ga0373946_0092999 | 3300035171 | Bacteria | 1339 |
| 980 | Ga0373946_0207943 | 3300035171 | Bacteria | 940 |
| 981 | Ga0373946_0334029 | 3300035171 | Bacteria | 755 |
| 982 | Ga0373955_0001039 | 3300035172 | Bacteria | 11796 |
| 983 | Ga0373955_0010151 | 3300035172 | Bacteria | 4438 |
| 984 | Ga0373955_0039022 | 3300035172 | Bacteria | 2532 |
| 985 | Ga0373955_0040170 | 3300035172 | Bacteria | 2500 |
| 986 | Ga0373955_0323326 | 3300035172 | Bacteria | 932 |
| 987 | Ga0373942_0004939 | 3300035207 | Bacteria | 3091 |
| 988 | Ga0373942_0050359 | 3300035207 | Bacteria | 1166 |
| 989 | Ga0373961_0033135 | 3300035241 | Bacteria | 1454 |
| 990 | Ga0373961_0051661 | 3300035241 | Bacteria | 1221 |
| 991 | Ga0373961_0142071 | 3300035241 | Bacteria | 812 |
| 992 | Ga0373962_0000078 | 3300035242 | Bacteria | 21523 |
| 993 | Ga0373962_0078897 | 3300035242 | Bacteria | 996 |
| 994 | Ga0316574_0020651 | 3300035398 | Bacteria | 3900 |
| 995 | Ga0373924_0002945 | 3300035410 | Bacteria | 5782 |
| 996 | Ga0373924_0010518 | 3300035410 | Bacteria | 3415 |
| 997 | Ga0373924_0041585 | 3300035410 | Bacteria | 1883 |
| 998 | Ga0373924_0073796 | 3300035410 | Bacteria | 1442 |
| 999 | Ga0373931_0003029 | 3300035691 | Bacteria | 7506 |
| 1000 | Ga0373931_0007166 | 3300035691 | Bacteria | 5243 |
| 1001 | Ga0373931_0031269 | 3300035691 | Bacteria | 2747 |
| 1002 | Ga0373931_0047034 | 3300035691 | Bacteria | 2283 |
| 1003 | Ga0373931_0052636 | 3300035691 | Bacteria | 2171 |
| 1004 | Ga0373931_0126248 | 3300035691 | Bacteria | 1467 |
| 1005 | Ga0373931_0723548 | 3300035691 | Bacteria | 659 |
| 1006 | Ga0373935_0042469 | 3300035692 | Bacteria | 2859 |
| 1007 | Ga0373935_0055098 | 3300035692 | Bacteria | 2533 |
| 1008 | Ga0373935_0243077 | 3300035692 | Bacteria | 1257 |
| 1009 | Ga0373935_0272398 | 3300035692 | Bacteria | 1190 |
| 1010 | Ga0373935_0345596 | 3300035692 | Bacteria | 1060 |
| 1011 | Ga0373935_0500773 | 3300035692 | Bacteria | 882 |
| 1012 | Ga0373927_0002439 | 3300035695 | Bacteria | 13560 |
| 1013 | Ga0373927_0035146 | 3300035695 | Bacteria | 3259 |
| 1014 | Ga0373927_0039369 | 3300035695 | Unclassified | 3068 |
| 1015 | Ga0373927_0074463 | 3300035695 | Bacteria | 2198 |
| 1016 | Ga0373933_0001176 | 3300035724 | Bacteria | 15509 |
| 1017 | Ga0373933_0003616 | 3300035724 | Bacteria | 8571 |
| 1018 | Ga0373933_0005523 | 3300035724 | Bacteria | 6888 |
| 1019 | Ga0373933_0020771 | 3300035724 | Bacteria | 3723 |
| 1020 | Ga0373933_0038938 | 3300035724 | Bacteria | 2795 |
| 1021 | Ga0373933_0586954 | 3300035724 | Bacteria | 731 |
| 1022 | Ga0373933_0845074 | 3300035724 | Bacteria | 603 |
| 1023 | Ga0373947_0011631 | 3300035725 | Bacteria | 5048 |
| 1024 | Ga0373947_0012163 | 3300035725 | Bacteria | 4928 |
| 1025 | Ga0373947_0166705 | 3300035725 | Bacteria | 1427 |
| 1026 | Ga0373947_0217401 | 3300035725 | Bacteria | 1255 |
| 1027 | Ga0373937_0004370 | 3300036401 | Bacteria | 12001 |
| 1028 | Ga0373937_0007299 | 3300036401 | Bacteria | 9566 |
| 1029 | Ga0373937_0012395 | 3300036401 | Bacteria | 7497 |
| 1030 | Ga0373937_0016330 | 3300036401 | Bacteria | 6589 |
| 1031 | Ga0373937_0027073 | 3300036401 | Bacteria | 5182 |
| 1032 | Ga0373937_0047990 | 3300036401 | Bacteria | 3907 |
| 1033 | Ga0373937_0328431 | 3300036401 | Bacteria | 1447 |
| 1034 | Ga0373937_0749498 | 3300036401 | Bacteria | 924 |
| 1035 | Ga0316582_0222711 | 3300036647 | Bacteria | 1290 |
| 1036 | Ga0316584_0013710 | 3300036712 | Bacteria | 5745 |
| 1037 | Ga0373925_0033621 | 3300037068 | Bacteria | 3778 |
| 1038 | Ga0373925_0058797 | 3300037068 | Bacteria | 2883 |
| 1039 | Ga0373925_0059519 | 3300037068 | Bacteria | 2866 |
| 1040 | Ga0373925_0060739 | 3300037068 | Bacteria | 2838 |
| 1041 | Ga0373925_0109019 | 3300037068 | Bacteria | 2137 |
| 1042 | Ga0373925_0253366 | 3300037068 | Bacteria | 1412 |
| 1043 | Ga0373925_0258352 | 3300037068 | Bacteria | 1399 |
| 1044 | Ga0373925_0379881 | 3300037068 | Bacteria | 1150 |
| 1045 | Ga0373925_0680786 | 3300037068 | Bacteria | 848 |
| 1046 | Ga0395900_0001529 | 3300037418 | Bacteria | 27494 |
| 1047 | Ga0395898_0005283 | 3300037466 | Bacteria | 13964 |
| 1048 | Ga0395898_0100534 | 3300037466 | Bacteria | 2777 |
| 1049 | Ga0395905_0009682 | 3300037471 | Bacteria | 9408 |
| 1050 | Ga0395905_0352196 | 3300037471 | Bacteria | 1365 |
| 1051 | Ga0395905_0624396 | 3300037471 | Bacteria | 979 |
| 1052 | Ga0436364_0151426 | 3300037853 | Bacteria | 1793 |
| 1053 | Ga0436364_0178002 | 3300037853 | Bacteria | 1020 |
| 1054 | Ga0436364_0449892 | 3300037853 | Bacteria | 1065 |
| 1055 | Ga0436364_0682938 | 3300037853 | Bacteria | 2822 |
| 1056 | Ga0436364_0690770 | 3300037853 | Bacteria | 684 |
| 1057 | Ga0395901_0011625 | 3300038443 | Bacteria | 8916 |
| 1058 | Ga0395901_0118144 | 3300038443 | Bacteria | 2786 |
| 1059 | Ga0242420_016255 | 3300038996 | Bacteria | 1294 |
| 1060 | Ga0436365_0062708 | 3300039437 | Bacteria | 3398 |
| 1061 | Ga0436365_0191965 | 3300039437 | Bacteria | 59780 |
| 1062 | Ga0436365_0343292 | 3300039437 | Bacteria | 749 |
| 1063 | Ga0436360_0579576 | 3300039438 | Bacteria | 1184 |
| 1064 | Ga0436360_0996754 | 3300039438 | Bacteria | 777 |
| 1065 | Ga0436361_0357546 | 3300039447 | Bacteria | 1164 |
| 1066 | Ga0436363_0511827 | 3300039450 | Bacteria | 699 |
| 1067 | Ga0436363_0597243 | 3300039450 | Bacteria | 2030 |
| 1068 | Ga0436363_0655408 | 3300039450 | Bacteria | 2260 |
| 1069 | Ga0436363_0767052 | 3300039450 | Bacteria | 1678 |
| 1070 | Ga0436363_1430348 | 3300039450 | Bacteria | 842 |
| 1071 | Ga0436362_0173083 | 3300039453 | Bacteria | 728 |
| 1072 | Ga0436362_0297855 | 3300039453 | Bacteria | 4014 |
| 1073 | Ga0436362_1296428 | 3300039453 | Bacteria | 4654 |
| 1074 | Ga0439453_0000053 | 3300041408 | Bacteria | 8018 |
| 1075 | Ga0439453_0008707 | 3300041408 | Unclassified | 1635 |
| 1076 | Ga0439466_0167669 | 3300041411 | Bacteria | 671 |
| 1077 | Ga0439465_0049910 | 3300041413 | Bacteria | 1368 |
| 1078 | Ga0451787_808973 | 3300041441 | Bacteria | 1014 |
| 1079 | Ga0451791_1200117 | 3300041451 | Bacteria | 1384 |
| 1080 | Ga0451793_1238971 | 3300041452 | Bacteria | 963 |
| 1081 | Ga0451797_0556017 | 3300041453 | Bacteria | 735 |
| 1082 | Ga0451795_0815001 | 3300041456 | Bacteria | 1461 |
| 1083 | Ga0451802_1763825 | 3300041460 | Bacteria | 773 |
| 1084 | Ga0451807_0886678 | 3300041486 | Bacteria | 768 |
| 1085 | Ga0451807_2188998 | 3300041486 | Bacteria | 840 |
| 1086 | Ga0451835_0276910 | 3300041492 | Bacteria | 930 |
| 1087 | Ga0451845_0923467 | 3300041501 | Bacteria | 2220 |
| 1088 | Ga0451847_0233955 | 3300041503 | Bacteria | 623 |
| 1089 | Ga0439443_004635 | 3300042003 | Unclassified | 1802 |
| 1090 | Ga0439445_0044869 | 3300042004 | Bacteria | 1182 |
| 1091 | Ga0439448_0120978 | 3300042005 | Bacteria | 898 |
| 1092 | Ga0439450_057016 | 3300042008 | Bacteria | 938 |
| 1093 | Ga0439455_0100033 | 3300042012 | Unclassified | 801 |
| 1094 | Ga0439463_019984 | 3300042016 | Bacteria | 1669 |
| 1095 | Ga0439446_0042517 | 3300042156 | Bacteria | 1341 |
| 1096 | Ga0439446_0092976 | 3300042156 | Unclassified | 946 |
| 1097 | Ga0439458_0101087 | 3300042157 | Unclassified | 749 |
| 1098 | Ga0439435_0000678 | 3300042436 | Bacteria | 5656 |
| 1099 | Ga0439459_0007786 | 3300042438 | Bacteria | 1817 |
| 1100 | Ga0439464_0012113 | 3300042439 | Bacteria | 2292 |
| 1101 | Ga0439464_0057733 | 3300042439 | Unclassified | 1132 |
| 1102 | Ga0439460_0038009 | 3300042461 | Unclassified | 1402 |
| 1103 | Ga0451577_0171992 | 3300042876 | Bacteria | 1952 |
| 1104 | Ga0439440_0056720 | 3300042993 | Bacteria | 991 |
| 1105 | Ga0466969_0020427 | 3300044656 | Bacteria | 3431 |
| 1106 | Ga0466972_0000333 | 3300044658 | Bacteria | 26290 |
| 1107 | Ga0466972_0208586 | 3300044658 | Bacteria | 914 |
| 1108 | Ga0466966_0046761 | 3300044684 | Bacteria | 2762 |
| 1109 | Ga0466963_0339535 | 3300044694 | Bacteria | 1057 |
| 1110 | Ga0453684_1652533 | 3300044712 | Bacteria | 656 |
| 1111 | Ga0466968_0010020 | 3300044735 | Bacteria | 3661 |
| 1112 | Ga0466968_0413493 | 3300044735 | Bacteria | 663 |
| 1113 | Ga0466957_0063718 | 3300044842 | Bacteria | 2267 |
| 1114 | Ga0466957_0172040 | 3300044842 | Bacteria | 1411 |
| 1115 | Ga0466960_0009504 | 3300044901 | Bacteria | 4011 |
| 1116 | Ga0466960_0043264 | 3300044901 | Bacteria | 2141 |
| 1117 | Ga0466959_0177173 | 3300045049 | Bacteria | 1493 |
| 1118 | Ga0451576_1208535 | 3300045051 | Bacteria | 789 |
| 1119 | Ga0466958_0060744 | 3300045836 | Bacteria | 2301 |
| 1120 | Ga0466967_0047293 | 3300045976 | Bacteria | 3750 |
| 1121 | Ga0466967_0611811 | 3300045976 | Bacteria | 1076 |
| 1122 | Ga0495627_050057 | 3300046453 | Bacteria | 1260 |
| 1123 | Ga0495592_0001529 | 3300046454 | Bacteria | 16130 |
| 1124 | Ga0495592_0002728 | 3300046454 | Bacteria | 12506 |
| 1125 | Ga0495592_0004236 | 3300046454 | Bacteria | 10480 |
| 1126 | Ga0495592_0045149 | 3300046454 | Bacteria | 3288 |
| 1127 | Ga0495592_0122154 | 3300046454 | Bacteria | 1830 |
| 1128 | Ga0495592_0145649 | 3300046454 | Bacteria | 1643 |
| 1129 | Ga0495592_0278130 | 3300046454 | Bacteria | 1095 |
| 1130 | Ga0495603_0035549 | 3300046455 | Bacteria | 2992 |
| 1131 | Ga0495603_0066995 | 3300046455 | Bacteria | 2114 |
| 1132 | Ga0495590_0014239 | 3300046457 | Bacteria | 2905 |
| 1133 | Ga0495590_0049465 | 3300046457 | Bacteria | 1467 |
| 1134 | Ga0495629_0003844 | 3300046459 | Bacteria | 11325 |
| 1135 | Ga0495629_0005031 | 3300046459 | Bacteria | 9895 |
| 1136 | Ga0495629_0108958 | 3300046459 | Bacteria | 1931 |
| 1137 | Ga0495629_0143127 | 3300046459 | Bacteria | 1663 |
| 1138 | Ga0495629_0153766 | 3300046459 | Bacteria | 1599 |
| 1139 | Ga0495629_0707691 | 3300046459 | Bacteria | 668 |
| 1140 | Ga0495638_0023480 | 3300046460 | Bacteria | 4032 |
| 1141 | Ga0495638_0047066 | 3300046460 | Bacteria | 2706 |
| 1142 | Ga0495641_0051051 | 3300046461 | Bacteria | 1890 |
| 1143 | Ga0495641_0207686 | 3300046461 | Bacteria | 878 |
| 1144 | Ga0495651_0001050 | 3300046462 | Bacteria | 21354 |
| 1145 | Ga0495651_0023047 | 3300046462 | Bacteria | 4842 |
| 1146 | Ga0495651_0028941 | 3300046462 | Bacteria | 4320 |
| 1147 | Ga0495653_0000513 | 3300046463 | Bacteria | 29794 |
| 1148 | Ga0495653_0005821 | 3300046463 | Bacteria | 10090 |
| 1149 | Ga0495653_0012012 | 3300046463 | Bacteria | 7069 |
| 1150 | Ga0495653_0049040 | 3300046463 | Bacteria | 3256 |
| 1151 | Ga0495650_0051836 | 3300046471 | Bacteria | 1688 |
| 1152 | Ga0495650_0055945 | 3300046471 | Bacteria | 1603 |
| 1153 | Ga0495582_0100275 | 3300046473 | Bacteria | 1621 |
| 1154 | Ga0495582_0159047 | 3300046473 | Bacteria | 1284 |
| 1155 | Ga0495605_0036148 | 3300046474 | Bacteria | 2492 |
| 1156 | Ga0495605_0062814 | 3300046474 | Bacteria | 1773 |
| 1157 | Ga0495605_0076397 | 3300046474 | Bacteria | 1573 |
| 1158 | Ga0495639_0031208 | 3300046475 | Bacteria | 2371 |
| 1159 | Ga0495639_0089626 | 3300046475 | Bacteria | 1441 |
| 1160 | Ga0495639_0124961 | 3300046475 | Bacteria | 1229 |
| 1161 | Ga0495639_0370037 | 3300046475 | Bacteria | 721 |
| 1162 | Ga0495639_0458663 | 3300046475 | Bacteria | 648 |
| 1163 | Ga0495662_0130354 | 3300046476 | Bacteria | 1236 |
| 1164 | Ga0495664_0015254 | 3300046477 | Bacteria | 4365 |
| 1165 | Ga0495664_0077438 | 3300046477 | Bacteria | 1991 |
| 1166 | Ga0495664_0079992 | 3300046477 | Bacteria | 1958 |
| 1167 | Ga0495664_0165213 | 3300046477 | Bacteria | 1343 |
| 1168 | Ga0495664_0254309 | 3300046477 | Bacteria | 1062 |
| 1169 | Ga0495664_0308653 | 3300046477 | Bacteria | 954 |
| 1170 | Ga0495664_0427658 | 3300046477 | Bacteria | 794 |
| 1171 | Ga0495584_0098425 | 3300046491 | Bacteria | 1478 |
| 1172 | Ga0495584_0118134 | 3300046491 | Bacteria | 1343 |
| 1173 | Ga0495584_0157352 | 3300046491 | Bacteria | 1155 |
| 1174 | Ga0495584_0201040 | 3300046491 | Bacteria | 1013 |
| 1175 | Ga0495585_0036252 | 3300046492 | Bacteria | 2783 |
| 1176 | Ga0495585_0049564 | 3300046492 | Bacteria | 2331 |
| 1177 | Ga0495585_0164648 | 3300046492 | Bacteria | 1149 |
| 1178 | Ga0495594_0139803 | 3300046499 | Bacteria | 1373 |
| 1179 | Ga0495596_0017806 | 3300046500 | Bacteria | 2936 |
| 1180 | Ga0495596_0053354 | 3300046500 | Bacteria | 1582 |
| 1181 | Ga0495596_0091482 | 3300046500 | Unclassified | 1181 |
| 1182 | Ga0495583_0095999 | 3300046506 | Bacteria | 1270 |
| 1183 | Ga0495583_0311352 | 3300046506 | Bacteria | 625 |
| 1184 | Ga0495606_0038140 | 3300046507 | Bacteria | 3253 |
| 1185 | Ga0495608_0000910 | 3300046511 | Bacteria | 20753 |
| 1186 | Ga0495608_0004294 | 3300046511 | Bacteria | 10205 |
| 1187 | Ga0495608_0012541 | 3300046511 | Bacteria | 5880 |
| 1188 | Ga0495608_0097283 | 3300046511 | Bacteria | 1900 |
| 1189 | Ga0495608_0127816 | 3300046511 | Bacteria | 1627 |
| 1190 | Ga0495610_0031329 | 3300046512 | Bacteria | 2775 |
| 1191 | Ga0495616_0019622 | 3300046513 | Bacteria | 3687 |
| 1192 | Ga0495616_0093382 | 3300046513 | Bacteria | 1421 |
| 1193 | Ga0495618_0013782 | 3300046514 | Bacteria | 4918 |
| 1194 | Ga0495618_0027302 | 3300046514 | Bacteria | 3554 |
| 1195 | Ga0495618_0057323 | 3300046514 | Bacteria | 2466 |
| 1196 | Ga0495618_0060670 | 3300046514 | Bacteria | 2398 |
| 1197 | Ga0495618_0139691 | 3300046514 | Bacteria | 1550 |
| 1198 | Ga0495628_0001000 | 3300046516 | Bacteria | 25859 |
| 1199 | Ga0495628_0005038 | 3300046516 | Bacteria | 11611 |
| 1200 | Ga0495628_0007197 | 3300046516 | Bacteria | 9635 |
| 1201 | Ga0495628_0054618 | 3300046516 | Bacteria | 3148 |
| 1202 | Ga0495628_0660412 | 3300046516 | Bacteria | 742 |
| 1203 | Ga0495630_0035402 | 3300046517 | Bacteria | 3731 |
| 1204 | Ga0495630_0218915 | 3300046517 | Bacteria | 1453 |
| 1205 | Ga0495630_0590567 | 3300046517 | Bacteria | 851 |
| 1206 | Ga0495631_0053956 | 3300046518 | Bacteria | 1753 |
| 1207 | Ga0495631_0191919 | 3300046518 | Bacteria | 874 |
| 1208 | Ga0495632_0144704 | 3300046519 | Bacteria | 1101 |
| 1209 | Ga0495632_0145487 | 3300046519 | Bacteria | 1098 |
| 1210 | Ga0495637_0077466 | 3300046520 | Bacteria | 1331 |
| 1211 | Ga0495637_0101462 | 3300046520 | Bacteria | 1124 |
| 1212 | Ga0495643_0003266 | 3300046522 | Bacteria | 11998 |
| 1213 | Ga0495644_0031147 | 3300046523 | Bacteria | 2015 |
| 1214 | Ga0495644_0089326 | 3300046523 | Bacteria | 1162 |
| 1215 | Ga0495666_0060266 | 3300046526 | Bacteria | 1814 |
| 1216 | Ga0495642_0022245 | 3300046528 | Bacteria | 2497 |
| 1217 | Ga0495652_0004645 | 3300046529 | Bacteria | 13093 |
| 1218 | Ga0495652_0020289 | 3300046529 | Bacteria | 5908 |
| 1219 | Ga0495652_0021614 | 3300046529 | Bacteria | 5718 |
| 1220 | Ga0495652_0108100 | 3300046529 | Bacteria | 2242 |
| 1221 | Ga0495652_0267732 | 3300046529 | Bacteria | 1257 |
| 1222 | Ga0495652_0338793 | 3300046529 | Bacteria | 1081 |
| 1223 | Ga0495652_0382011 | 3300046529 | Bacteria | 1001 |
| 1224 | Ga0495652_0383544 | 3300046529 | Bacteria | 999 |
| 1225 | Ga0495654_0209825 | 3300046530 | Unclassified | 829 |
| 1226 | Ga0495654_0329971 | 3300046530 | Bacteria | 617 |
| 1227 | Ga0495640_0014255 | 3300046533 | Bacteria | 6021 |
| 1228 | Ga0495640_0027945 | 3300046533 | Bacteria | 4064 |
| 1229 | Ga0495640_0048808 | 3300046533 | Bacteria | 2922 |
| 1230 | Ga0495640_0071628 | 3300046533 | Bacteria | 2325 |
| 1231 | Ga0495640_0130972 | 3300046533 | Bacteria | 1623 |
| 1232 | Ga0495640_0182841 | 3300046533 | Bacteria | 1335 |
| 1233 | Ga0495640_0195587 | 3300046533 | Bacteria | 1284 |
| 1234 | Ga0495586_0031809 | 3300046535 | Bacteria | 2828 |
| 1235 | Ga0495587_0004074 | 3300046536 | Bacteria | 9683 |
| 1236 | Ga0495587_0005057 | 3300046536 | Bacteria | 8625 |
| 1237 | Ga0495587_0017667 | 3300046536 | Bacteria | 4429 |
| 1238 | Ga0495587_0021173 | 3300046536 | Bacteria | 4009 |
| 1239 | Ga0495587_0219467 | 3300046536 | Bacteria | 1072 |
| 1240 | Ga0495587_0305160 | 3300046536 | Unclassified | 890 |
| 1241 | Ga0495598_0008957 | 3300046537 | Unclassified | 2347 |
| 1242 | Ga0495598_0087453 | 3300046537 | Bacteria | 1010 |
| 1243 | Ga0495609_0023003 | 3300046538 | Bacteria | 2867 |
| 1244 | Ga0495609_0135281 | 3300046538 | Bacteria | 1054 |
| 1245 | Ga0495621_0004613 | 3300046539 | Bacteria | 3894 |
| 1246 | Ga0495621_0019734 | 3300046539 | Unclassified | 2204 |
| 1247 | Ga0495621_0075419 | 3300046539 | Bacteria | 1249 |
| 1248 | Ga0495597_0022020 | 3300046542 | Bacteria | 2958 |
| 1249 | Ga0495597_0091715 | 3300046542 | Bacteria | 1289 |
| 1250 | Ga0495645_0000411 | 3300046543 | Bacteria | 29443 |
| 1251 | Ga0495645_0006906 | 3300046543 | Bacteria | 7887 |
| 1252 | Ga0495645_0010435 | 3300046543 | Bacteria | 6511 |
| 1253 | Ga0495645_0010890 | 3300046543 | Bacteria | 6388 |
| 1254 | Ga0495645_0218221 | 3300046543 | Bacteria | 1284 |
| 1255 | Ga0495622_0004278 | 3300046557 | Bacteria | 6645 |
| 1256 | Ga0495622_0078279 | 3300046557 | Bacteria | 1522 |
| 1257 | Ga0495622_0108318 | 3300046557 | Bacteria | 1272 |
| 1258 | Ga0495633_0031508 | 3300046558 | Bacteria | 2569 |
| 1259 | Ga0495633_0045705 | 3300046558 | Bacteria | 2072 |
| 1260 | Ga0495667_0000399 | 3300046559 | Bacteria | 27814 |
| 1261 | Ga0495667_0003789 | 3300046559 | Bacteria | 10155 |
| 1262 | Ga0495667_0006144 | 3300046559 | Bacteria | 8130 |
| 1263 | Ga0495667_0130731 | 3300046559 | Bacteria | 1619 |
| 1264 | Ga0495667_0259461 | 3300046559 | Bacteria | 1105 |
| 1265 | Ga0495656_0026731 | 3300046615 | Unclassified | 2300 |
| 1266 | Ga0495656_0034480 | 3300046615 | Bacteria | 2073 |
| 1267 | Ga0495668_0055740 | 3300046616 | Bacteria | 2182 |
| 1268 | Ga0495668_0139956 | 3300046616 | Bacteria | 1324 |
| 1269 | Ga0495634_0031038 | 3300046642 | Bacteria | 3683 |
| 1270 | Ga0495634_0038394 | 3300046642 | Bacteria | 3266 |
| 1271 | Ga0495634_0093363 | 3300046642 | Bacteria | 1951 |
| 1272 | Ga0495634_0118730 | 3300046642 | Bacteria | 1695 |
| 1273 | Ga0495634_0164049 | 3300046642 | Bacteria | 1399 |
| 1274 | Ga0495611_0014614 | 3300046648 | Bacteria | 3356 |
| 1275 | Ga0495611_0180671 | 3300046648 | Bacteria | 986 |
| 1276 | Ga0495625_0065754 | 3300046660 | Bacteria | 2555 |
| 1277 | Ga0495625_0483772 | 3300046660 | Bacteria | 759 |
| 1278 | Ga0495635_0000211 | 3300046663 | Bacteria | 36892 |
| 1279 | Ga0495635_0001031 | 3300046663 | Bacteria | 18442 |
| 1280 | Ga0495635_0023129 | 3300046663 | Bacteria | 4330 |
| 1281 | Ga0495635_0023663 | 3300046663 | Bacteria | 4278 |
| 1282 | Ga0495635_0038006 | 3300046663 | Bacteria | 3332 |
| 1283 | Ga0495659_0008931 | 3300046664 | Bacteria | 3193 |
| 1284 | Ga0495588_0046496 | 3300046674 | Bacteria | 2226 |
| 1285 | Ga0495657_0001810 | 3300046675 | Bacteria | 18276 |
| 1286 | Ga0495657_0002321 | 3300046675 | Bacteria | 16025 |
| 1287 | Ga0495657_0141925 | 3300046675 | Bacteria | 1496 |
| 1288 | Ga0495657_0180227 | 3300046675 | Bacteria | 1297 |
| 1289 | Ga0495599_0000957 | 3300046678 | Bacteria | 16146 |
| 1290 | Ga0495599_0027152 | 3300046678 | Bacteria | 3589 |
| 1291 | Ga0495599_0031838 | 3300046678 | Bacteria | 3310 |
| 1292 | Ga0495599_0083380 | 3300046678 | Bacteria | 1996 |
| 1293 | Ga0495599_0458834 | 3300046678 | Bacteria | 754 |
| 1294 | Ga0495623_0005094 | 3300046679 | Bacteria | 8622 |
| 1295 | Ga0495623_0005834 | 3300046679 | Bacteria | 8030 |
| 1296 | Ga0495623_0013653 | 3300046679 | Bacteria | 5264 |
| 1297 | Ga0495623_0013867 | 3300046679 | Bacteria | 5225 |
| 1298 | Ga0495623_0038133 | 3300046679 | Bacteria | 3073 |
| 1299 | Ga0495646_0001814 | 3300046680 | Bacteria | 12814 |
| 1300 | Ga0495646_0004069 | 3300046680 | Bacteria | 9174 |
| 1301 | Ga0495646_0072401 | 3300046680 | Bacteria | 2027 |
| 1302 | Ga0495647_0049450 | 3300046681 | Bacteria | 1629 |
| 1303 | Ga0495647_0061242 | 3300046681 | Bacteria | 1486 |
| 1304 | Ga0495647_0252117 | 3300046681 | Bacteria | 786 |
| 1305 | Ga0495658_0026853 | 3300046683 | Bacteria | 3091 |
| 1306 | Ga0495658_0081955 | 3300046683 | Bacteria | 1895 |
| 1307 | Ga0495658_0112671 | 3300046683 | Bacteria | 1637 |
| 1308 | Ga0495658_0366583 | 3300046683 | Bacteria | 916 |
| 1309 | Ga0495669_0023843 | 3300046684 | Bacteria | 2665 |
| 1310 | Ga0495613_0008427 | 3300046689 | Bacteria | 7652 |
| 1311 | Ga0495613_0032899 | 3300046689 | Bacteria | 3853 |
| 1312 | Ga0495613_0211295 | 3300046689 | Bacteria | 1365 |
| 1313 | Ga0495624_0050047 | 3300046690 | Bacteria | 2648 |
| 1314 | Ga0495624_0495348 | 3300046690 | Bacteria | 731 |
| 1315 | Ga0495670_0380480 | 3300046691 | Bacteria | 761 |
| 1316 | Ga0495671_0129106 | 3300046692 | Bacteria | 1233 |
| 1317 | Ga0495671_0183339 | 3300046692 | Bacteria | 1017 |
| 1318 | Ga0495671_0189079 | 3300046692 | Bacteria | 1000 |
| 1319 | Ga0495649_0033966 | 3300046694 | Bacteria | 2807 |
| 1320 | Ga0495649_0135354 | 3300046694 | Bacteria | 1299 |
| 1321 | Ga0495649_0313912 | 3300046694 | Bacteria | 796 |
| 1322 | Ga0495589_0080801 | 3300046794 | Bacteria | 1581 |
| 1323 | Ga0495600_0006411 | 3300046809 | Bacteria | 7161 |
| 1324 | Ga0495600_0013832 | 3300046809 | Bacteria | 5081 |
| 1325 | Ga0495600_0019824 | 3300046809 | Bacteria | 4298 |
| 1326 | Ga0495600_0291696 | 3300046809 | Bacteria | 1031 |
| 1327 | Ga0495600_0294156 | 3300046809 | Bacteria | 1025 |
| 1328 | Ga0495660_0189023 | 3300046810 | Bacteria | 991 |
| 1329 | Ga0495581_0235415 | 3300047315 | Bacteria | 1071 |
| 1330 | Ga0495581_0423308 | 3300047315 | Bacteria | 776 |
| 1331 | Ga0495604_0002733 | 3300047317 | Bacteria | 14153 |
| 1332 | Ga0495604_0006074 | 3300047317 | Bacteria | 9585 |
| 1333 | Ga0495604_0006930 | 3300047317 | Bacteria | 8983 |
| 1334 | Ga0495604_0009592 | 3300047317 | Bacteria | 7656 |
| 1335 | Ga0495604_0010845 | 3300047317 | Bacteria | 7237 |
| 1336 | Ga0495604_0589279 | 3300047317 | Bacteria | 714 |
| 1337 | Ga0495636_0046748 | 3300047318 | Bacteria | 1806 |
| 1338 | Ga0495636_0048470 | 3300047318 | Bacteria | 1775 |
| 1339 | Ga0495674_0001693 | 3300047319 | Bacteria | 21667 |
| 1340 | Ga0495674_0013996 | 3300047319 | Bacteria | 7521 |
| 1341 | Ga0495674_0030166 | 3300047319 | Bacteria | 4933 |
| 1342 | Ga0495674_0031972 | 3300047319 | Bacteria | 4776 |
| 1343 | Ga0495674_0050926 | 3300047319 | Bacteria | 3652 |
| 1344 | Ga0495674_0055361 | 3300047319 | Bacteria | 3479 |
| 1345 | Ga0495674_0103100 | 3300047319 | Bacteria | 2426 |
| 1346 | Ga0495674_0134788 | 3300047319 | Bacteria | 2079 |
| 1347 | Ga0495674_0393229 | 3300047319 | Unclassified | 1120 |
| 1348 | Ga0495672_0037216 | 3300047320 | Bacteria | 2980 |
| 1349 | Ga0495672_0053767 | 3300047320 | Bacteria | 2357 |
| 1350 | Ga0495672_0061604 | 3300047320 | Bacteria | 2162 |
| 1351 | Ga0495672_0068356 | 3300047320 | Bacteria | 2020 |
| 1352 | Ga0495672_0088611 | 3300047320 | Bacteria | 1705 |
| 1353 | Ga0495672_0096380 | 3300047320 | Bacteria | 1613 |
| 1354 | Ga0495672_0111174 | 3300047320 | Bacteria | 1470 |
| 1355 | Ga0495672_0206936 | 3300047320 | Bacteria | 977 |
| 1356 | Ga0495672_0215598 | 3300047320 | Bacteria | 951 |
| 1357 | Ga0495676_0203139 | 3300047321 | Bacteria | 1376 |
| 1358 | Ga0495676_0247761 | 3300047321 | Bacteria | 1217 |
| 1359 | Ga0495676_0356239 | 3300047321 | Bacteria | 977 |
| 1360 | Ga0495680_0001112 | 3300047322 | Bacteria | 29712 |
| 1361 | Ga0495680_0004228 | 3300047322 | Bacteria | 13784 |
| 1362 | Ga0495680_0006158 | 3300047322 | Bacteria | 11190 |
| 1363 | Ga0495680_0021510 | 3300047322 | Bacteria | 5398 |
| 1364 | Ga0495680_0044833 | 3300047322 | Bacteria | 3494 |
| 1365 | Ga0495680_0072530 | 3300047322 | Bacteria | 2618 |
| 1366 | Ga0495680_0308760 | 3300047322 | Bacteria | 1109 |
| 1367 | Ga0495680_0310922 | 3300047322 | Bacteria | 1104 |
| 1368 | Ga0495680_0537376 | 3300047322 | Bacteria | 789 |
| 1369 | Ga0495683_0037174 | 3300047323 | Bacteria | 2469 |
| 1370 | Ga0495683_0203472 | 3300047323 | Bacteria | 891 |
| 1371 | Ga0495687_010582 | 3300047443 | Bacteria | 5050 |
| 1372 | Ga0495687_099324 | 3300047443 | Bacteria | 1096 |
| 1373 | Ga0495675_0001324 | 3300047444 | Bacteria | 15012 |
| 1374 | Ga0495675_0007639 | 3300047444 | Bacteria | 6669 |
| 1375 | Ga0495675_0025334 | 3300047444 | Bacteria | 3782 |
| 1376 | Ga0495675_0083197 | 3300047444 | Bacteria | 2014 |
| 1377 | Ga0495675_0184389 | 3300047444 | Bacteria | 1276 |
| 1378 | Ga0495684_0015971 | 3300047471 | Bacteria | 5782 |
| 1379 | Ga0495684_0020317 | 3300047471 | Bacteria | 5116 |
| 1380 | Ga0495684_0029872 | 3300047471 | Bacteria | 4184 |
| 1381 | Ga0495684_0037641 | 3300047471 | Bacteria | 3711 |
| 1382 | Ga0495684_0266704 | 3300047471 | Bacteria | 1240 |
| 1383 | Ga0495686_0034271 | 3300047472 | Bacteria | 3271 |
| 1384 | Ga0495686_0220937 | 3300047472 | Bacteria | 1078 |
| 1385 | Ga0495593_0002923 | 3300047673 | Bacteria | 10287 |
| 1386 | Ga0495593_0036009 | 3300047673 | Bacteria | 2685 |
| 1387 | Ga0495593_0127282 | 3300047673 | Bacteria | 1294 |
| 1388 | Ga0495602_0000965 | 3300048088 | Bacteria | 27818 |
| 1389 | Ga0495602_0006595 | 3300048088 | Bacteria | 12164 |
| 1390 | Ga0495602_0008570 | 3300048088 | Bacteria | 10678 |
| 1391 | Ga0495602_0041931 | 3300048088 | Bacteria | 4175 |
| 1392 | Ga0495602_0213520 | 3300048088 | Bacteria | 1462 |
| 1393 | Ga0495602_0307064 | 3300048088 | Bacteria | 1159 |
| 1394 | Ga0495615_0001775 | 3300048090 | Plasmid | 3296 |
| 1395 | Ga0495615_0002752 | 3300048090 | Bacteria | 2857 |
| 1396 | Ga0495615_0008706 | 3300048090 | Bacteria | 1972 |
| 1397 | Ga0495615_0050964 | 3300048090 | Bacteria | 1065 |
| 1398 | Ga0495626_0019232 | 3300048091 | Bacteria | 3416 |
| 1399 | Ga0496100_0002382 | 3300048903 | Bacteria | 9515 |
| 1400 | Ga0496100_0014232 | 3300048903 | Bacteria | 4614 |
| 1401 | Ga0496100_0047643 | 3300048903 | Bacteria | 2763 |
| 1402 | Ga0496100_0057810 | 3300048903 | Bacteria | 2542 |
| 1403 | Ga0496100_0111412 | 3300048903 | Bacteria | 1902 |
| 1404 | Ga0496100_0257738 | 3300048903 | Bacteria | 1292 |
| 1405 | Ga0496100_0264505 | 3300048903 | Bacteria | 1276 |
| 1406 | Ga0496100_0305837 | 3300048903 | Bacteria | 1191 |
| 1407 | Ga0496101_0006609 | 3300048904 | Bacteria | 7470 |
| 1408 | Ga0496101_0012677 | 3300048904 | Bacteria | 5634 |
| 1409 | Ga0496101_0022688 | 3300048904 | Bacteria | 4324 |
| 1410 | Ga0496101_0047225 | 3300048904 | Bacteria | 3090 |
| 1411 | Ga0496101_0163170 | 3300048904 | Bacteria | 1710 |
| 1412 | Ga0496101_0641045 | 3300048904 | Bacteria | 839 |
| 1413 | Ga0496102_0010844 | 3300048905 | Bacteria | 7845 |
| 1414 | Ga0496102_0020999 | 3300048905 | Bacteria | 5773 |
| 1415 | Ga0496102_0045634 | 3300048905 | Bacteria | 3979 |
| 1416 | Ga0496102_0046713 | 3300048905 | Bacteria | 3932 |
| 1417 | Ga0496102_0082115 | 3300048905 | Bacteria | 2972 |
| 1418 | Ga0496102_0105735 | 3300048905 | Bacteria | 2619 |
| 1419 | Ga0496102_0304428 | 3300048905 | Bacteria | 1502 |
| 1420 | Ga0496102_0342681 | 3300048905 | Bacteria | 1407 |
| 1421 | Ga0496102_0585870 | 3300048905 | Bacteria | 1038 |
| 1422 | Ga0496103_0001419 | 3300048906 | Bacteria | 16061 |
| 1423 | Ga0496103_0002062 | 3300048906 | Bacteria | 12860 |
| 1424 | Ga0496103_0023756 | 3300048906 | Bacteria | 3696 |
| 1425 | Ga0496103_0051560 | 3300048906 | Bacteria | 2547 |
| 1426 | Ga0496103_0072196 | 3300048906 | Bacteria | 2161 |
| 1427 | Ga0496103_0113002 | 3300048906 | Bacteria | 1726 |
| 1428 | Ga0496103_0241484 | 3300048906 | Bacteria | 1162 |
| 1429 | Ga0496104_0000140 | 3300048907 | Bacteria | 67259 |
| 1430 | Ga0496104_0004452 | 3300048907 | Bacteria | 12203 |
| 1431 | Ga0496104_0008421 | 3300048907 | Bacteria | 9169 |
| 1432 | Ga0496104_0039302 | 3300048907 | Bacteria | 4430 |
| 1433 | Ga0496104_0058499 | 3300048907 | Bacteria | 3648 |
| 1434 | Ga0496104_0071910 | 3300048907 | Bacteria | 3289 |
| 1435 | Ga0496104_0090536 | 3300048907 | Bacteria | 2923 |
| 1436 | Ga0496104_0111274 | 3300048907 | Bacteria | 2625 |
| 1437 | Ga0496104_0143567 | 3300048907 | Bacteria | 2293 |
| 1438 | Ga0496104_0161654 | 3300048907 | Bacteria | 2148 |
| 1439 | Ga0496104_0182846 | 3300048907 | Bacteria | 2007 |
| 1440 | Ga0496104_0383469 | 3300048907 | Bacteria | 1318 |
| 1441 | Ga0496104_0463606 | 3300048907 | Bacteria | 1178 |
| 1442 | Ga0496104_0465559 | 3300048907 | Bacteria | 1175 |
| 1443 | Ga0496104_0584170 | 3300048907 | Bacteria | 1027 |
| 1444 | Ga0496105_0000043 | 3300048908 | Bacteria | 114348 |
| 1445 | Ga0496105_0001390 | 3300048908 | Bacteria | 16994 |
| 1446 | Ga0496105_0006096 | 3300048908 | Bacteria | 9227 |
| 1447 | Ga0496105_0006732 | 3300048908 | Bacteria | 8837 |
| 1448 | Ga0496105_0025833 | 3300048908 | Bacteria | 4784 |
| 1449 | Ga0496105_0066445 | 3300048908 | Bacteria | 2977 |
| 1450 | Ga0496105_0068744 | 3300048908 | Bacteria | 2926 |
| 1451 | Ga0496105_0210178 | 3300048908 | Bacteria | 1586 |
| 1452 | Ga0496105_0232880 | 3300048908 | Bacteria | 1496 |
| 1453 | Ga0496105_0351797 | 3300048908 | Bacteria | 1176 |
| 1454 | Ga0496105_0359571 | 3300048908 | Bacteria | 1161 |
| 1455 | Ga0496105_0461199 | 3300048908 | Bacteria | 1002 |
| 1456 | Ga0496106_0005076 | 3300048909 | Bacteria | 9744 |
| 1457 | Ga0496106_0006330 | 3300048909 | Bacteria | 8767 |
| 1458 | Ga0496106_0006503 | 3300048909 | Bacteria | 8654 |
| 1459 | Ga0496106_0014137 | 3300048909 | Bacteria | 5896 |
| 1460 | Ga0496106_0035723 | 3300048909 | Bacteria | 3716 |
| 1461 | Ga0496106_0107271 | 3300048909 | Bacteria | 2172 |
| 1462 | Ga0496106_0132066 | 3300048909 | Bacteria | 1959 |
| 1463 | Ga0496106_0188677 | 3300048909 | Bacteria | 1638 |
| 1464 | Ga0496106_0332789 | 3300048909 | Bacteria | 1219 |
| 1465 | Ga0496106_0909481 | 3300048909 | Bacteria | 694 |
| 1466 | Ga0496107_0006319 | 3300048910 | Bacteria | 8142 |
| 1467 | Ga0496107_0014188 | 3300048910 | Bacteria | 5579 |
| 1468 | Ga0496107_0017343 | 3300048910 | Bacteria | 5063 |
| 1469 | Ga0496107_0019745 | 3300048910 | Bacteria | 4756 |
| 1470 | Ga0496107_0034155 | 3300048910 | Bacteria | 3641 |
| 1471 | Ga0496107_0065142 | 3300048910 | Bacteria | 2641 |
| 1472 | Ga0496107_0210274 | 3300048910 | Bacteria | 1446 |
| 1473 | Ga0496107_0420564 | 3300048910 | Bacteria | 993 |
| 1474 | Ga0496107_0665198 | 3300048910 | Bacteria | 767 |
| 1475 | Ga0496108_0000449 | 3300048911 | Bacteria | 32814 |
| 1476 | Ga0496108_0000845 | 3300048911 | Bacteria | 23854 |
| 1477 | Ga0496108_0001227 | 3300048911 | Bacteria | 20117 |
| 1478 | Ga0496108_0018642 | 3300048911 | Bacteria | 5686 |
| 1479 | Ga0496108_0022690 | 3300048911 | Bacteria | 5162 |
| 1480 | Ga0496108_0067630 | 3300048911 | Bacteria | 3014 |
| 1481 | Ga0496108_0115483 | 3300048911 | Bacteria | 2299 |
| 1482 | Ga0496108_0296107 | 3300048911 | Bacteria | 1409 |
| 1483 | Ga0496108_0466440 | 3300048911 | Bacteria | 1103 |
| 1484 | Ga0496108_0471213 | 3300048911 | Bacteria | 1097 |
| 1485 | Ga0496108_0624047 | 3300048911 | Bacteria | 938 |
| 1486 | Ga0496109_0000592 | 3300048912 | Bacteria | 30336 |
| 1487 | Ga0496109_0000896 | 3300048912 | Bacteria | 24846 |
| 1488 | Ga0496109_0001611 | 3300048912 | Bacteria | 18840 |
| 1489 | Ga0496109_0002747 | 3300048912 | Bacteria | 14762 |
| 1490 | Ga0496109_0052497 | 3300048912 | Bacteria | 3716 |
| 1491 | Ga0496109_0159366 | 3300048912 | Bacteria | 2114 |
| 1492 | Ga0496109_0170979 | 3300048912 | Bacteria | 2038 |
| 1493 | Ga0496109_0271921 | 3300048912 | Bacteria | 1596 |
| 1494 | Ga0496109_0514765 | 3300048912 | Bacteria | 1129 |
| 1495 | Ga0496109_0605327 | 3300048912 | Bacteria | 1032 |
| 1496 | Ga0496109_0728453 | 3300048912 | Bacteria | 929 |
| 1497 | Ga0496110_0025034 | 3300048913 | Bacteria | 5095 |
| 1498 | Ga0496110_0040389 | 3300048913 | Bacteria | 4066 |
| 1499 | Ga0496110_0054663 | 3300048913 | Bacteria | 3512 |
| 1500 | Ga0496110_0060173 | 3300048913 | Bacteria | 3349 |
| 1501 | Ga0496110_0068694 | 3300048913 | Bacteria | 3136 |
| 1502 | Ga0496110_0117351 | 3300048913 | Bacteria | 2396 |
| 1503 | Ga0496110_0156060 | 3300048913 | Bacteria | 2067 |
| 1504 | Ga0496110_0181993 | 3300048913 | Bacteria | 1908 |
| 1505 | Ga0496110_0213957 | 3300048913 | Bacteria | 1752 |
| 1506 | Ga0496110_0325869 | 3300048913 | Bacteria | 1399 |
| 1507 | Ga0496110_0460770 | 3300048913 | Bacteria | 1158 |
| 1508 | Ga0496110_0572726 | 3300048913 | Bacteria | 1025 |
| 1509 | Ga0496111_0001189 | 3300048914 | Bacteria | 14505 |
| 1510 | Ga0496111_0001965 | 3300048914 | Bacteria | 12213 |
| 1511 | Ga0496111_0041773 | 3300048914 | Bacteria | 3291 |
| 1512 | Ga0496111_0048896 | 3300048914 | Bacteria | 3048 |
| 1513 | Ga0496111_0092622 | 3300048914 | Bacteria | 2215 |
| 1514 | Ga0496111_0148066 | 3300048914 | Bacteria | 1741 |
| 1515 | Ga0496111_0212255 | 3300048914 | Bacteria | 1438 |
| 1516 | Ga0496111_0349793 | 3300048914 | Bacteria | 1094 |
| 1517 | Ga0496112_0001178 | 3300048915 | Bacteria | 19598 |
| 1518 | Ga0496112_0002006 | 3300048915 | Bacteria | 16103 |
| 1519 | Ga0496112_0010720 | 3300048915 | Bacteria | 8333 |
| 1520 | Ga0496112_0014863 | 3300048915 | Bacteria | 7241 |
| 1521 | Ga0496112_0017698 | 3300048915 | Bacteria | 6704 |
| 1522 | Ga0496112_0030697 | 3300048915 | Bacteria | 5204 |
| 1523 | Ga0496112_0345767 | 3300048915 | Bacteria | 1430 |
| 1524 | Ga0496112_0432434 | 3300048915 | Bacteria | 1254 |
| 1525 | Ga0496112_0611316 | 3300048915 | Bacteria | 1021 |
| 1526 | Ga0496112_0737280 | 3300048915 | Bacteria | 912 |
| 1527 | Ga0496113_0000507 | 3300048916 | Bacteria | 19242 |
| 1528 | Ga0496113_0000911 | 3300048916 | Bacteria | 15617 |
| 1529 | Ga0496113_0001342 | 3300048916 | Bacteria | 13620 |
| 1530 | Ga0496113_0016467 | 3300048916 | Bacteria | 5108 |
| 1531 | Ga0496113_0042838 | 3300048916 | Bacteria | 3346 |
| 1532 | Ga0496113_0932551 | 3300048916 | Bacteria | 686 |
| 1533 | Ga0496114_0003476 | 3300048917 | Bacteria | 12094 |
| 1534 | Ga0496114_0007914 | 3300048917 | Bacteria | 8413 |
| 1535 | Ga0496114_0054340 | 3300048917 | Bacteria | 3340 |
| 1536 | Ga0496114_0154390 | 3300048917 | Bacteria | 1992 |
| 1537 | Ga0496114_0193357 | 3300048917 | Bacteria | 1780 |
| 1538 | Ga0496114_0222469 | 3300048917 | Bacteria | 1657 |
| 1539 | Ga0496114_0354882 | 3300048917 | Bacteria | 1297 |
| 1540 | Ga0496115_0001082 | 3300048918 | Bacteria | 19741 |
| 1541 | Ga0496115_0015997 | 3300048918 | Bacteria | 5704 |
| 1542 | Ga0496115_0030182 | 3300048918 | Bacteria | 4263 |
| 1543 | Ga0496115_0033375 | 3300048918 | Bacteria | 4064 |
| 1544 | Ga0496115_0056942 | 3300048918 | Bacteria | 3143 |
| 1545 | Ga0496115_0067466 | 3300048918 | Bacteria | 2893 |
| 1546 | Ga0496115_0082658 | 3300048918 | Bacteria | 2617 |
| 1547 | Ga0496115_0153536 | 3300048918 | Bacteria | 1901 |
| 1548 | Ga0496115_0211374 | 3300048918 | Bacteria | 1602 |
| 1549 | Ga0496115_0281254 | 3300048918 | Bacteria | 1366 |
| 1550 | Ga0496115_0411480 | 3300048918 | Bacteria | 1096 |
| 1551 | Ga0496115_0593531 | 3300048918 | Bacteria | 881 |
| 1552 | Ga0496115_0793748 | 3300048918 | Bacteria | 737 |
| 1553 | Ga0496115_0795474 | 3300048918 | Bacteria | 736 |
| 1554 | Ga0496116_0172725 | 3300048919 | Bacteria | 1169 |
| 1555 | Ga0496117_0039541 | 3300048920 | Bacteria | 3480 |
| 1556 | Ga0496117_0284201 | 3300048920 | Bacteria | 884 |
| 1557 | Ga0496118_0003113 | 3300048921 | Bacteria | 21268 |
| 1558 | Ga0496118_0012566 | 3300048921 | Bacteria | 8109 |
| 1559 | Ga0496119_0024068 | 3300048922 | Bacteria | 4297 |
| 1560 | Ga0496119_0111262 | 3300048922 | Bacteria | 1519 |
| 1561 | Ga0496119_0178687 | 3300048922 | Bacteria | 1115 |
| 1562 | Ga0496120_0116930 | 3300048923 | Bacteria | 1384 |
| 1563 | Ga0496120_0294849 | 3300048923 | Bacteria | 745 |
| 1564 | Ga0496120_0374167 | 3300048923 | Bacteria | 635 |
| 1565 | Ga0496121_0000886 | 3300048924 | Bacteria | 54049 |
| 1566 | Ga0496121_0002017 | 3300048924 | Bacteria | 32207 |
| 1567 | Ga0496121_0017513 | 3300048924 | Bacteria | 7311 |
| 1568 | Ga0496121_0049748 | 3300048924 | Bacteria | 3549 |
| 1569 | Ga0496121_0215718 | 3300048924 | Bacteria | 1356 |
| 1570 | Ga0496121_0255633 | 3300048924 | Bacteria | 1212 |
| 1571 | Ga0496122_0071623 | 3300048925 | Bacteria | 2469 |
| 1572 | Ga0496124_0013881 | 3300048927 | Bacteria | 7832 |
| 1573 | Ga0496124_0144905 | 3300048927 | Bacteria | 1870 |
| 1574 | Ga0496124_0156452 | 3300048927 | Bacteria | 1781 |
| 1575 | Ga0496125_0018812 | 3300048928 | Bacteria | 6543 |
| 1576 | Ga0496125_0034757 | 3300048928 | Bacteria | 4436 |
| 1577 | Ga0496125_0050051 | 3300048928 | Bacteria | 3464 |
| 1578 | Ga0496125_0181019 | 3300048928 | Bacteria | 1404 |
| 1579 | Ga0496126_0017266 | 3300048929 | Bacteria | 7190 |
| 1580 | Ga0496126_0044034 | 3300048929 | Bacteria | 4113 |
| 1581 | Ga0496126_0076736 | 3300048929 | Bacteria | 2964 |
| 1582 | Ga0496126_0166185 | 3300048929 | Bacteria | 1883 |
| 1583 | Ga0496126_0963885 | 3300048929 | Bacteria | 642 |
| 1584 | Ga0501309_024232 | 3300049129 | Bacteria | 866 |
| 1585 | Ga0495678_037461 | 3300049459 | Bacteria | 1970 |
| 1586 | Ga0495682_0045975 | 3300049460 | Bacteria | 1594 |
| 1587 | Ga0495682_0082909 | 3300049460 | Bacteria | 1153 |
| 1588 | Ga0501033_0134455 | 3300049570 | Bacteria | 1790 |
| 1589 | Ga0501033_0164043 | 3300049570 | Bacteria | 1598 |
| 1590 | Ga0501034_0073120 | 3300049571 | Bacteria | 3437 |
| 1591 | Ga0501034_0675434 | 3300049571 | Bacteria | 933 |
| 1592 | Ga0501036_0063664 | 3300049572 | Bacteria | 3122 |
| 1593 | Ga0501036_0200803 | 3300049572 | Bacteria | 1677 |
| 1594 | Ga0501036_0448230 | 3300049572 | Bacteria | 1075 |
| 1595 | Ga0501037_0272014 | 3300049573 | Bacteria | 1182 |
| 1596 | Ga0501038_0093943 | 3300049574 | Bacteria | 2508 |
| 1597 | Ga0501038_0375293 | 3300049574 | Bacteria | 1104 |
| 1598 | Ga0501038_0410248 | 3300049574 | Bacteria | 1047 |
| 1599 | Ga0501039_0144968 | 3300049575 | Bacteria | 1866 |
| 1600 | Ga0501041_0043056 | 3300049577 | Bacteria | 2745 |
| 1601 | Ga0501042_0393614 | 3300049578 | Bacteria | 1004 |
| 1602 | Ga0501043_0584704 | 3300049579 | Bacteria | 826 |
| 1603 | Ga0501046_0026812 | 3300049580 | Bacteria | 4706 |
| 1604 | Ga0501046_0249702 | 3300049580 | Bacteria | 1306 |
| 1605 | Ga0501047_0108340 | 3300049581 | Bacteria | 2660 |
| 1606 | Ga0501047_0701833 | 3300049581 | Bacteria | 829 |
| 1607 | Ga0501048_0333066 | 3300049582 | Bacteria | 1082 |
| 1608 | Ga0501048_0395781 | 3300049582 | Bacteria | 987 |
| 1609 | Ga0501048_0695419 | 3300049582 | Bacteria | 730 |
| 1610 | Ga0501067_0029147 | 3300049583 | Bacteria | 3059 |
| 1611 | Ga0501068_0336607 | 3300049584 | Bacteria | 969 |
| 1612 | Ga0501070_0049621 | 3300049586 | Bacteria | 3485 |
| 1613 | Ga0501071_0101042 | 3300049587 | Bacteria | 2126 |
| 1614 | Ga0501071_0175580 | 3300049587 | Bacteria | 1605 |
| 1615 | Ga0501071_0227380 | 3300049587 | Bacteria | 1405 |
| 1616 | Ga0501071_0964315 | 3300049587 | Bacteria | 658 |
| 1617 | Ga0501072_0008000 | 3300049588 | Bacteria | 8023 |
| 1618 | Ga0501072_0017905 | 3300049588 | Bacteria | 5448 |
| 1619 | Ga0501072_0352048 | 3300049588 | Bacteria | 1169 |
| 1620 | Ga0501073_0074697 | 3300049589 | Bacteria | 2360 |
| 1621 | Ga0501073_0405085 | 3300049589 | Bacteria | 942 |
| 1622 | Ga0501073_0639138 | 3300049589 | Unclassified | 735 |
| 1623 | Ga0501075_0020214 | 3300049591 | Bacteria | 4839 |
| 1624 | Ga0501075_0051469 | 3300049591 | Bacteria | 3097 |
| 1625 | Ga0501075_0100730 | 3300049591 | Bacteria | 2194 |
| 1626 | Ga0501075_0398654 | 3300049591 | Bacteria | 1049 |
| 1627 | Ga0501076_0026146 | 3300049592 | Bacteria | 4519 |
| 1628 | Ga0501076_0056326 | 3300049592 | Bacteria | 3120 |
| 1629 | Ga0501076_0090946 | 3300049592 | Bacteria | 2455 |
| 1630 | Ga0501076_0232587 | 3300049592 | Bacteria | 1507 |
| 1631 | Ga0501076_0344665 | 3300049592 | Bacteria | 1223 |
| 1632 | Ga0501076_0493584 | 3300049592 | Bacteria | 1009 |
| 1633 | Ga0501076_0611521 | 3300049592 | Unclassified | 899 |
| 1634 | Ga0501077_0068698 | 3300049593 | Bacteria | 2246 |
| 1635 | Ga0501077_0093371 | 3300049593 | Bacteria | 1907 |
| 1636 | Ga0501077_0589818 | 3300049593 | Bacteria | 714 |
| 1637 | Ga0501077_0622669 | 3300049593 | Bacteria | 693 |
| 1638 | Ga0501079_0022862 | 3300049741 | Bacteria | 4799 |
| 1639 | Ga0501079_0129953 | 3300049741 | Bacteria | 1960 |
| 1640 | Ga0501079_0139630 | 3300049741 | Unclassified | 1887 |
| 1641 | Ga0501079_0350733 | 3300049741 | Bacteria | 1156 |
| 1642 | Ga0501079_0617329 | 3300049741 | Bacteria | 853 |
| 1643 | Ga0501079_1146054 | 3300049741 | Bacteria | 613 |
| 1644 | Ga0501080_0245615 | 3300049742 | Bacteria | 1633 |
| 1645 | Ga0501080_0545869 | 3300049742 | Bacteria | 1033 |
| 1646 | Ga0501081_0081615 | 3300049743 | Bacteria | 2264 |
| 1647 | Ga0501081_0151462 | 3300049743 | Bacteria | 1666 |
| 1648 | Ga0501081_0281312 | 3300049743 | Unclassified | 1218 |
| 1649 | Ga0501081_0282723 | 3300049743 | Bacteria | 1215 |
| 1650 | Ga0501081_0378489 | 3300049743 | Bacteria | 1046 |
| 1651 | Ga0501081_0433568 | 3300049743 | Bacteria | 975 |
| 1652 | Ga0501081_0728988 | 3300049743 | Bacteria | 745 |
| 1653 | Ga0501081_0880596 | 3300049743 | Unclassified | 675 |
| 1654 | Ga0501083_0003903 | 3300049744 | Bacteria | 10472 |
| 1655 | Ga0501083_0013908 | 3300049744 | Bacteria | 5627 |
| 1656 | Ga0501083_0115837 | 3300049744 | Bacteria | 1759 |
| 1657 | Ga0501083_0247446 | 3300049744 | Bacteria | 1161 |
| 1658 | Ga0501035_0182194 | 3300049822 | Bacteria | 1809 |
| 1659 | Ga0501044_0029667 | 3300049823 | Bacteria | 5766 |
| 1660 | Ga0501044_1100295 | 3300049823 | Bacteria | 664 |
| 1661 | Ga0501045_0033295 | 3300049824 | Bacteria | 3737 |
| 1662 | Ga0501045_0228042 | 3300049824 | Bacteria | 1387 |
| 1663 | Ga0501045_0369617 | 3300049824 | Bacteria | 1067 |
| 1664 | nmdc:mga03683_119971_c1 | 3300050489 | Bacteria | 1169 |
| 1665 | nmdc:mga03683_274542_c1 | 3300050489 | Bacteria | 787 |
| 1666 | nmdc:mga03683_34584_c1 | 3300050489 | Bacteria | 2045 |
| 1667 | nmdc:mga03683_4641_c1 | 3300050489 | Bacteria | 4576 |
| 1668 | nmdc:mga03683_78970_c1 | 3300050489 | Bacteria | 1418 |
| 1669 | nmdc:mga03n38_10463_c1 | 3300050490 | Bacteria | 3413 |
| 1670 | nmdc:mga03n38_170575_c1 | 3300050490 | Unclassified | 1108 |
| 1671 | nmdc:mga03n38_349289_c1 | 3300050490 | Bacteria | 805 |
| 1672 | nmdc:mga03n38_45781_c1 | 3300050490 | Bacteria | 1928 |
| 1673 | nmdc:mga03n38_59539_c1 | 3300050490 | Bacteria | 1734 |
| 1674 | nmdc:mga03n38_6717_c1 | 3300050490 | Bacteria | 4021 |
| 1675 | nmdc:mga03n38_68457_c1 | 3300050490 | Bacteria | 1637 |
| 1676 | nmdc:mga00v17_207358_c1 | 3300050491 | Bacteria | 1268 |
| 1677 | nmdc:mga00v17_274513_c1 | 3300050491 | Bacteria | 1094 |
| 1678 | nmdc:mga00v17_429911_c1 | 3300050491 | Bacteria | 858 |
| 1679 | nmdc:mga00v17_43255_c1 | 3300050491 | Bacteria | 2712 |
| 1680 | nmdc:mga00v17_59880_c1 | 3300050491 | Bacteria | 2338 |
| 1681 | nmdc:mga0yw44_11255_c1 | 3300050492 | Unclassified | 4608 |
| 1682 | nmdc:mga0yw44_118837_c1 | 3300050492 | Bacteria | 1701 |
| 1683 | nmdc:mga0yw44_150798_c1 | 3300050492 | Bacteria | 1516 |
| 1684 | nmdc:mga0yw44_198523_c1 | 3300050492 | Bacteria | 1324 |
| 1685 | nmdc:mga0yw44_255925_c1 | 3300050492 | Bacteria | 1166 |
| 1686 | nmdc:mga0yw44_28117_c1 | 3300050492 | Plasmid | 3232 |
| 1687 | nmdc:mga0yw44_281998_c1 | 3300050492 | Bacteria | 1111 |
| 1688 | nmdc:mga0yw44_30505_c1 | 3300050492 | Plasmid | 3125 |
| 1689 | nmdc:mga0yw44_30604_c1 | 3300050492 | Bacteria | 3122 |
| 1690 | nmdc:mga0yw44_331605_c1 | 3300050492 | Bacteria | 1023 |
| 1691 | nmdc:mga0yw44_43345_c1 | 3300050492 | Bacteria | 2686 |
| 1692 | nmdc:mga0yw44_4648_c1 | 3300050492 | Bacteria | 6341 |
| 1693 | nmdc:mga0yw44_517042_c1 | 3300050492 | Bacteria | 810 |
| 1694 | nmdc:mga0yw44_78004_c1 | 3300050492 | Bacteria | 2071 |
| 1695 | nmdc:mga0k408_122033_c1 | 3300050493 | Bacteria | 1544 |
| 1696 | nmdc:mga0k408_207440_c1 | 3300050493 | Bacteria | 1170 |
| 1697 | nmdc:mga0k408_31601_c1 | 3300050493 | Bacteria | 3024 |
| 1698 | nmdc:mga0k408_383483_c1 | 3300050493 | Bacteria | 837 |
| 1699 | nmdc:mga0k408_54735_c1 | 3300050493 | Bacteria | 2312 |
| 1700 | nmdc:mga0k408_78564_c1 | 3300050493 | Bacteria | 1931 |
| 1701 | nmdc:mga0k408_8031_c1 | 3300050493 | Bacteria | 5657 |
| 1702 | nmdc:mga0k408_82626_c1 | 3300050493 | Bacteria | 1882 |
| 1703 | nmdc:mga0k408_91669_c1 | 3300050493 | Bacteria | 1292 |
| 1704 | nmdc:mga0k408_92254_c1 | 3300050493 | Bacteria | 1780 |
| 1705 | nmdc:mga06z11_102584_c1 | 3300050494 | Bacteria | 1572 |
| 1706 | nmdc:mga06z11_106571_c1 | 3300050494 | Bacteria | 1546 |
| 1707 | nmdc:mga06z11_121587_c1 | 3300050494 | Bacteria | 1457 |
| 1708 | nmdc:mga06z11_124756_c1 | 3300050494 | Bacteria | 1440 |
| 1709 | nmdc:mga06z11_214875_c1 | 3300050494 | Bacteria | 1122 |
| 1710 | nmdc:mga06z11_276345_c1 | 3300050494 | Bacteria | 994 |
| 1711 | nmdc:mga06z11_34496_c1 | 3300050494 | Bacteria | 2485 |
| 1712 | nmdc:mga06z11_44322_c1 | 3300050494 | Unclassified | 2243 |
| 1713 | nmdc:mga06z11_50325_c1 | 3300050494 | Bacteria | 2129 |
| 1714 | nmdc:mga06z11_525023_c1 | 3300050494 | Bacteria | 718 |
| 1715 | nmdc:mga06z11_64594_c1 | 3300050494 | Unclassified | 1919 |
| 1716 | nmdc:mga06z11_75107_c1 | 3300050494 | Bacteria | 1799 |
| 1717 | nmdc:mga04h51_107365_c1 | 3300050495 | Bacteria | 1025 |
| 1718 | nmdc:mga04h51_107883_c1 | 3300050495 | Bacteria | 1023 |
| 1719 | nmdc:mga04h51_1239_c1 | 3300050495 | Bacteria | 5904 |
| 1720 | nmdc:mga04h51_1563_c1 | 3300050495 | Bacteria | 5327 |
| 1721 | nmdc:mga04h51_23183_c1 | 3300050495 | Bacteria | 1888 |
| 1722 | nmdc:mga04h51_255299_c1 | 3300050495 | Unclassified | 704 |
| 1723 | nmdc:mga04h51_42321_c1 | 3300050495 | Bacteria | 1493 |
| 1724 | nmdc:mga04h51_67446_c1 | 3300050495 | Bacteria | 1241 |
| 1725 | nmdc:mga07m45_15871_c1 | 3300050496 | Bacteria | 4027 |
| 1726 | nmdc:mga07m45_215588_c2 | 3300050496 | Bacteria | 909 |
| 1727 | nmdc:mga07m45_23262_c1 | 3300050496 | Bacteria | 3386 |
| 1728 | nmdc:mga07m45_349640_c1 | 3300050496 | Bacteria | 859 |
| 1729 | nmdc:mga07m45_431249_c1 | 3300050496 | Bacteria | 765 |
| 1730 | nmdc:mga07m45_587041_c1 | 3300050496 | Bacteria | 644 |
| 1731 | nmdc:mga05p37_1180728_c1 | 3300050507 | Bacteria | 793 |
| 1732 | nmdc:mga05p37_118439_c1 | 3300050507 | Bacteria | 3254 |
| 1733 | nmdc:mga05p37_156170_c1 | 3300050507 | Bacteria | 2788 |
| 1734 | nmdc:mga05p37_22407_c1 | 3300050507 | Bacteria | 7662 |
| 1735 | nmdc:mga05p37_413180_c1 | 3300050507 | Bacteria | 1572 |
| 1736 | nmdc:mga05p37_481_c1 | 3300050507 | Bacteria | 43634 |
| 1737 | nmdc:mga05p37_56162_c1 | 3300050507 | Bacteria | 4847 |
| 1738 | nmdc:mga05p37_89411_c1 | 3300050507 | Bacteria | 3795 |
| 1739 | nmdc:mga05p37_91321_c1 | 3300050507 | Unclassified | 3205 |
| 1740 | nmdc:mga09592_1486_c1 | 3300050508 | Bacteria | 18853 |
| 1741 | nmdc:mga09592_183634_c1 | 3300050508 | Bacteria | 1809 |
| 1742 | nmdc:mga09592_211036_c1 | 3300050508 | Bacteria | 1682 |
| 1743 | nmdc:mga09592_359431_c1 | 3300050508 | Bacteria | 1260 |
| 1744 | nmdc:mga0qj67_111_c1 | 3300050509 | Bacteria | 53806 |
| 1745 | nmdc:mga0qj67_194899_c1 | 3300050509 | Bacteria | 1646 |
| 1746 | nmdc:mga0qj67_42686_c1 | 3300050509 | Bacteria | 3570 |
| 1747 | nmdc:mga0qj67_511437_c1 | 3300050509 | Bacteria | 965 |
| 1748 | nmdc:mga0qj67_545_c1 | 3300050509 | Bacteria | 25640 |
| 1749 | nmdc:mga06r32_1300867_c1 | 3300050510 | Bacteria | 671 |
| 1750 | nmdc:mga06r32_158652_c1 | 3300050510 | Bacteria | 2244 |
| 1751 | nmdc:mga06r32_16404_c1 | 3300050510 | Bacteria | 6750 |
| 1752 | nmdc:mga06r32_32_c1 | 3300050510 | Bacteria | 83882 |
| 1753 | nmdc:mga06r32_461652_c1 | 3300050510 | Bacteria | 1249 |
| 1754 | nmdc:mga06r32_596492_c1 | 3300050510 | Bacteria | 1076 |
| 1755 | nmdc:mga06r32_723428_c1 | 3300050510 | Bacteria | 960 |
| 1756 | nmdc:mga08y16_233645_c1 | 3300050511 | Bacteria | 1901 |
| 1757 | nmdc:mga08y16_268625_c1 | 3300050511 | Bacteria | 1761 |
| 1758 | nmdc:mga08y16_29056_c1 | 3300050511 | Bacteria | 5827 |
| 1759 | nmdc:mga08y16_315591_c1 | 3300050511 | Bacteria | 1610 |
| 1760 | nmdc:mga08y16_37_c1 | 3300050511 | Bacteria | 150340 |
| 1761 | nmdc:mga08y16_50185_c1 | 3300050511 | Bacteria | 4366 |
| 1762 | nmdc:mga08y16_53825_c1 | 3300050511 | Bacteria | 4206 |
| 1763 | nmdc:mga08y16_73437_c1 | 3300050511 | Unclassified | 3564 |
| 1764 | nmdc:mga08y16_7415_c1 | 3300050511 | Bacteria | 11491 |
| 1765 | nmdc:mga08y16_975869_c1 | 3300050511 | Bacteria | 829 |
| 1766 | nmdc:mga08y16_983593_c1 | 3300050511 | Bacteria | 825 |
| 1767 | nmdc:mga0n895_129713_c1 | 3300050512 | Bacteria | 2546 |
| 1768 | nmdc:mga0n895_197525_c1 | 3300050512 | Bacteria | 2043 |
| 1769 | nmdc:mga0n895_21007_c1 | 3300050512 | Bacteria | 6099 |
| 1770 | nmdc:mga0n895_30774_c1 | 3300050512 | Bacteria | 5133 |
| 1771 | nmdc:mga0rr50_132058_c1 | 3300050513 | Bacteria | 2000 |
| 1772 | nmdc:mga0rr50_182900_c1 | 3300050513 | Bacteria | 1714 |
| 1773 | nmdc:mga0rr50_372834_c1 | 3300050513 | Bacteria | 1203 |
| 1774 | nmdc:mga0rr50_831076_c1 | 3300050513 | Bacteria | 788 |
| 1775 | nmdc:mga08x19_201358_c1 | 3300050514 | Bacteria | 1365 |
| 1776 | nmdc:mga08x19_226002_c1 | 3300050514 | Bacteria | 1287 |
| 1777 | nmdc:mga0a205_302815_c1 | 3300050515 | Bacteria | 1471 |
| 1778 | nmdc:mga0a205_325570_c1 | 3300050515 | Bacteria | 1407 |
| 1779 | nmdc:mga0a205_367707_c1 | 3300050515 | Bacteria | 1304 |
| 1780 | nmdc:mga0a205_48670_c1 | 3300050515 | Bacteria | 1032 |
| 1781 | nmdc:mga0a205_69199_c1 | 3300050515 | Bacteria | 3409 |
| 1782 | nmdc:mga0a205_72778_c1 | 3300050515 | Bacteria | 3320 |
| 1783 | nmdc:mga0a205_916012_c1 | 3300050515 | Bacteria | 723 |
| 1784 | nmdc:mga0sz30_120911_c1 | 3300050516 | Bacteria | 1151 |
| 1785 | nmdc:mga0sz30_1617_c1 | 3300050516 | Bacteria | 3982 |
| 1786 | nmdc:mga0sz30_222244_c1 | 3300050516 | Bacteria | 840 |
| 1787 | nmdc:mga0sz30_47446_c1 | 3300050516 | Bacteria | 1815 |
| 1788 | nmdc:mga0sz30_64811_c1 | 3300050516 | Bacteria | 1566 |
| 1789 | nmdc:mga0sz30_66961_c1 | 3300050516 | Bacteria | 1542 |
| 1790 | nmdc:mga0sz30_9308_c2 | 3300050516 | Bacteria | 3518 |
| 1791 | Ga0495601_0000467 | 3300053077 | Bacteria | 21224 |
| 1792 | Ga0495601_0000861 | 3300053077 | Bacteria | 16540 |
| 1793 | Ga0495601_0001456 | 3300053077 | Bacteria | 13045 |
| 1794 | Ga0495601_0005945 | 3300053077 | Bacteria | 7118 |
| 1795 | Ga0495601_0011563 | 3300053077 | Bacteria | 5287 |
| 1796 | Ga0495601_0095822 | 3300053077 | Bacteria | 1913 |
| 1797 | Ga0495601_0115884 | 3300053077 | Bacteria | 1737 |
| 1798 | Ga0495601_0201605 | 3300053077 | Bacteria | 1300 |
| 1799 | Ga0495612_0000575 | 3300053078 | Bacteria | 14787 |
| 1800 | Ga0495612_0004648 | 3300053078 | Bacteria | 5685 |
| 1801 | Ga0495612_0012284 | 3300053078 | Bacteria | 3452 |
| 1802 | Ga0495612_0149889 | 3300053078 | Bacteria | 1014 |
| 1803 | Ga0500610_0035592 | 3300053079 | Bacteria | 2555 |
| 1804 | Ga0500635_0004759 | 3300053080 | Bacteria | 3512 |
| 1805 | Ga0495655_0003619 | 3300053083 | Bacteria | 2566 |
| 1806 | Ga0495595_0000635 | 3300053084 | Bacteria | 13367 |
| 1807 | Ga0495595_0001020 | 3300053084 | Bacteria | 10783 |
| 1808 | Ga0495595_0004731 | 3300053084 | Bacteria | 5474 |
| 1809 | Ga0495595_0015661 | 3300053084 | Bacteria | 3235 |
| 1810 | Ga0495595_0022205 | 3300053084 | Bacteria | 2783 |
| 1811 | Ga0495595_0034075 | 3300053084 | Bacteria | 2301 |
| 1812 | Ga0495595_0041025 | 3300053084 | Bacteria | 2116 |
| 1813 | Ga0495595_0253401 | 3300053084 | Bacteria | 881 |
| 1814 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1815 | Ga0495619_0002154 | 3300053085 | Bacteria | 13053 |
| 1816 | Ga0495619_0003042 | 3300053085 | Bacteria | 10894 |
| 1817 | Ga0495619_0004154 | 3300053085 | Bacteria | 9254 |
| 1818 | Ga0495619_0012362 | 3300053085 | Bacteria | 5374 |
| 1819 | Ga0495619_0016222 | 3300053085 | Bacteria | 4714 |
| 1820 | Ga0495619_0045937 | 3300053085 | Plasmid | 2871 |
| 1821 | Ga0495619_0093467 | 3300053085 | Bacteria | 2039 |
| 1822 | Ga0495619_0140872 | 3300053085 | Bacteria | 1660 |
| 1823 | Ga0495619_0321836 | 3300053085 | Bacteria | 1070 |
| 1824 | Ga0495619_0347848 | 3300053085 | Bacteria | 1025 |
| 1825 | Ga0500578_0051516 | 3300053086 | Bacteria | 2637 |
| 1826 | Ga0500578_0377718 | 3300053086 | Bacteria | 822 |
| 1827 | Ga0500644_0064861 | 3300053088 | Bacteria | 1299 |
| 1828 | Ga0500646_0106468 | 3300053090 | Bacteria | 887 |
| 1829 | Ga0500651_0191576 | 3300053093 | Bacteria | 1210 |
| 1830 | Ga0500566_0004766 | 3300053094 | Bacteria | 8084 |
| 1831 | Ga0500566_0022772 | 3300053094 | Bacteria | 3679 |
| 1832 | Ga0500566_0296634 | 3300053094 | Bacteria | 763 |
| 1833 | Ga0500641_0008154 | 3300053096 | Bacteria | 3733 |
| 1834 | Ga0500641_0021665 | 3300053096 | Bacteria | 2453 |
| 1835 | Ga0500641_0023473 | 3300053096 | Bacteria | 2372 |
| 1836 | Ga0500650_0096145 | 3300053098 | Bacteria | 1386 |
| 1837 | Ga0500650_0240431 | 3300053098 | Bacteria | 814 |
| 1838 | Ga0500555_041263 | 3300053103 | Bacteria | 1284 |
| 1839 | Ga0500558_055504 | 3300053106 | Bacteria | 1664 |
| 1840 | Ga0500572_000093 | 3300053111 | Bacteria | 29132 |
| 1841 | Ga0500582_173345 | 3300053114 | Bacteria | 737 |
| 1842 | Ga0500592_020606 | 3300053116 | Bacteria | 1061 |
| 1843 | Ga0500594_0045023 | 3300053118 | Bacteria | 1222 |
| 1844 | Ga0500595_001406 | 3300053119 | Bacteria | 12911 |
| 1845 | Ga0500595_001750 | 3300053119 | Bacteria | 11313 |
| 1846 | Ga0500595_009426 | 3300053119 | Bacteria | 3940 |
| 1847 | Ga0500595_016335 | 3300053119 | Bacteria | 2767 |
| 1848 | Ga0500595_073355 | 3300053119 | Bacteria | 1012 |
| 1849 | Ga0500608_060376 | 3300053122 | Bacteria | 1813 |
| 1850 | Ga0500618_035027 | 3300053125 | Bacteria | 1166 |
| 1851 | Ga0500626_073006 | 3300053128 | Bacteria | 1525 |
| 1852 | Ga0500642_0022506 | 3300053130 | Bacteria | 2517 |
| 1853 | Ga0500652_146848 | 3300053131 | Bacteria | 980 |
| 1854 | Ga0500655_003381 | 3300053133 | Bacteria | 2885 |
| 1855 | Ga0500658_0025355 | 3300053134 | Bacteria | 2278 |
| 1856 | Ga0500559_0000242 | 3300053136 | Bacteria | 43285 |
| 1857 | Ga0500559_0026137 | 3300053136 | Bacteria | 2485 |
| 1858 | Ga0500559_0090946 | 3300053136 | Bacteria | 1397 |
| 1859 | Ga0500568_0006307 | 3300053139 | Bacteria | 5972 |
| 1860 | Ga0500568_0078438 | 3300053139 | Bacteria | 1256 |
| 1861 | Ga0500568_0118598 | 3300053139 | Bacteria | 986 |
| 1862 | Ga0500573_0136887 | 3300053140 | Bacteria | 1351 |
| 1863 | Ga0500577_0035215 | 3300053142 | Bacteria | 1784 |
| 1864 | Ga0500588_0207952 | 3300053146 | Bacteria | 726 |
| 1865 | Ga0500589_022266 | 3300053147 | Bacteria | 2913 |
| 1866 | Ga0500604_0017013 | 3300053151 | Bacteria | 2007 |
| 1867 | Ga0500604_0073716 | 3300053151 | Bacteria | 1093 |
| 1868 | Ga0500604_0092872 | 3300053151 | Bacteria | 987 |
| 1869 | Ga0500616_0025644 | 3300053153 | Bacteria | 3268 |
| 1870 | Ga0500616_0148295 | 3300053153 | Bacteria | 1089 |
| 1871 | Ga0500619_132158 | 3300053154 | Bacteria | 851 |
| 1872 | Ga0500622_0020471 | 3300053156 | Bacteria | 3512 |
| 1873 | Ga0500622_0111697 | 3300053156 | Bacteria | 1335 |
| 1874 | Ga0500627_0190400 | 3300053158 | Bacteria | 921 |
| 1875 | Ga0500633_0219929 | 3300053160 | Bacteria | 709 |
| 1876 | Ga0500634_0082277 | 3300053161 | Bacteria | 1655 |
| 1877 | Ga0500638_000402 | 3300053162 | Bacteria | 10262 |
| 1878 | Ga0500639_001904 | 3300053163 | Bacteria | 10448 |
| 1879 | Ga0500637_0002381 | 3300053178 | Bacteria | 8348 |
| 1880 | Ga0500611_052981 | 3300053727 | Bacteria | 936 |
| 1881 | Ga0500611_143867 | 3300053727 | Bacteria | 651 |
| 1882 | Ga0500657_094878 | 3300053728 | Bacteria | 1246 |
| 1883 | Ga0500645_029155 | 3300053730 | Bacteria | 1667 |
| 1884 | Ga0500645_040182 | 3300053730 | Bacteria | 1384 |
| 1885 | Ga0500645_129448 | 3300053730 | Bacteria | 701 |
| 1886 | Ga0500609_007246 | 3300053731 | Bacteria | 1498 |
| 1887 | Ga0500656_015415 | 3300053732 | Bacteria | 895 |
| 1888 | Ga0500552_001834 | 3300053733 | Bacteria | 2037 |
| 1889 | Ga0500596_000350 | 3300053735 | Bacteria | 8310 |
| 1890 | Ga0500596_001100 | 3300053735 | Bacteria | 5443 |
| 1891 | Ga0501084_0061368 | 3300054114 | Bacteria | 3147 |
| 1892 | Ga0501084_0100910 | 3300054114 | Bacteria | 2423 |
| 1893 | Ga0501084_0156432 | 3300054114 | Bacteria | 1922 |
| 1894 | Ga0501084_0206589 | 3300054114 | Bacteria | 1657 |
| 1895 | Ga0501084_0447580 | 3300054114 | Bacteria | 1092 |
| 1896 | Ga0501084_0842730 | 3300054114 | Bacteria | 772 |
| 1897 | Ga0501084_1015190 | 3300054114 | Bacteria | 697 |
| 1898 | Ga0500661_000108 | 3300055283 | Bacteria | 13387 |
| 1899 | Ga0590071_003417 | 3300059421 | Bacteria | 3902 |
| 1900 | Ga0587093_032290 | 3300059478 | Bacteria | 759 |
| 1901 | Ga0587083_0075839 | 3300059505 | Bacteria | 791 |
| 1902 | Ga0587085_032574 | 3300059506 | Bacteria | 866 |
| 1903 | Ga0587086_023435 | 3300059507 | Bacteria | 861 |
| 1904 | Ga0587068_052867 | 3300059641 | Bacteria | 764 |
| 1905 | Ga0501082_0000106 | 3300060353 | Bacteria | 65983 |
| 1906 | Ga0501082_0043636 | 3300060353 | Bacteria | 3867 |
| 1907 | Ga0501082_0049770 | 3300060353 | Bacteria | 3614 |
| 1908 | Ga0501082_0081512 | 3300060353 | Bacteria | 2792 |
| 1909 | Ga0501082_0292811 | 3300060353 | Bacteria | 1417 |
| 1910 | Ga0501082_0758478 | 3300060353 | Unclassified | 849 |
| 1911 | Ga0501082_0790114 | 3300060353 | Bacteria | 830 |
| 1912 | Ga0501082_1155901 | 3300060353 | Bacteria | 677 |
| 1913 | Ga0530510_0017881 | 3300061734 | Bacteria | 5027 |
| 1914 | Ga0530510_0020095 | 3300061734 | Bacteria | 4748 |
| 1915 | Ga0530510_0213744 | 3300061734 | Bacteria | 1433 |
| 1916 | Ga0530510_0266002 | 3300061734 | Unclassified | 1279 |
| 1917 | Ga0530510_0545461 | 3300061734 | Unclassified | 880 |
| 1918 | 2509149394 | 2508501128 | Bacteria | 8613869 |
| 1919 | 2513622966 | 2513237092 | Bacteria | 8341956 |
| 1920 | 2513699544 | 2513237102 | Bacteria | 7703324 |
| 1921 | 2517104065 | 2517093001 | Bacteria | 9002274 |
| 1922 | 2517891444 | 2517572143 | Bacteria | 9484767 |
| 1923 | 2524436375 | 2524023205 | Bacteria | 8918781 |
| 1924 | 2524538381 | 2524023228 | Bacteria | 10118060 |
| 1925 | 2603861422 | 2602042107 | Bacteria | 6226103 |
| 1926 | 2643758643 | 2643221547 | Bacteria | 4740017 |
| 1927 | 2728750139 | 2728368998 | Bacteria | 8720350 |
| 1928 | 2745080671 | 2744054633 | Bacteria | 8678936 |
| 1929 | 2818236462 | 2816332527 | Bacteria | 8933356 |
| 1930 | 2824621920 | 2824617872 | Bacteria | 8814715 |
| 1931 | 2824631612 | 2824626560 | Bacteria | 8813858 |
| 1932 | 2824641698 | 2824635225 | Bacteria | 8785348 |
| 1933 | 2824649360 | 2824644064 | Bacteria | 8743947 |
| 1934 | 2824713657 | 2824704595 | Bacteria | 9667483 |
| 1935 | 2824719187 | 2824714736 | Bacteria | 8717648 |
| 1936 | 2824729604 | 2824723954 | Bacteria | 8758240 |
| 1937 | 2824758461 | 2824753945 | Bacteria | 9787441 |
| 1938 | 2824770045 | 2824763712 | Bacteria | 9792355 |
| 1939 | 2836164696 | 2836160341 | Unclassified | 5867367 |
| 1940 | 2841959784 | 2841957949 | Bacteria | 8652217 |
| 1941 | 2842040562 | 2842038055 | Bacteria | 8002051 |
| 1942 | 2842046492 | 2842045827 | Bacteria | 8006841 |
| 1943 | 2847937237 | 2847930680 | Bacteria | 9342022 |
| 1944 | 2874607295 | 2874604998 | Bacteria | 7834745 |
| 1945 | 2874614665 | 2874612657 | Bacteria | 8252029 |
| 1946 | 2874627989 | 2874620515 | Bacteria | 8290088 |
| 1947 | 2876766184 | 2876761206 | Bacteria | 10111113 |
| 1948 | 2876814532 | 2876808645 | Bacteria | 8824342 |
| 1949 | 2879088465 | 2879083081 | Bacteria | 8587928 |
| 1950 | 2879114627 | 2879110137 | Bacteria | 8907982 |
| 1951 | 2881371546 | 2881364244 | Bacteria | 7710352 |
| 1952 | 2881671842 | 2881665667 | Bacteria | 8175609 |
| 1953 | 2885369883 | 2885366525 | Bacteria | 8326213 |
| 1954 | 2885379649 | 2885374607 | Bacteria | 8927485 |
| 1955 | 2885412280 | 2885409591 | Bacteria | 9235467 |
| 1956 | 2888385362 | 2888378607 | Bacteria | 9652610 |
| 1957 | 2889038110 | 2889033259 | Bacteria | 9099371 |
| 1958 | 2903752507 | 2903748898 | Bacteria | 9972761 |
| 1959 | 2904674393 | 2904666416 | Bacteria | 8226587 |
| 1960 | 2904691286 | 2904690495 | Bacteria | 9412302 |
| 1961 | 2904704891 | |||
| 1962 | 2904712072 | 2904711408 | Bacteria | 9771557 |
| 1963 | 2906616616 | |||
| 1964 | 2906635400 | 2906635258 | Bacteria | 8601019 |
| 1965 | 2906649362 | 2906643746 | Bacteria | 8722424 |
| 1966 | 2906666945 | 2906660503 | Bacteria | 8595048 |
| 1967 | 2908741782 | 2908739725 | Bacteria | 8628932 |
| 1968 | 2908759072 | 2908756301 | Bacteria | 8864324 |
| 1969 | 2922368588 | 2922361189 | Bacteria | 7436256 |
| 1970 | 2922431363 | |||
| 1971 | 2935633959 | 2935630451 | Bacteria | 8169952 |
| 1972 | 2941510738 | 2941507105 | Bacteria | 8166816 |
| 1973 | 2941518122 | 2941515067 | Bacteria | 8166720 |
| 1974 | 2941527007 | 2941523033 | Bacteria | 8169134 |
| 1975 | 8006930880 | 8006926726 | Bacteria | 6749210 |
| 1976 | 8006939554 | 8006933436 | Bacteria | 10410654 |
| 1977 | 8006968361 | 8006964411 | Bacteria | 8966052 |
| 1978 | 8006979305 | 8006973647 | Bacteria | 10679141 |
| 1979 | 8006989197 | 8006984368 | Bacteria | 9651211 |
| 1980 | 8006994809 | 8006994254 | Bacteria | 8309700 |
| 1981 | 8019575534 | 8019565922 | Bacteria | 9639779 |
| 1982 | 8056681019 | 8056673599 | Bacteria | 7871253 |
| 1983 | 8056693407 | 8056689827 | Bacteria | 6712655 |
| 1984 | JGI25404J52841_10006413 | |||
| 1985 | RicEn_C2512 | |||
| 1986 | 2214745216 | |||
| 1987 | ARSoilYngRDRAFT_c00191 | |||
| 1988 | ARcpr5yngRDRAFT_c000145 | |||
| 1989 | ARSoilOldRDRAFT_c000016 | |||
| 1990 | ARCol0oldRDRAFT_c00161 | |||
| 1991 | ARCol0yngRDRAFT_1000187 | |||
| 1992 | JGI24032J14994_102107 | |||
| 1993 | JGI24746J21847_1001112 | |||
| 1994 | JGI24746J21847_1006035 | |||
| 1995 | JGI24740J21852_10025456 | |||
| 1996 | JGI24739J22299_10001106 | |||
| 1997 | JGI24737J22298_10010720 | |||
| 1998 | JGI24737J22298_10027266 | |||
| 1999 | JGI24743J22301_10026795 | |||
| 2000 | JGI24735J21928_10028666 | |||
| 2001 | JGI24745J21846_1000214 | |||
| 2002 | JGI24748J21848_1010542 | |||
| 2003 | JGI24738J21930_10004532 | |||
| 2004 | JGI24749J21850_1006566 | |||
| 2005 | JGI24035J26624_1002401 | |||
| 2006 | JGI24033J26618_1017191 | |||
| 2007 | JGI24034J26672_10007006 | |||
| 2008 | JGI24742J22300_10002116 | |||
| 2009 | JGI24742J22300_10002245 | |||
| 2010 | JGI24742J22300_10006662 | |||
| 2011 | JGI24742J22300_10007686 | |||
| 2012 | JGI24742J22300_10039293 | |||
| 2013 | JGI24751J29686_10003559 | |||
| 2014 | JGI24751J29686_10016566 | |||
| 2015 | JGI24751J29686_10048232 | |||
| 2016 | Ga0006759J45824_1016848 | |||
| 2017 | JGI25406J46586_10002634 | |||
| 2018 | JGI25153J46596_10000632 | |||
| 2019 | JGI25153J46596_10003303 | |||
| 2020 | JGI25160J50197_1007144 | |||
| 2021 | JGI25160J50197_1016309 | |||
| 2022 | Ga0058859_10005899 | |||
| 2023 | Ga0058860_10029185 | |||
| 2024 | Ga0065165_1001679 | |||
| 2025 | Ga0065714_10032781 | |||
| 2026 | Ga0065704_10096121 | |||
| 2027 | Ga0065712_10039456 | |||
| 2028 | Ga0065712_10072238 | |||
| 2029 | Ga0065712_10121301 | |||
| 2030 | Ga0065712_10147584 | |||
| 2031 | Ga0065715_10056642 | |||
| 2032 | Ga0065715_10201834 | |||
| 2033 | Ga0065715_10224079 | |||
| 2034 | Ga0065707_10147313 | |||
| 2035 | Ga0065707_10200827 | |||
| 2036 | Ga0065707_10242627 | |||
| 2037 | Ga0070658_10482792 | |||
| 2038 | Ga0070676_10003681 | |||
| 2039 | Ga0070676_10024186 | |||
| 2040 | Ga0070676_10074811 | |||
| 2041 | Ga0070676_10347673 | |||
| 2042 | Ga0070676_10425296 | |||
| 2043 | Ga0070683_100010409 | |||
| 2044 | Ga0070683_100019681 | |||
| 2045 | Ga0070683_100307391 | |||
| 2046 | Ga0070690_100005755 | |||
| 2047 | Ga0070690_100104361 | |||
| 2048 | Ga0070690_100303423 | |||
| 2049 | Ga0070670_100014637 | |||
| 2050 | Ga0070670_100035140 | |||
| 2051 | Ga0070670_100035513 | |||
| 2052 | Ga0070670_100036571 | |||
| 2053 | Ga0070670_100857778 | |||
| 2054 | Ga0070670_101241656 | |||
| 2055 | Ga0070677_10000046 | |||
| 2056 | Ga0070677_10004236 | |||
| 2057 | Ga0070677_10010099 | |||
| 2058 | Ga0068869_100000900 | |||
| 2059 | Ga0068869_100319141 | |||
| 2060 | Ga0068869_100438424 | |||
| 2061 | Ga0068869_100861791 | |||
| 2062 | Ga0070666_10008419 | |||
| 2063 | Ga0070666_10029279 | |||
| 2064 | Ga0070666_10185925 | |||
| 2065 | Ga0070666_10541099 | |||
| 2066 | Ga0070680_100013751 | |||
| 2067 | Ga0070680_100314262 | |||
| 2068 | Ga0070682_100000920 | |||
| 2069 | Ga0070682_100065469 | |||
| 2070 | Ga0070682_100112701 | |||
| 2071 | Ga0068868_100074087 | |||
| 2072 | Ga0068868_100163283 | |||
| 2073 | Ga0068868_100199663 | |||
| 2074 | Ga0068868_100326725 | |||
| 2075 | Ga0070660_100002099 | |||
| 2076 | Ga0070660_100021171 | |||
| 2077 | Ga0070660_100060234 | |||
| 2078 | Ga0070660_100255481 | |||
| 2079 | Ga0070689_100031944 | |||
| 2080 | Ga0070689_100036745 | |||
| 2081 | Ga0070689_100061023 | |||
| 2082 | Ga0070689_100162213 | |||
| 2083 | Ga0070689_100806770 | |||
| 2084 | Ga0070687_100000217 | |||
| 2085 | Ga0070687_100240828 | |||
| 2086 | Ga0070687_100270606 | |||
| 2087 | Ga0070661_100193041 | |||
| 2088 | Ga0070661_100892389 | |||
| 2089 | Ga0070668_100126408 | |||
| 2090 | Ga0070668_100327847 | |||
| 2091 | Ga0070669_100040867 | |||
| 2092 | Ga0070669_100043787 | |||
| 2093 | Ga0070669_100199255 | |||
| 2094 | Ga0070669_100956167 | |||
| 2095 | Ga0070675_100004785 | |||
| 2096 | Ga0070675_100324326 | |||
| 2097 | Ga0070675_100502510 | |||
| 2098 | Ga0070675_100622786 | |||
| 2099 | Ga0070675_101276596 | |||
| 2100 | Ga0070671_100005407 | |||
| 2101 | Ga0070671_100011957 | |||
| 2102 | Ga0070671_100016718 | |||
| 2103 | Ga0070671_100033894 | |||
| 2104 | Ga0070671_100049957 | |||
| 2105 | Ga0070671_100055944 | |||
| 2106 | Ga0070671_100316123 | |||
| 2107 | Ga0070674_100000375 | |||
| 2108 | Ga0070674_100000893 | |||
| 2109 | Ga0070674_100001474 | |||
| 2110 | Ga0070674_100161671 | |||
| 2111 | Ga0070674_100194081 | |||
| 2112 | Ga0070674_100288239 | |||
| 2113 | Ga0070674_100365945 | |||
| 2114 | Ga0070674_100404699 | |||
| 2115 | Ga0070673_100000470 | |||
| 2116 | Ga0070673_100018635 | |||
| 2117 | Ga0070688_100016929 | |||
| 2118 | Ga0070688_100080542 | |||
| 2119 | Ga0070688_100124721 | |||
| 2120 | Ga0070688_100239881 | |||
| 2121 | Ga0070688_100368375 | |||
| 2122 | Ga0070659_100006204 | |||
| 2123 | Ga0070667_100012633 | |||
| 2124 | Ga0070667_100041130 | |||
| 2125 | Ga0070667_100233536 | |||
| 2126 | Ga0070667_100467640 | |||
| 2127 | Ga0070667_100736038 | |||
| 2128 | Ga0070709_10005104 | |||
| 2129 | Ga0070709_10006845 | |||
| 2130 | Ga0070709_10080910 | |||
| 2131 | Ga0070709_10141911 | |||
| 2132 | Ga0070709_10392129 | |||
| 2133 | Ga0070714_100002780 | |||
| 2134 | Ga0070714_100018995 | |||
| 2135 | Ga0070714_100111744 | |||
| 2136 | Ga0070713_100017941 | |||
| 2137 | Ga0070713_100181064 | |||
| 2138 | Ga0070713_100469847 | |||
| 2139 | Ga0070710_10016995 | |||
| 2140 | Ga0070710_10023746 | |||
| 2141 | Ga0070710_10088442 | |||
| 2142 | Ga0070710_10124786 | |||
| 2143 | Ga0070701_10186895 | |||
| 2144 | Ga0070701_10231618 | |||
| 2145 | Ga0070711_100244836 | |||
| 2146 | Ga0070711_100486816 | |||
| 2147 | Ga0070711_100548466 | |||
| 2148 | Ga0070705_100000204 | |||
| 2149 | Ga0070705_100306506 | |||
| 2150 | Ga0070705_100362657 | |||
| 2151 | Ga0070705_100417666 | |||
| 2152 | Ga0070705_100751926 | |||
| 2153 | Ga0070700_100319833 | |||
| 2154 | Ga0070700_100417222 | |||
| 2155 | Ga0070700_100533032 | |||
| 2156 | Ga0070694_100450974 | |||
| 2157 | Ga0070663_100026729 | |||
| 2158 | Ga0070663_100328207 | |||
| 2159 | Ga0070663_100726371 | |||
| 2160 | Ga0070678_100002319 | |||
| 2161 | Ga0070678_100014852 | |||
| 2162 | Ga0070678_100047057 | |||
| 2163 | Ga0070662_100013235 | |||
| 2164 | Ga0070662_100512516 | |||
| 2165 | Ga0070681_10061201 | |||
| 2166 | Ga0070681_10360321 | |||
| 2167 | Ga0070681_10621943 | |||
| 2168 | Ga0068867_100004027 | |||
| 2169 | Ga0068867_100006503 | |||
| 2170 | Ga0068867_101246686 | |||
| 2171 | Ga0070685_10001617 | |||
| 2172 | Ga0070685_10008570 | |||
| 2173 | Ga0070685_10041027 | |||
| 2174 | Ga0070685_10206947 | |||
| 2175 | Ga0074259_10896662 | |||
| 2176 | Ga0070699_100462520 | |||
| 2177 | Ga0070699_100536465 | |||
| 2178 | Ga0070699_100786324 | |||
| 2179 | Ga0070679_100025312 | |||
| 2180 | Ga0070679_100159196 | |||
| 2181 | Ga0070684_100008508 | |||
| 2182 | Ga0070684_100029649 | |||
| 2183 | Ga0070684_100112955 | |||
| 2184 | Ga0070697_100132093 | |||
| 2185 | Ga0068853_100033577 | |||
| 2186 | Ga0068853_100067830 | |||
| 2187 | Ga0068853_100092887 | |||
| 2188 | Ga0068853_100234876 | |||
| 2189 | Ga0068853_100351911 | |||
| 2190 | Ga0068853_100356024 | |||
| 2191 | Ga0068853_100484304 | |||
| 2192 | Ga0068853_100630652 | |||
| 2193 | Ga0070672_100015602 | |||
| 2194 | Ga0070672_100046664 | |||
| 2195 | Ga0070672_100216997 | |||
| 2196 | Ga0070686_100018072 | |||
| 2197 | Ga0070686_100048208 | |||
| 2198 | Ga0070686_100119889 | |||
| 2199 | Ga0070686_100231573 | |||
| 2200 | Ga0070686_100305331 | |||
| 2201 | Ga0070695_100114448 | |||
| 2202 | Ga0070695_100561926 | |||
| 2203 | Ga0070696_100073889 | |||
| 2204 | Ga0070696_100511780 | |||
| 2205 | Ga0070693_100025149 | |||
| 2206 | Ga0070693_100238020 | |||
| 2207 | Ga0070665_100136427 | |||
| 2208 | Ga0070665_100159772 | |||
| 2209 | Ga0070665_100168616 | |||
| 2210 | Ga0070665_100172989 | |||
| 2211 | Ga0070665_100213906 | |||
| 2212 | Ga0070665_100551647 | |||
| 2213 | Ga0070704_100158213 | |||
| 2214 | Ga0068855_100007909 | |||
| 2215 | Ga0068855_100087873 | |||
| 2216 | Ga0068855_100232331 | |||
| 2217 | Ga0070664_100003650 | |||
| 2218 | Ga0070664_100160089 | |||
| 2219 | Ga0070664_100218015 | |||
| 2220 | Ga0068857_100002698 | |||
| 2221 | Ga0068857_100051580 | |||
| 2222 | Ga0068857_100097530 | |||
| 2223 | Ga0068857_100165918 | |||
| 2224 | Ga0068857_100670601 | |||
| 2225 | Ga0068854_100046914 | |||
| 2226 | Ga0068854_100120058 | |||
| 2227 | Ga0068854_100129469 | |||
| 2228 | Ga0068854_100453231 | |||
| 2229 | Ga0068856_100005538 | |||
| 2230 | Ga0068856_100045821 | |||
| 2231 | Ga0068856_100226569 | |||
| 2232 | Ga0068856_100282875 | |||
| 2233 | Ga0068856_100632430 | |||
| 2234 | Ga0070702_100000758 | |||
| 2235 | Ga0070702_100002474 | |||
| 2236 | Ga0070702_100005458 | |||
| 2237 | Ga0070702_100061626 | |||
| 2238 | Ga0070702_100093906 | |||
| 2239 | Ga0070702_100214701 | |||
| 2240 | Ga0070702_100423573 | |||
| 2241 | Ga0068852_100025773 | |||
| 2242 | Ga0068859_100020242 | |||
| 2243 | Ga0068859_100023296 | |||
| 2244 | Ga0068859_100078546 | |||
| 2245 | Ga0068859_100752895 | |||
| 2246 | Ga0068864_100000443 | |||
| 2247 | Ga0068864_100004887 | |||
| 2248 | Ga0068864_100020334 | |||
| 2249 | Ga0068864_100033589 | |||
| 2250 | Ga0068864_100048665 | |||
| 2251 | Ga0068864_100644235 | |||
| 2252 | Ga0068866_10000908 | |||
| 2253 | Ga0068866_10164879 | |||
| 2254 | Ga0068861_100007339 | |||
| 2255 | Ga0068861_100033080 | |||
| 2256 | Ga0068861_100679237 | |||
| 2257 | Ga0068870_10000734 | |||
| 2258 | Ga0068870_10060901 | |||
| 2259 | Ga0068870_10083312 | |||
| 2260 | Ga0068863_100007663 | |||
| 2261 | Ga0068863_100054632 | |||
| 2262 | Ga0068863_100298475 | |||
| 2263 | Ga0068863_100360320 | |||
| 2264 | Ga0068863_100523151 | |||
| 2265 | Ga0068863_100856859 | |||
| 2266 | Ga0068858_100003447 | |||
| 2267 | Ga0068858_100060090 | |||
| 2268 | Ga0068858_100085044 | |||
| 2269 | Ga0068858_100095118 | |||
| 2270 | Ga0068858_100533274 | |||
| 2271 | Ga0068860_100354400 | |||
| 2272 | Ga0068860_100417277 | |||
| 2273 | Ga0068862_100008086 | |||
| 2274 | Ga0068862_100352462 | |||
| 2275 | Ga0081455_10019100 | |||
| 2276 | Ga0081455_10024219 | |||
| 2277 | Ga0081455_10221049 | |||
| 2278 | Ga0081455_10247539 | |||
| 2279 | Ga0081538_10002974 | |||
| 2280 | Ga0081538_10125128 | |||
| 2281 | Ga0081540_1000140 | |||
| 2282 | Ga0081540_1008037 | |||
| 2283 | Ga0081540_1041211 | |||
| 2284 | Ga0081540_1134370 | |||
| 2285 | Ga0081540_1182014 | |||
| 2286 | Ga0081539_10004161 | |||
| 2287 | Ga0070717_10004047 | |||
| 2288 | Ga0070717_10013853 | |||
| 2289 | Ga0070717_10410194 | |||
| 2290 | Ga0070717_10906302 | |||
| 2291 | Ga0075365_10048713 | |||
| 2292 | Ga0075365_10062317 | |||
| 2293 | Ga0075365_10063600 | |||
| 2294 | Ga0075365_10151459 | |||
| 2295 | Ga0075365_10175006 | |||
| 2296 | Ga0075365_10250989 | |||
| 2297 | Ga0075365_10343220 | |||
| 2298 | Ga0075365_10522901 | |||
| 2299 | Ga0075368_10045053 | |||
| 2300 | Ga0075368_10058301 | |||
| 2301 | Ga0075368_10061023 | |||
| 2302 | Ga0075363_100012895 | |||
| 2303 | Ga0075363_100179641 | |||
| 2304 | Ga0075363_100190585 | |||
| 2305 | Ga0075363_100418033 | |||
| 2306 | Ga0075363_100498411 | |||
| 2307 | Ga0075364_10008807 | |||
| 2308 | Ga0075364_10050422 | |||
| 2309 | Ga0075364_10324493 | |||
| 2310 | Ga0075364_10351445 | |||
| 2311 | Ga0075364_10561853 | |||
| 2312 | Ga0075432_10046599 | |||
| 2313 | Ga0075432_10053596 | |||
| 2314 | Ga0070715_10000352 | |||
| 2315 | Ga0070715_10003497 | |||
| 2316 | Ga0070715_10177149 | |||
| 2317 | Ga0070716_100000521 | |||
| 2318 | Ga0070716_100007900 | |||
| 2319 | Ga0070716_100244255 | |||
| 2320 | Ga0070716_100319368 | |||
| 2321 | Ga0070712_100053418 | |||
| 2322 | Ga0070712_100112599 | |||
| 2323 | Ga0070712_100225902 | |||
| 2324 | Ga0070712_100356239 | |||
| 2325 | Ga0070712_100598293 | |||
| 2326 | Ga0075362_10073571 | |||
| 2327 | Ga0075367_10019468 | |||
| 2328 | Ga0075367_10024342 | |||
| 2329 | Ga0075367_10057607 | |||
| 2330 | Ga0075367_10132826 | |||
| 2331 | Ga0075367_10211134 | |||
| 2332 | Ga0075367_10306161 | |||
| 2333 | Ga0075369_10085867 | |||
| 2334 | Ga0075366_10025202 | |||
| 2335 | Ga0075366_10101432 | |||
| 2336 | Ga0075366_10250736 | |||
| 2337 | Ga0097621_100000435 | |||
| 2338 | Ga0097621_100072099 | |||
| 2339 | Ga0097621_100263162 | |||
| 2340 | Ga0097621_100383900 | |||
| 2341 | Ga0075370_10033603 | |||
| 2342 | Ga0075370_10045809 | |||
| 2343 | Ga0075370_10140482 | |||
| 2344 | Ga0075370_10176599 | |||
| 2345 | Ga0068871_100012417 | |||
| 2346 | Ga0068871_100081619 | |||
| 2347 | Ga0068871_100205915 | |||
| 2348 | Ga0068871_100312046 | |||
| 2349 | Ga0068871_100694977 | |||
| 2350 | Ga0075428_100191902 | |||
| 2351 | Ga0075428_100332413 | |||
| 2352 | Ga0075428_100342286 | |||
| 2353 | Ga0075428_101026227 | |||
| 2354 | Ga0075428_101055374 | |||
| 2355 | Ga0075430_100010823 | |||
| 2356 | Ga0075430_100231826 | |||
| 2357 | Ga0075431_100000020 | |||
| 2358 | Ga0075431_100008458 | |||
| 2359 | Ga0075431_100208400 | |||
| 2360 | Ga0075431_100277984 | |||
| 2361 | Ga0075431_100366055 | |||
| 2362 | Ga0075431_100468385 | |||
| 2363 | Ga0075431_100982760 | |||
| 2364 | Ga0075431_101477921 | |||
| 2365 | Ga0075433_10018880 | |||
| 2366 | Ga0075433_10062667 | |||
| 2367 | Ga0075433_10289422 | |||
| 2368 | Ga0075433_10805682 | |||
| 2369 | Ga0075434_100003352 | |||
| 2370 | Ga0075434_100011154 | |||
| 2371 | Ga0075434_100185713 | |||
| 2372 | Ga0075429_100015669 | |||
| 2373 | Ga0075429_100323427 | |||
| 2374 | Ga0075429_100332978 | |||
| 2375 | Ga0075429_100451746 | |||
| 2376 | Ga0075429_100638716 | |||
| 2377 | Ga0068865_100000485 | |||
| 2378 | Ga0068865_100012411 | |||
| 2379 | Ga0068865_100053945 | |||
| 2380 | Ga0068865_100059221 | |||
| 2381 | Ga0068865_100157100 | |||
| 2382 | Ga0068865_101250436 | |||
| 2383 | Ga0075436_100208924 | |||
| 2384 | Ga0075436_100441214 | |||
| 2385 | Ga0097620_100020243 | |||
| 2386 | Ga0097620_100023296 | |||
| 2387 | Ga0097620_100078551 | |||
| 2388 | Ga0097620_100752838 | |||
| 2389 | Ga0075435_100089882 | |||
| 2390 | Ga0075435_100494239 | |||
| 2391 | Ga0099794_10015955 | |||
| 2392 | Ga0099795_10000648 | |||
| 2393 | Ga0099795_10024650 | |||
| 2394 | Ga0099795_10034727 | |||
| 2395 | Ga0099795_10063687 | |||
| 2396 | Ga0099795_10108818 | |||
| 2397 | Ga0099795_10148233 | |||
| 2398 | Ga0099795_10201972 | |||
| 2399 | Ga0105251_10030260 | |||
| 2400 | Ga0105251_10050543 | |||
| 2401 | Ga0105244_10108496 | |||
| 2402 | Ga0105250_10033276 | |||
| 2403 | Ga0105240_10130732 | |||
| 2404 | Ga0105240_10352859 | |||
| 2405 | Ga0111539_10000167 | |||
| 2406 | Ga0111539_10027723 | |||
| 2407 | Ga0111539_10038414 | |||
| 2408 | Ga0111539_10050859 | |||
| 2409 | Ga0111539_10334252 | |||
| 2410 | Ga0111539_10497695 | |||
| 2411 | Ga0111539_10522767 | |||
| 2412 | Ga0111539_11254150 | |||
| 2413 | Ga0111539_11745084 | |||
| 2414 | Ga0105245_10004286 | |||
| 2415 | Ga0105245_10008339 | |||
| 2416 | Ga0105245_10065446 | |||
| 2417 | Ga0105245_10079827 | |||
| 2418 | Ga0105245_10115240 | |||
| 2419 | Ga0105245_11718779 | |||
| 2420 | Ga0105245_11842643 | |||
| 2421 | Ga0105247_10009390 | |||
| 2422 | Ga0105247_10028516 | |||
| 2423 | Ga0105247_10046178 | |||
| 2424 | Ga0105247_10233872 | |||
| 2425 | Ga0105247_10498355 | |||
| 2426 | Ga0105247_10825026 | |||
| 2427 | Ga0114129_10003047 | |||
| 2428 | Ga0114129_10015940 | |||
| 2429 | Ga0114129_10056117 | |||
| 2430 | Ga0114129_10192494 | |||
| 2431 | Ga0114129_10244766 | |||
| 2432 | Ga0114129_10508315 | |||
| 2433 | Ga0114129_10794122 | |||
| 2434 | Ga0114129_10846802 | |||
| 2435 | Ga0114129_11145646 | |||
| 2436 | Ga0114129_11538054 | |||
| 2437 | Ga0105243_10033625 | |||
| 2438 | Ga0105243_10121717 | |||
| 2439 | Ga0105243_10148011 | |||
| 2440 | Ga0105243_10151959 | |||
| 2441 | Ga0105243_10169286 | |||
| 2442 | Ga0105243_11462591 | |||
| 2443 | Ga0105241_10032007 | |||
| 2444 | Ga0105241_10041491 | |||
| 2445 | Ga0105241_10046934 | |||
| 2446 | Ga0105241_10122616 | |||
| 2447 | Ga0105241_10126944 | |||
| 2448 | Ga0105241_10314966 | |||
| 2449 | Ga0105241_10553089 | |||
| 2450 | Ga0105242_10074853 | |||
| 2451 | Ga0105242_10144189 | |||
| 2452 | Ga0105242_10152776 | |||
| 2453 | Ga0105242_10238535 | |||
| 2454 | Ga0105242_10337825 | |||
| 2455 | Ga0105242_10681706 | |||
| 2456 | Ga0105242_11269755 | |||
| 2457 | Ga0105248_10096003 | |||
| 2458 | Ga0105248_10125981 | |||
| 2459 | Ga0105248_10232856 | |||
| 2460 | Ga0105248_10599454 | |||
| 2461 | Ga0105237_10032875 | |||
| 2462 | Ga0105237_10044558 | |||
| 2463 | Ga0105237_10058881 | |||
| 2464 | Ga0105237_10087376 | |||
| 2465 | Ga0105237_10101576 | |||
| 2466 | Ga0105237_10107873 | |||
| 2467 | Ga0105237_10132663 | |||
| 2468 | Ga0105237_10164128 | |||
| 2469 | Ga0105238_10011666 | |||
| 2470 | Ga0105238_10014012 | |||
| 2471 | Ga0105238_10030098 | |||
| 2472 | Ga0105238_10064680 | |||
| 2473 | Ga0105238_10200783 | |||
| 2474 | Ga0105238_10248589 | |||
| 2475 | Ga0105238_10296057 | |||
| 2476 | Ga0105238_10303495 | |||
| 2477 | Ga0105249_10057994 | |||
| 2478 | Ga0105249_10122241 | |||
| 2479 | Ga0105249_10197068 | |||
| 2480 | Ga0105249_10700638 | |||
| 2481 | Ga0105249_11043569 | |||
| 2482 | Ga0099796_10000265 | |||
| 2483 | Ga0099796_10007182 | |||
| 2484 | Ga0099796_10024637 | |||
| 2485 | Ga0099796_10034554 | |||
| 2486 | Ga0099796_10137756 | |||
| 2487 | Ga0105239_10004659 | |||
| 2488 | Ga0105239_10013269 | |||
| 2489 | Ga0105239_10093866 | |||
| 2490 | Ga0105239_10102663 | |||
| 2491 | Ga0105239_10133836 | |||
| 2492 | Ga0105239_10143653 | |||
| 2493 | Ga0105239_10176938 | |||
| 2494 | Ga0105239_10440731 | |||
| 2495 | Ga0105239_10688221 | |||
| 2496 | Ga0105246_10025897 | |||
| 2497 | Ga0105246_10084828 | |||
| 2498 | Ga0105246_10659942 | |||
| 2499 | Ga0105246_10893052 | |||
| 2500 | Ga0157346_1003509 | |||
| 2501 | Ga0157341_1002432 | |||
| 2502 | Ga0157323_1002561 | |||
| 2503 | Ga0157313_1009676 | |||
| 2504 | Ga0157342_1000683 | |||
| 2505 | Ga0157316_1023090 | |||
| 2506 | Ga0157371_10133354 | |||
| 2507 | Ga0157371_10209600 | |||
| 2508 | Ga0157371_10271568 | |||
| 2509 | Ga0157370_10127401 | |||
| 2510 | Ga0157370_10132132 | |||
| 2511 | Ga0157370_10199482 | |||
| 2512 | Ga0157369_10016835 | |||
| 2513 | Ga0157369_10269640 | |||
| 2514 | Ga0157369_10577588 | |||
| 2515 | Ga0157374_10004303 | |||
| 2516 | Ga0157374_10039082 | |||
| 2517 | Ga0157374_10067422 | |||
| 2518 | Ga0157374_10187920 | |||
| 2519 | Ga0157374_10953995 | |||
| 2520 | Ga0157378_10003893 | |||
| 2521 | Ga0157378_10009387 | |||
| 2522 | Ga0157378_10030439 | |||
| 2523 | Ga0157378_10030828 | |||
| 2524 | Ga0157378_10032444 | |||
| 2525 | Ga0157378_10109632 | |||
| 2526 | Ga0157378_10120946 | |||
| 2527 | Ga0157378_10271919 | |||
| 2528 | Ga0157378_10353221 | |||
| 2529 | Ga0157378_10653726 | |||
| 2530 | Ga0163162_10183755 | |||
| 2531 | Ga0163162_10205336 | |||
| 2532 | Ga0163162_10801032 | |||
| 2533 | Ga0163162_11429929 | |||
| 2534 | Ga0157372_10302570 | |||
| 2535 | Ga0157372_11454882 | |||
| 2536 | Ga0157375_10050882 | |||
| 2537 | Ga0157375_10313984 | |||
| 2538 | Ga0157375_10682618 | |||
| 2539 | Ga0157375_10750634 | |||
| 2540 | Ga0157375_11847156 | |||
| 2541 | Ga0163163_10007071 | |||
| 2542 | Ga0163163_10020427 | |||
| 2543 | Ga0163163_10030125 | |||
| 2544 | Ga0163163_10034989 | |||
| 2545 | Ga0163163_10035700 | |||
| 2546 | Ga0163163_10140778 | |||
| 2547 | Ga0163163_10614641 | |||
| 2548 | Ga0157380_10003632 | |||
| 2549 | Ga0157380_10133478 | |||
| 2550 | Ga0157380_10185561 | |||
| 2551 | Ga0157380_10236115 | |||
| 2552 | Ga0157377_10000432 | |||
| 2553 | Ga0157377_10081564 | |||
| 2554 | Ga0157377_10220246 | |||
| 2555 | Ga0157377_10399894 | |||
| 2556 | Ga0157379_10148279 | |||
| 2557 | Ga0157379_10333519 | |||
| 2558 | Ga0157379_10480655 | |||
| 2559 | Ga0157379_10896128 | |||
| 2560 | Ga0157376_10032211 | |||
| 2561 | Ga0157376_10048633 | |||
| 2562 | Ga0157376_10254265 | |||
| 2563 | Ga0182007_10064525 | |||
| 2564 | Ga0163161_10002081 | |||
| 2565 | Ga0163161_10022770 | |||
| 2566 | Ga0163161_10686903 | |||
| 2567 | Ga0206356_10720898 | |||
| 2568 | Ga0213873_10016781 | |||
| 2569 | Ga0213875_10072544 | |||
| 2570 | Ga0207666_1000028 | |||
| 2571 | Ga0209130_1031527 | |||
| 2572 | Ga0207673_1003204 | |||
| 2573 | Ga0209758_1000365 | |||
| 2574 | Ga0209256_1027726 | |||
| 2575 | Ga0207426_1000620 | |||
| 2576 | Ga0207426_1091643 | |||
| 2577 | Ga0209257_1024757 | |||
| 2578 | Ga0209257_1038323 | |||
| 2579 | Ga0207697_10043143 | |||
| 2580 | Ga0207697_10117666 | |||
| 2581 | Ga0207656_10095591 | |||
| 2582 | Ga0207656_10138308 | |||
| 2583 | Ga0207696_1029645 | |||
| 2584 | Ga0207655_1116701 | |||
| 2585 | Ga0207653_10006097 | |||
| 2586 | Ga0207682_10000640 | |||
| 2587 | Ga0207682_10002485 | |||
| 2588 | Ga0207682_10009098 | |||
| 2589 | Ga0207692_10003023 | |||
| 2590 | Ga0207692_10037773 | |||
| 2591 | Ga0207642_10022716 | |||
| 2592 | Ga0207642_10119391 | |||
| 2593 | Ga0207642_10417167 | |||
| 2594 | Ga0207710_10004196 | |||
| 2595 | Ga0207710_10008402 | |||
| 2596 | Ga0207710_10046025 | |||
| 2597 | Ga0207710_10106992 | |||
| 2598 | Ga0207710_10225945 | |||
| 2599 | Ga0207688_10000088 | |||
| 2600 | Ga0207688_10007354 | |||
| 2601 | Ga0207688_10026961 | |||
| 2602 | Ga0207688_10066454 | |||
| 2603 | Ga0207688_10096042 | |||
| 2604 | Ga0207688_10480997 | |||
| 2605 | Ga0207680_10060673 | |||
| 2606 | Ga0207680_10128477 | |||
| 2607 | Ga0207680_10311273 | |||
| 2608 | Ga0207680_10418409 | |||
| 2609 | Ga0207647_10030620 | |||
| 2610 | Ga0207647_10227752 | |||
| 2611 | Ga0207699_10025289 | |||
| 2612 | Ga0207699_10120198 | |||
| 2613 | Ga0207645_10002863 | |||
| 2614 | Ga0207645_10115125 | |||
| 2615 | Ga0207645_10146462 | |||
| 2616 | Ga0207645_10373518 | |||
| 2617 | Ga0207643_10000085 | |||
| 2618 | Ga0207643_10024148 | |||
| 2619 | Ga0207643_10037649 | |||
| 2620 | Ga0207684_10046815 | |||
| 2621 | Ga0207654_10000373 | |||
| 2622 | Ga0207654_10245862 | |||
| 2623 | Ga0207654_10553910 | |||
| 2624 | Ga0207695_10106623 | |||
| 2625 | Ga0207671_10160163 | |||
| 2626 | Ga0207671_10391560 | |||
| 2627 | Ga0207671_10484080 | |||
| 2628 | Ga0207693_10003902 | |||
| 2629 | Ga0207693_10019378 | |||
| 2630 | Ga0207693_10161394 | |||
| 2631 | Ga0207660_10220496 | |||
| 2632 | Ga0207662_10000339 | |||
| 2633 | Ga0207662_10020438 | |||
| 2634 | Ga0207662_10052177 | |||
| 2635 | Ga0207662_10067003 | |||
| 2636 | Ga0207657_10040320 | |||
| 2637 | Ga0207657_10066425 | |||
| 2638 | Ga0207657_10155102 | |||
| 2639 | Ga0207657_10439651 | |||
| 2640 | Ga0207657_10617051 | |||
| 2641 | Ga0207649_10151151 | |||
| 2642 | Ga0207649_10263137 | |||
| 2643 | Ga0207649_10315794 | |||
| 2644 | Ga0207649_10483364 | |||
| 2645 | Ga0207652_10328765 | |||
| 2646 | Ga0207652_10382514 | |||
| 2647 | Ga0207681_10002232 | |||
| 2648 | Ga0207681_10055014 | |||
| 2649 | Ga0207681_10151240 | |||
| 2650 | Ga0207681_10217859 | |||
| 2651 | Ga0207681_10357048 | |||
| 2652 | Ga0207681_10387612 | |||
| 2653 | Ga0207681_10773471 | |||
| 2654 | Ga0207694_10065814 | |||
| 2655 | Ga0207694_10307947 | |||
| 2656 | Ga0207650_10004558 | |||
| 2657 | Ga0207650_10019027 | |||
| 2658 | Ga0207650_10073393 | |||
| 2659 | Ga0207650_10542726 | |||
| 2660 | Ga0207659_10000200 | |||
| 2661 | Ga0207659_10057893 | |||
| 2662 | Ga0207659_10094040 | |||
| 2663 | Ga0207659_10153311 | |||
| 2664 | Ga0207659_10776934 | |||
| 2665 | Ga0207687_10015071 | |||
| 2666 | Ga0207687_10039006 | |||
| 2667 | Ga0207687_10127218 | |||
| 2668 | Ga0207687_10602183 | |||
| 2669 | Ga0207700_10051991 | |||
| 2670 | Ga0207700_10121169 | |||
| 2671 | Ga0207700_10584548 | |||
| 2672 | Ga0207664_10012242 | |||
| 2673 | Ga0207664_10042377 | |||
| 2674 | Ga0207664_10181896 | |||
| 2675 | Ga0207644_10000867 | |||
| 2676 | Ga0207644_10223595 | |||
| 2677 | Ga0207644_10431864 | |||
| 2678 | Ga0207644_10614865 | |||
| 2679 | Ga0207644_11029016 | |||
| 2680 | Ga0207690_10003950 | |||
| 2681 | Ga0207690_10011516 | |||
| 2682 | Ga0207690_10409120 | |||
| 2683 | Ga0207706_10017547 | |||
| 2684 | Ga0207706_10132071 | |||
| 2685 | Ga0207686_10001404 | |||
| 2686 | Ga0207686_10109020 | |||
| 2687 | Ga0207686_10220609 | |||
| 2688 | Ga0207686_10391527 | |||
| 2689 | Ga0207709_10001343 | |||
| 2690 | Ga0207709_10010649 | |||
| 2691 | Ga0207709_10081472 | |||
| 2692 | Ga0207709_10170268 | |||
| 2693 | Ga0207709_10214736 | |||
| 2694 | Ga0207709_10250423 | |||
| 2695 | Ga0207709_10780686 | |||
| 2696 | Ga0207670_10000398 | |||
| 2697 | Ga0207670_10049599 | |||
| 2698 | Ga0207670_10137623 | |||
| 2699 | Ga0207669_10000129 | |||
| 2700 | Ga0207669_10003951 | |||
| 2701 | Ga0207669_10004285 | |||
| 2702 | Ga0207669_10022028 | |||
| 2703 | Ga0207669_10101901 | |||
| 2704 | Ga0207669_10141449 | |||
| 2705 | Ga0207669_10571335 | |||
| 2706 | Ga0207704_10001904 | |||
| 2707 | Ga0207704_10012182 | |||
| 2708 | Ga0207704_10048853 | |||
| 2709 | Ga0207704_10356655 | |||
| 2710 | Ga0207704_10848757 | |||
| 2711 | Ga0207665_10001387 | |||
| 2712 | Ga0207665_10049257 | |||
| 2713 | Ga0207665_10078193 | |||
| 2714 | Ga0207665_10391624 | |||
| 2715 | Ga0207691_10069299 | |||
| 2716 | Ga0207691_10916550 | |||
| 2717 | Ga0207711_10017080 | |||
| 2718 | Ga0207711_10199467 | |||
| 2719 | Ga0207711_10763488 | |||
| 2720 | Ga0207689_10000547 | |||
| 2721 | Ga0207689_10339556 | |||
| 2722 | Ga0207661_10004288 | |||
| 2723 | Ga0207661_10050124 | |||
| 2724 | Ga0207661_10079137 | |||
| 2725 | Ga0207679_10000558 | |||
| 2726 | Ga0207679_10030376 | |||
| 2727 | Ga0207679_10206653 | |||
| 2728 | Ga0207667_10007300 | |||
| 2729 | Ga0207667_10119406 | |||
| 2730 | Ga0207667_10120691 | |||
| 2731 | Ga0207651_10000790 | |||
| 2732 | Ga0207651_10009960 | |||
| 2733 | Ga0207651_10055107 | |||
| 2734 | Ga0207651_10210802 | |||
| 2735 | Ga0207651_10331489 | |||
| 2736 | Ga0207651_10610433 | |||
| 2737 | Ga0207712_10007058 | |||
| 2738 | Ga0207712_10071902 | |||
| 2739 | Ga0207712_10399669 | |||
| 2740 | Ga0207668_10002729 | |||
| 2741 | Ga0207640_10058086 | |||
| 2742 | Ga0207640_10296952 | |||
| 2743 | Ga0207640_10455943 | |||
| 2744 | Ga0207658_10003874 | |||
| 2745 | Ga0207658_10016875 | |||
| 2746 | Ga0207658_10152763 | |||
| 2747 | Ga0207658_10549181 | |||
| 2748 | Ga0207658_11141663 | |||
| 2749 | Ga0207677_10005171 | |||
| 2750 | Ga0207677_10045803 | |||
| 2751 | Ga0207677_10313952 | |||
| 2752 | Ga0207677_10406995 | |||
| 2753 | Ga0207703_10000644 | |||
| 2754 | Ga0207703_10320184 | |||
| 2755 | Ga0207703_10567591 | |||
| 2756 | Ga0207703_10629172 | |||
| 2757 | Ga0207639_10034810 | |||
| 2758 | Ga0207678_10016400 | |||
| 2759 | Ga0207678_10020707 | |||
| 2760 | Ga0207678_10260816 | |||
| 2761 | Ga0207678_11113786 | |||
| 2762 | Ga0207708_10068669 | |||
| 2763 | Ga0207708_10185080 | |||
| 2764 | Ga0207708_10197695 | |||
| 2765 | Ga0207708_10220307 | |||
| 2766 | Ga0207702_10000243 | |||
| 2767 | Ga0207702_10012908 | |||
| 2768 | Ga0207702_10466793 | |||
| 2769 | Ga0207702_10776128 | |||
| 2770 | Ga0207702_11295314 | |||
| 2771 | Ga0207641_10001185 | |||
| 2772 | Ga0207641_10003587 | |||
| 2773 | Ga0207641_10072216 | |||
| 2774 | Ga0207641_10157664 | |||
| 2775 | Ga0207641_10248173 | |||
| 2776 | Ga0207641_10313507 | |||
| 2777 | Ga0207648_10002538 | |||
| 2778 | Ga0207648_10017413 | |||
| 2779 | Ga0207648_11143643 | |||
| 2780 | Ga0207676_10003948 | |||
| 2781 | Ga0207676_10007042 | |||
| 2782 | Ga0207676_10057920 | |||
| 2783 | Ga0207676_10064493 | |||
| 2784 | Ga0207676_10112099 | |||
| 2785 | Ga0207674_10018619 | |||
| 2786 | Ga0207674_10124866 | |||
| 2787 | Ga0207674_10606714 | |||
| 2788 | Ga0207675_100008179 | |||
| 2789 | Ga0207675_100061200 | |||
| 2790 | Ga0207675_100070938 | |||
| 2791 | Ga0207675_100077967 | |||
| 2792 | Ga0207675_100396191 | |||
| 2793 | Ga0207675_100699335 | |||
| 2794 | Ga0207683_10003695 | |||
| 2795 | Ga0207683_10005841 | |||
| 2796 | Ga0207683_10012937 | |||
| 2797 | Ga0207683_10022205 | |||
| 2798 | Ga0207683_10056654 | |||
| 2799 | Ga0207698_10065550 | |||
| 2800 | Ga0207698_10852441 | |||
| 2801 | Ga0209389_1000001 | |||
| 2802 | Ga0209589_1000033 | |||
| 2803 | Ga0209489_100040 | |||
| 2804 | Ga0209489_111101 | |||
| 2805 | Ga0209700_100007 | |||
| 2806 | Ga0209981_1022404 | |||
| 2807 | Ga0209996_1017111 | |||
| 2808 | Ga0209984_1002986 | |||
| 2809 | Ga0209995_1004548 | |||
| 2810 | Ga0209179_1007538 | |||
| 2811 | Ga0209999_1042680 | |||
| 2812 | Ga0209982_1004605 | |||
| 2813 | Ga0209970_1025045 | |||
| 2814 | Ga0210002_1002707 | |||
| 2815 | Ga0209983_1021928 | |||
| 2816 | Ga0209588_1017279 | |||
| 2817 | Ga0209971_1011063 | |||
| 2818 | Ga0209966_1000401 | |||
| 2819 | Ga0209813_10014033 | |||
| 2820 | Ga0209813_10066481 | |||
| 2821 | Ga0209813_10074315 | |||
| 2822 | Ga0207428_10000055 | |||
| 2823 | Ga0207428_10000664 | |||
| 2824 | Ga0207428_10004496 | |||
| 2825 | Ga0207428_10013539 | |||
| 2826 | Ga0207428_10038968 | |||
| 2827 | Ga0207428_10181740 | |||
| 2828 | Ga0207428_10231565 | |||
| 2829 | Ga0268266_10034374 | |||
| 2830 | Ga0268266_10075860 | |||
| 2831 | Ga0268266_10250329 | |||
| 2832 | Ga0268266_10271509 | |||
| 2833 | Ga0268266_10575926 | |||
| 2834 | Ga0268266_10773313 | |||
| 2835 | Ga0268266_10898176 | |||
| 2836 | Ga0268265_10011790 | |||
| 2837 | Ga0268265_10076192 | |||
| 2838 | Ga0268265_10699873 | |||
| 2839 | Ga0268265_10739965 | |||
| 2840 | Ga0268264_10049815 | |||
| 2841 | Ga0268264_10246818 | |||
| 2842 | Ga0268264_10840666 | |||
| 2843 | Ga0265318_10008361 | |||
| 2844 | Ga0307515_10573132 | |||
| 2845 | Ga0265338_10040637 | |||
| 2846 | Ga0265338_10243378 | |||
| 2847 | Ga0265338_10271405 | |||
| 2848 | Ga0265771_1001725 | |||
| 2849 | Ga0265330_10005858 | |||
| 2850 | Ga0265332_10000641 | |||
| 2851 | Ga0265332_10095195 | |||
| 2852 | Ga0265332_10201261 | |||
| 2853 | Ga0265320_10012872 | |||
| 2854 | Ga0265325_10005224 | |||
| 2855 | Ga0265325_10017063 | |||
| 2856 | Ga0265325_10035241 | |||
| 2857 | Ga0265329_10007481 | |||
| 2858 | Ga0265340_10004511 | |||
| 2859 | Ga0265340_10004663 | |||
| 2860 | Ga0265340_10010325 | |||
| 2861 | Ga0265340_10137825 | |||
| 2862 | Ga0265339_10003204 | |||
| 2863 | Ga0265339_10006269 | |||
| 2864 | Ga0265339_10086100 | |||
| 2865 | Ga0265331_10056584 | |||
| 2866 | Ga0265331_10069200 | |||
| 2867 | Ga0265316_10082491 | |||
| 2868 | Ga0265316_10153653 | |||
| 2869 | Ga0265316_10562091 | |||
| 2870 | Ga0265316_10574905 | |||
| 2871 | Ga0307513_10481132 | |||
| 2872 | Ga0307408_100265679 | |||
| 2873 | Ga0265313_10010495 | |||
| 2874 | Ga0265313_10020356 | |||
| 2875 | Ga0265313_10021730 | |||
| 2876 | Ga0265313_10050212 | |||
| 2877 | Ga0316575_10042005 | |||
| 2878 | Ga0265314_10012502 | |||
| 2879 | Ga0265342_10000282 | |||
| 2880 | Ga0265342_10011053 | |||
| 2881 | Ga0265342_10020118 | |||
| 2882 | Ga0265342_10343505 | |||
| 2883 | Ga0316576_10157407 | |||
| 2884 | Ga0316578_10034384 | |||
| 2885 | Ga0307516_10305913 | |||
| 2886 | Ga0316577_10230631 | |||
| 2887 | Ga0307413_10040352 | |||
| 2888 | Ga0307410_10024175 | |||
| 2889 | Ga0307410_10900364 | |||
| 2890 | Ga0307406_10031987 | |||
| 2891 | Ga0307406_11151487 | |||
| 2892 | Ga0307407_10053100 | |||
| 2893 | Ga0307412_10837602 | |||
| 2894 | Ga0307412_10917064 | |||
| 2895 | Ga0307409_100091683 | |||
| 2896 | Ga0307409_100521271 | |||
| 2897 | Ga0307409_100991263 | |||
| 2898 | Ga0307416_100098002 | |||
| 2899 | Ga0307411_10050524 | |||
| 2900 | Ga0307411_10521142 | |||
| 2901 | Ga0307411_10726885 | |||
| 2902 | Ga0307415_100636557 | |||
| 2903 | Ga0316583_10000114 | |||
| 2904 | Ga0307507_10164021 | |||
| 2905 | Ga0307510_10041923 | |||
| 2906 | Ga0373930_0000142 | |||
| 2907 | Ga0373948_0085747 | |||
| 2908 | Ga0373950_0000162 | |||
| 2909 | Ga0373958_0000310 | |||
| 2910 | Ga0373959_0001515 | |||
| 2911 | Ga0373959_0048333 | |||
| 2912 | Ga0373938_0000124 | |||
| 2913 | Ga0373938_0046958 | |||
| 2914 | Ga0373928_0000366 | |||
| 2915 | Ga0373928_0023056 | |||
| 2916 | Ga0373929_0000321 | |||
| 2917 | Ga0373934_0005198 | |||
| 2918 | Ga0373934_0136381 | |||
| 2919 | Ga0373940_0000053 | |||
| 2920 | Ga0373944_0158725 | |||
| 2921 | Ga0373949_0000761 | |||
| 2922 | Ga0373949_0043436 | |||
| 2923 | Ga0373951_0005041 | |||
| 2924 | Ga0373951_0115354 | |||
| 2925 | Ga0373952_0000668 | |||
| 2926 | Ga0373952_0049121 | |||
| 2927 | Ga0373923_0003286 | |||
| 2928 | Ga0373923_0193464 | |||
| 2929 | Ga0373932_0137000 | |||
| 2930 | Ga0373932_0228937 | |||
| 2931 | Ga0373936_0013171 | |||
| 2932 | Ga0373936_0036262 | |||
| 2933 | Ga0373936_0049667 | |||
| 2934 | Ga0373936_0125661 | |||
| 2935 | Ga0373936_0313487 | |||
| 2936 | Ga0373939_0000855 | |||
| 2937 | Ga0373939_0011251 | |||
| 2938 | Ga0373939_0084704 | |||
| 2939 | Ga0373939_0108185 | |||
| 2940 | Ga0373945_0084067 | |||
| 2941 | Ga0373953_0008645 | |||
| 2942 | Ga0373953_0012266 | |||
| 2943 | Ga0373953_0016153 | |||
| 2944 | Ga0373953_0029442 | |||
| 2945 | Ga0373953_0074233 | |||
| 2946 | Ga0373954_0001141 | |||
| 2947 | Ga0373954_0012463 | |||
| 2948 | Ga0373954_0014468 | |||
| 2949 | Ga0373954_0015482 | |||
| 2950 | Ga0373956_0001770 | |||
| 2951 | Ga0373956_0007856 | |||
| 2952 | Ga0373956_0081040 | |||
| 2953 | Ga0373957_0003776 | |||
| 2954 | Ga0373957_0042367 | |||
| 2955 | Ga0373960_0001357 | |||
| 2956 | Ga0373960_0030810 | |||
| 2957 | Ga0373943_0124400 | |||
| 2958 | Ga0373943_0154707 | |||
| 2959 | Ga0373943_0244481 | |||
| 2960 | Ga0373946_0071296 | |||
| 2961 | Ga0373946_0081077 | |||
| 2962 | Ga0373946_0092999 | |||
| 2963 | Ga0373946_0207943 | |||
| 2964 | Ga0373946_0334029 | |||
| 2965 | Ga0373955_0001039 | |||
| 2966 | Ga0373955_0010151 | |||
| 2967 | Ga0373955_0039022 | |||
| 2968 | Ga0373955_0040170 | |||
| 2969 | Ga0373955_0323326 | |||
| 2970 | Ga0373942_0004939 | |||
| 2971 | Ga0373942_0050359 | |||
| 2972 | Ga0373961_0033135 | |||
| 2973 | Ga0373961_0051661 | |||
| 2974 | Ga0373961_0142071 | |||
| 2975 | Ga0373962_0000078 | |||
| 2976 | Ga0373962_0078897 | |||
| 2977 | Ga0316574_0020651 | |||
| 2978 | Ga0373924_0002945 | |||
| 2979 | Ga0373924_0010518 | |||
| 2980 | Ga0373924_0041585 | |||
| 2981 | Ga0373924_0073796 | |||
| 2982 | Ga0373931_0003029 | |||
| 2983 | Ga0373931_0007166 | |||
| 2984 | Ga0373931_0031269 | |||
| 2985 | Ga0373931_0047034 | |||
| 2986 | Ga0373931_0052636 | |||
| 2987 | Ga0373931_0126248 | |||
| 2988 | Ga0373931_0723548 | |||
| 2989 | Ga0373935_0042469 | |||
| 2990 | Ga0373935_0055098 | |||
| 2991 | Ga0373935_0243077 | |||
| 2992 | Ga0373935_0272398 | |||
| 2993 | Ga0373935_0345596 | |||
| 2994 | Ga0373935_0500773 | |||
| 2995 | Ga0373927_0002439 | |||
| 2996 | Ga0373927_0035146 | |||
| 2997 | Ga0373927_0039369 | |||
| 2998 | Ga0373927_0074463 | |||
| 2999 | Ga0373933_0001176 | |||
| 3000 | Ga0373933_0003616 | |||
| 3001 | Ga0373933_0005523 | |||
| 3002 | Ga0373933_0020771 | |||
| 3003 | Ga0373933_0038938 | |||
| 3004 | Ga0373933_0586954 | |||
| 3005 | Ga0373933_0845074 | |||
| 3006 | Ga0373947_0011631 | |||
| 3007 | Ga0373947_0012163 | |||
| 3008 | Ga0373947_0166705 | |||
| 3009 | Ga0373947_0217401 | |||
| 3010 | Ga0373937_0004370 | |||
| 3011 | Ga0373937_0007299 | |||
| 3012 | Ga0373937_0012395 | |||
| 3013 | Ga0373937_0016330 | |||
| 3014 | Ga0373937_0027073 | |||
| 3015 | Ga0373937_0047990 | |||
| 3016 | Ga0373937_0328431 | |||
| 3017 | Ga0373937_0749498 | |||
| 3018 | Ga0316582_0222711 | |||
| 3019 | Ga0316584_0013710 | |||
| 3020 | Ga0373925_0033621 | |||
| 3021 | Ga0373925_0058797 | |||
| 3022 | Ga0373925_0059519 | |||
| 3023 | Ga0373925_0060739 | |||
| 3024 | Ga0373925_0109019 | |||
| 3025 | Ga0373925_0253366 | |||
| 3026 | Ga0373925_0258352 | |||
| 3027 | Ga0373925_0379881 | |||
| 3028 | Ga0373925_0680786 | |||
| 3029 | Ga0395900_0001529 | |||
| 3030 | Ga0395898_0005283 | |||
| 3031 | Ga0395898_0100534 | |||
| 3032 | Ga0395905_0009682 | |||
| 3033 | Ga0395905_0352196 | |||
| 3034 | Ga0395905_0624396 | |||
| 3035 | Ga0436364_0151426 | |||
| 3036 | Ga0436364_0178002 | |||
| 3037 | Ga0436364_0449892 | |||
| 3038 | Ga0436364_0682938 | |||
| 3039 | Ga0436364_0690770 | |||
| 3040 | Ga0395901_0011625 | |||
| 3041 | Ga0395901_0118144 | |||
| 3042 | Ga0242420_016255 | |||
| 3043 | Ga0436365_0062708 | |||
| 3044 | Ga0436365_0191965 | |||
| 3045 | Ga0436365_0343292 | |||
| 3046 | Ga0436360_0579576 | |||
| 3047 | Ga0436360_0996754 | |||
| 3048 | Ga0436361_0357546 | |||
| 3049 | Ga0436363_0511827 | |||
| 3050 | Ga0436363_0597243 | |||
| 3051 | Ga0436363_0655408 | |||
| 3052 | Ga0436363_0767052 | |||
| 3053 | Ga0436363_1430348 | |||
| 3054 | Ga0436362_0173083 | |||
| 3055 | Ga0436362_0297855 | |||
| 3056 | Ga0436362_1296428 | |||
| 3057 | Ga0439453_0000053 | |||
| 3058 | Ga0439453_0008707 | |||
| 3059 | Ga0439466_0167669 | |||
| 3060 | Ga0439465_0049910 | |||
| 3061 | Ga0451787_808973 | |||
| 3062 | Ga0451791_1200117 | |||
| 3063 | Ga0451793_1238971 | |||
| 3064 | Ga0451797_0556017 | |||
| 3065 | Ga0451795_0815001 | |||
| 3066 | Ga0451802_1763825 | |||
| 3067 | Ga0451807_0886678 | |||
| 3068 | Ga0451807_2188998 | |||
| 3069 | Ga0451835_0276910 | |||
| 3070 | Ga0451845_0923467 | |||
| 3071 | Ga0451847_0233955 | |||
| 3072 | Ga0439443_004635 | |||
| 3073 | Ga0439445_0044869 | |||
| 3074 | Ga0439448_0120978 | |||
| 3075 | Ga0439450_057016 | |||
| 3076 | Ga0439455_0100033 | |||
| 3077 | Ga0439463_019984 | |||
| 3078 | Ga0439446_0042517 | |||
| 3079 | Ga0439446_0092976 | |||
| 3080 | Ga0439458_0101087 | |||
| 3081 | Ga0439435_0000678 | |||
| 3082 | Ga0439459_0007786 | |||
| 3083 | Ga0439464_0012113 | |||
| 3084 | Ga0439464_0057733 | |||
| 3085 | Ga0439460_0038009 | |||
| 3086 | Ga0451577_0171992 | |||
| 3087 | Ga0439440_0056720 | |||
| 3088 | Ga0466969_0020427 | |||
| 3089 | Ga0466972_0000333 | |||
| 3090 | Ga0466972_0208586 | |||
| 3091 | Ga0466966_0046761 | |||
| 3092 | Ga0466963_0339535 | |||
| 3093 | Ga0453684_1652533 | |||
| 3094 | Ga0466968_0010020 | |||
| 3095 | Ga0466968_0413493 | |||
| 3096 | Ga0466957_0063718 | |||
| 3097 | Ga0466957_0172040 | |||
| 3098 | Ga0466960_0009504 | |||
| 3099 | Ga0466960_0043264 | |||
| 3100 | Ga0466959_0177173 | |||
| 3101 | Ga0451576_1208535 | |||
| 3102 | Ga0466958_0060744 | |||
| 3103 | Ga0466967_0047293 | |||
| 3104 | Ga0466967_0611811 | |||
| 3105 | Ga0495627_050057 | |||
| 3106 | Ga0495592_0001529 | |||
| 3107 | Ga0495592_0002728 | |||
| 3108 | Ga0495592_0004236 | |||
| 3109 | Ga0495592_0045149 | |||
| 3110 | Ga0495592_0122154 | |||
| 3111 | Ga0495592_0145649 | |||
| 3112 | Ga0495592_0278130 | |||
| 3113 | Ga0495603_0035549 | |||
| 3114 | Ga0495603_0066995 | |||
| 3115 | Ga0495590_0014239 | |||
| 3116 | Ga0495590_0049465 | |||
| 3117 | Ga0495629_0003844 | |||
| 3118 | Ga0495629_0005031 | |||
| 3119 | Ga0495629_0108958 | |||
| 3120 | Ga0495629_0143127 | |||
| 3121 | Ga0495629_0153766 | |||
| 3122 | Ga0495629_0707691 | |||
| 3123 | Ga0495638_0023480 | |||
| 3124 | Ga0495638_0047066 | |||
| 3125 | Ga0495641_0051051 | |||
| 3126 | Ga0495641_0207686 | |||
| 3127 | Ga0495651_0001050 | |||
| 3128 | Ga0495651_0023047 | |||
| 3129 | Ga0495651_0028941 | |||
| 3130 | Ga0495653_0000513 | |||
| 3131 | Ga0495653_0005821 | |||
| 3132 | Ga0495653_0012012 | |||
| 3133 | Ga0495653_0049040 | |||
| 3134 | Ga0495650_0051836 | |||
| 3135 | Ga0495650_0055945 | |||
| 3136 | Ga0495582_0100275 | |||
| 3137 | Ga0495582_0159047 | |||
| 3138 | Ga0495605_0036148 | |||
| 3139 | Ga0495605_0062814 | |||
| 3140 | Ga0495605_0076397 | |||
| 3141 | Ga0495639_0031208 | |||
| 3142 | Ga0495639_0089626 | |||
| 3143 | Ga0495639_0124961 | |||
| 3144 | Ga0495639_0370037 | |||
| 3145 | Ga0495639_0458663 | |||
| 3146 | Ga0495662_0130354 | |||
| 3147 | Ga0495664_0015254 | |||
| 3148 | Ga0495664_0077438 | |||
| 3149 | Ga0495664_0079992 | |||
| 3150 | Ga0495664_0165213 | |||
| 3151 | Ga0495664_0254309 | |||
| 3152 | Ga0495664_0308653 | |||
| 3153 | Ga0495664_0427658 | |||
| 3154 | Ga0495584_0098425 | |||
| 3155 | Ga0495584_0118134 | |||
| 3156 | Ga0495584_0157352 | |||
| 3157 | Ga0495584_0201040 | |||
| 3158 | Ga0495585_0036252 | |||
| 3159 | Ga0495585_0049564 | |||
| 3160 | Ga0495585_0164648 | |||
| 3161 | Ga0495594_0139803 | |||
| 3162 | Ga0495596_0017806 | |||
| 3163 | Ga0495596_0053354 | |||
| 3164 | Ga0495596_0091482 | |||
| 3165 | Ga0495583_0095999 | |||
| 3166 | Ga0495583_0311352 | |||
| 3167 | Ga0495606_0038140 | |||
| 3168 | Ga0495608_0000910 | |||
| 3169 | Ga0495608_0004294 | |||
| 3170 | Ga0495608_0012541 | |||
| 3171 | Ga0495608_0097283 | |||
| 3172 | Ga0495608_0127816 | |||
| 3173 | Ga0495610_0031329 | |||
| 3174 | Ga0495616_0019622 | |||
| 3175 | Ga0495616_0093382 | |||
| 3176 | Ga0495618_0013782 | |||
| 3177 | Ga0495618_0027302 | |||
| 3178 | Ga0495618_0057323 | |||
| 3179 | Ga0495618_0060670 | |||
| 3180 | Ga0495618_0139691 | |||
| 3181 | Ga0495628_0001000 | |||
| 3182 | Ga0495628_0005038 | |||
| 3183 | Ga0495628_0007197 | |||
| 3184 | Ga0495628_0054618 | |||
| 3185 | Ga0495628_0660412 | |||
| 3186 | Ga0495630_0035402 | |||
| 3187 | Ga0495630_0218915 | |||
| 3188 | Ga0495630_0590567 | |||
| 3189 | Ga0495631_0053956 | |||
| 3190 | Ga0495631_0191919 | |||
| 3191 | Ga0495632_0144704 | |||
| 3192 | Ga0495632_0145487 | |||
| 3193 | Ga0495637_0077466 | |||
| 3194 | Ga0495637_0101462 | |||
| 3195 | Ga0495643_0003266 | |||
| 3196 | Ga0495644_0031147 | |||
| 3197 | Ga0495644_0089326 | |||
| 3198 | Ga0495666_0060266 | |||
| 3199 | Ga0495642_0022245 | |||
| 3200 | Ga0495652_0004645 | |||
| 3201 | Ga0495652_0020289 | |||
| 3202 | Ga0495652_0021614 | |||
| 3203 | Ga0495652_0108100 | |||
| 3204 | Ga0495652_0267732 | |||
| 3205 | Ga0495652_0338793 | |||
| 3206 | Ga0495652_0382011 | |||
| 3207 | Ga0495652_0383544 | |||
| 3208 | Ga0495654_0209825 | |||
| 3209 | Ga0495654_0329971 | |||
| 3210 | Ga0495640_0014255 | |||
| 3211 | Ga0495640_0027945 | |||
| 3212 | Ga0495640_0048808 | |||
| 3213 | Ga0495640_0071628 | |||
| 3214 | Ga0495640_0130972 | |||
| 3215 | Ga0495640_0182841 | |||
| 3216 | Ga0495640_0195587 | |||
| 3217 | Ga0495586_0031809 | |||
| 3218 | Ga0495587_0004074 | |||
| 3219 | Ga0495587_0005057 | |||
| 3220 | Ga0495587_0017667 | |||
| 3221 | Ga0495587_0021173 | |||
| 3222 | Ga0495587_0219467 | |||
| 3223 | Ga0495587_0305160 | |||
| 3224 | Ga0495598_0008957 | |||
| 3225 | Ga0495598_0087453 | |||
| 3226 | Ga0495609_0023003 | |||
| 3227 | Ga0495609_0135281 | |||
| 3228 | Ga0495621_0004613 | |||
| 3229 | Ga0495621_0019734 | |||
| 3230 | Ga0495621_0075419 | |||
| 3231 | Ga0495597_0022020 | |||
| 3232 | Ga0495597_0091715 | |||
| 3233 | Ga0495645_0000411 | |||
| 3234 | Ga0495645_0006906 | |||
| 3235 | Ga0495645_0010435 | |||
| 3236 | Ga0495645_0010890 | |||
| 3237 | Ga0495645_0218221 | |||
| 3238 | Ga0495622_0004278 | |||
| 3239 | Ga0495622_0078279 | |||
| 3240 | Ga0495622_0108318 | |||
| 3241 | Ga0495633_0031508 | |||
| 3242 | Ga0495633_0045705 | |||
| 3243 | Ga0495667_0000399 | |||
| 3244 | Ga0495667_0003789 | |||
| 3245 | Ga0495667_0006144 | |||
| 3246 | Ga0495667_0130731 | |||
| 3247 | Ga0495667_0259461 | |||
| 3248 | Ga0495656_0026731 | |||
| 3249 | Ga0495656_0034480 | |||
| 3250 | Ga0495668_0055740 | |||
| 3251 | Ga0495668_0139956 | |||
| 3252 | Ga0495634_0031038 | |||
| 3253 | Ga0495634_0038394 | |||
| 3254 | Ga0495634_0093363 | |||
| 3255 | Ga0495634_0118730 | |||
| 3256 | Ga0495634_0164049 | |||
| 3257 | Ga0495611_0014614 | |||
| 3258 | Ga0495611_0180671 | |||
| 3259 | Ga0495625_0065754 | |||
| 3260 | Ga0495625_0483772 | |||
| 3261 | Ga0495635_0000211 | |||
| 3262 | Ga0495635_0001031 | |||
| 3263 | Ga0495635_0023129 | |||
| 3264 | Ga0495635_0023663 | |||
| 3265 | Ga0495635_0038006 | |||
| 3266 | Ga0495659_0008931 | |||
| 3267 | Ga0495588_0046496 | |||
| 3268 | Ga0495657_0001810 | |||
| 3269 | Ga0495657_0002321 | |||
| 3270 | Ga0495657_0141925 | |||
| 3271 | Ga0495657_0180227 | |||
| 3272 | Ga0495599_0000957 | |||
| 3273 | Ga0495599_0027152 | |||
| 3274 | Ga0495599_0031838 | |||
| 3275 | Ga0495599_0083380 | |||
| 3276 | Ga0495599_0458834 | |||
| 3277 | Ga0495623_0005094 | |||
| 3278 | Ga0495623_0005834 | |||
| 3279 | Ga0495623_0013653 | |||
| 3280 | Ga0495623_0013867 | |||
| 3281 | Ga0495623_0038133 | |||
| 3282 | Ga0495646_0001814 | |||
| 3283 | Ga0495646_0004069 | |||
| 3284 | Ga0495646_0072401 | |||
| 3285 | Ga0495647_0049450 | |||
| 3286 | Ga0495647_0061242 | |||
| 3287 | Ga0495647_0252117 | |||
| 3288 | Ga0495658_0026853 | |||
| 3289 | Ga0495658_0081955 | |||
| 3290 | Ga0495658_0112671 | |||
| 3291 | Ga0495658_0366583 | |||
| 3292 | Ga0495669_0023843 | |||
| 3293 | Ga0495613_0008427 | |||
| 3294 | Ga0495613_0032899 | |||
| 3295 | Ga0495613_0211295 | |||
| 3296 | Ga0495624_0050047 | |||
| 3297 | Ga0495624_0495348 | |||
| 3298 | Ga0495670_0380480 | |||
| 3299 | Ga0495671_0129106 | |||
| 3300 | Ga0495671_0183339 | |||
| 3301 | Ga0495671_0189079 | |||
| 3302 | Ga0495649_0033966 | |||
| 3303 | Ga0495649_0135354 | |||
| 3304 | Ga0495649_0313912 | |||
| 3305 | Ga0495589_0080801 | |||
| 3306 | Ga0495600_0006411 | |||
| 3307 | Ga0495600_0013832 | |||
| 3308 | Ga0495600_0019824 | |||
| 3309 | Ga0495600_0291696 | |||
| 3310 | Ga0495600_0294156 | |||
| 3311 | Ga0495660_0189023 | |||
| 3312 | Ga0495581_0235415 | |||
| 3313 | Ga0495581_0423308 | |||
| 3314 | Ga0495604_0002733 | |||
| 3315 | Ga0495604_0006074 | |||
| 3316 | Ga0495604_0006930 | |||
| 3317 | Ga0495604_0009592 | |||
| 3318 | Ga0495604_0010845 | |||
| 3319 | Ga0495604_0589279 | |||
| 3320 | Ga0495636_0046748 | |||
| 3321 | Ga0495636_0048470 | |||
| 3322 | Ga0495674_0001693 | |||
| 3323 | Ga0495674_0013996 | |||
| 3324 | Ga0495674_0030166 | |||
| 3325 | Ga0495674_0031972 | |||
| 3326 | Ga0495674_0050926 | |||
| 3327 | Ga0495674_0055361 | |||
| 3328 | Ga0495674_0103100 | |||
| 3329 | Ga0495674_0134788 | |||
| 3330 | Ga0495674_0393229 | |||
| 3331 | Ga0495672_0037216 | |||
| 3332 | Ga0495672_0053767 | |||
| 3333 | Ga0495672_0061604 | |||
| 3334 | Ga0495672_0068356 | |||
| 3335 | Ga0495672_0088611 | |||
| 3336 | Ga0495672_0096380 | |||
| 3337 | Ga0495672_0111174 | |||
| 3338 | Ga0495672_0206936 | |||
| 3339 | Ga0495672_0215598 | |||
| 3340 | Ga0495676_0203139 | |||
| 3341 | Ga0495676_0247761 | |||
| 3342 | Ga0495676_0356239 | |||
| 3343 | Ga0495680_0001112 | |||
| 3344 | Ga0495680_0004228 | |||
| 3345 | Ga0495680_0006158 | |||
| 3346 | Ga0495680_0021510 | |||
| 3347 | Ga0495680_0044833 | |||
| 3348 | Ga0495680_0072530 | |||
| 3349 | Ga0495680_0308760 | |||
| 3350 | Ga0495680_0310922 | |||
| 3351 | Ga0495680_0537376 | |||
| 3352 | Ga0495683_0037174 | |||
| 3353 | Ga0495683_0203472 | |||
| 3354 | Ga0495687_010582 | |||
| 3355 | Ga0495687_099324 | |||
| 3356 | Ga0495675_0001324 | |||
| 3357 | Ga0495675_0007639 | |||
| 3358 | Ga0495675_0025334 | |||
| 3359 | Ga0495675_0083197 | |||
| 3360 | Ga0495675_0184389 | |||
| 3361 | Ga0495684_0015971 | |||
| 3362 | Ga0495684_0020317 | |||
| 3363 | Ga0495684_0029872 | |||
| 3364 | Ga0495684_0037641 | |||
| 3365 | Ga0495684_0266704 | |||
| 3366 | Ga0495686_0034271 | |||
| 3367 | Ga0495686_0220937 | |||
| 3368 | Ga0495593_0002923 | |||
| 3369 | Ga0495593_0036009 | |||
| 3370 | Ga0495593_0127282 | |||
| 3371 | Ga0495602_0000965 | |||
| 3372 | Ga0495602_0006595 | |||
| 3373 | Ga0495602_0008570 | |||
| 3374 | Ga0495602_0041931 | |||
| 3375 | Ga0495602_0213520 | |||
| 3376 | Ga0495602_0307064 | |||
| 3377 | Ga0495615_0001775 | |||
| 3378 | Ga0495615_0002752 | |||
| 3379 | Ga0495615_0008706 | |||
| 3380 | Ga0495615_0050964 | |||
| 3381 | Ga0495626_0019232 | |||
| 3382 | Ga0496100_0002382 | |||
| 3383 | Ga0496100_0014232 | |||
| 3384 | Ga0496100_0047643 | |||
| 3385 | Ga0496100_0057810 | |||
| 3386 | Ga0496100_0111412 | |||
| 3387 | Ga0496100_0257738 | |||
| 3388 | Ga0496100_0264505 | |||
| 3389 | Ga0496100_0305837 | |||
| 3390 | Ga0496101_0006609 | |||
| 3391 | Ga0496101_0012677 | |||
| 3392 | Ga0496101_0022688 | |||
| 3393 | Ga0496101_0047225 | |||
| 3394 | Ga0496101_0163170 | |||
| 3395 | Ga0496101_0641045 | |||
| 3396 | Ga0496102_0010844 | |||
| 3397 | Ga0496102_0020999 | |||
| 3398 | Ga0496102_0045634 | |||
| 3399 | Ga0496102_0046713 | |||
| 3400 | Ga0496102_0082115 | |||
| 3401 | Ga0496102_0105735 | |||
| 3402 | Ga0496102_0304428 | |||
| 3403 | Ga0496102_0342681 | |||
| 3404 | Ga0496102_0585870 | |||
| 3405 | Ga0496103_0001419 | |||
| 3406 | Ga0496103_0002062 | |||
| 3407 | Ga0496103_0023756 | |||
| 3408 | Ga0496103_0051560 | |||
| 3409 | Ga0496103_0072196 | |||
| 3410 | Ga0496103_0113002 | |||
| 3411 | Ga0496103_0241484 | |||
| 3412 | Ga0496104_0000140 | |||
| 3413 | Ga0496104_0004452 | |||
| 3414 | Ga0496104_0008421 | |||
| 3415 | Ga0496104_0039302 | |||
| 3416 | Ga0496104_0058499 | |||
| 3417 | Ga0496104_0071910 | |||
| 3418 | Ga0496104_0090536 | |||
| 3419 | Ga0496104_0111274 | |||
| 3420 | Ga0496104_0143567 | |||
| 3421 | Ga0496104_0161654 | |||
| 3422 | Ga0496104_0182846 | |||
| 3423 | Ga0496104_0383469 | |||
| 3424 | Ga0496104_0463606 | |||
| 3425 | Ga0496104_0465559 | |||
| 3426 | Ga0496104_0584170 | |||
| 3427 | Ga0496105_0000043 | |||
| 3428 | Ga0496105_0001390 | |||
| 3429 | Ga0496105_0006096 | |||
| 3430 | Ga0496105_0006732 | |||
| 3431 | Ga0496105_0025833 | |||
| 3432 | Ga0496105_0066445 | |||
| 3433 | Ga0496105_0068744 | |||
| 3434 | Ga0496105_0210178 | |||
| 3435 | Ga0496105_0232880 | |||
| 3436 | Ga0496105_0351797 | |||
| 3437 | Ga0496105_0359571 | |||
| 3438 | Ga0496105_0461199 | |||
| 3439 | Ga0496106_0005076 | |||
| 3440 | Ga0496106_0006330 | |||
| 3441 | Ga0496106_0006503 | |||
| 3442 | Ga0496106_0014137 | |||
| 3443 | Ga0496106_0035723 | |||
| 3444 | Ga0496106_0107271 | |||
| 3445 | Ga0496106_0132066 | |||
| 3446 | Ga0496106_0188677 | |||
| 3447 | Ga0496106_0332789 | |||
| 3448 | Ga0496106_0909481 | |||
| 3449 | Ga0496107_0006319 | |||
| 3450 | Ga0496107_0014188 | |||
| 3451 | Ga0496107_0017343 | |||
| 3452 | Ga0496107_0019745 | |||
| 3453 | Ga0496107_0034155 | |||
| 3454 | Ga0496107_0065142 | |||
| 3455 | Ga0496107_0210274 | |||
| 3456 | Ga0496107_0420564 | |||
| 3457 | Ga0496107_0665198 | |||
| 3458 | Ga0496108_0000449 | |||
| 3459 | Ga0496108_0000845 | |||
| 3460 | Ga0496108_0001227 | |||
| 3461 | Ga0496108_0018642 | |||
| 3462 | Ga0496108_0022690 | |||
| 3463 | Ga0496108_0067630 | |||
| 3464 | Ga0496108_0115483 | |||
| 3465 | Ga0496108_0296107 | |||
| 3466 | Ga0496108_0466440 | |||
| 3467 | Ga0496108_0471213 | |||
| 3468 | Ga0496108_0624047 | |||
| 3469 | Ga0496109_0000592 | |||
| 3470 | Ga0496109_0000896 | |||
| 3471 | Ga0496109_0001611 | |||
| 3472 | Ga0496109_0002747 | |||
| 3473 | Ga0496109_0052497 | |||
| 3474 | Ga0496109_0159366 | |||
| 3475 | Ga0496109_0170979 | |||
| 3476 | Ga0496109_0271921 | |||
| 3477 | Ga0496109_0514765 | |||
| 3478 | Ga0496109_0605327 | |||
| 3479 | Ga0496109_0728453 | |||
| 3480 | Ga0496110_0025034 | |||
| 3481 | Ga0496110_0040389 | |||
| 3482 | Ga0496110_0054663 | |||
| 3483 | Ga0496110_0060173 | |||
| 3484 | Ga0496110_0068694 | |||
| 3485 | Ga0496110_0117351 | |||
| 3486 | Ga0496110_0156060 | |||
| 3487 | Ga0496110_0181993 | |||
| 3488 | Ga0496110_0213957 | |||
| 3489 | Ga0496110_0325869 | |||
| 3490 | Ga0496110_0460770 | |||
| 3491 | Ga0496110_0572726 | |||
| 3492 | Ga0496111_0001189 | |||
| 3493 | Ga0496111_0001965 | |||
| 3494 | Ga0496111_0041773 | |||
| 3495 | Ga0496111_0048896 | |||
| 3496 | Ga0496111_0092622 | |||
| 3497 | Ga0496111_0148066 | |||
| 3498 | Ga0496111_0212255 | |||
| 3499 | Ga0496111_0349793 | |||
| 3500 | Ga0496112_0001178 | |||
| 3501 | Ga0496112_0002006 | |||
| 3502 | Ga0496112_0010720 | |||
| 3503 | Ga0496112_0014863 | |||
| 3504 | Ga0496112_0017698 | |||
| 3505 | Ga0496112_0030697 | |||
| 3506 | Ga0496112_0345767 | |||
| 3507 | Ga0496112_0432434 | |||
| 3508 | Ga0496112_0611316 | |||
| 3509 | Ga0496112_0737280 | |||
| 3510 | Ga0496113_0000507 | |||
| 3511 | Ga0496113_0000911 | |||
| 3512 | Ga0496113_0001342 | |||
| 3513 | Ga0496113_0016467 | |||
| 3514 | Ga0496113_0042838 | |||
| 3515 | Ga0496113_0932551 | |||
| 3516 | Ga0496114_0003476 | |||
| 3517 | Ga0496114_0007914 | |||
| 3518 | Ga0496114_0054340 | |||
| 3519 | Ga0496114_0154390 | |||
| 3520 | Ga0496114_0193357 | |||
| 3521 | Ga0496114_0222469 | |||
| 3522 | Ga0496114_0354882 | |||
| 3523 | Ga0496115_0001082 | |||
| 3524 | Ga0496115_0015997 | |||
| 3525 | Ga0496115_0030182 | |||
| 3526 | Ga0496115_0033375 | |||
| 3527 | Ga0496115_0056942 | |||
| 3528 | Ga0496115_0067466 | |||
| 3529 | Ga0496115_0082658 | |||
| 3530 | Ga0496115_0153536 | |||
| 3531 | Ga0496115_0211374 | |||
| 3532 | Ga0496115_0281254 | |||
| 3533 | Ga0496115_0411480 | |||
| 3534 | Ga0496115_0593531 | |||
| 3535 | Ga0496115_0793748 | |||
| 3536 | Ga0496115_0795474 | |||
| 3537 | Ga0496116_0172725 | |||
| 3538 | Ga0496117_0039541 | |||
| 3539 | Ga0496117_0284201 | |||
| 3540 | Ga0496118_0003113 | |||
| 3541 | Ga0496118_0012566 | |||
| 3542 | Ga0496119_0024068 | |||
| 3543 | Ga0496119_0111262 | |||
| 3544 | Ga0496119_0178687 | |||
| 3545 | Ga0496120_0116930 | |||
| 3546 | Ga0496120_0294849 | |||
| 3547 | Ga0496120_0374167 | |||
| 3548 | Ga0496121_0000886 | |||
| 3549 | Ga0496121_0002017 | |||
| 3550 | Ga0496121_0017513 | |||
| 3551 | Ga0496121_0049748 | |||
| 3552 | Ga0496121_0215718 | |||
| 3553 | Ga0496121_0255633 | |||
| 3554 | Ga0496122_0071623 | |||
| 3555 | Ga0496124_0013881 | |||
| 3556 | Ga0496124_0144905 | |||
| 3557 | Ga0496124_0156452 | |||
| 3558 | Ga0496125_0018812 | |||
| 3559 | Ga0496125_0034757 | |||
| 3560 | Ga0496125_0050051 | |||
| 3561 | Ga0496125_0181019 | |||
| 3562 | Ga0496126_0017266 | |||
| 3563 | Ga0496126_0044034 | |||
| 3564 | Ga0496126_0076736 | |||
| 3565 | Ga0496126_0166185 | |||
| 3566 | Ga0496126_0963885 | |||
| 3567 | Ga0501309_024232 | |||
| 3568 | Ga0495678_037461 | |||
| 3569 | Ga0495682_0045975 | |||
| 3570 | Ga0495682_0082909 | |||
| 3571 | Ga0501033_0134455 | |||
| 3572 | Ga0501033_0164043 | |||
| 3573 | Ga0501034_0073120 | |||
| 3574 | Ga0501034_0675434 | |||
| 3575 | Ga0501036_0063664 | |||
| 3576 | Ga0501036_0200803 | |||
| 3577 | Ga0501036_0448230 | |||
| 3578 | Ga0501037_0272014 | |||
| 3579 | Ga0501038_0093943 | |||
| 3580 | Ga0501038_0375293 | |||
| 3581 | Ga0501038_0410248 | |||
| 3582 | Ga0501039_0144968 | |||
| 3583 | Ga0501041_0043056 | |||
| 3584 | Ga0501042_0393614 | |||
| 3585 | Ga0501043_0584704 | |||
| 3586 | Ga0501046_0026812 | |||
| 3587 | Ga0501046_0249702 | |||
| 3588 | Ga0501047_0108340 | |||
| 3589 | Ga0501047_0701833 | |||
| 3590 | Ga0501048_0333066 | |||
| 3591 | Ga0501048_0395781 | |||
| 3592 | Ga0501048_0695419 | |||
| 3593 | Ga0501067_0029147 | |||
| 3594 | Ga0501068_0336607 | |||
| 3595 | Ga0501070_0049621 | |||
| 3596 | Ga0501071_0101042 | |||
| 3597 | Ga0501071_0175580 | |||
| 3598 | Ga0501071_0227380 | |||
| 3599 | Ga0501071_0964315 | |||
| 3600 | Ga0501072_0008000 | |||
| 3601 | Ga0501072_0017905 | |||
| 3602 | Ga0501072_0352048 | |||
| 3603 | Ga0501073_0074697 | |||
| 3604 | Ga0501073_0405085 | |||
| 3605 | Ga0501073_0639138 | |||
| 3606 | Ga0501075_0020214 | |||
| 3607 | Ga0501075_0051469 | |||
| 3608 | Ga0501075_0100730 | |||
| 3609 | Ga0501075_0398654 | |||
| 3610 | Ga0501076_0026146 | |||
| 3611 | Ga0501076_0056326 | |||
| 3612 | Ga0501076_0090946 | |||
| 3613 | Ga0501076_0232587 | |||
| 3614 | Ga0501076_0344665 | |||
| 3615 | Ga0501076_0493584 | |||
| 3616 | Ga0501076_0611521 | |||
| 3617 | Ga0501077_0068698 | |||
| 3618 | Ga0501077_0093371 | |||
| 3619 | Ga0501077_0589818 | |||
| 3620 | Ga0501077_0622669 | |||
| 3621 | Ga0501079_0022862 | |||
| 3622 | Ga0501079_0129953 | |||
| 3623 | Ga0501079_0139630 | |||
| 3624 | Ga0501079_0350733 | |||
| 3625 | Ga0501079_0617329 | |||
| 3626 | Ga0501079_1146054 | |||
| 3627 | Ga0501080_0245615 | |||
| 3628 | Ga0501080_0545869 | |||
| 3629 | Ga0501081_0081615 | |||
| 3630 | Ga0501081_0151462 | |||
| 3631 | Ga0501081_0281312 | |||
| 3632 | Ga0501081_0282723 | |||
| 3633 | Ga0501081_0378489 | |||
| 3634 | Ga0501081_0433568 | |||
| 3635 | Ga0501081_0728988 | |||
| 3636 | Ga0501081_0880596 | |||
| 3637 | Ga0501083_0003903 | |||
| 3638 | Ga0501083_0013908 | |||
| 3639 | Ga0501083_0115837 | |||
| 3640 | Ga0501083_0247446 | |||
| 3641 | Ga0501035_0182194 | |||
| 3642 | Ga0501044_0029667 | |||
| 3643 | Ga0501044_1100295 | |||
| 3644 | Ga0501045_0033295 | |||
| 3645 | Ga0501045_0228042 | |||
| 3646 | Ga0501045_0369617 | |||
| 3647 | nmdc:mga03683_119971_c1 | |||
| 3648 | nmdc:mga03683_274542_c1 | |||
| 3649 | nmdc:mga03683_34584_c1 | |||
| 3650 | nmdc:mga03683_4641_c1 | |||
| 3651 | nmdc:mga03683_78970_c1 | |||
| 3652 | nmdc:mga03n38_10463_c1 | |||
| 3653 | nmdc:mga03n38_170575_c1 | |||
| 3654 | nmdc:mga03n38_349289_c1 | |||
| 3655 | nmdc:mga03n38_45781_c1 | |||
| 3656 | nmdc:mga03n38_59539_c1 | |||
| 3657 | nmdc:mga03n38_6717_c1 | |||
| 3658 | nmdc:mga03n38_68457_c1 | |||
| 3659 | nmdc:mga00v17_207358_c1 | |||
| 3660 | nmdc:mga00v17_274513_c1 | |||
| 3661 | nmdc:mga00v17_429911_c1 | |||
| 3662 | nmdc:mga00v17_43255_c1 | |||
| 3663 | nmdc:mga00v17_59880_c1 | |||
| 3664 | nmdc:mga0yw44_11255_c1 | |||
| 3665 | nmdc:mga0yw44_118837_c1 | |||
| 3666 | nmdc:mga0yw44_150798_c1 | |||
| 3667 | nmdc:mga0yw44_198523_c1 | |||
| 3668 | nmdc:mga0yw44_255925_c1 | |||
| 3669 | nmdc:mga0yw44_28117_c1 | |||
| 3670 | nmdc:mga0yw44_281998_c1 | |||
| 3671 | nmdc:mga0yw44_30505_c1 | |||
| 3672 | nmdc:mga0yw44_30604_c1 | |||
| 3673 | nmdc:mga0yw44_331605_c1 | |||
| 3674 | nmdc:mga0yw44_43345_c1 | |||
| 3675 | nmdc:mga0yw44_4648_c1 | |||
| 3676 | nmdc:mga0yw44_517042_c1 | |||
| 3677 | nmdc:mga0yw44_78004_c1 | |||
| 3678 | nmdc:mga0k408_122033_c1 | |||
| 3679 | nmdc:mga0k408_207440_c1 | |||
| 3680 | nmdc:mga0k408_31601_c1 | |||
| 3681 | nmdc:mga0k408_383483_c1 | |||
| 3682 | nmdc:mga0k408_54735_c1 | |||
| 3683 | nmdc:mga0k408_78564_c1 | |||
| 3684 | nmdc:mga0k408_8031_c1 | |||
| 3685 | nmdc:mga0k408_82626_c1 | |||
| 3686 | nmdc:mga0k408_91669_c1 | |||
| 3687 | nmdc:mga0k408_92254_c1 | |||
| 3688 | nmdc:mga06z11_102584_c1 | |||
| 3689 | nmdc:mga06z11_106571_c1 | |||
| 3690 | nmdc:mga06z11_121587_c1 | |||
| 3691 | nmdc:mga06z11_124756_c1 | |||
| 3692 | nmdc:mga06z11_214875_c1 | |||
| 3693 | nmdc:mga06z11_276345_c1 | |||
| 3694 | nmdc:mga06z11_34496_c1 | |||
| 3695 | nmdc:mga06z11_44322_c1 | |||
| 3696 | nmdc:mga06z11_50325_c1 | |||
| 3697 | nmdc:mga06z11_525023_c1 | |||
| 3698 | nmdc:mga06z11_64594_c1 | |||
| 3699 | nmdc:mga06z11_75107_c1 | |||
| 3700 | nmdc:mga04h51_107365_c1 | |||
| 3701 | nmdc:mga04h51_107883_c1 | |||
| 3702 | nmdc:mga04h51_1239_c1 | |||
| 3703 | nmdc:mga04h51_1563_c1 | |||
| 3704 | nmdc:mga04h51_23183_c1 | |||
| 3705 | nmdc:mga04h51_255299_c1 | |||
| 3706 | nmdc:mga04h51_42321_c1 | |||
| 3707 | nmdc:mga04h51_67446_c1 | |||
| 3708 | nmdc:mga07m45_15871_c1 | |||
| 3709 | nmdc:mga07m45_215588_c2 | |||
| 3710 | nmdc:mga07m45_23262_c1 | |||
| 3711 | nmdc:mga07m45_349640_c1 | |||
| 3712 | nmdc:mga07m45_431249_c1 | |||
| 3713 | nmdc:mga07m45_587041_c1 | |||
| 3714 | nmdc:mga05p37_1180728_c1 | |||
| 3715 | nmdc:mga05p37_118439_c1 | |||
| 3716 | nmdc:mga05p37_156170_c1 | |||
| 3717 | nmdc:mga05p37_22407_c1 | |||
| 3718 | nmdc:mga05p37_413180_c1 | |||
| 3719 | nmdc:mga05p37_481_c1 | |||
| 3720 | nmdc:mga05p37_56162_c1 | |||
| 3721 | nmdc:mga05p37_89411_c1 | |||
| 3722 | nmdc:mga05p37_91321_c1 | |||
| 3723 | nmdc:mga09592_1486_c1 | |||
| 3724 | nmdc:mga09592_183634_c1 | |||
| 3725 | nmdc:mga09592_211036_c1 | |||
| 3726 | nmdc:mga09592_359431_c1 | |||
| 3727 | nmdc:mga0qj67_111_c1 | |||
| 3728 | nmdc:mga0qj67_194899_c1 | |||
| 3729 | nmdc:mga0qj67_42686_c1 | |||
| 3730 | nmdc:mga0qj67_511437_c1 | |||
| 3731 | nmdc:mga0qj67_545_c1 | |||
| 3732 | nmdc:mga06r32_1300867_c1 | |||
| 3733 | nmdc:mga06r32_158652_c1 | |||
| 3734 | nmdc:mga06r32_16404_c1 | |||
| 3735 | nmdc:mga06r32_32_c1 | |||
| 3736 | nmdc:mga06r32_461652_c1 | |||
| 3737 | nmdc:mga06r32_596492_c1 | |||
| 3738 | nmdc:mga06r32_723428_c1 | |||
| 3739 | nmdc:mga08y16_233645_c1 | |||
| 3740 | nmdc:mga08y16_268625_c1 | |||
| 3741 | nmdc:mga08y16_29056_c1 | |||
| 3742 | nmdc:mga08y16_315591_c1 | |||
| 3743 | nmdc:mga08y16_37_c1 | |||
| 3744 | nmdc:mga08y16_50185_c1 | |||
| 3745 | nmdc:mga08y16_53825_c1 | |||
| 3746 | nmdc:mga08y16_73437_c1 | |||
| 3747 | nmdc:mga08y16_7415_c1 | |||
| 3748 | nmdc:mga08y16_975869_c1 | |||
| 3749 | nmdc:mga08y16_983593_c1 | |||
| 3750 | nmdc:mga0n895_129713_c1 | |||
| 3751 | nmdc:mga0n895_197525_c1 | |||
| 3752 | nmdc:mga0n895_21007_c1 | |||
| 3753 | nmdc:mga0n895_30774_c1 | |||
| 3754 | nmdc:mga0rr50_132058_c1 | |||
| 3755 | nmdc:mga0rr50_182900_c1 | |||
| 3756 | nmdc:mga0rr50_372834_c1 | |||
| 3757 | nmdc:mga0rr50_831076_c1 | |||
| 3758 | nmdc:mga08x19_201358_c1 | |||
| 3759 | nmdc:mga08x19_226002_c1 | |||
| 3760 | nmdc:mga0a205_302815_c1 | |||
| 3761 | nmdc:mga0a205_325570_c1 | |||
| 3762 | nmdc:mga0a205_367707_c1 | |||
| 3763 | nmdc:mga0a205_48670_c1 | |||
| 3764 | nmdc:mga0a205_69199_c1 | |||
| 3765 | nmdc:mga0a205_72778_c1 | |||
| 3766 | nmdc:mga0a205_916012_c1 | |||
| 3767 | nmdc:mga0sz30_120911_c1 | |||
| 3768 | nmdc:mga0sz30_1617_c1 | |||
| 3769 | nmdc:mga0sz30_222244_c1 | |||
| 3770 | nmdc:mga0sz30_47446_c1 | |||
| 3771 | nmdc:mga0sz30_64811_c1 | |||
| 3772 | nmdc:mga0sz30_66961_c1 | |||
| 3773 | nmdc:mga0sz30_9308_c2 | |||
| 3774 | Ga0495601_0000467 | |||
| 3775 | Ga0495601_0000861 | |||
| 3776 | Ga0495601_0001456 | |||
| 3777 | Ga0495601_0005945 | |||
| 3778 | Ga0495601_0011563 | |||
| 3779 | Ga0495601_0095822 | |||
| 3780 | Ga0495601_0115884 | |||
| 3781 | Ga0495601_0201605 | |||
| 3782 | Ga0495612_0000575 | |||
| 3783 | Ga0495612_0004648 | |||
| 3784 | Ga0495612_0012284 | |||
| 3785 | Ga0495612_0149889 | |||
| 3786 | Ga0500610_0035592 | |||
| 3787 | Ga0500635_0004759 | |||
| 3788 | Ga0495655_0003619 | |||
| 3789 | Ga0495595_0000635 | |||
| 3790 | Ga0495595_0001020 | |||
| 3791 | Ga0495595_0004731 | |||
| 3792 | Ga0495595_0015661 | |||
| 3793 | Ga0495595_0022205 | |||
| 3794 | Ga0495595_0034075 | |||
| 3795 | Ga0495595_0041025 | |||
| 3796 | Ga0495595_0253401 | |||
| 3797 | Ga0495619_0000016 | |||
| 3798 | Ga0495619_0002154 | |||
| 3799 | Ga0495619_0003042 | |||
| 3800 | Ga0495619_0004154 | |||
| 3801 | Ga0495619_0012362 | |||
| 3802 | Ga0495619_0016222 | |||
| 3803 | Ga0495619_0045937 | |||
| 3804 | Ga0495619_0093467 | |||
| 3805 | Ga0495619_0140872 | |||
| 3806 | Ga0495619_0321836 | |||
| 3807 | Ga0495619_0347848 | |||
| 3808 | Ga0500578_0051516 | |||
| 3809 | Ga0500578_0377718 | |||
| 3810 | Ga0500644_0064861 | |||
| 3811 | Ga0500646_0106468 | |||
| 3812 | Ga0500651_0191576 | |||
| 3813 | Ga0500566_0004766 | |||
| 3814 | Ga0500566_0022772 | |||
| 3815 | Ga0500566_0296634 | |||
| 3816 | Ga0500641_0008154 | |||
| 3817 | Ga0500641_0021665 | |||
| 3818 | Ga0500641_0023473 | |||
| 3819 | Ga0500650_0096145 | |||
| 3820 | Ga0500650_0240431 | |||
| 3821 | Ga0500555_041263 | |||
| 3822 | Ga0500558_055504 | |||
| 3823 | Ga0500572_000093 | |||
| 3824 | Ga0500582_173345 | |||
| 3825 | Ga0500592_020606 | |||
| 3826 | Ga0500594_0045023 | |||
| 3827 | Ga0500595_001406 | |||
| 3828 | Ga0500595_001750 | |||
| 3829 | Ga0500595_009426 | |||
| 3830 | Ga0500595_016335 | |||
| 3831 | Ga0500595_073355 | |||
| 3832 | Ga0500608_060376 | |||
| 3833 | Ga0500618_035027 | |||
| 3834 | Ga0500626_073006 | |||
| 3835 | Ga0500642_0022506 | |||
| 3836 | Ga0500652_146848 | |||
| 3837 | Ga0500655_003381 | |||
| 3838 | Ga0500658_0025355 | |||
| 3839 | Ga0500559_0000242 | |||
| 3840 | Ga0500559_0026137 | |||
| 3841 | Ga0500559_0090946 | |||
| 3842 | Ga0500568_0006307 | |||
| 3843 | Ga0500568_0078438 | |||
| 3844 | Ga0500568_0118598 | |||
| 3845 | Ga0500573_0136887 | |||
| 3846 | Ga0500577_0035215 | |||
| 3847 | Ga0500588_0207952 | |||
| 3848 | Ga0500589_022266 | |||
| 3849 | Ga0500604_0017013 | |||
| 3850 | Ga0500604_0073716 | |||
| 3851 | Ga0500604_0092872 | |||
| 3852 | Ga0500616_0025644 | |||
| 3853 | Ga0500616_0148295 | |||
| 3854 | Ga0500619_132158 | |||
| 3855 | Ga0500622_0020471 | |||
| 3856 | Ga0500622_0111697 | |||
| 3857 | Ga0500627_0190400 | |||
| 3858 | Ga0500633_0219929 | |||
| 3859 | Ga0500634_0082277 | |||
| 3860 | Ga0500638_000402 | |||
| 3861 | Ga0500639_001904 | |||
| 3862 | Ga0500637_0002381 | |||
| 3863 | Ga0500611_052981 | |||
| 3864 | Ga0500611_143867 | |||
| 3865 | Ga0500657_094878 | |||
| 3866 | Ga0500645_029155 | |||
| 3867 | Ga0500645_040182 | |||
| 3868 | Ga0500645_129448 | |||
| 3869 | Ga0500609_007246 | |||
| 3870 | Ga0500656_015415 | |||
| 3871 | Ga0500552_001834 | |||
| 3872 | Ga0500596_000350 | |||
| 3873 | Ga0500596_001100 | |||
| 3874 | Ga0501084_0061368 | |||
| 3875 | Ga0501084_0100910 | |||
| 3876 | Ga0501084_0156432 | |||
| 3877 | Ga0501084_0206589 | |||
| 3878 | Ga0501084_0447580 | |||
| 3879 | Ga0501084_0842730 | |||
| 3880 | Ga0501084_1015190 | |||
| 3881 | Ga0500661_000108 | |||
| 3882 | Ga0590071_003417 | |||
| 3883 | Ga0587093_032290 | |||
| 3884 | Ga0587083_0075839 | |||
| 3885 | Ga0587085_032574 | |||
| 3886 | Ga0587086_023435 | |||
| 3887 | Ga0587068_052867 | |||
| 3888 | Ga0501082_0000106 | |||
| 3889 | Ga0501082_0043636 | |||
| 3890 | Ga0501082_0049770 | |||
| 3891 | Ga0501082_0081512 | |||
| 3892 | Ga0501082_0292811 | |||
| 3893 | Ga0501082_0758478 | |||
| 3894 | Ga0501082_0790114 | |||
| 3895 | Ga0501082_1155901 | |||
| 3896 | Ga0530510_0017881 | |||
| 3897 | Ga0530510_0020095 | |||
| 3898 | Ga0530510_0213744 | |||
| 3899 | Ga0530510_0266002 | |||
| 3900 | Ga0530510_0545461 | |||
| 3901 | 2509149394 | |||
| 3902 | 2513622966 | |||
| 3903 | 2513699544 | |||
| 3904 | 2517104065 | |||
| 3905 | 2517891444 | |||
| 3906 | 2524436375 | |||
| 3907 | 2524538381 | |||
| 3908 | 2603861422 | |||
| 3909 | 2643758643 | |||
| 3910 | 2728750139 | |||
| 3911 | 2745080671 | |||
| 3912 | 2818236462 | |||
| 3913 | 2824621920 | |||
| 3914 | 2824631612 | |||
| 3915 | 2824641698 | |||
| 3916 | 2824649360 | |||
| 3917 | 2824713657 | |||
| 3918 | 2824719187 | |||
| 3919 | 2824729604 | |||
| 3920 | 2824758461 | |||
| 3921 | 2824770045 | |||
| 3922 | 2836164696 | |||
| 3923 | 2841959784 | |||
| 3924 | 2842040562 | |||
| 3925 | 2842046492 | |||
| 3926 | 2847937237 | |||
| 3927 | 2874607295 | |||
| 3928 | 2874614665 | |||
| 3929 | 2874627989 | |||
| 3930 | 2876766184 | |||
| 3931 | 2876814532 | |||
| 3932 | 2879088465 | |||
| 3933 | 2879114627 | |||
| 3934 | 2881371546 | |||
| 3935 | 2881671842 | |||
| 3936 | 2885369883 | |||
| 3937 | 2885379649 | |||
| 3938 | 2885412280 | |||
| 3939 | 2888385362 | |||
| 3940 | 2889038110 | |||
| 3941 | 2903752507 | |||
| 3942 | 2904674393 | |||
| 3943 | 2904691286 | |||
| 3944 | 2904704891 | |||
| 3945 | 2904712072 | |||
| 3946 | 2906616616 | |||
| 3947 | 2906635400 | |||
| 3948 | 2906649362 | |||
| 3949 | 2906666945 | |||
| 3950 | 2908741782 | |||
| 3951 | 2908759072 | |||
| 3952 | 2922368588 | |||
| 3953 | 2922431363 | |||
| 3954 | 2935633959 | |||
| 3955 | 2941510738 | |||
| 3956 | 2941518122 | |||
| 3957 | 2941527007 | |||
| 3958 | 8006930880 | |||
| 3959 | 8006939554 | |||
| 3960 | 8006968361 | |||
| 3961 | 8006979305 | |||
| 3962 | 8006989197 | |||
| 3963 | 8006994809 | |||
| 3964 | 8019575534 | |||
| 3965 | 8056681019 | |||
| 3966 | 8056693407 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4go1-assembly1.cif.gz_A-2 | crystal structure of full length transcription repressor lsrr from e. coli. | 0.9801 | 135 | 168 |
| 2w48-assembly1.cif.gz_B | crystal structure of the full-length sorbitol operon regulator sorc from klebsiella pneumoniae | 0.9682 | 136 | 174 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.9594 | 132 | 179 |
| 3hug-assembly2.cif.gz_E | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9486 | 116 | 186 |
| 3vfz-assembly3.cif.gz_A | crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis | 0.9435 | 121 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGH7_10_94_1.10.1740.10 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9744 | 9 | 90 | 1.10.1740.10 |
| 2w48B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9682 | 136 | 174 | 1.10.10.60 |
| af_O06371_1_115_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9663 | 136 | 168 | 1.10.10.60 |
| af_P13445_245_318_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9592 | 111 | 179 | 1.10.10.10 |
| 1or7B01 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9591 | 9 | 91 | 1.10.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P9Z6S1-F1-model_v4 | Peptidase S8/S53 domain-containing protein | 0.5408 | 25 | 183 |
GO:0003677
GO:0004252 GO:0006352 GO:0006508 GO:0016020 GO:0016987 |
| AF-A0A537TZN1-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.5319 | 6 | 181 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A317HYH0-F1-model_v4 | deleted | 0.5294 | 6 | 181 |
|
| AF-A0A1K1M515-F1-model_v4 | RNA polymerase sigma-70 factor, ECF subfamily | 0.5235 | 6 | 179 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A6EK26-F1-model_v4 | RNA polymerase ECF-type sigma factor | 0.5227 | 6 | 178 |
GO:0003677
GO:0006352 GO:0016987 |