F496196

General Info

Members Datasets Scaffolds Average Seq Length
1983 686 3966 190

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10006413|JGI25404J52841_100064133
Length 223
Sequence MIGSKGRASQATGFAPNSSLNLTAASRNQSMSRPLTATQSTPDEVLIERIAGGDRLAMQVLFARHHVRVYRFVLRLVRKPEVAEDLISEVFLDVWRQADRFEGRSAVTTWLLAIARFKALSALRRRPDEELDEDTAAAIEDPSDTPEVAIEKKDKGNVLRQCLDCLSPEHREIIDLVYYHEKSVEEAAEIVGIPANTVKTRMFYARKKLGELLKERGIERGWP

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
156 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
157 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
158 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
159 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
160 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
178 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
179 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
252 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
253 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
254 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
274 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
275 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
276 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
278 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
279 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
280 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
281 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
282 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
283 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
284 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
285 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
286 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
287 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
288 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
289 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
290 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
291 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
292 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
293 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
294 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
295 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
296 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
297 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
298 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
299 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
300 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
301 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
302 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
303 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
304 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
305 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
306 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
307 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
308 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
309 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
310 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
311 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
312 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
313 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
314 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
315 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
316 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
317 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
318 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
319 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
320 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
321 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
322 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
324 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
325 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
326 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
327 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
328 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
329 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
330 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
331 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
332 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
333 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
334 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
335 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
336 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
337 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
347 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
348 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
349 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
350 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
351 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
352 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
353 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
354 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
357 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
358 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
359 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
360 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
361 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
362 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
363 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
364 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
365 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
366 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
367 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
368 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
369 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
370 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
371 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
372 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
373 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
374 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
375 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
376 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
377 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
378 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
379 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
380 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
381 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
382 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
383 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
384 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
385 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
386 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
387 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
388 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
389 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
390 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
391 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
392 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
393 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
394 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
395 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
396 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
397 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
398 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
399 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
400 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
401 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
402 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
405 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
406 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
407 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
408 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
409 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
410 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
413 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
414 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
415 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
416 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
417 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
418 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
419 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
420 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
421 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
422 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
423 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
424 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
425 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
426 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
427 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
428 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
430 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
431 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
432 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
433 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
436 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
437 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
438 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
439 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
440 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
441 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
442 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
443 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
444 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
445 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
446 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
447 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
448 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
449 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
450 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
451 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
452 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
453 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
454 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
455 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
456 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
457 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
458 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
459 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
460 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
461 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
462 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
463 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
464 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
465 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
466 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
467 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
468 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
469 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
470 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
471 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
472 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
473 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
474 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
475 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
476 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
477 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
478 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
479 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
480 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
481 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
482 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
483 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
484 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
485 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
486 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
487 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
488 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
489 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
490 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
491 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
492 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
493 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
494 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
495 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
496 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
497 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
498 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
499 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
500 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
501 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
502 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
503 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
504 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
505 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
506 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
507 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
508 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
509 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
510 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
511 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
513 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
514 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
527 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
528 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
529 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
530 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
531 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
532 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
533 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
534 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
535 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
536 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
537 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
538 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
542 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
543 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
544 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
545 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
546 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
547 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
548 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
549 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
550 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
551 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
552 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
553 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
554 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
555 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
556 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
557 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
558 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
559 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
560 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
561 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
562 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
563 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
564 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
565 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
566 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
567 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
568 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
569 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
570 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
571 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
572 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
573 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
574 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
575 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
576 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
577 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
578 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
579 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
580 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
581 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
582 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
583 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
584 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
585 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
586 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
587 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
588 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
589 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
590 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
591 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
592 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
593 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
594 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
595 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
596 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
597 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
598 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
599 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
600 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
601 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
602 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
603 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
604 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
605 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
606 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
607 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
608 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
609 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
610 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
611 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
612 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
613 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
614 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
620 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
621 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
622 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
623 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
624 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
625 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
626 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
627 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
628 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
629 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
630 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
631 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
632 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
633 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
634 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
635 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
636 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
637 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
638 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
639 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
640 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
641 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
642 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
643 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
644 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
645 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
646 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
647 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
648 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
649 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
650 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
651 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
652 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
653 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
654 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
655 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
656 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
657 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
658 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
659 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
660 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
661 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
662 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
663 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
664 2904699407
665 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
666 2906610324
667 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
668 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
669 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
670 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
671 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
672 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
673 2922425934
674 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
675 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
676 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
677 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
678 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
679 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
680 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
681 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
682 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
683 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
684 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
685 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
686 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0.56
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.83
Nodule 1.82
Rhizoplane 8.27
Rhizosphere 75.64
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10006413 3300003659 Bacteria 2459
2 RicEn_C2512 2010549000 Bacteria 2046
3 2214745216 2209111006 Bacteria 14541
4 ARSoilYngRDRAFT_c00191 3300000042 Bacteria 10262
5 ARcpr5yngRDRAFT_c000145 3300000043 Bacteria 11347
6 ARSoilOldRDRAFT_c000016 3300000044 Bacteria 39308
7 ARCol0oldRDRAFT_c00161 3300000045 Bacteria 6068
8 ARCol0yngRDRAFT_1000187 3300000652 Bacteria 10522
9 JGI24032J14994_102107 3300001430 Bacteria 730
10 JGI24746J21847_1001112 3300001977 Bacteria 4234
11 JGI24746J21847_1006035 3300001977 Bacteria 1883
12 JGI24740J21852_10025456 3300001979 Bacteria 1994
13 JGI24739J22299_10001106 3300001989 Bacteria 10054
14 JGI24737J22298_10010720 3300001990 Bacteria 3016
15 JGI24737J22298_10027266 3300001990 Bacteria 1802
16 JGI24743J22301_10026795 3300001991 Bacteria 1123
17 JGI24735J21928_10028666 3300002067 Bacteria 1662
18 JGI24745J21846_1000214 3300002073 Bacteria 4700
19 JGI24748J21848_1010542 3300002074 Bacteria 1087
20 JGI24738J21930_10004532 3300002075 Bacteria 3395
21 JGI24749J21850_1006566 3300002076 Bacteria 1620
22 JGI24035J26624_1002401 3300002126 Bacteria 1747
23 JGI24033J26618_1017191 3300002155 Bacteria 903
24 JGI24034J26672_10007006 3300002239 Bacteria 1635
25 JGI24742J22300_10002116 3300002244 Bacteria 3159
26 JGI24742J22300_10002245 3300002244 Bacteria 3086
27 JGI24742J22300_10006662 3300002244 Bacteria 1904
28 JGI24742J22300_10007686 3300002244 Bacteria 1780
29 JGI24742J22300_10039293 3300002244 Bacteria 841
30 JGI24751J29686_10003559 3300002459 Bacteria 3139
31 JGI24751J29686_10016566 3300002459 Bacteria 1520
32 JGI24751J29686_10048232 3300002459 Bacteria 879
33 Ga0006759J45824_1016848 3300003163 Unclassified 869
34 JGI25406J46586_10002634 3300003203 Bacteria 8465
35 JGI25153J46596_10000632 3300003215 Bacteria 21524
36 JGI25153J46596_10003303 3300003215 Bacteria 9062
37 JGI25160J50197_1007144 3300003354 Bacteria 4403
38 JGI25160J50197_1016309 3300003354 Bacteria 2397
39 Ga0058859_10005899 3300004798 Bacteria 913
40 Ga0058860_10029185 3300004801 Bacteria 761
41 Ga0065165_1001679 3300005262 Bacteria 22393
42 Ga0065714_10032781 3300005288 Bacteria 939
43 Ga0065704_10096121 3300005289 Bacteria 2457
44 Ga0065712_10039456 3300005290 Bacteria 822
45 Ga0065712_10072238 3300005290 Bacteria 4846
46 Ga0065712_10121301 3300005290 Bacteria 1667
47 Ga0065712_10147584 3300005290 Bacteria 1394
48 Ga0065715_10056642 3300005293 Bacteria 773
49 Ga0065715_10201834 3300005293 Bacteria 1357
50 Ga0065715_10224079 3300005293 Bacteria 1260
51 Ga0065707_10147313 3300005295 Bacteria 1698
52 Ga0065707_10200827 3300005295 Bacteria 1311
53 Ga0065707_10242627 3300005295 Bacteria 1150
54 Ga0070658_10482792 3300005327 Bacteria 1069
55 Ga0070676_10003681 3300005328 Bacteria 8025
56 Ga0070676_10024186 3300005328 Bacteria 3419
57 Ga0070676_10074811 3300005328 Bacteria 2041
58 Ga0070676_10347673 3300005328 Bacteria 1019
59 Ga0070676_10425296 3300005328 Bacteria 929
60 Ga0070683_100010409 3300005329 Bacteria 7999
61 Ga0070683_100019681 3300005329 Bacteria 5998
62 Ga0070683_100307391 3300005329 Bacteria 1508
63 Ga0070690_100005755 3300005330 Bacteria 6984
64 Ga0070690_100104361 3300005330 Bacteria 1883
65 Ga0070690_100303423 3300005330 Bacteria 1145
66 Ga0070670_100014637 3300005331 Bacteria 6734
67 Ga0070670_100035140 3300005331 Bacteria 4314
68 Ga0070670_100035513 3300005331 Bacteria 4291
69 Ga0070670_100036571 3300005331 Bacteria 4225
70 Ga0070670_100857778 3300005331 Bacteria 822
71 Ga0070670_101241656 3300005331 Unclassified 681
72 Ga0070677_10000046 3300005333 Bacteria 38785
73 Ga0070677_10004236 3300005333 Bacteria 4672
74 Ga0070677_10010099 3300005333 Unclassified 3218
75 Ga0068869_100000900 3300005334 Bacteria 17139
76 Ga0068869_100319141 3300005334 Bacteria 1259
77 Ga0068869_100438424 3300005334 Bacteria 1081
78 Ga0068869_100861791 3300005334 Bacteria 782
79 Ga0070666_10008419 3300005335 Bacteria 6405
80 Ga0070666_10029279 3300005335 Bacteria 3619
81 Ga0070666_10185925 3300005335 Bacteria 1459
82 Ga0070666_10541099 3300005335 Bacteria 847
83 Ga0070680_100013751 3300005336 Bacteria 6313
84 Ga0070680_100314262 3300005336 Bacteria 1329
85 Ga0070682_100000920 3300005337 Bacteria 17145
86 Ga0070682_100065469 3300005337 Bacteria 2309
87 Ga0070682_100112701 3300005337 Bacteria 1815
88 Ga0068868_100074087 3300005338 Bacteria 2718
89 Ga0068868_100163283 3300005338 Bacteria 1841
90 Ga0068868_100199663 3300005338 Bacteria 1667
91 Ga0068868_100326725 3300005338 Bacteria 1308
92 Ga0070660_100002099 3300005339 Bacteria 13744
93 Ga0070660_100021171 3300005339 Bacteria 4791
94 Ga0070660_100060234 3300005339 Unclassified 2946
95 Ga0070660_100255481 3300005339 Bacteria 1430
96 Ga0070689_100031944 3300005340 Bacteria 4002
97 Ga0070689_100036745 3300005340 Bacteria 3745
98 Ga0070689_100061023 3300005340 Unclassified 2932
99 Ga0070689_100162213 3300005340 Bacteria 1807
100 Ga0070689_100806770 3300005340 Bacteria 826
101 Ga0070687_100000217 3300005343 Bacteria 20090
102 Ga0070687_100240828 3300005343 Bacteria 1118
103 Ga0070687_100270606 3300005343 Bacteria 1065
104 Ga0070661_100193041 3300005344 Bacteria 1554
105 Ga0070661_100892389 3300005344 Bacteria 733
106 Ga0070668_100126408 3300005347 Bacteria 2048
107 Ga0070668_100327847 3300005347 Bacteria 1290
108 Ga0070669_100040867 3300005353 Bacteria 3371
109 Ga0070669_100043787 3300005353 Unclassified 3261
110 Ga0070669_100199255 3300005353 Bacteria 1574
111 Ga0070669_100956167 3300005353 Bacteria 733
112 Ga0070675_100004785 3300005354 Bacteria 10323
113 Ga0070675_100324326 3300005354 Bacteria 1361
114 Ga0070675_100502510 3300005354 Bacteria 1093
115 Ga0070675_100622786 3300005354 Bacteria 980
116 Ga0070675_101276596 3300005354 Unclassified 676
117 Ga0070671_100005407 3300005355 Bacteria 10186
118 Ga0070671_100011957 3300005355 Bacteria 6983
119 Ga0070671_100016718 3300005355 Bacteria 5932
120 Ga0070671_100033894 3300005355 Bacteria 4225
121 Ga0070671_100049957 3300005355 Bacteria 3479
122 Ga0070671_100055944 3300005355 Bacteria 3282
123 Ga0070671_100316123 3300005355 Bacteria 1330
124 Ga0070674_100000375 3300005356 Bacteria 22468
125 Ga0070674_100000893 3300005356 Bacteria 15592
126 Ga0070674_100001474 3300005356 Bacteria 12549
127 Ga0070674_100161671 3300005356 Bacteria 1699
128 Ga0070674_100194081 3300005356 Bacteria 1564
129 Ga0070674_100288239 3300005356 Bacteria 1304
130 Ga0070674_100365945 3300005356 Bacteria 1169
131 Ga0070674_100404699 3300005356 Bacteria 1116
132 Ga0070673_100000470 3300005364 Bacteria 21421
133 Ga0070673_100018635 3300005364 Bacteria 4964
134 Ga0070688_100016929 3300005365 Bacteria 4175
135 Ga0070688_100080542 3300005365 Bacteria 2106
136 Ga0070688_100124721 3300005365 Bacteria 1730
137 Ga0070688_100239881 3300005365 Bacteria 1286
138 Ga0070688_100368375 3300005365 Bacteria 1056
139 Ga0070659_100006204 3300005366 Bacteria 8635
140 Ga0070667_100012633 3300005367 Bacteria 6984
141 Ga0070667_100041130 3300005367 Bacteria 3878
142 Ga0070667_100233536 3300005367 Bacteria 1640
143 Ga0070667_100467640 3300005367 Bacteria 1153
144 Ga0070667_100736038 3300005367 Bacteria 914
145 Ga0070709_10005104 3300005434 Bacteria 7098
146 Ga0070709_10006845 3300005434 Bacteria 6226
147 Ga0070709_10080910 3300005434 Bacteria 2119
148 Ga0070709_10141911 3300005434 Bacteria 1651
149 Ga0070709_10392129 3300005434 Bacteria 1035
150 Ga0070714_100002780 3300005435 Bacteria 12900
151 Ga0070714_100018995 3300005435 Bacteria 5593
152 Ga0070714_100111744 3300005435 Bacteria 2420
153 Ga0070713_100017941 3300005436 Bacteria 5370
154 Ga0070713_100181064 3300005436 Bacteria 1894
155 Ga0070713_100469847 3300005436 Bacteria 1184
156 Ga0070710_10016995 3300005437 Bacteria 3714
157 Ga0070710_10023746 3300005437 Bacteria 3226
158 Ga0070710_10088442 3300005437 Bacteria 1823
159 Ga0070710_10124786 3300005437 Bacteria 1563
160 Ga0070701_10186895 3300005438 Bacteria 1217
161 Ga0070701_10231618 3300005438 Bacteria 1107
162 Ga0070711_100244836 3300005439 Bacteria 1404
163 Ga0070711_100486816 3300005439 Bacteria 1015
164 Ga0070711_100548466 3300005439 Bacteria 959
165 Ga0070705_100000204 3300005440 Bacteria 34961
166 Ga0070705_100306506 3300005440 Bacteria 1140
167 Ga0070705_100362657 3300005440 Bacteria 1060
168 Ga0070705_100417666 3300005440 Bacteria 998
169 Ga0070705_100751926 3300005440 Bacteria 771
170 Ga0070700_100319833 3300005441 Bacteria 1140
171 Ga0070700_100417222 3300005441 Bacteria 1013
172 Ga0070700_100533032 3300005441 Bacteria 909
173 Ga0070694_100450974 3300005444 Bacteria 1016
174 Ga0070663_100026729 3300005455 Bacteria 3911
175 Ga0070663_100328207 3300005455 Bacteria 1232
176 Ga0070663_100726371 3300005455 Bacteria 846
177 Ga0070678_100002319 3300005456 Bacteria 10389
178 Ga0070678_100014852 3300005456 Bacteria 4928
179 Ga0070678_100047057 3300005456 Bacteria 3097
180 Ga0070662_100013235 3300005457 Bacteria 5486
181 Ga0070662_100512516 3300005457 Bacteria 1001
182 Ga0070681_10061201 3300005458 Bacteria 3741
183 Ga0070681_10360321 3300005458 Bacteria 1364
184 Ga0070681_10621943 3300005458 Bacteria 994
185 Ga0068867_100004027 3300005459 Bacteria 10340
186 Ga0068867_100006503 3300005459 Bacteria 8256
187 Ga0068867_101246686 3300005459 Bacteria 684
188 Ga0070685_10001617 3300005466 Bacteria 11892
189 Ga0070685_10008570 3300005466 Bacteria 5262
190 Ga0070685_10041027 3300005466 Bacteria 2636
191 Ga0070685_10206947 3300005466 Bacteria 1278
192 Ga0074259_10896662 3300005507 Bacteria 1191
193 Ga0070699_100462520 3300005518 Bacteria 1151
194 Ga0070699_100536465 3300005518 Bacteria 1064
195 Ga0070699_100786324 3300005518 Bacteria 871
196 Ga0070679_100025312 3300005530 Bacteria 5822
197 Ga0070679_100159196 3300005530 Bacteria 2232
198 Ga0070684_100008508 3300005535 Bacteria 8026
199 Ga0070684_100029649 3300005535 Bacteria 4639
200 Ga0070684_100112955 3300005535 Bacteria 2437
201 Ga0070697_100132093 3300005536 Bacteria 2094
202 Ga0068853_100033577 3300005539 Bacteria 4354
203 Ga0068853_100067830 3300005539 Bacteria 3100
204 Ga0068853_100092887 3300005539 Bacteria 2655
205 Ga0068853_100234876 3300005539 Bacteria 1678
206 Ga0068853_100351911 3300005539 Bacteria 1370
207 Ga0068853_100356024 3300005539 Bacteria 1362
208 Ga0068853_100484304 3300005539 Bacteria 1166
209 Ga0068853_100630652 3300005539 Bacteria 1019
210 Ga0070672_100015602 3300005543 Bacteria 5416
211 Ga0070672_100046664 3300005543 Bacteria 3357
212 Ga0070672_100216997 3300005543 Bacteria 1603
213 Ga0070686_100018072 3300005544 Bacteria 4132
214 Ga0070686_100048208 3300005544 Bacteria 2698
215 Ga0070686_100119889 3300005544 Unclassified 1805
216 Ga0070686_100231573 3300005544 Bacteria 1340
217 Ga0070686_100305331 3300005544 Bacteria 1182
218 Ga0070695_100114448 3300005545 Bacteria 1836
219 Ga0070695_100561926 3300005545 Bacteria 891
220 Ga0070696_100073889 3300005546 Bacteria 2403
221 Ga0070696_100511780 3300005546 Bacteria 957
222 Ga0070693_100025149 3300005547 Bacteria 3201
223 Ga0070693_100238020 3300005547 Bacteria 1201
224 Ga0070665_100136427 3300005548 Bacteria 2457
225 Ga0070665_100159772 3300005548 Bacteria 2255
226 Ga0070665_100168616 3300005548 Bacteria 2191
227 Ga0070665_100172989 3300005548 Bacteria 2161
228 Ga0070665_100213906 3300005548 Bacteria 1928
229 Ga0070665_100551647 3300005548 Bacteria 1165
230 Ga0070704_100158213 3300005549 Bacteria 1789
231 Ga0068855_100007909 3300005563 Bacteria 12845
232 Ga0068855_100087873 3300005563 Bacteria 3591
233 Ga0068855_100232331 3300005563 Bacteria 2064
234 Ga0070664_100003650 3300005564 Bacteria 12393
235 Ga0070664_100160089 3300005564 Bacteria 1991
236 Ga0070664_100218015 3300005564 Bacteria 1707
237 Ga0068857_100002698 3300005577 Bacteria 14566
238 Ga0068857_100051580 3300005577 Bacteria 3650
239 Ga0068857_100097530 3300005577 Bacteria 2635
240 Ga0068857_100165918 3300005577 Unclassified 2005
241 Ga0068857_100670601 3300005577 Bacteria 984
242 Ga0068854_100046914 3300005578 Bacteria 3078
243 Ga0068854_100120058 3300005578 Bacteria 1994
244 Ga0068854_100129469 3300005578 Bacteria 1925
245 Ga0068854_100453231 3300005578 Bacteria 1072
246 Ga0068856_100005538 3300005614 Bacteria 12434
247 Ga0068856_100045821 3300005614 Bacteria 4306
248 Ga0068856_100226569 3300005614 Bacteria 1885
249 Ga0068856_100282875 3300005614 Bacteria 1675
250 Ga0068856_100632430 3300005614 Bacteria 1091
251 Ga0070702_100000758 3300005615 Bacteria 12227
252 Ga0070702_100002474 3300005615 Bacteria 7990
253 Ga0070702_100005458 3300005615 Bacteria 5924
254 Ga0070702_100061626 3300005615 Bacteria 2185
255 Ga0070702_100093906 3300005615 Bacteria 1825
256 Ga0070702_100214701 3300005615 Bacteria 1283
257 Ga0070702_100423573 3300005615 Unclassified 959
258 Ga0068852_100025773 3300005616 Bacteria 4769
259 Ga0068859_100020242 3300005617 Bacteria 6679
260 Ga0068859_100023296 3300005617 Bacteria 6214
261 Ga0068859_100078546 3300005617 Bacteria 3341
262 Ga0068859_100752895 3300005617 Bacteria 1063
263 Ga0068864_100000443 3300005618 Bacteria 35869
264 Ga0068864_100004887 3300005618 Bacteria 10977
265 Ga0068864_100020334 3300005618 Bacteria 5553
266 Ga0068864_100033589 3300005618 Bacteria 4362
267 Ga0068864_100048665 3300005618 Bacteria 3645
268 Ga0068864_100644235 3300005618 Bacteria 1031
269 Ga0068866_10000908 3300005718 Bacteria 12992
270 Ga0068866_10164879 3300005718 Unclassified 1295
271 Ga0068861_100007339 3300005719 Bacteria 7552
272 Ga0068861_100033080 3300005719 Bacteria 3812
273 Ga0068861_100679237 3300005719 Unclassified 954
274 Ga0068870_10000734 3300005840 Bacteria 12617
275 Ga0068870_10060901 3300005840 Bacteria 2027
276 Ga0068870_10083312 3300005840 Bacteria 1773
277 Ga0068863_100007663 3300005841 Bacteria 10561
278 Ga0068863_100054632 3300005841 Bacteria 3783
279 Ga0068863_100298475 3300005841 Bacteria 1562
280 Ga0068863_100360320 3300005841 Bacteria 1417
281 Ga0068863_100523151 3300005841 Bacteria 1170
282 Ga0068863_100856859 3300005841 Bacteria 908
283 Ga0068858_100003447 3300005842 Bacteria 15698
284 Ga0068858_100060090 3300005842 Bacteria 3513
285 Ga0068858_100085044 3300005842 Bacteria 2943
286 Ga0068858_100095118 3300005842 Bacteria 2776
287 Ga0068858_100533274 3300005842 Bacteria 1136
288 Ga0068860_100354400 3300005843 Bacteria 1445
289 Ga0068860_100417277 3300005843 Bacteria 1330
290 Ga0068862_100008086 3300005844 Bacteria 8706
291 Ga0068862_100352462 3300005844 Bacteria 1366
292 Ga0081455_10019100 3300005937 Bacteria 6497
293 Ga0081455_10024219 3300005937 Bacteria 5628
294 Ga0081455_10221049 3300005937 Unclassified 1404
295 Ga0081455_10247539 3300005937 Bacteria 1306
296 Ga0081538_10002974 3300005981 Bacteria 16168
297 Ga0081538_10125128 3300005981 Bacteria 1224
298 Ga0081540_1000140 3300005983 Bacteria 75770
299 Ga0081540_1008037 3300005983 Bacteria 7421
300 Ga0081540_1041211 3300005983 Bacteria 2396
301 Ga0081540_1134370 3300005983 Bacteria 1004
302 Ga0081540_1182014 3300005983 Bacteria 785
303 Ga0081539_10004161 3300005985 Bacteria 16415
304 Ga0070717_10004047 3300006028 Bacteria 10561
305 Ga0070717_10013853 3300006028 Bacteria 6192
306 Ga0070717_10410194 3300006028 Bacteria 1218
307 Ga0070717_10906302 3300006028 Bacteria 803
308 Ga0075365_10048713 3300006038 Bacteria 2790
309 Ga0075365_10062317 3300006038 Bacteria 2494
310 Ga0075365_10063600 3300006038 Unclassified 2471
311 Ga0075365_10151459 3300006038 Bacteria 1613
312 Ga0075365_10175006 3300006038 Bacteria 1499
313 Ga0075365_10250989 3300006038 Bacteria 1243
314 Ga0075365_10343220 3300006038 Bacteria 1052
315 Ga0075365_10522901 3300006038 Bacteria 839
316 Ga0075368_10045053 3300006042 Bacteria 1742
317 Ga0075368_10058301 3300006042 Bacteria 1543
318 Ga0075368_10061023 3300006042 Bacteria 1509
319 Ga0075363_100012895 3300006048 Bacteria 4036
320 Ga0075363_100179641 3300006048 Unclassified 1203
321 Ga0075363_100190585 3300006048 Bacteria 1169
322 Ga0075363_100418033 3300006048 Bacteria 789
323 Ga0075363_100498411 3300006048 Bacteria 723
324 Ga0075364_10008807 3300006051 Bacteria 6039
325 Ga0075364_10050422 3300006051 Bacteria 2717
326 Ga0075364_10324493 3300006051 Bacteria 1048
327 Ga0075364_10351445 3300006051 Bacteria 1005
328 Ga0075364_10561853 3300006051 Bacteria 780
329 Ga0075432_10046599 3300006058 Bacteria 1522
330 Ga0075432_10053596 3300006058 Bacteria 1427
331 Ga0070715_10000352 3300006163 Bacteria 11511
332 Ga0070715_10003497 3300006163 Bacteria 5009
333 Ga0070715_10177149 3300006163 Bacteria 1066
334 Ga0070716_100000521 3300006173 Bacteria 16062
335 Ga0070716_100007900 3300006173 Bacteria 5263
336 Ga0070716_100244255 3300006173 Bacteria 1219
337 Ga0070716_100319368 3300006173 Bacteria 1087
338 Ga0070712_100053418 3300006175 Bacteria 2821
339 Ga0070712_100112599 3300006175 Bacteria 2033
340 Ga0070712_100225902 3300006175 Bacteria 1484
341 Ga0070712_100356239 3300006175 Bacteria 1199
342 Ga0070712_100598293 3300006175 Bacteria 933
343 Ga0075362_10073571 3300006177 Bacteria 1564
344 Ga0075367_10019468 3300006178 Bacteria 3764
345 Ga0075367_10024342 3300006178 Bacteria 3413
346 Ga0075367_10057607 3300006178 Bacteria 2310
347 Ga0075367_10132826 3300006178 Bacteria 1539
348 Ga0075367_10211134 3300006178 Bacteria 1214
349 Ga0075367_10306161 3300006178 Bacteria 1000
350 Ga0075369_10085867 3300006186 Bacteria 1400
351 Ga0075366_10025202 3300006195 Bacteria 3473
352 Ga0075366_10101432 3300006195 Bacteria 1727
353 Ga0075366_10250736 3300006195 Bacteria 1080
354 Ga0097621_100000435 3300006237 Bacteria 29115
355 Ga0097621_100072099 3300006237 Bacteria 2856
356 Ga0097621_100263162 3300006237 Bacteria 1513
357 Ga0097621_100383900 3300006237 Bacteria 1255
358 Ga0075370_10033603 3300006353 Bacteria 2872
359 Ga0075370_10045809 3300006353 Bacteria 2474
360 Ga0075370_10140482 3300006353 Bacteria 1412
361 Ga0075370_10176599 3300006353 Bacteria 1256
362 Ga0068871_100012417 3300006358 Bacteria 6278
363 Ga0068871_100081619 3300006358 Bacteria 2679
364 Ga0068871_100205915 3300006358 Bacteria 1700
365 Ga0068871_100312046 3300006358 Bacteria 1383
366 Ga0068871_100694977 3300006358 Bacteria 931
367 Ga0075428_100191902 3300006844 Bacteria 2209
368 Ga0075428_100332413 3300006844 Bacteria 1632
369 Ga0075428_100342286 3300006844 Unclassified 1606
370 Ga0075428_101026227 3300006844 Bacteria 873
371 Ga0075428_101055374 3300006844 Bacteria 859
372 Ga0075430_100010823 3300006846 Bacteria 7728
373 Ga0075430_100231826 3300006846 Bacteria 1531
374 Ga0075431_100000020 3300006847 Bacteria 82958
375 Ga0075431_100008458 3300006847 Bacteria 10305
376 Ga0075431_100208400 3300006847 Bacteria 1998
377 Ga0075431_100277984 3300006847 Unclassified 1695
378 Ga0075431_100366055 3300006847 Bacteria 1447
379 Ga0075431_100468385 3300006847 Bacteria 1254
380 Ga0075431_100982760 3300006847 Bacteria 811
381 Ga0075431_101477921 3300006847 Bacteria 638
382 Ga0075433_10018880 3300006852 Bacteria 5738
383 Ga0075433_10062667 3300006852 Bacteria 3257
384 Ga0075433_10289422 3300006852 Bacteria 1451
385 Ga0075433_10805682 3300006852 Bacteria 821
386 Ga0075434_100003352 3300006871 Bacteria 14332
387 Ga0075434_100011154 3300006871 Bacteria 8456
388 Ga0075434_100185713 3300006871 Bacteria 2099
389 Ga0075429_100015669 3300006880 Bacteria 6569
390 Ga0075429_100323427 3300006880 Bacteria 1350
391 Ga0075429_100332978 3300006880 Bacteria 1329
392 Ga0075429_100451746 3300006880 Bacteria 1126
393 Ga0075429_100638716 3300006880 Bacteria 933
394 Ga0068865_100000485 3300006881 Bacteria 22288
395 Ga0068865_100012411 3300006881 Bacteria 5361
396 Ga0068865_100053945 3300006881 Unclassified 2791
397 Ga0068865_100059221 3300006881 Bacteria 2678
398 Ga0068865_100157100 3300006881 Bacteria 1731
399 Ga0068865_101250436 3300006881 Unclassified 658
400 Ga0075436_100208924 3300006914 Bacteria 1384
401 Ga0075436_100441214 3300006914 Bacteria 947
402 Ga0097620_100020243 3300006931 Bacteria 6679
403 Ga0097620_100023296 3300006931 Bacteria 6214
404 Ga0097620_100078551 3300006931 Bacteria 3341
405 Ga0097620_100752838 3300006931 Bacteria 1063
406 Ga0075435_100089882 3300007076 Bacteria 2533
407 Ga0075435_100494239 3300007076 Bacteria 1057
408 Ga0099794_10015955 3300007265 Bacteria 3324
409 Ga0099795_10000648 3300007788 Bacteria 6682
410 Ga0099795_10024650 3300007788 Bacteria 2009
411 Ga0099795_10034727 3300007788 Bacteria 1758
412 Ga0099795_10063687 3300007788 Bacteria 1375
413 Ga0099795_10108818 3300007788 Bacteria 1096
414 Ga0099795_10148233 3300007788 Bacteria 959
415 Ga0099795_10201972 3300007788 Bacteria 839
416 Ga0105251_10030260 3300009011 Bacteria 2720
417 Ga0105251_10050543 3300009011 Bacteria 1985
418 Ga0105244_10108496 3300009036 Bacteria 1352
419 Ga0105250_10033276 3300009092 Bacteria 2069
420 Ga0105240_10130732 3300009093 Bacteria 3012
421 Ga0105240_10352859 3300009093 Bacteria 1668
422 Ga0111539_10000167 3300009094 Bacteria 75742
423 Ga0111539_10027723 3300009094 Bacteria 6919
424 Ga0111539_10038414 3300009094 Bacteria 5774
425 Ga0111539_10050859 3300009094 Bacteria 4937
426 Ga0111539_10334252 3300009094 Bacteria 1763
427 Ga0111539_10497695 3300009094 Bacteria 1419
428 Ga0111539_10522767 3300009094 Bacteria 1382
429 Ga0111539_11254150 3300009094 Bacteria 860
430 Ga0111539_11745084 3300009094 Bacteria 722
431 Ga0105245_10004286 3300009098 Bacteria 12646
432 Ga0105245_10008339 3300009098 Bacteria 9053
433 Ga0105245_10065446 3300009098 Bacteria 3287
434 Ga0105245_10079827 3300009098 Bacteria 2988
435 Ga0105245_10115240 3300009098 Bacteria 2504
436 Ga0105245_11718779 3300009098 Bacteria 680
437 Ga0105245_11842643 3300009098 Bacteria 658
438 Ga0105247_10009390 3300009101 Bacteria 5937
439 Ga0105247_10028516 3300009101 Bacteria 3378
440 Ga0105247_10046178 3300009101 Bacteria 2673
441 Ga0105247_10233872 3300009101 Bacteria 1249
442 Ga0105247_10498355 3300009101 Bacteria 887
443 Ga0105247_10825026 3300009101 Bacteria 710
444 Ga0114129_10003047 3300009147 Bacteria 23477
445 Ga0114129_10015940 3300009147 Bacteria 10687
446 Ga0114129_10056117 3300009147 Bacteria 5518
447 Ga0114129_10192494 3300009147 Bacteria 2768
448 Ga0114129_10244766 3300009147 Bacteria 2410
449 Ga0114129_10508315 3300009147 Bacteria 1573
450 Ga0114129_10794122 3300009147 Bacteria 1208
451 Ga0114129_10846802 3300009147 Bacteria 1163
452 Ga0114129_11145646 3300009147 Bacteria 971
453 Ga0114129_11538054 3300009147 Bacteria 816
454 Ga0105243_10033625 3300009148 Bacteria 3965
455 Ga0105243_10121717 3300009148 Bacteria 2201
456 Ga0105243_10148011 3300009148 Bacteria 2011
457 Ga0105243_10151959 3300009148 Unclassified 1987
458 Ga0105243_10169286 3300009148 Bacteria 1891
459 Ga0105243_11462591 3300009148 Bacteria 706
460 Ga0105241_10032007 3300009174 Bacteria 3938
461 Ga0105241_10041491 3300009174 Bacteria 3477
462 Ga0105241_10046934 3300009174 Bacteria 3282
463 Ga0105241_10122616 3300009174 Bacteria 2095
464 Ga0105241_10126944 3300009174 Bacteria 2061
465 Ga0105241_10314966 3300009174 Bacteria 1347
466 Ga0105241_10553089 3300009174 Bacteria 1033
467 Ga0105242_10074853 3300009176 Bacteria 2818
468 Ga0105242_10144189 3300009176 Bacteria 2070
469 Ga0105242_10152776 3300009176 Bacteria 2015
470 Ga0105242_10238535 3300009176 Unclassified 1633
471 Ga0105242_10337825 3300009176 Bacteria 1387
472 Ga0105242_10681706 3300009176 Bacteria 1003
473 Ga0105242_11269755 3300009176 Bacteria 759
474 Ga0105248_10096003 3300009177 Bacteria 3338
475 Ga0105248_10125981 3300009177 Unclassified 2889
476 Ga0105248_10232856 3300009177 Bacteria 2074
477 Ga0105248_10599454 3300009177 Bacteria 1243
478 Ga0105237_10032875 3300009545 Bacteria 5252
479 Ga0105237_10044558 3300009545 Bacteria 4468
480 Ga0105237_10058881 3300009545 Bacteria 3845
481 Ga0105237_10087376 3300009545 Bacteria 3107
482 Ga0105237_10101576 3300009545 Bacteria 2868
483 Ga0105237_10107873 3300009545 Bacteria 2776
484 Ga0105237_10132663 3300009545 Bacteria 2485
485 Ga0105237_10164128 3300009545 Bacteria 2220
486 Ga0105238_10011666 3300009551 Bacteria 8855
487 Ga0105238_10014012 3300009551 Bacteria 8108
488 Ga0105238_10030098 3300009551 Bacteria 5525
489 Ga0105238_10064680 3300009551 Bacteria 3657
490 Ga0105238_10200783 3300009551 Bacteria 1969
491 Ga0105238_10248589 3300009551 Bacteria 1756
492 Ga0105238_10296057 3300009551 Bacteria 1601
493 Ga0105238_10303495 3300009551 Bacteria 1580
494 Ga0105249_10057994 3300009553 Bacteria 3548
495 Ga0105249_10122241 3300009553 Bacteria 2475
496 Ga0105249_10197068 3300009553 Bacteria 1969
497 Ga0105249_10700638 3300009553 Bacteria 1073
498 Ga0105249_11043569 3300009553 Bacteria 887
499 Ga0099796_10000265 3300010159 Bacteria 8288
500 Ga0099796_10007182 3300010159 Unclassified 2900
501 Ga0099796_10024637 3300010159 Bacteria 1890
502 Ga0099796_10034554 3300010159 Bacteria 1671
503 Ga0099796_10137756 3300010159 Bacteria 951
504 Ga0105239_10004659 3300010375 Bacteria 16304
505 Ga0105239_10013269 3300010375 Bacteria 9155
506 Ga0105239_10093866 3300010375 Bacteria 3313
507 Ga0105239_10102663 3300010375 Bacteria 3164
508 Ga0105239_10133836 3300010375 Bacteria 2759
509 Ga0105239_10143653 3300010375 Bacteria 2660
510 Ga0105239_10176938 3300010375 Unclassified 2386
511 Ga0105239_10440731 3300010375 Bacteria 1477
512 Ga0105239_10688221 3300010375 Bacteria 1169
513 Ga0105246_10025897 3300011119 Bacteria 3826
514 Ga0105246_10084828 3300011119 Bacteria 2267
515 Ga0105246_10659942 3300011119 Bacteria 912
516 Ga0105246_10893052 3300011119 Bacteria 796
517 Ga0157346_1003509 3300012480 Bacteria 880
518 Ga0157341_1002432 3300012494 Bacteria 1228
519 Ga0157323_1002561 3300012495 Bacteria 1023
520 Ga0157313_1009676 3300012503 Bacteria 803
521 Ga0157342_1000683 3300012507 Bacteria 2210
522 Ga0157316_1023090 3300012510 Bacteria 697
523 Ga0157371_10133354 3300013102 Bacteria 1767
524 Ga0157371_10209600 3300013102 Bacteria 1398
525 Ga0157371_10271568 3300013102 Bacteria 1224
526 Ga0157370_10127401 3300013104 Bacteria 2376
527 Ga0157370_10132132 3300013104 Bacteria 2328
528 Ga0157370_10199482 3300013104 Bacteria 1856
529 Ga0157369_10016835 3300013105 Bacteria 8214
530 Ga0157369_10269640 3300013105 Bacteria 1774
531 Ga0157369_10577588 3300013105 Bacteria 1161
532 Ga0157374_10004303 3300013296 Bacteria 11970
533 Ga0157374_10039082 3300013296 Bacteria 4365
534 Ga0157374_10067422 3300013296 Bacteria 3364
535 Ga0157374_10187920 3300013296 Bacteria 2020
536 Ga0157374_10953995 3300013296 Bacteria 876
537 Ga0157378_10003893 3300013297 Bacteria 13222
538 Ga0157378_10009387 3300013297 Bacteria 8523
539 Ga0157378_10030439 3300013297 Bacteria 4769
540 Ga0157378_10030828 3300013297 Bacteria 4734
541 Ga0157378_10032444 3300013297 Bacteria 4615
542 Ga0157378_10109632 3300013297 Unclassified 2529
543 Ga0157378_10120946 3300013297 Bacteria 2413
544 Ga0157378_10271919 3300013297 Bacteria 1630
545 Ga0157378_10353221 3300013297 Bacteria 1436
546 Ga0157378_10653726 3300013297 Bacteria 1067
547 Ga0163162_10183755 3300013306 Bacteria 2217
548 Ga0163162_10205336 3300013306 Bacteria 2099
549 Ga0163162_10801032 3300013306 Bacteria 1060
550 Ga0163162_11429929 3300013306 Bacteria 787
551 Ga0157372_10302570 3300013307 Bacteria 1860
552 Ga0157372_11454882 3300013307 Bacteria 790
553 Ga0157375_10050882 3300013308 Bacteria 4065
554 Ga0157375_10313984 3300013308 Bacteria 1732
555 Ga0157375_10682618 3300013308 Bacteria 1182
556 Ga0157375_10750634 3300013308 Bacteria 1127
557 Ga0157375_11847156 3300013308 Bacteria 717
558 Ga0163163_10007071 3300014325 Bacteria 9863
559 Ga0163163_10020427 3300014325 Bacteria 6235
560 Ga0163163_10030125 3300014325 Bacteria 5224
561 Ga0163163_10034989 3300014325 Bacteria 4870
562 Ga0163163_10035700 3300014325 Bacteria 4824
563 Ga0163163_10140778 3300014325 Bacteria 2455
564 Ga0163163_10614641 3300014325 Bacteria 1150
565 Ga0157380_10003632 3300014326 Bacteria 10605
566 Ga0157380_10133478 3300014326 Bacteria 2121
567 Ga0157380_10185561 3300014326 Bacteria 1831
568 Ga0157380_10236115 3300014326 Unclassified 1645
569 Ga0157377_10000432 3300014745 Bacteria 18095
570 Ga0157377_10081564 3300014745 Bacteria 1892
571 Ga0157377_10220246 3300014745 Bacteria 1214
572 Ga0157377_10399894 3300014745 Bacteria 935
573 Ga0157379_10148279 3300014968 Bacteria 2116
574 Ga0157379_10333519 3300014968 Bacteria 1386
575 Ga0157379_10480655 3300014968 Bacteria 1149
576 Ga0157379_10896128 3300014968 Bacteria 841
577 Ga0157376_10032211 3300014969 Bacteria 4207
578 Ga0157376_10048633 3300014969 Bacteria 3509
579 Ga0157376_10254265 3300014969 Bacteria 1642
580 Ga0182007_10064525 3300015262 Bacteria 1200
581 Ga0163161_10002081 3300017792 Bacteria 14502
582 Ga0163161_10022770 3300017792 Bacteria 4414
583 Ga0163161_10686903 3300017792 Bacteria 851
584 Ga0206356_10720898 3300020070 Bacteria 3145
585 Ga0213873_10016781 3300021358 Bacteria 1660
586 Ga0213875_10072544 3300021388 Bacteria 1607
587 Ga0207666_1000028 3300025271 Bacteria 32086
588 Ga0209130_1031527 3300025284 Bacteria 1086
589 Ga0207673_1003204 3300025290 Bacteria 1907
590 Ga0209758_1000365 3300025297 Bacteria 80645
591 Ga0209256_1027726 3300025299 Bacteria 1609
592 Ga0207426_1000620 3300025302 Bacteria 45305
593 Ga0207426_1091643 3300025302 Bacteria 803
594 Ga0209257_1024757 3300025304 Bacteria 2069
595 Ga0209257_1038323 3300025304 Bacteria 1453
596 Ga0207697_10043143 3300025315 Bacteria 1854
597 Ga0207697_10117666 3300025315 Bacteria 1142
598 Ga0207656_10095591 3300025321 Bacteria 1355
599 Ga0207656_10138308 3300025321 Bacteria 1146
600 Ga0207696_1029645 3300025711 Bacteria 1669
601 Ga0207655_1116701 3300025728 Bacteria 891
602 Ga0207653_10006097 3300025885 Bacteria 3757
603 Ga0207682_10000640 3300025893 Bacteria 16315
604 Ga0207682_10002485 3300025893 Bacteria 8251
605 Ga0207682_10009098 3300025893 Bacteria 3923
606 Ga0207692_10003023 3300025898 Bacteria 6521
607 Ga0207692_10037773 3300025898 Bacteria 2364
608 Ga0207642_10022716 3300025899 Bacteria 2493
609 Ga0207642_10119391 3300025899 Bacteria 1357
610 Ga0207642_10417167 3300025899 Bacteria 806
611 Ga0207710_10004196 3300025900 Bacteria 6317
612 Ga0207710_10008402 3300025900 Bacteria 4354
613 Ga0207710_10046025 3300025900 Bacteria 1947
614 Ga0207710_10106992 3300025900 Bacteria 1325
615 Ga0207710_10225945 3300025900 Bacteria 931
616 Ga0207688_10000088 3300025901 Bacteria 35438
617 Ga0207688_10007354 3300025901 Bacteria 5995
618 Ga0207688_10026961 3300025901 Bacteria 3160
619 Ga0207688_10066454 3300025901 Bacteria 2039
620 Ga0207688_10096042 3300025901 Bacteria 1706
621 Ga0207688_10480997 3300025901 Bacteria 776
622 Ga0207680_10060673 3300025903 Bacteria 2303
623 Ga0207680_10128477 3300025903 Bacteria 1667
624 Ga0207680_10311273 3300025903 Bacteria 1099
625 Ga0207680_10418409 3300025903 Bacteria 949
626 Ga0207647_10030620 3300025904 Bacteria 3469
627 Ga0207647_10227752 3300025904 Bacteria 1073
628 Ga0207699_10025289 3300025906 Bacteria 3257
629 Ga0207699_10120198 3300025906 Bacteria 1698
630 Ga0207645_10002863 3300025907 Bacteria 13368
631 Ga0207645_10115125 3300025907 Bacteria 1743
632 Ga0207645_10146462 3300025907 Bacteria 1540
633 Ga0207645_10373518 3300025907 Bacteria 956
634 Ga0207643_10000085 3300025908 Bacteria 61372
635 Ga0207643_10024148 3300025908 Unclassified 3354
636 Ga0207643_10037649 3300025908 Bacteria 2714
637 Ga0207684_10046815 3300025910 Plasmid 3669
638 Ga0207654_10000373 3300025911 Bacteria 26098
639 Ga0207654_10245862 3300025911 Bacteria 1197
640 Ga0207654_10553910 3300025911 Bacteria 817
641 Ga0207695_10106623 3300025913 Bacteria 2788
642 Ga0207671_10160163 3300025914 Bacteria 1742
643 Ga0207671_10391560 3300025914 Bacteria 1105
644 Ga0207671_10484080 3300025914 Bacteria 986
645 Ga0207693_10003902 3300025915 Bacteria 12694
646 Ga0207693_10019378 3300025915 Bacteria 5413
647 Ga0207693_10161394 3300025915 Bacteria 1763
648 Ga0207660_10220496 3300025917 Bacteria 1488
649 Ga0207662_10000339 3300025918 Bacteria 21125
650 Ga0207662_10020438 3300025918 Bacteria 3778
651 Ga0207662_10052177 3300025918 Bacteria 2433
652 Ga0207662_10067003 3300025918 Bacteria 2164
653 Ga0207657_10040320 3300025919 Bacteria 4138
654 Ga0207657_10066425 3300025919 Bacteria 3070
655 Ga0207657_10155102 3300025919 Bacteria 1862
656 Ga0207657_10439651 3300025919 Bacteria 1024
657 Ga0207657_10617051 3300025919 Bacteria 845
658 Ga0207649_10151151 3300025920 Bacteria 1599
659 Ga0207649_10263137 3300025920 Bacteria 1247
660 Ga0207649_10315794 3300025920 Bacteria 1146
661 Ga0207649_10483364 3300025920 Bacteria 939
662 Ga0207652_10328765 3300025921 Bacteria 1380
663 Ga0207652_10382514 3300025921 Bacteria 1270
664 Ga0207681_10002232 3300025923 Bacteria 12316
665 Ga0207681_10055014 3300025923 Unclassified 2708
666 Ga0207681_10151240 3300025923 Unclassified 1740
667 Ga0207681_10217859 3300025923 Bacteria 1475
668 Ga0207681_10357048 3300025923 Bacteria 1171
669 Ga0207681_10387612 3300025923 Bacteria 1126
670 Ga0207681_10773471 3300025923 Bacteria 801
671 Ga0207694_10065814 3300025924 Bacteria 2826
672 Ga0207694_10307947 3300025924 Bacteria 1305
673 Ga0207650_10004558 3300025925 Bacteria 9475
674 Ga0207650_10019027 3300025925 Bacteria 4827
675 Ga0207650_10073393 3300025925 Bacteria 2577
676 Ga0207650_10542726 3300025925 Bacteria 974
677 Ga0207659_10000200 3300025926 Bacteria 35764
678 Ga0207659_10057893 3300025926 Bacteria 2781
679 Ga0207659_10094040 3300025926 Bacteria 2245
680 Ga0207659_10153311 3300025926 Bacteria 1801
681 Ga0207659_10776934 3300025926 Bacteria 822
682 Ga0207687_10015071 3300025927 Bacteria 5064
683 Ga0207687_10039006 3300025927 Bacteria 3250
684 Ga0207687_10127218 3300025927 Bacteria 1915
685 Ga0207687_10602183 3300025927 Bacteria 926
686 Ga0207700_10051991 3300025928 Bacteria 3061
687 Ga0207700_10121169 3300025928 Bacteria 2121
688 Ga0207700_10584548 3300025928 Bacteria 993
689 Ga0207664_10012242 3300025929 Bacteria 6130
690 Ga0207664_10042377 3300025929 Bacteria 3553
691 Ga0207664_10181896 3300025929 Bacteria 1805
692 Ga0207644_10000867 3300025931 Bacteria 19095
693 Ga0207644_10223595 3300025931 Bacteria 1493
694 Ga0207644_10431864 3300025931 Bacteria 1080
695 Ga0207644_10614865 3300025931 Bacteria 903
696 Ga0207644_11029016 3300025931 Unclassified 691
697 Ga0207690_10003950 3300025932 Bacteria 8770
698 Ga0207690_10011516 3300025932 Bacteria 5284
699 Ga0207690_10409120 3300025932 Bacteria 1083
700 Ga0207706_10017547 3300025933 Bacteria 6450
701 Ga0207706_10132071 3300025933 Bacteria 2196
702 Ga0207686_10001404 3300025934 Bacteria 13700
703 Ga0207686_10109020 3300025934 Bacteria 1864
704 Ga0207686_10220609 3300025934 Bacteria 1369
705 Ga0207686_10391527 3300025934 Unclassified 1056
706 Ga0207709_10001343 3300025935 Bacteria 17343
707 Ga0207709_10010649 3300025935 Bacteria 5065
708 Ga0207709_10081472 3300025935 Bacteria 2087
709 Ga0207709_10170268 3300025935 Unclassified 1528
710 Ga0207709_10214736 3300025935 Unclassified 1383
711 Ga0207709_10250423 3300025935 Bacteria 1293
712 Ga0207709_10780686 3300025935 Bacteria 770
713 Ga0207670_10000398 3300025936 Bacteria 25046
714 Ga0207670_10049599 3300025936 Unclassified 2809
715 Ga0207670_10137623 3300025936 Bacteria 1797
716 Ga0207669_10000129 3300025937 Bacteria 37620
717 Ga0207669_10003951 3300025937 Bacteria 6468
718 Ga0207669_10004285 3300025937 Bacteria 6267
719 Ga0207669_10022028 3300025937 Bacteria 3377
720 Ga0207669_10101901 3300025937 Bacteria 1900
721 Ga0207669_10141449 3300025937 Bacteria 1671
722 Ga0207669_10571335 3300025937 Bacteria 915
723 Ga0207704_10001904 3300025938 Bacteria 9350
724 Ga0207704_10012182 3300025938 Bacteria 4261
725 Ga0207704_10048853 3300025938 Bacteria 2540
726 Ga0207704_10356655 3300025938 Unclassified 1140
727 Ga0207704_10848757 3300025938 Unclassified 765
728 Ga0207665_10001387 3300025939 Bacteria 16312
729 Ga0207665_10049257 3300025939 Bacteria 2830
730 Ga0207665_10078193 3300025939 Bacteria 2272
731 Ga0207665_10391624 3300025939 Bacteria 1056
732 Ga0207691_10069299 3300025940 Bacteria 3186
733 Ga0207691_10916550 3300025940 Bacteria 733
734 Ga0207711_10017080 3300025941 Bacteria 6028
735 Ga0207711_10199467 3300025941 Bacteria 1826
736 Ga0207711_10763488 3300025941 Bacteria 901
737 Ga0207689_10000547 3300025942 Bacteria 35807
738 Ga0207689_10339556 3300025942 Bacteria 1248
739 Ga0207661_10004288 3300025944 Bacteria 9982
740 Ga0207661_10050124 3300025944 Bacteria 3325
741 Ga0207661_10079137 3300025944 Bacteria 2709
742 Ga0207679_10000558 3300025945 Bacteria 25037
743 Ga0207679_10030376 3300025945 Bacteria 3773
744 Ga0207679_10206653 3300025945 Bacteria 1644
745 Ga0207667_10007300 3300025949 Bacteria 13319
746 Ga0207667_10119406 3300025949 Bacteria 2717
747 Ga0207667_10120691 3300025949 Bacteria 2701
748 Ga0207651_10000790 3300025960 Bacteria 13595
749 Ga0207651_10009960 3300025960 Bacteria 5239
750 Ga0207651_10055107 3300025960 Unclassified 2728
751 Ga0207651_10210802 3300025960 Bacteria 1564
752 Ga0207651_10331489 3300025960 Unclassified 1275
753 Ga0207651_10610433 3300025960 Bacteria 954
754 Ga0207712_10007058 3300025961 Bacteria 7086
755 Ga0207712_10071902 3300025961 Bacteria 2489
756 Ga0207712_10399669 3300025961 Bacteria 1155
757 Ga0207668_10002729 3300025972 Bacteria 10324
758 Ga0207640_10058086 3300025981 Bacteria 2547
759 Ga0207640_10296952 3300025981 Bacteria 1276
760 Ga0207640_10455943 3300025981 Bacteria 1055
761 Ga0207658_10003874 3300025986 Bacteria 10534
762 Ga0207658_10016875 3300025986 Bacteria 5025
763 Ga0207658_10152763 3300025986 Bacteria 1883
764 Ga0207658_10549181 3300025986 Bacteria 1033
765 Ga0207658_11141663 3300025986 Bacteria 712
766 Ga0207677_10005171 3300026023 Bacteria 7063
767 Ga0207677_10045803 3300026023 Bacteria 2923
768 Ga0207677_10313952 3300026023 Bacteria 1300
769 Ga0207677_10406995 3300026023 Bacteria 1155
770 Ga0207703_10000644 3300026035 Bacteria 35023
771 Ga0207703_10320184 3300026035 Bacteria 1420
772 Ga0207703_10567591 3300026035 Bacteria 1071
773 Ga0207703_10629172 3300026035 Bacteria 1017
774 Ga0207639_10034810 3300026041 Bacteria 3725
775 Ga0207678_10016400 3300026067 Bacteria 6504
776 Ga0207678_10020707 3300026067 Bacteria 5765
777 Ga0207678_10260816 3300026067 Bacteria 1485
778 Ga0207678_11113786 3300026067 Bacteria 699
779 Ga0207708_10068669 3300026075 Bacteria 2712
780 Ga0207708_10185080 3300026075 Bacteria 1655
781 Ga0207708_10197695 3300026075 Bacteria 1603
782 Ga0207708_10220307 3300026075 Unclassified 1520
783 Ga0207702_10000243 3300026078 Bacteria 63718
784 Ga0207702_10012908 3300026078 Bacteria 6948
785 Ga0207702_10466793 3300026078 Bacteria 1227
786 Ga0207702_10776128 3300026078 Bacteria 947
787 Ga0207702_11295314 3300026078 Bacteria 723
788 Ga0207641_10001185 3300026088 Bacteria 26147
789 Ga0207641_10003587 3300026088 Bacteria 13709
790 Ga0207641_10072216 3300026088 Bacteria 2971
791 Ga0207641_10157664 3300026088 Bacteria 2061
792 Ga0207641_10248173 3300026088 Bacteria 1661
793 Ga0207641_10313507 3300026088 Bacteria 1485
794 Ga0207648_10002538 3300026089 Bacteria 19586
795 Ga0207648_10017413 3300026089 Bacteria 6539
796 Ga0207648_11143643 3300026089 Bacteria 730
797 Ga0207676_10003948 3300026095 Bacteria 10472
798 Ga0207676_10007042 3300026095 Bacteria 7969
799 Ga0207676_10057920 3300026095 Bacteria 3053
800 Ga0207676_10064493 3300026095 Bacteria 2913
801 Ga0207676_10112099 3300026095 Bacteria 2284
802 Ga0207674_10018619 3300026116 Bacteria 7543
803 Ga0207674_10124866 3300026116 Bacteria 2540
804 Ga0207674_10606714 3300026116 Bacteria 1057
805 Ga0207675_100008179 3300026118 Bacteria 9859
806 Ga0207675_100061200 3300026118 Bacteria 3515
807 Ga0207675_100070938 3300026118 Bacteria 3257
808 Ga0207675_100077967 3300026118 Bacteria 3104
809 Ga0207675_100396191 3300026118 Bacteria 1360
810 Ga0207675_100699335 3300026118 Unclassified 1022
811 Ga0207683_10003695 3300026121 Bacteria 13295
812 Ga0207683_10005841 3300026121 Bacteria 10553
813 Ga0207683_10012937 3300026121 Bacteria 7125
814 Ga0207683_10022205 3300026121 Bacteria 5446
815 Ga0207683_10056654 3300026121 Bacteria 3439
816 Ga0207698_10065550 3300026142 Bacteria 2853
817 Ga0207698_10852441 3300026142 Bacteria 916
818 Ga0209389_1000001 3300027296 Bacteria 463799
819 Ga0209589_1000033 3300027357 Bacteria 140561
820 Ga0209489_100040 3300027361 Bacteria 164986
821 Ga0209489_111101 3300027361 Bacteria 9483
822 Ga0209700_100007 3300027363 Bacteria 454608
823 Ga0209981_1022404 3300027378 Bacteria 906
824 Ga0209996_1017111 3300027395 Bacteria 1000
825 Ga0209984_1002986 3300027424 Bacteria 1913
826 Ga0209995_1004548 3300027471 Bacteria 2218
827 Ga0209179_1007538 3300027512 Bacteria 1800
828 Ga0209999_1042680 3300027543 Bacteria 851
829 Ga0209982_1004605 3300027552 Bacteria 1978
830 Ga0209970_1025045 3300027614 Bacteria 1021
831 Ga0210002_1002707 3300027617 Bacteria 2566
832 Ga0209983_1021928 3300027665 Bacteria 1337
833 Ga0209588_1017279 3300027671 Bacteria 2235
834 Ga0209971_1011063 3300027682 Bacteria 2137
835 Ga0209966_1000401 3300027695 Bacteria 12728
836 Ga0209813_10014033 3300027866 Bacteria 2150
837 Ga0209813_10066481 3300027866 Bacteria 1163
838 Ga0209813_10074315 3300027866 Bacteria 1111
839 Ga0207428_10000055 3300027907 Bacteria 166460
840 Ga0207428_10000664 3300027907 Bacteria 40266
841 Ga0207428_10004496 3300027907 Bacteria 13227
842 Ga0207428_10013539 3300027907 Bacteria 7120
843 Ga0207428_10038968 3300027907 Bacteria 3859
844 Ga0207428_10181740 3300027907 Bacteria 1589
845 Ga0207428_10231565 3300027907 Bacteria 1382
846 Ga0268266_10034374 3300028379 Bacteria 4311
847 Ga0268266_10075860 3300028379 Bacteria 2921
848 Ga0268266_10250329 3300028379 Bacteria 1638
849 Ga0268266_10271509 3300028379 Bacteria 1574
850 Ga0268266_10575926 3300028379 Bacteria 1080
851 Ga0268266_10773313 3300028379 Bacteria 927
852 Ga0268266_10898176 3300028379 Bacteria 857
853 Ga0268265_10011790 3300028380 Bacteria 5910
854 Ga0268265_10076192 3300028380 Unclassified 2630
855 Ga0268265_10699873 3300028380 Bacteria 979
856 Ga0268265_10739965 3300028380 Bacteria 953
857 Ga0268264_10049815 3300028381 Bacteria 3486
858 Ga0268264_10246818 3300028381 Bacteria 1657
859 Ga0268264_10840666 3300028381 Bacteria 919
860 Ga0265318_10008361 3300028577 Bacteria 4613
861 Ga0307515_10573132 3300028794 Bacteria 739
862 Ga0265338_10040637 3300028800 Bacteria 4365
863 Ga0265338_10243378 3300028800 Bacteria 1331
864 Ga0265338_10271405 3300028800 Bacteria 1243
865 Ga0265771_1001725 3300031010 Bacteria 1080
866 Ga0265330_10005858 3300031235 Bacteria 6094
867 Ga0265332_10000641 3300031238 Bacteria 22774
868 Ga0265332_10095195 3300031238 Bacteria 1258
869 Ga0265332_10201261 3300031238 Bacteria 827
870 Ga0265320_10012872 3300031240 Bacteria 4839
871 Ga0265325_10005224 3300031241 Bacteria 8061
872 Ga0265325_10017063 3300031241 Bacteria 4040
873 Ga0265325_10035241 3300031241 Bacteria 2659
874 Ga0265329_10007481 3300031242 Bacteria 4216
875 Ga0265340_10004511 3300031247 Bacteria 7768
876 Ga0265340_10004663 3300031247 Bacteria 7625
877 Ga0265340_10010325 3300031247 Bacteria 4994
878 Ga0265340_10137825 3300031247 Bacteria 1117
879 Ga0265339_10003204 3300031249 Bacteria 11487
880 Ga0265339_10006269 3300031249 Bacteria 7824
881 Ga0265339_10086100 3300031249 Bacteria 1653
882 Ga0265331_10056584 3300031250 Bacteria 1861
883 Ga0265331_10069200 3300031250 Bacteria 1654
884 Ga0265316_10082491 3300031344 Unclassified 2463
885 Ga0265316_10153653 3300031344 Bacteria 1723
886 Ga0265316_10562091 3300031344 Bacteria 811
887 Ga0265316_10574905 3300031344 Bacteria 800
888 Ga0307513_10481132 3300031456 Bacteria 961
889 Ga0307408_100265679 3300031548 Bacteria 1422
890 Ga0265313_10010495 3300031595 Bacteria 5846
891 Ga0265313_10020356 3300031595 Bacteria 3662
892 Ga0265313_10021730 3300031595 Bacteria 3501
893 Ga0265313_10050212 3300031595 Bacteria 2003
894 Ga0316575_10042005 3300031665 Bacteria 1810
895 Ga0265314_10012502 3300031711 Bacteria 6921
896 Ga0265342_10000282 3300031712 Bacteria 57360
897 Ga0265342_10011053 3300031712 Bacteria 6198
898 Ga0265342_10020118 3300031712 Bacteria 4289
899 Ga0265342_10343505 3300031712 Bacteria 778
900 Ga0316576_10157407 3300031727 Bacteria 1713
901 Ga0316578_10034384 3300031728 Bacteria 2910
902 Ga0307516_10305913 3300031730 Bacteria 1264
903 Ga0316577_10230631 3300031733 Bacteria 1047
904 Ga0307413_10040352 3300031824 Bacteria 2723
905 Ga0307410_10024175 3300031852 Bacteria 3792
906 Ga0307410_10900364 3300031852 Bacteria 758
907 Ga0307406_10031987 3300031901 Bacteria 3208
908 Ga0307406_11151487 3300031901 Bacteria 672
909 Ga0307407_10053100 3300031903 Bacteria 2331
910 Ga0307412_10837602 3300031911 Bacteria 801
911 Ga0307412_10917064 3300031911 Bacteria 769
912 Ga0307409_100091683 3300031995 Bacteria 2491
913 Ga0307409_100521271 3300031995 Bacteria 1161
914 Ga0307409_100991263 3300031995 Bacteria 858
915 Ga0307416_100098002 3300032002 Bacteria 2541
916 Ga0307411_10050524 3300032005 Bacteria 2708
917 Ga0307411_10521142 3300032005 Bacteria 1009
918 Ga0307411_10726885 3300032005 Bacteria 867
919 Ga0307415_100636557 3300032126 Bacteria 954
920 Ga0316583_10000114 3300032133 Bacteria 18718
921 Ga0307507_10164021 3300033179 Bacteria 1633
922 Ga0307510_10041923 3300033180 Bacteria 4995
923 Ga0373930_0000142 3300034816 Bacteria 8077
924 Ga0373948_0085747 3300034817 Bacteria 725
925 Ga0373950_0000162 3300034818 Bacteria 9703
926 Ga0373958_0000310 3300034819 Bacteria 5880
927 Ga0373959_0001515 3300034820 Bacteria 3706
928 Ga0373959_0048333 3300034820 Bacteria 912
929 Ga0373938_0000124 3300034957 Bacteria 10815
930 Ga0373938_0046958 3300034957 Bacteria 976
931 Ga0373928_0000366 3300035084 Bacteria 9008
932 Ga0373928_0023056 3300035084 Bacteria 1325
933 Ga0373929_0000321 3300035085 Bacteria 8891
934 Ga0373934_0005198 3300035086 Bacteria 4815
935 Ga0373934_0136381 3300035086 Bacteria 1002
936 Ga0373940_0000053 3300035088 Bacteria 13004
937 Ga0373944_0158725 3300035089 Bacteria 801
938 Ga0373949_0000761 3300035090 Bacteria 10377
939 Ga0373949_0043436 3300035090 Bacteria 1112
940 Ga0373951_0005041 3300035091 Bacteria 3090
941 Ga0373951_0115354 3300035091 Bacteria 726
942 Ga0373952_0000668 3300035092 Bacteria 6060
943 Ga0373952_0049121 3300035092 Bacteria 1000
944 Ga0373923_0003286 3300035111 Bacteria 5158
945 Ga0373923_0193464 3300035111 Bacteria 938
946 Ga0373932_0137000 3300035112 Bacteria 829
947 Ga0373932_0228937 3300035112 Bacteria 671
948 Ga0373936_0013171 3300035113 Bacteria 3155
949 Ga0373936_0036262 3300035113 Bacteria 1966
950 Ga0373936_0049667 3300035113 Bacteria 1695
951 Ga0373936_0125661 3300035113 Bacteria 1099
952 Ga0373936_0313487 3300035113 Bacteria 710
953 Ga0373939_0000855 3300035114 Bacteria 7531
954 Ga0373939_0011251 3300035114 Bacteria 2253
955 Ga0373939_0084704 3300035114 Bacteria 1060
956 Ga0373939_0108185 3300035114 Bacteria 964
957 Ga0373945_0084067 3300035116 Bacteria 1223
958 Ga0373953_0008645 3300035117 Bacteria 3468
959 Ga0373953_0012266 3300035117 Bacteria 3031
960 Ga0373953_0016153 3300035117 Bacteria 2721
961 Ga0373953_0029442 3300035117 Bacteria 2123
962 Ga0373953_0074233 3300035117 Bacteria 1407
963 Ga0373954_0001141 3300035118 Bacteria 10672
964 Ga0373954_0012463 3300035118 Bacteria 3780
965 Ga0373954_0014468 3300035118 Bacteria 3517
966 Ga0373954_0015482 3300035118 Bacteria 3409
967 Ga0373956_0001770 3300035119 Bacteria 8897
968 Ga0373956_0007856 3300035119 Bacteria 4304
969 Ga0373956_0081040 3300035119 Bacteria 1489
970 Ga0373957_0003776 3300035120 Bacteria 4535
971 Ga0373957_0042367 3300035120 Bacteria 1717
972 Ga0373960_0001357 3300035121 Bacteria 5398
973 Ga0373960_0030810 3300035121 Bacteria 1496
974 Ga0373943_0124400 3300035170 Bacteria 1374
975 Ga0373943_0154707 3300035170 Bacteria 1244
976 Ga0373943_0244481 3300035170 Bacteria 1006
977 Ga0373946_0071296 3300035171 Bacteria 1501
978 Ga0373946_0081077 3300035171 Bacteria 1421
979 Ga0373946_0092999 3300035171 Bacteria 1339
980 Ga0373946_0207943 3300035171 Bacteria 940
981 Ga0373946_0334029 3300035171 Bacteria 755
982 Ga0373955_0001039 3300035172 Bacteria 11796
983 Ga0373955_0010151 3300035172 Bacteria 4438
984 Ga0373955_0039022 3300035172 Bacteria 2532
985 Ga0373955_0040170 3300035172 Bacteria 2500
986 Ga0373955_0323326 3300035172 Bacteria 932
987 Ga0373942_0004939 3300035207 Bacteria 3091
988 Ga0373942_0050359 3300035207 Bacteria 1166
989 Ga0373961_0033135 3300035241 Bacteria 1454
990 Ga0373961_0051661 3300035241 Bacteria 1221
991 Ga0373961_0142071 3300035241 Bacteria 812
992 Ga0373962_0000078 3300035242 Bacteria 21523
993 Ga0373962_0078897 3300035242 Bacteria 996
994 Ga0316574_0020651 3300035398 Bacteria 3900
995 Ga0373924_0002945 3300035410 Bacteria 5782
996 Ga0373924_0010518 3300035410 Bacteria 3415
997 Ga0373924_0041585 3300035410 Bacteria 1883
998 Ga0373924_0073796 3300035410 Bacteria 1442
999 Ga0373931_0003029 3300035691 Bacteria 7506
1000 Ga0373931_0007166 3300035691 Bacteria 5243
1001 Ga0373931_0031269 3300035691 Bacteria 2747
1002 Ga0373931_0047034 3300035691 Bacteria 2283
1003 Ga0373931_0052636 3300035691 Bacteria 2171
1004 Ga0373931_0126248 3300035691 Bacteria 1467
1005 Ga0373931_0723548 3300035691 Bacteria 659
1006 Ga0373935_0042469 3300035692 Bacteria 2859
1007 Ga0373935_0055098 3300035692 Bacteria 2533
1008 Ga0373935_0243077 3300035692 Bacteria 1257
1009 Ga0373935_0272398 3300035692 Bacteria 1190
1010 Ga0373935_0345596 3300035692 Bacteria 1060
1011 Ga0373935_0500773 3300035692 Bacteria 882
1012 Ga0373927_0002439 3300035695 Bacteria 13560
1013 Ga0373927_0035146 3300035695 Bacteria 3259
1014 Ga0373927_0039369 3300035695 Unclassified 3068
1015 Ga0373927_0074463 3300035695 Bacteria 2198
1016 Ga0373933_0001176 3300035724 Bacteria 15509
1017 Ga0373933_0003616 3300035724 Bacteria 8571
1018 Ga0373933_0005523 3300035724 Bacteria 6888
1019 Ga0373933_0020771 3300035724 Bacteria 3723
1020 Ga0373933_0038938 3300035724 Bacteria 2795
1021 Ga0373933_0586954 3300035724 Bacteria 731
1022 Ga0373933_0845074 3300035724 Bacteria 603
1023 Ga0373947_0011631 3300035725 Bacteria 5048
1024 Ga0373947_0012163 3300035725 Bacteria 4928
1025 Ga0373947_0166705 3300035725 Bacteria 1427
1026 Ga0373947_0217401 3300035725 Bacteria 1255
1027 Ga0373937_0004370 3300036401 Bacteria 12001
1028 Ga0373937_0007299 3300036401 Bacteria 9566
1029 Ga0373937_0012395 3300036401 Bacteria 7497
1030 Ga0373937_0016330 3300036401 Bacteria 6589
1031 Ga0373937_0027073 3300036401 Bacteria 5182
1032 Ga0373937_0047990 3300036401 Bacteria 3907
1033 Ga0373937_0328431 3300036401 Bacteria 1447
1034 Ga0373937_0749498 3300036401 Bacteria 924
1035 Ga0316582_0222711 3300036647 Bacteria 1290
1036 Ga0316584_0013710 3300036712 Bacteria 5745
1037 Ga0373925_0033621 3300037068 Bacteria 3778
1038 Ga0373925_0058797 3300037068 Bacteria 2883
1039 Ga0373925_0059519 3300037068 Bacteria 2866
1040 Ga0373925_0060739 3300037068 Bacteria 2838
1041 Ga0373925_0109019 3300037068 Bacteria 2137
1042 Ga0373925_0253366 3300037068 Bacteria 1412
1043 Ga0373925_0258352 3300037068 Bacteria 1399
1044 Ga0373925_0379881 3300037068 Bacteria 1150
1045 Ga0373925_0680786 3300037068 Bacteria 848
1046 Ga0395900_0001529 3300037418 Bacteria 27494
1047 Ga0395898_0005283 3300037466 Bacteria 13964
1048 Ga0395898_0100534 3300037466 Bacteria 2777
1049 Ga0395905_0009682 3300037471 Bacteria 9408
1050 Ga0395905_0352196 3300037471 Bacteria 1365
1051 Ga0395905_0624396 3300037471 Bacteria 979
1052 Ga0436364_0151426 3300037853 Bacteria 1793
1053 Ga0436364_0178002 3300037853 Bacteria 1020
1054 Ga0436364_0449892 3300037853 Bacteria 1065
1055 Ga0436364_0682938 3300037853 Bacteria 2822
1056 Ga0436364_0690770 3300037853 Bacteria 684
1057 Ga0395901_0011625 3300038443 Bacteria 8916
1058 Ga0395901_0118144 3300038443 Bacteria 2786
1059 Ga0242420_016255 3300038996 Bacteria 1294
1060 Ga0436365_0062708 3300039437 Bacteria 3398
1061 Ga0436365_0191965 3300039437 Bacteria 59780
1062 Ga0436365_0343292 3300039437 Bacteria 749
1063 Ga0436360_0579576 3300039438 Bacteria 1184
1064 Ga0436360_0996754 3300039438 Bacteria 777
1065 Ga0436361_0357546 3300039447 Bacteria 1164
1066 Ga0436363_0511827 3300039450 Bacteria 699
1067 Ga0436363_0597243 3300039450 Bacteria 2030
1068 Ga0436363_0655408 3300039450 Bacteria 2260
1069 Ga0436363_0767052 3300039450 Bacteria 1678
1070 Ga0436363_1430348 3300039450 Bacteria 842
1071 Ga0436362_0173083 3300039453 Bacteria 728
1072 Ga0436362_0297855 3300039453 Bacteria 4014
1073 Ga0436362_1296428 3300039453 Bacteria 4654
1074 Ga0439453_0000053 3300041408 Bacteria 8018
1075 Ga0439453_0008707 3300041408 Unclassified 1635
1076 Ga0439466_0167669 3300041411 Bacteria 671
1077 Ga0439465_0049910 3300041413 Bacteria 1368
1078 Ga0451787_808973 3300041441 Bacteria 1014
1079 Ga0451791_1200117 3300041451 Bacteria 1384
1080 Ga0451793_1238971 3300041452 Bacteria 963
1081 Ga0451797_0556017 3300041453 Bacteria 735
1082 Ga0451795_0815001 3300041456 Bacteria 1461
1083 Ga0451802_1763825 3300041460 Bacteria 773
1084 Ga0451807_0886678 3300041486 Bacteria 768
1085 Ga0451807_2188998 3300041486 Bacteria 840
1086 Ga0451835_0276910 3300041492 Bacteria 930
1087 Ga0451845_0923467 3300041501 Bacteria 2220
1088 Ga0451847_0233955 3300041503 Bacteria 623
1089 Ga0439443_004635 3300042003 Unclassified 1802
1090 Ga0439445_0044869 3300042004 Bacteria 1182
1091 Ga0439448_0120978 3300042005 Bacteria 898
1092 Ga0439450_057016 3300042008 Bacteria 938
1093 Ga0439455_0100033 3300042012 Unclassified 801
1094 Ga0439463_019984 3300042016 Bacteria 1669
1095 Ga0439446_0042517 3300042156 Bacteria 1341
1096 Ga0439446_0092976 3300042156 Unclassified 946
1097 Ga0439458_0101087 3300042157 Unclassified 749
1098 Ga0439435_0000678 3300042436 Bacteria 5656
1099 Ga0439459_0007786 3300042438 Bacteria 1817
1100 Ga0439464_0012113 3300042439 Bacteria 2292
1101 Ga0439464_0057733 3300042439 Unclassified 1132
1102 Ga0439460_0038009 3300042461 Unclassified 1402
1103 Ga0451577_0171992 3300042876 Bacteria 1952
1104 Ga0439440_0056720 3300042993 Bacteria 991
1105 Ga0466969_0020427 3300044656 Bacteria 3431
1106 Ga0466972_0000333 3300044658 Bacteria 26290
1107 Ga0466972_0208586 3300044658 Bacteria 914
1108 Ga0466966_0046761 3300044684 Bacteria 2762
1109 Ga0466963_0339535 3300044694 Bacteria 1057
1110 Ga0453684_1652533 3300044712 Bacteria 656
1111 Ga0466968_0010020 3300044735 Bacteria 3661
1112 Ga0466968_0413493 3300044735 Bacteria 663
1113 Ga0466957_0063718 3300044842 Bacteria 2267
1114 Ga0466957_0172040 3300044842 Bacteria 1411
1115 Ga0466960_0009504 3300044901 Bacteria 4011
1116 Ga0466960_0043264 3300044901 Bacteria 2141
1117 Ga0466959_0177173 3300045049 Bacteria 1493
1118 Ga0451576_1208535 3300045051 Bacteria 789
1119 Ga0466958_0060744 3300045836 Bacteria 2301
1120 Ga0466967_0047293 3300045976 Bacteria 3750
1121 Ga0466967_0611811 3300045976 Bacteria 1076
1122 Ga0495627_050057 3300046453 Bacteria 1260
1123 Ga0495592_0001529 3300046454 Bacteria 16130
1124 Ga0495592_0002728 3300046454 Bacteria 12506
1125 Ga0495592_0004236 3300046454 Bacteria 10480
1126 Ga0495592_0045149 3300046454 Bacteria 3288
1127 Ga0495592_0122154 3300046454 Bacteria 1830
1128 Ga0495592_0145649 3300046454 Bacteria 1643
1129 Ga0495592_0278130 3300046454 Bacteria 1095
1130 Ga0495603_0035549 3300046455 Bacteria 2992
1131 Ga0495603_0066995 3300046455 Bacteria 2114
1132 Ga0495590_0014239 3300046457 Bacteria 2905
1133 Ga0495590_0049465 3300046457 Bacteria 1467
1134 Ga0495629_0003844 3300046459 Bacteria 11325
1135 Ga0495629_0005031 3300046459 Bacteria 9895
1136 Ga0495629_0108958 3300046459 Bacteria 1931
1137 Ga0495629_0143127 3300046459 Bacteria 1663
1138 Ga0495629_0153766 3300046459 Bacteria 1599
1139 Ga0495629_0707691 3300046459 Bacteria 668
1140 Ga0495638_0023480 3300046460 Bacteria 4032
1141 Ga0495638_0047066 3300046460 Bacteria 2706
1142 Ga0495641_0051051 3300046461 Bacteria 1890
1143 Ga0495641_0207686 3300046461 Bacteria 878
1144 Ga0495651_0001050 3300046462 Bacteria 21354
1145 Ga0495651_0023047 3300046462 Bacteria 4842
1146 Ga0495651_0028941 3300046462 Bacteria 4320
1147 Ga0495653_0000513 3300046463 Bacteria 29794
1148 Ga0495653_0005821 3300046463 Bacteria 10090
1149 Ga0495653_0012012 3300046463 Bacteria 7069
1150 Ga0495653_0049040 3300046463 Bacteria 3256
1151 Ga0495650_0051836 3300046471 Bacteria 1688
1152 Ga0495650_0055945 3300046471 Bacteria 1603
1153 Ga0495582_0100275 3300046473 Bacteria 1621
1154 Ga0495582_0159047 3300046473 Bacteria 1284
1155 Ga0495605_0036148 3300046474 Bacteria 2492
1156 Ga0495605_0062814 3300046474 Bacteria 1773
1157 Ga0495605_0076397 3300046474 Bacteria 1573
1158 Ga0495639_0031208 3300046475 Bacteria 2371
1159 Ga0495639_0089626 3300046475 Bacteria 1441
1160 Ga0495639_0124961 3300046475 Bacteria 1229
1161 Ga0495639_0370037 3300046475 Bacteria 721
1162 Ga0495639_0458663 3300046475 Bacteria 648
1163 Ga0495662_0130354 3300046476 Bacteria 1236
1164 Ga0495664_0015254 3300046477 Bacteria 4365
1165 Ga0495664_0077438 3300046477 Bacteria 1991
1166 Ga0495664_0079992 3300046477 Bacteria 1958
1167 Ga0495664_0165213 3300046477 Bacteria 1343
1168 Ga0495664_0254309 3300046477 Bacteria 1062
1169 Ga0495664_0308653 3300046477 Bacteria 954
1170 Ga0495664_0427658 3300046477 Bacteria 794
1171 Ga0495584_0098425 3300046491 Bacteria 1478
1172 Ga0495584_0118134 3300046491 Bacteria 1343
1173 Ga0495584_0157352 3300046491 Bacteria 1155
1174 Ga0495584_0201040 3300046491 Bacteria 1013
1175 Ga0495585_0036252 3300046492 Bacteria 2783
1176 Ga0495585_0049564 3300046492 Bacteria 2331
1177 Ga0495585_0164648 3300046492 Bacteria 1149
1178 Ga0495594_0139803 3300046499 Bacteria 1373
1179 Ga0495596_0017806 3300046500 Bacteria 2936
1180 Ga0495596_0053354 3300046500 Bacteria 1582
1181 Ga0495596_0091482 3300046500 Unclassified 1181
1182 Ga0495583_0095999 3300046506 Bacteria 1270
1183 Ga0495583_0311352 3300046506 Bacteria 625
1184 Ga0495606_0038140 3300046507 Bacteria 3253
1185 Ga0495608_0000910 3300046511 Bacteria 20753
1186 Ga0495608_0004294 3300046511 Bacteria 10205
1187 Ga0495608_0012541 3300046511 Bacteria 5880
1188 Ga0495608_0097283 3300046511 Bacteria 1900
1189 Ga0495608_0127816 3300046511 Bacteria 1627
1190 Ga0495610_0031329 3300046512 Bacteria 2775
1191 Ga0495616_0019622 3300046513 Bacteria 3687
1192 Ga0495616_0093382 3300046513 Bacteria 1421
1193 Ga0495618_0013782 3300046514 Bacteria 4918
1194 Ga0495618_0027302 3300046514 Bacteria 3554
1195 Ga0495618_0057323 3300046514 Bacteria 2466
1196 Ga0495618_0060670 3300046514 Bacteria 2398
1197 Ga0495618_0139691 3300046514 Bacteria 1550
1198 Ga0495628_0001000 3300046516 Bacteria 25859
1199 Ga0495628_0005038 3300046516 Bacteria 11611
1200 Ga0495628_0007197 3300046516 Bacteria 9635
1201 Ga0495628_0054618 3300046516 Bacteria 3148
1202 Ga0495628_0660412 3300046516 Bacteria 742
1203 Ga0495630_0035402 3300046517 Bacteria 3731
1204 Ga0495630_0218915 3300046517 Bacteria 1453
1205 Ga0495630_0590567 3300046517 Bacteria 851
1206 Ga0495631_0053956 3300046518 Bacteria 1753
1207 Ga0495631_0191919 3300046518 Bacteria 874
1208 Ga0495632_0144704 3300046519 Bacteria 1101
1209 Ga0495632_0145487 3300046519 Bacteria 1098
1210 Ga0495637_0077466 3300046520 Bacteria 1331
1211 Ga0495637_0101462 3300046520 Bacteria 1124
1212 Ga0495643_0003266 3300046522 Bacteria 11998
1213 Ga0495644_0031147 3300046523 Bacteria 2015
1214 Ga0495644_0089326 3300046523 Bacteria 1162
1215 Ga0495666_0060266 3300046526 Bacteria 1814
1216 Ga0495642_0022245 3300046528 Bacteria 2497
1217 Ga0495652_0004645 3300046529 Bacteria 13093
1218 Ga0495652_0020289 3300046529 Bacteria 5908
1219 Ga0495652_0021614 3300046529 Bacteria 5718
1220 Ga0495652_0108100 3300046529 Bacteria 2242
1221 Ga0495652_0267732 3300046529 Bacteria 1257
1222 Ga0495652_0338793 3300046529 Bacteria 1081
1223 Ga0495652_0382011 3300046529 Bacteria 1001
1224 Ga0495652_0383544 3300046529 Bacteria 999
1225 Ga0495654_0209825 3300046530 Unclassified 829
1226 Ga0495654_0329971 3300046530 Bacteria 617
1227 Ga0495640_0014255 3300046533 Bacteria 6021
1228 Ga0495640_0027945 3300046533 Bacteria 4064
1229 Ga0495640_0048808 3300046533 Bacteria 2922
1230 Ga0495640_0071628 3300046533 Bacteria 2325
1231 Ga0495640_0130972 3300046533 Bacteria 1623
1232 Ga0495640_0182841 3300046533 Bacteria 1335
1233 Ga0495640_0195587 3300046533 Bacteria 1284
1234 Ga0495586_0031809 3300046535 Bacteria 2828
1235 Ga0495587_0004074 3300046536 Bacteria 9683
1236 Ga0495587_0005057 3300046536 Bacteria 8625
1237 Ga0495587_0017667 3300046536 Bacteria 4429
1238 Ga0495587_0021173 3300046536 Bacteria 4009
1239 Ga0495587_0219467 3300046536 Bacteria 1072
1240 Ga0495587_0305160 3300046536 Unclassified 890
1241 Ga0495598_0008957 3300046537 Unclassified 2347
1242 Ga0495598_0087453 3300046537 Bacteria 1010
1243 Ga0495609_0023003 3300046538 Bacteria 2867
1244 Ga0495609_0135281 3300046538 Bacteria 1054
1245 Ga0495621_0004613 3300046539 Bacteria 3894
1246 Ga0495621_0019734 3300046539 Unclassified 2204
1247 Ga0495621_0075419 3300046539 Bacteria 1249
1248 Ga0495597_0022020 3300046542 Bacteria 2958
1249 Ga0495597_0091715 3300046542 Bacteria 1289
1250 Ga0495645_0000411 3300046543 Bacteria 29443
1251 Ga0495645_0006906 3300046543 Bacteria 7887
1252 Ga0495645_0010435 3300046543 Bacteria 6511
1253 Ga0495645_0010890 3300046543 Bacteria 6388
1254 Ga0495645_0218221 3300046543 Bacteria 1284
1255 Ga0495622_0004278 3300046557 Bacteria 6645
1256 Ga0495622_0078279 3300046557 Bacteria 1522
1257 Ga0495622_0108318 3300046557 Bacteria 1272
1258 Ga0495633_0031508 3300046558 Bacteria 2569
1259 Ga0495633_0045705 3300046558 Bacteria 2072
1260 Ga0495667_0000399 3300046559 Bacteria 27814
1261 Ga0495667_0003789 3300046559 Bacteria 10155
1262 Ga0495667_0006144 3300046559 Bacteria 8130
1263 Ga0495667_0130731 3300046559 Bacteria 1619
1264 Ga0495667_0259461 3300046559 Bacteria 1105
1265 Ga0495656_0026731 3300046615 Unclassified 2300
1266 Ga0495656_0034480 3300046615 Bacteria 2073
1267 Ga0495668_0055740 3300046616 Bacteria 2182
1268 Ga0495668_0139956 3300046616 Bacteria 1324
1269 Ga0495634_0031038 3300046642 Bacteria 3683
1270 Ga0495634_0038394 3300046642 Bacteria 3266
1271 Ga0495634_0093363 3300046642 Bacteria 1951
1272 Ga0495634_0118730 3300046642 Bacteria 1695
1273 Ga0495634_0164049 3300046642 Bacteria 1399
1274 Ga0495611_0014614 3300046648 Bacteria 3356
1275 Ga0495611_0180671 3300046648 Bacteria 986
1276 Ga0495625_0065754 3300046660 Bacteria 2555
1277 Ga0495625_0483772 3300046660 Bacteria 759
1278 Ga0495635_0000211 3300046663 Bacteria 36892
1279 Ga0495635_0001031 3300046663 Bacteria 18442
1280 Ga0495635_0023129 3300046663 Bacteria 4330
1281 Ga0495635_0023663 3300046663 Bacteria 4278
1282 Ga0495635_0038006 3300046663 Bacteria 3332
1283 Ga0495659_0008931 3300046664 Bacteria 3193
1284 Ga0495588_0046496 3300046674 Bacteria 2226
1285 Ga0495657_0001810 3300046675 Bacteria 18276
1286 Ga0495657_0002321 3300046675 Bacteria 16025
1287 Ga0495657_0141925 3300046675 Bacteria 1496
1288 Ga0495657_0180227 3300046675 Bacteria 1297
1289 Ga0495599_0000957 3300046678 Bacteria 16146
1290 Ga0495599_0027152 3300046678 Bacteria 3589
1291 Ga0495599_0031838 3300046678 Bacteria 3310
1292 Ga0495599_0083380 3300046678 Bacteria 1996
1293 Ga0495599_0458834 3300046678 Bacteria 754
1294 Ga0495623_0005094 3300046679 Bacteria 8622
1295 Ga0495623_0005834 3300046679 Bacteria 8030
1296 Ga0495623_0013653 3300046679 Bacteria 5264
1297 Ga0495623_0013867 3300046679 Bacteria 5225
1298 Ga0495623_0038133 3300046679 Bacteria 3073
1299 Ga0495646_0001814 3300046680 Bacteria 12814
1300 Ga0495646_0004069 3300046680 Bacteria 9174
1301 Ga0495646_0072401 3300046680 Bacteria 2027
1302 Ga0495647_0049450 3300046681 Bacteria 1629
1303 Ga0495647_0061242 3300046681 Bacteria 1486
1304 Ga0495647_0252117 3300046681 Bacteria 786
1305 Ga0495658_0026853 3300046683 Bacteria 3091
1306 Ga0495658_0081955 3300046683 Bacteria 1895
1307 Ga0495658_0112671 3300046683 Bacteria 1637
1308 Ga0495658_0366583 3300046683 Bacteria 916
1309 Ga0495669_0023843 3300046684 Bacteria 2665
1310 Ga0495613_0008427 3300046689 Bacteria 7652
1311 Ga0495613_0032899 3300046689 Bacteria 3853
1312 Ga0495613_0211295 3300046689 Bacteria 1365
1313 Ga0495624_0050047 3300046690 Bacteria 2648
1314 Ga0495624_0495348 3300046690 Bacteria 731
1315 Ga0495670_0380480 3300046691 Bacteria 761
1316 Ga0495671_0129106 3300046692 Bacteria 1233
1317 Ga0495671_0183339 3300046692 Bacteria 1017
1318 Ga0495671_0189079 3300046692 Bacteria 1000
1319 Ga0495649_0033966 3300046694 Bacteria 2807
1320 Ga0495649_0135354 3300046694 Bacteria 1299
1321 Ga0495649_0313912 3300046694 Bacteria 796
1322 Ga0495589_0080801 3300046794 Bacteria 1581
1323 Ga0495600_0006411 3300046809 Bacteria 7161
1324 Ga0495600_0013832 3300046809 Bacteria 5081
1325 Ga0495600_0019824 3300046809 Bacteria 4298
1326 Ga0495600_0291696 3300046809 Bacteria 1031
1327 Ga0495600_0294156 3300046809 Bacteria 1025
1328 Ga0495660_0189023 3300046810 Bacteria 991
1329 Ga0495581_0235415 3300047315 Bacteria 1071
1330 Ga0495581_0423308 3300047315 Bacteria 776
1331 Ga0495604_0002733 3300047317 Bacteria 14153
1332 Ga0495604_0006074 3300047317 Bacteria 9585
1333 Ga0495604_0006930 3300047317 Bacteria 8983
1334 Ga0495604_0009592 3300047317 Bacteria 7656
1335 Ga0495604_0010845 3300047317 Bacteria 7237
1336 Ga0495604_0589279 3300047317 Bacteria 714
1337 Ga0495636_0046748 3300047318 Bacteria 1806
1338 Ga0495636_0048470 3300047318 Bacteria 1775
1339 Ga0495674_0001693 3300047319 Bacteria 21667
1340 Ga0495674_0013996 3300047319 Bacteria 7521
1341 Ga0495674_0030166 3300047319 Bacteria 4933
1342 Ga0495674_0031972 3300047319 Bacteria 4776
1343 Ga0495674_0050926 3300047319 Bacteria 3652
1344 Ga0495674_0055361 3300047319 Bacteria 3479
1345 Ga0495674_0103100 3300047319 Bacteria 2426
1346 Ga0495674_0134788 3300047319 Bacteria 2079
1347 Ga0495674_0393229 3300047319 Unclassified 1120
1348 Ga0495672_0037216 3300047320 Bacteria 2980
1349 Ga0495672_0053767 3300047320 Bacteria 2357
1350 Ga0495672_0061604 3300047320 Bacteria 2162
1351 Ga0495672_0068356 3300047320 Bacteria 2020
1352 Ga0495672_0088611 3300047320 Bacteria 1705
1353 Ga0495672_0096380 3300047320 Bacteria 1613
1354 Ga0495672_0111174 3300047320 Bacteria 1470
1355 Ga0495672_0206936 3300047320 Bacteria 977
1356 Ga0495672_0215598 3300047320 Bacteria 951
1357 Ga0495676_0203139 3300047321 Bacteria 1376
1358 Ga0495676_0247761 3300047321 Bacteria 1217
1359 Ga0495676_0356239 3300047321 Bacteria 977
1360 Ga0495680_0001112 3300047322 Bacteria 29712
1361 Ga0495680_0004228 3300047322 Bacteria 13784
1362 Ga0495680_0006158 3300047322 Bacteria 11190
1363 Ga0495680_0021510 3300047322 Bacteria 5398
1364 Ga0495680_0044833 3300047322 Bacteria 3494
1365 Ga0495680_0072530 3300047322 Bacteria 2618
1366 Ga0495680_0308760 3300047322 Bacteria 1109
1367 Ga0495680_0310922 3300047322 Bacteria 1104
1368 Ga0495680_0537376 3300047322 Bacteria 789
1369 Ga0495683_0037174 3300047323 Bacteria 2469
1370 Ga0495683_0203472 3300047323 Bacteria 891
1371 Ga0495687_010582 3300047443 Bacteria 5050
1372 Ga0495687_099324 3300047443 Bacteria 1096
1373 Ga0495675_0001324 3300047444 Bacteria 15012
1374 Ga0495675_0007639 3300047444 Bacteria 6669
1375 Ga0495675_0025334 3300047444 Bacteria 3782
1376 Ga0495675_0083197 3300047444 Bacteria 2014
1377 Ga0495675_0184389 3300047444 Bacteria 1276
1378 Ga0495684_0015971 3300047471 Bacteria 5782
1379 Ga0495684_0020317 3300047471 Bacteria 5116
1380 Ga0495684_0029872 3300047471 Bacteria 4184
1381 Ga0495684_0037641 3300047471 Bacteria 3711
1382 Ga0495684_0266704 3300047471 Bacteria 1240
1383 Ga0495686_0034271 3300047472 Bacteria 3271
1384 Ga0495686_0220937 3300047472 Bacteria 1078
1385 Ga0495593_0002923 3300047673 Bacteria 10287
1386 Ga0495593_0036009 3300047673 Bacteria 2685
1387 Ga0495593_0127282 3300047673 Bacteria 1294
1388 Ga0495602_0000965 3300048088 Bacteria 27818
1389 Ga0495602_0006595 3300048088 Bacteria 12164
1390 Ga0495602_0008570 3300048088 Bacteria 10678
1391 Ga0495602_0041931 3300048088 Bacteria 4175
1392 Ga0495602_0213520 3300048088 Bacteria 1462
1393 Ga0495602_0307064 3300048088 Bacteria 1159
1394 Ga0495615_0001775 3300048090 Plasmid 3296
1395 Ga0495615_0002752 3300048090 Bacteria 2857
1396 Ga0495615_0008706 3300048090 Bacteria 1972
1397 Ga0495615_0050964 3300048090 Bacteria 1065
1398 Ga0495626_0019232 3300048091 Bacteria 3416
1399 Ga0496100_0002382 3300048903 Bacteria 9515
1400 Ga0496100_0014232 3300048903 Bacteria 4614
1401 Ga0496100_0047643 3300048903 Bacteria 2763
1402 Ga0496100_0057810 3300048903 Bacteria 2542
1403 Ga0496100_0111412 3300048903 Bacteria 1902
1404 Ga0496100_0257738 3300048903 Bacteria 1292
1405 Ga0496100_0264505 3300048903 Bacteria 1276
1406 Ga0496100_0305837 3300048903 Bacteria 1191
1407 Ga0496101_0006609 3300048904 Bacteria 7470
1408 Ga0496101_0012677 3300048904 Bacteria 5634
1409 Ga0496101_0022688 3300048904 Bacteria 4324
1410 Ga0496101_0047225 3300048904 Bacteria 3090
1411 Ga0496101_0163170 3300048904 Bacteria 1710
1412 Ga0496101_0641045 3300048904 Bacteria 839
1413 Ga0496102_0010844 3300048905 Bacteria 7845
1414 Ga0496102_0020999 3300048905 Bacteria 5773
1415 Ga0496102_0045634 3300048905 Bacteria 3979
1416 Ga0496102_0046713 3300048905 Bacteria 3932
1417 Ga0496102_0082115 3300048905 Bacteria 2972
1418 Ga0496102_0105735 3300048905 Bacteria 2619
1419 Ga0496102_0304428 3300048905 Bacteria 1502
1420 Ga0496102_0342681 3300048905 Bacteria 1407
1421 Ga0496102_0585870 3300048905 Bacteria 1038
1422 Ga0496103_0001419 3300048906 Bacteria 16061
1423 Ga0496103_0002062 3300048906 Bacteria 12860
1424 Ga0496103_0023756 3300048906 Bacteria 3696
1425 Ga0496103_0051560 3300048906 Bacteria 2547
1426 Ga0496103_0072196 3300048906 Bacteria 2161
1427 Ga0496103_0113002 3300048906 Bacteria 1726
1428 Ga0496103_0241484 3300048906 Bacteria 1162
1429 Ga0496104_0000140 3300048907 Bacteria 67259
1430 Ga0496104_0004452 3300048907 Bacteria 12203
1431 Ga0496104_0008421 3300048907 Bacteria 9169
1432 Ga0496104_0039302 3300048907 Bacteria 4430
1433 Ga0496104_0058499 3300048907 Bacteria 3648
1434 Ga0496104_0071910 3300048907 Bacteria 3289
1435 Ga0496104_0090536 3300048907 Bacteria 2923
1436 Ga0496104_0111274 3300048907 Bacteria 2625
1437 Ga0496104_0143567 3300048907 Bacteria 2293
1438 Ga0496104_0161654 3300048907 Bacteria 2148
1439 Ga0496104_0182846 3300048907 Bacteria 2007
1440 Ga0496104_0383469 3300048907 Bacteria 1318
1441 Ga0496104_0463606 3300048907 Bacteria 1178
1442 Ga0496104_0465559 3300048907 Bacteria 1175
1443 Ga0496104_0584170 3300048907 Bacteria 1027
1444 Ga0496105_0000043 3300048908 Bacteria 114348
1445 Ga0496105_0001390 3300048908 Bacteria 16994
1446 Ga0496105_0006096 3300048908 Bacteria 9227
1447 Ga0496105_0006732 3300048908 Bacteria 8837
1448 Ga0496105_0025833 3300048908 Bacteria 4784
1449 Ga0496105_0066445 3300048908 Bacteria 2977
1450 Ga0496105_0068744 3300048908 Bacteria 2926
1451 Ga0496105_0210178 3300048908 Bacteria 1586
1452 Ga0496105_0232880 3300048908 Bacteria 1496
1453 Ga0496105_0351797 3300048908 Bacteria 1176
1454 Ga0496105_0359571 3300048908 Bacteria 1161
1455 Ga0496105_0461199 3300048908 Bacteria 1002
1456 Ga0496106_0005076 3300048909 Bacteria 9744
1457 Ga0496106_0006330 3300048909 Bacteria 8767
1458 Ga0496106_0006503 3300048909 Bacteria 8654
1459 Ga0496106_0014137 3300048909 Bacteria 5896
1460 Ga0496106_0035723 3300048909 Bacteria 3716
1461 Ga0496106_0107271 3300048909 Bacteria 2172
1462 Ga0496106_0132066 3300048909 Bacteria 1959
1463 Ga0496106_0188677 3300048909 Bacteria 1638
1464 Ga0496106_0332789 3300048909 Bacteria 1219
1465 Ga0496106_0909481 3300048909 Bacteria 694
1466 Ga0496107_0006319 3300048910 Bacteria 8142
1467 Ga0496107_0014188 3300048910 Bacteria 5579
1468 Ga0496107_0017343 3300048910 Bacteria 5063
1469 Ga0496107_0019745 3300048910 Bacteria 4756
1470 Ga0496107_0034155 3300048910 Bacteria 3641
1471 Ga0496107_0065142 3300048910 Bacteria 2641
1472 Ga0496107_0210274 3300048910 Bacteria 1446
1473 Ga0496107_0420564 3300048910 Bacteria 993
1474 Ga0496107_0665198 3300048910 Bacteria 767
1475 Ga0496108_0000449 3300048911 Bacteria 32814
1476 Ga0496108_0000845 3300048911 Bacteria 23854
1477 Ga0496108_0001227 3300048911 Bacteria 20117
1478 Ga0496108_0018642 3300048911 Bacteria 5686
1479 Ga0496108_0022690 3300048911 Bacteria 5162
1480 Ga0496108_0067630 3300048911 Bacteria 3014
1481 Ga0496108_0115483 3300048911 Bacteria 2299
1482 Ga0496108_0296107 3300048911 Bacteria 1409
1483 Ga0496108_0466440 3300048911 Bacteria 1103
1484 Ga0496108_0471213 3300048911 Bacteria 1097
1485 Ga0496108_0624047 3300048911 Bacteria 938
1486 Ga0496109_0000592 3300048912 Bacteria 30336
1487 Ga0496109_0000896 3300048912 Bacteria 24846
1488 Ga0496109_0001611 3300048912 Bacteria 18840
1489 Ga0496109_0002747 3300048912 Bacteria 14762
1490 Ga0496109_0052497 3300048912 Bacteria 3716
1491 Ga0496109_0159366 3300048912 Bacteria 2114
1492 Ga0496109_0170979 3300048912 Bacteria 2038
1493 Ga0496109_0271921 3300048912 Bacteria 1596
1494 Ga0496109_0514765 3300048912 Bacteria 1129
1495 Ga0496109_0605327 3300048912 Bacteria 1032
1496 Ga0496109_0728453 3300048912 Bacteria 929
1497 Ga0496110_0025034 3300048913 Bacteria 5095
1498 Ga0496110_0040389 3300048913 Bacteria 4066
1499 Ga0496110_0054663 3300048913 Bacteria 3512
1500 Ga0496110_0060173 3300048913 Bacteria 3349
1501 Ga0496110_0068694 3300048913 Bacteria 3136
1502 Ga0496110_0117351 3300048913 Bacteria 2396
1503 Ga0496110_0156060 3300048913 Bacteria 2067
1504 Ga0496110_0181993 3300048913 Bacteria 1908
1505 Ga0496110_0213957 3300048913 Bacteria 1752
1506 Ga0496110_0325869 3300048913 Bacteria 1399
1507 Ga0496110_0460770 3300048913 Bacteria 1158
1508 Ga0496110_0572726 3300048913 Bacteria 1025
1509 Ga0496111_0001189 3300048914 Bacteria 14505
1510 Ga0496111_0001965 3300048914 Bacteria 12213
1511 Ga0496111_0041773 3300048914 Bacteria 3291
1512 Ga0496111_0048896 3300048914 Bacteria 3048
1513 Ga0496111_0092622 3300048914 Bacteria 2215
1514 Ga0496111_0148066 3300048914 Bacteria 1741
1515 Ga0496111_0212255 3300048914 Bacteria 1438
1516 Ga0496111_0349793 3300048914 Bacteria 1094
1517 Ga0496112_0001178 3300048915 Bacteria 19598
1518 Ga0496112_0002006 3300048915 Bacteria 16103
1519 Ga0496112_0010720 3300048915 Bacteria 8333
1520 Ga0496112_0014863 3300048915 Bacteria 7241
1521 Ga0496112_0017698 3300048915 Bacteria 6704
1522 Ga0496112_0030697 3300048915 Bacteria 5204
1523 Ga0496112_0345767 3300048915 Bacteria 1430
1524 Ga0496112_0432434 3300048915 Bacteria 1254
1525 Ga0496112_0611316 3300048915 Bacteria 1021
1526 Ga0496112_0737280 3300048915 Bacteria 912
1527 Ga0496113_0000507 3300048916 Bacteria 19242
1528 Ga0496113_0000911 3300048916 Bacteria 15617
1529 Ga0496113_0001342 3300048916 Bacteria 13620
1530 Ga0496113_0016467 3300048916 Bacteria 5108
1531 Ga0496113_0042838 3300048916 Bacteria 3346
1532 Ga0496113_0932551 3300048916 Bacteria 686
1533 Ga0496114_0003476 3300048917 Bacteria 12094
1534 Ga0496114_0007914 3300048917 Bacteria 8413
1535 Ga0496114_0054340 3300048917 Bacteria 3340
1536 Ga0496114_0154390 3300048917 Bacteria 1992
1537 Ga0496114_0193357 3300048917 Bacteria 1780
1538 Ga0496114_0222469 3300048917 Bacteria 1657
1539 Ga0496114_0354882 3300048917 Bacteria 1297
1540 Ga0496115_0001082 3300048918 Bacteria 19741
1541 Ga0496115_0015997 3300048918 Bacteria 5704
1542 Ga0496115_0030182 3300048918 Bacteria 4263
1543 Ga0496115_0033375 3300048918 Bacteria 4064
1544 Ga0496115_0056942 3300048918 Bacteria 3143
1545 Ga0496115_0067466 3300048918 Bacteria 2893
1546 Ga0496115_0082658 3300048918 Bacteria 2617
1547 Ga0496115_0153536 3300048918 Bacteria 1901
1548 Ga0496115_0211374 3300048918 Bacteria 1602
1549 Ga0496115_0281254 3300048918 Bacteria 1366
1550 Ga0496115_0411480 3300048918 Bacteria 1096
1551 Ga0496115_0593531 3300048918 Bacteria 881
1552 Ga0496115_0793748 3300048918 Bacteria 737
1553 Ga0496115_0795474 3300048918 Bacteria 736
1554 Ga0496116_0172725 3300048919 Bacteria 1169
1555 Ga0496117_0039541 3300048920 Bacteria 3480
1556 Ga0496117_0284201 3300048920 Bacteria 884
1557 Ga0496118_0003113 3300048921 Bacteria 21268
1558 Ga0496118_0012566 3300048921 Bacteria 8109
1559 Ga0496119_0024068 3300048922 Bacteria 4297
1560 Ga0496119_0111262 3300048922 Bacteria 1519
1561 Ga0496119_0178687 3300048922 Bacteria 1115
1562 Ga0496120_0116930 3300048923 Bacteria 1384
1563 Ga0496120_0294849 3300048923 Bacteria 745
1564 Ga0496120_0374167 3300048923 Bacteria 635
1565 Ga0496121_0000886 3300048924 Bacteria 54049
1566 Ga0496121_0002017 3300048924 Bacteria 32207
1567 Ga0496121_0017513 3300048924 Bacteria 7311
1568 Ga0496121_0049748 3300048924 Bacteria 3549
1569 Ga0496121_0215718 3300048924 Bacteria 1356
1570 Ga0496121_0255633 3300048924 Bacteria 1212
1571 Ga0496122_0071623 3300048925 Bacteria 2469
1572 Ga0496124_0013881 3300048927 Bacteria 7832
1573 Ga0496124_0144905 3300048927 Bacteria 1870
1574 Ga0496124_0156452 3300048927 Bacteria 1781
1575 Ga0496125_0018812 3300048928 Bacteria 6543
1576 Ga0496125_0034757 3300048928 Bacteria 4436
1577 Ga0496125_0050051 3300048928 Bacteria 3464
1578 Ga0496125_0181019 3300048928 Bacteria 1404
1579 Ga0496126_0017266 3300048929 Bacteria 7190
1580 Ga0496126_0044034 3300048929 Bacteria 4113
1581 Ga0496126_0076736 3300048929 Bacteria 2964
1582 Ga0496126_0166185 3300048929 Bacteria 1883
1583 Ga0496126_0963885 3300048929 Bacteria 642
1584 Ga0501309_024232 3300049129 Bacteria 866
1585 Ga0495678_037461 3300049459 Bacteria 1970
1586 Ga0495682_0045975 3300049460 Bacteria 1594
1587 Ga0495682_0082909 3300049460 Bacteria 1153
1588 Ga0501033_0134455 3300049570 Bacteria 1790
1589 Ga0501033_0164043 3300049570 Bacteria 1598
1590 Ga0501034_0073120 3300049571 Bacteria 3437
1591 Ga0501034_0675434 3300049571 Bacteria 933
1592 Ga0501036_0063664 3300049572 Bacteria 3122
1593 Ga0501036_0200803 3300049572 Bacteria 1677
1594 Ga0501036_0448230 3300049572 Bacteria 1075
1595 Ga0501037_0272014 3300049573 Bacteria 1182
1596 Ga0501038_0093943 3300049574 Bacteria 2508
1597 Ga0501038_0375293 3300049574 Bacteria 1104
1598 Ga0501038_0410248 3300049574 Bacteria 1047
1599 Ga0501039_0144968 3300049575 Bacteria 1866
1600 Ga0501041_0043056 3300049577 Bacteria 2745
1601 Ga0501042_0393614 3300049578 Bacteria 1004
1602 Ga0501043_0584704 3300049579 Bacteria 826
1603 Ga0501046_0026812 3300049580 Bacteria 4706
1604 Ga0501046_0249702 3300049580 Bacteria 1306
1605 Ga0501047_0108340 3300049581 Bacteria 2660
1606 Ga0501047_0701833 3300049581 Bacteria 829
1607 Ga0501048_0333066 3300049582 Bacteria 1082
1608 Ga0501048_0395781 3300049582 Bacteria 987
1609 Ga0501048_0695419 3300049582 Bacteria 730
1610 Ga0501067_0029147 3300049583 Bacteria 3059
1611 Ga0501068_0336607 3300049584 Bacteria 969
1612 Ga0501070_0049621 3300049586 Bacteria 3485
1613 Ga0501071_0101042 3300049587 Bacteria 2126
1614 Ga0501071_0175580 3300049587 Bacteria 1605
1615 Ga0501071_0227380 3300049587 Bacteria 1405
1616 Ga0501071_0964315 3300049587 Bacteria 658
1617 Ga0501072_0008000 3300049588 Bacteria 8023
1618 Ga0501072_0017905 3300049588 Bacteria 5448
1619 Ga0501072_0352048 3300049588 Bacteria 1169
1620 Ga0501073_0074697 3300049589 Bacteria 2360
1621 Ga0501073_0405085 3300049589 Bacteria 942
1622 Ga0501073_0639138 3300049589 Unclassified 735
1623 Ga0501075_0020214 3300049591 Bacteria 4839
1624 Ga0501075_0051469 3300049591 Bacteria 3097
1625 Ga0501075_0100730 3300049591 Bacteria 2194
1626 Ga0501075_0398654 3300049591 Bacteria 1049
1627 Ga0501076_0026146 3300049592 Bacteria 4519
1628 Ga0501076_0056326 3300049592 Bacteria 3120
1629 Ga0501076_0090946 3300049592 Bacteria 2455
1630 Ga0501076_0232587 3300049592 Bacteria 1507
1631 Ga0501076_0344665 3300049592 Bacteria 1223
1632 Ga0501076_0493584 3300049592 Bacteria 1009
1633 Ga0501076_0611521 3300049592 Unclassified 899
1634 Ga0501077_0068698 3300049593 Bacteria 2246
1635 Ga0501077_0093371 3300049593 Bacteria 1907
1636 Ga0501077_0589818 3300049593 Bacteria 714
1637 Ga0501077_0622669 3300049593 Bacteria 693
1638 Ga0501079_0022862 3300049741 Bacteria 4799
1639 Ga0501079_0129953 3300049741 Bacteria 1960
1640 Ga0501079_0139630 3300049741 Unclassified 1887
1641 Ga0501079_0350733 3300049741 Bacteria 1156
1642 Ga0501079_0617329 3300049741 Bacteria 853
1643 Ga0501079_1146054 3300049741 Bacteria 613
1644 Ga0501080_0245615 3300049742 Bacteria 1633
1645 Ga0501080_0545869 3300049742 Bacteria 1033
1646 Ga0501081_0081615 3300049743 Bacteria 2264
1647 Ga0501081_0151462 3300049743 Bacteria 1666
1648 Ga0501081_0281312 3300049743 Unclassified 1218
1649 Ga0501081_0282723 3300049743 Bacteria 1215
1650 Ga0501081_0378489 3300049743 Bacteria 1046
1651 Ga0501081_0433568 3300049743 Bacteria 975
1652 Ga0501081_0728988 3300049743 Bacteria 745
1653 Ga0501081_0880596 3300049743 Unclassified 675
1654 Ga0501083_0003903 3300049744 Bacteria 10472
1655 Ga0501083_0013908 3300049744 Bacteria 5627
1656 Ga0501083_0115837 3300049744 Bacteria 1759
1657 Ga0501083_0247446 3300049744 Bacteria 1161
1658 Ga0501035_0182194 3300049822 Bacteria 1809
1659 Ga0501044_0029667 3300049823 Bacteria 5766
1660 Ga0501044_1100295 3300049823 Bacteria 664
1661 Ga0501045_0033295 3300049824 Bacteria 3737
1662 Ga0501045_0228042 3300049824 Bacteria 1387
1663 Ga0501045_0369617 3300049824 Bacteria 1067
1664 nmdc:mga03683_119971_c1 3300050489 Bacteria 1169
1665 nmdc:mga03683_274542_c1 3300050489 Bacteria 787
1666 nmdc:mga03683_34584_c1 3300050489 Bacteria 2045
1667 nmdc:mga03683_4641_c1 3300050489 Bacteria 4576
1668 nmdc:mga03683_78970_c1 3300050489 Bacteria 1418
1669 nmdc:mga03n38_10463_c1 3300050490 Bacteria 3413
1670 nmdc:mga03n38_170575_c1 3300050490 Unclassified 1108
1671 nmdc:mga03n38_349289_c1 3300050490 Bacteria 805
1672 nmdc:mga03n38_45781_c1 3300050490 Bacteria 1928
1673 nmdc:mga03n38_59539_c1 3300050490 Bacteria 1734
1674 nmdc:mga03n38_6717_c1 3300050490 Bacteria 4021
1675 nmdc:mga03n38_68457_c1 3300050490 Bacteria 1637
1676 nmdc:mga00v17_207358_c1 3300050491 Bacteria 1268
1677 nmdc:mga00v17_274513_c1 3300050491 Bacteria 1094
1678 nmdc:mga00v17_429911_c1 3300050491 Bacteria 858
1679 nmdc:mga00v17_43255_c1 3300050491 Bacteria 2712
1680 nmdc:mga00v17_59880_c1 3300050491 Bacteria 2338
1681 nmdc:mga0yw44_11255_c1 3300050492 Unclassified 4608
1682 nmdc:mga0yw44_118837_c1 3300050492 Bacteria 1701
1683 nmdc:mga0yw44_150798_c1 3300050492 Bacteria 1516
1684 nmdc:mga0yw44_198523_c1 3300050492 Bacteria 1324
1685 nmdc:mga0yw44_255925_c1 3300050492 Bacteria 1166
1686 nmdc:mga0yw44_28117_c1 3300050492 Plasmid 3232
1687 nmdc:mga0yw44_281998_c1 3300050492 Bacteria 1111
1688 nmdc:mga0yw44_30505_c1 3300050492 Plasmid 3125
1689 nmdc:mga0yw44_30604_c1 3300050492 Bacteria 3122
1690 nmdc:mga0yw44_331605_c1 3300050492 Bacteria 1023
1691 nmdc:mga0yw44_43345_c1 3300050492 Bacteria 2686
1692 nmdc:mga0yw44_4648_c1 3300050492 Bacteria 6341
1693 nmdc:mga0yw44_517042_c1 3300050492 Bacteria 810
1694 nmdc:mga0yw44_78004_c1 3300050492 Bacteria 2071
1695 nmdc:mga0k408_122033_c1 3300050493 Bacteria 1544
1696 nmdc:mga0k408_207440_c1 3300050493 Bacteria 1170
1697 nmdc:mga0k408_31601_c1 3300050493 Bacteria 3024
1698 nmdc:mga0k408_383483_c1 3300050493 Bacteria 837
1699 nmdc:mga0k408_54735_c1 3300050493 Bacteria 2312
1700 nmdc:mga0k408_78564_c1 3300050493 Bacteria 1931
1701 nmdc:mga0k408_8031_c1 3300050493 Bacteria 5657
1702 nmdc:mga0k408_82626_c1 3300050493 Bacteria 1882
1703 nmdc:mga0k408_91669_c1 3300050493 Bacteria 1292
1704 nmdc:mga0k408_92254_c1 3300050493 Bacteria 1780
1705 nmdc:mga06z11_102584_c1 3300050494 Bacteria 1572
1706 nmdc:mga06z11_106571_c1 3300050494 Bacteria 1546
1707 nmdc:mga06z11_121587_c1 3300050494 Bacteria 1457
1708 nmdc:mga06z11_124756_c1 3300050494 Bacteria 1440
1709 nmdc:mga06z11_214875_c1 3300050494 Bacteria 1122
1710 nmdc:mga06z11_276345_c1 3300050494 Bacteria 994
1711 nmdc:mga06z11_34496_c1 3300050494 Bacteria 2485
1712 nmdc:mga06z11_44322_c1 3300050494 Unclassified 2243
1713 nmdc:mga06z11_50325_c1 3300050494 Bacteria 2129
1714 nmdc:mga06z11_525023_c1 3300050494 Bacteria 718
1715 nmdc:mga06z11_64594_c1 3300050494 Unclassified 1919
1716 nmdc:mga06z11_75107_c1 3300050494 Bacteria 1799
1717 nmdc:mga04h51_107365_c1 3300050495 Bacteria 1025
1718 nmdc:mga04h51_107883_c1 3300050495 Bacteria 1023
1719 nmdc:mga04h51_1239_c1 3300050495 Bacteria 5904
1720 nmdc:mga04h51_1563_c1 3300050495 Bacteria 5327
1721 nmdc:mga04h51_23183_c1 3300050495 Bacteria 1888
1722 nmdc:mga04h51_255299_c1 3300050495 Unclassified 704
1723 nmdc:mga04h51_42321_c1 3300050495 Bacteria 1493
1724 nmdc:mga04h51_67446_c1 3300050495 Bacteria 1241
1725 nmdc:mga07m45_15871_c1 3300050496 Bacteria 4027
1726 nmdc:mga07m45_215588_c2 3300050496 Bacteria 909
1727 nmdc:mga07m45_23262_c1 3300050496 Bacteria 3386
1728 nmdc:mga07m45_349640_c1 3300050496 Bacteria 859
1729 nmdc:mga07m45_431249_c1 3300050496 Bacteria 765
1730 nmdc:mga07m45_587041_c1 3300050496 Bacteria 644
1731 nmdc:mga05p37_1180728_c1 3300050507 Bacteria 793
1732 nmdc:mga05p37_118439_c1 3300050507 Bacteria 3254
1733 nmdc:mga05p37_156170_c1 3300050507 Bacteria 2788
1734 nmdc:mga05p37_22407_c1 3300050507 Bacteria 7662
1735 nmdc:mga05p37_413180_c1 3300050507 Bacteria 1572
1736 nmdc:mga05p37_481_c1 3300050507 Bacteria 43634
1737 nmdc:mga05p37_56162_c1 3300050507 Bacteria 4847
1738 nmdc:mga05p37_89411_c1 3300050507 Bacteria 3795
1739 nmdc:mga05p37_91321_c1 3300050507 Unclassified 3205
1740 nmdc:mga09592_1486_c1 3300050508 Bacteria 18853
1741 nmdc:mga09592_183634_c1 3300050508 Bacteria 1809
1742 nmdc:mga09592_211036_c1 3300050508 Bacteria 1682
1743 nmdc:mga09592_359431_c1 3300050508 Bacteria 1260
1744 nmdc:mga0qj67_111_c1 3300050509 Bacteria 53806
1745 nmdc:mga0qj67_194899_c1 3300050509 Bacteria 1646
1746 nmdc:mga0qj67_42686_c1 3300050509 Bacteria 3570
1747 nmdc:mga0qj67_511437_c1 3300050509 Bacteria 965
1748 nmdc:mga0qj67_545_c1 3300050509 Bacteria 25640
1749 nmdc:mga06r32_1300867_c1 3300050510 Bacteria 671
1750 nmdc:mga06r32_158652_c1 3300050510 Bacteria 2244
1751 nmdc:mga06r32_16404_c1 3300050510 Bacteria 6750
1752 nmdc:mga06r32_32_c1 3300050510 Bacteria 83882
1753 nmdc:mga06r32_461652_c1 3300050510 Bacteria 1249
1754 nmdc:mga06r32_596492_c1 3300050510 Bacteria 1076
1755 nmdc:mga06r32_723428_c1 3300050510 Bacteria 960
1756 nmdc:mga08y16_233645_c1 3300050511 Bacteria 1901
1757 nmdc:mga08y16_268625_c1 3300050511 Bacteria 1761
1758 nmdc:mga08y16_29056_c1 3300050511 Bacteria 5827
1759 nmdc:mga08y16_315591_c1 3300050511 Bacteria 1610
1760 nmdc:mga08y16_37_c1 3300050511 Bacteria 150340
1761 nmdc:mga08y16_50185_c1 3300050511 Bacteria 4366
1762 nmdc:mga08y16_53825_c1 3300050511 Bacteria 4206
1763 nmdc:mga08y16_73437_c1 3300050511 Unclassified 3564
1764 nmdc:mga08y16_7415_c1 3300050511 Bacteria 11491
1765 nmdc:mga08y16_975869_c1 3300050511 Bacteria 829
1766 nmdc:mga08y16_983593_c1 3300050511 Bacteria 825
1767 nmdc:mga0n895_129713_c1 3300050512 Bacteria 2546
1768 nmdc:mga0n895_197525_c1 3300050512 Bacteria 2043
1769 nmdc:mga0n895_21007_c1 3300050512 Bacteria 6099
1770 nmdc:mga0n895_30774_c1 3300050512 Bacteria 5133
1771 nmdc:mga0rr50_132058_c1 3300050513 Bacteria 2000
1772 nmdc:mga0rr50_182900_c1 3300050513 Bacteria 1714
1773 nmdc:mga0rr50_372834_c1 3300050513 Bacteria 1203
1774 nmdc:mga0rr50_831076_c1 3300050513 Bacteria 788
1775 nmdc:mga08x19_201358_c1 3300050514 Bacteria 1365
1776 nmdc:mga08x19_226002_c1 3300050514 Bacteria 1287
1777 nmdc:mga0a205_302815_c1 3300050515 Bacteria 1471
1778 nmdc:mga0a205_325570_c1 3300050515 Bacteria 1407
1779 nmdc:mga0a205_367707_c1 3300050515 Bacteria 1304
1780 nmdc:mga0a205_48670_c1 3300050515 Bacteria 1032
1781 nmdc:mga0a205_69199_c1 3300050515 Bacteria 3409
1782 nmdc:mga0a205_72778_c1 3300050515 Bacteria 3320
1783 nmdc:mga0a205_916012_c1 3300050515 Bacteria 723
1784 nmdc:mga0sz30_120911_c1 3300050516 Bacteria 1151
1785 nmdc:mga0sz30_1617_c1 3300050516 Bacteria 3982
1786 nmdc:mga0sz30_222244_c1 3300050516 Bacteria 840
1787 nmdc:mga0sz30_47446_c1 3300050516 Bacteria 1815
1788 nmdc:mga0sz30_64811_c1 3300050516 Bacteria 1566
1789 nmdc:mga0sz30_66961_c1 3300050516 Bacteria 1542
1790 nmdc:mga0sz30_9308_c2 3300050516 Bacteria 3518
1791 Ga0495601_0000467 3300053077 Bacteria 21224
1792 Ga0495601_0000861 3300053077 Bacteria 16540
1793 Ga0495601_0001456 3300053077 Bacteria 13045
1794 Ga0495601_0005945 3300053077 Bacteria 7118
1795 Ga0495601_0011563 3300053077 Bacteria 5287
1796 Ga0495601_0095822 3300053077 Bacteria 1913
1797 Ga0495601_0115884 3300053077 Bacteria 1737
1798 Ga0495601_0201605 3300053077 Bacteria 1300
1799 Ga0495612_0000575 3300053078 Bacteria 14787
1800 Ga0495612_0004648 3300053078 Bacteria 5685
1801 Ga0495612_0012284 3300053078 Bacteria 3452
1802 Ga0495612_0149889 3300053078 Bacteria 1014
1803 Ga0500610_0035592 3300053079 Bacteria 2555
1804 Ga0500635_0004759 3300053080 Bacteria 3512
1805 Ga0495655_0003619 3300053083 Bacteria 2566
1806 Ga0495595_0000635 3300053084 Bacteria 13367
1807 Ga0495595_0001020 3300053084 Bacteria 10783
1808 Ga0495595_0004731 3300053084 Bacteria 5474
1809 Ga0495595_0015661 3300053084 Bacteria 3235
1810 Ga0495595_0022205 3300053084 Bacteria 2783
1811 Ga0495595_0034075 3300053084 Bacteria 2301
1812 Ga0495595_0041025 3300053084 Bacteria 2116
1813 Ga0495595_0253401 3300053084 Bacteria 881
1814 Ga0495619_0000016 3300053085 Bacteria 231442
1815 Ga0495619_0002154 3300053085 Bacteria 13053
1816 Ga0495619_0003042 3300053085 Bacteria 10894
1817 Ga0495619_0004154 3300053085 Bacteria 9254
1818 Ga0495619_0012362 3300053085 Bacteria 5374
1819 Ga0495619_0016222 3300053085 Bacteria 4714
1820 Ga0495619_0045937 3300053085 Plasmid 2871
1821 Ga0495619_0093467 3300053085 Bacteria 2039
1822 Ga0495619_0140872 3300053085 Bacteria 1660
1823 Ga0495619_0321836 3300053085 Bacteria 1070
1824 Ga0495619_0347848 3300053085 Bacteria 1025
1825 Ga0500578_0051516 3300053086 Bacteria 2637
1826 Ga0500578_0377718 3300053086 Bacteria 822
1827 Ga0500644_0064861 3300053088 Bacteria 1299
1828 Ga0500646_0106468 3300053090 Bacteria 887
1829 Ga0500651_0191576 3300053093 Bacteria 1210
1830 Ga0500566_0004766 3300053094 Bacteria 8084
1831 Ga0500566_0022772 3300053094 Bacteria 3679
1832 Ga0500566_0296634 3300053094 Bacteria 763
1833 Ga0500641_0008154 3300053096 Bacteria 3733
1834 Ga0500641_0021665 3300053096 Bacteria 2453
1835 Ga0500641_0023473 3300053096 Bacteria 2372
1836 Ga0500650_0096145 3300053098 Bacteria 1386
1837 Ga0500650_0240431 3300053098 Bacteria 814
1838 Ga0500555_041263 3300053103 Bacteria 1284
1839 Ga0500558_055504 3300053106 Bacteria 1664
1840 Ga0500572_000093 3300053111 Bacteria 29132
1841 Ga0500582_173345 3300053114 Bacteria 737
1842 Ga0500592_020606 3300053116 Bacteria 1061
1843 Ga0500594_0045023 3300053118 Bacteria 1222
1844 Ga0500595_001406 3300053119 Bacteria 12911
1845 Ga0500595_001750 3300053119 Bacteria 11313
1846 Ga0500595_009426 3300053119 Bacteria 3940
1847 Ga0500595_016335 3300053119 Bacteria 2767
1848 Ga0500595_073355 3300053119 Bacteria 1012
1849 Ga0500608_060376 3300053122 Bacteria 1813
1850 Ga0500618_035027 3300053125 Bacteria 1166
1851 Ga0500626_073006 3300053128 Bacteria 1525
1852 Ga0500642_0022506 3300053130 Bacteria 2517
1853 Ga0500652_146848 3300053131 Bacteria 980
1854 Ga0500655_003381 3300053133 Bacteria 2885
1855 Ga0500658_0025355 3300053134 Bacteria 2278
1856 Ga0500559_0000242 3300053136 Bacteria 43285
1857 Ga0500559_0026137 3300053136 Bacteria 2485
1858 Ga0500559_0090946 3300053136 Bacteria 1397
1859 Ga0500568_0006307 3300053139 Bacteria 5972
1860 Ga0500568_0078438 3300053139 Bacteria 1256
1861 Ga0500568_0118598 3300053139 Bacteria 986
1862 Ga0500573_0136887 3300053140 Bacteria 1351
1863 Ga0500577_0035215 3300053142 Bacteria 1784
1864 Ga0500588_0207952 3300053146 Bacteria 726
1865 Ga0500589_022266 3300053147 Bacteria 2913
1866 Ga0500604_0017013 3300053151 Bacteria 2007
1867 Ga0500604_0073716 3300053151 Bacteria 1093
1868 Ga0500604_0092872 3300053151 Bacteria 987
1869 Ga0500616_0025644 3300053153 Bacteria 3268
1870 Ga0500616_0148295 3300053153 Bacteria 1089
1871 Ga0500619_132158 3300053154 Bacteria 851
1872 Ga0500622_0020471 3300053156 Bacteria 3512
1873 Ga0500622_0111697 3300053156 Bacteria 1335
1874 Ga0500627_0190400 3300053158 Bacteria 921
1875 Ga0500633_0219929 3300053160 Bacteria 709
1876 Ga0500634_0082277 3300053161 Bacteria 1655
1877 Ga0500638_000402 3300053162 Bacteria 10262
1878 Ga0500639_001904 3300053163 Bacteria 10448
1879 Ga0500637_0002381 3300053178 Bacteria 8348
1880 Ga0500611_052981 3300053727 Bacteria 936
1881 Ga0500611_143867 3300053727 Bacteria 651
1882 Ga0500657_094878 3300053728 Bacteria 1246
1883 Ga0500645_029155 3300053730 Bacteria 1667
1884 Ga0500645_040182 3300053730 Bacteria 1384
1885 Ga0500645_129448 3300053730 Bacteria 701
1886 Ga0500609_007246 3300053731 Bacteria 1498
1887 Ga0500656_015415 3300053732 Bacteria 895
1888 Ga0500552_001834 3300053733 Bacteria 2037
1889 Ga0500596_000350 3300053735 Bacteria 8310
1890 Ga0500596_001100 3300053735 Bacteria 5443
1891 Ga0501084_0061368 3300054114 Bacteria 3147
1892 Ga0501084_0100910 3300054114 Bacteria 2423
1893 Ga0501084_0156432 3300054114 Bacteria 1922
1894 Ga0501084_0206589 3300054114 Bacteria 1657
1895 Ga0501084_0447580 3300054114 Bacteria 1092
1896 Ga0501084_0842730 3300054114 Bacteria 772
1897 Ga0501084_1015190 3300054114 Bacteria 697
1898 Ga0500661_000108 3300055283 Bacteria 13387
1899 Ga0590071_003417 3300059421 Bacteria 3902
1900 Ga0587093_032290 3300059478 Bacteria 759
1901 Ga0587083_0075839 3300059505 Bacteria 791
1902 Ga0587085_032574 3300059506 Bacteria 866
1903 Ga0587086_023435 3300059507 Bacteria 861
1904 Ga0587068_052867 3300059641 Bacteria 764
1905 Ga0501082_0000106 3300060353 Bacteria 65983
1906 Ga0501082_0043636 3300060353 Bacteria 3867
1907 Ga0501082_0049770 3300060353 Bacteria 3614
1908 Ga0501082_0081512 3300060353 Bacteria 2792
1909 Ga0501082_0292811 3300060353 Bacteria 1417
1910 Ga0501082_0758478 3300060353 Unclassified 849
1911 Ga0501082_0790114 3300060353 Bacteria 830
1912 Ga0501082_1155901 3300060353 Bacteria 677
1913 Ga0530510_0017881 3300061734 Bacteria 5027
1914 Ga0530510_0020095 3300061734 Bacteria 4748
1915 Ga0530510_0213744 3300061734 Bacteria 1433
1916 Ga0530510_0266002 3300061734 Unclassified 1279
1917 Ga0530510_0545461 3300061734 Unclassified 880
1918 2509149394 2508501128 Bacteria 8613869
1919 2513622966 2513237092 Bacteria 8341956
1920 2513699544 2513237102 Bacteria 7703324
1921 2517104065 2517093001 Bacteria 9002274
1922 2517891444 2517572143 Bacteria 9484767
1923 2524436375 2524023205 Bacteria 8918781
1924 2524538381 2524023228 Bacteria 10118060
1925 2603861422 2602042107 Bacteria 6226103
1926 2643758643 2643221547 Bacteria 4740017
1927 2728750139 2728368998 Bacteria 8720350
1928 2745080671 2744054633 Bacteria 8678936
1929 2818236462 2816332527 Bacteria 8933356
1930 2824621920 2824617872 Bacteria 8814715
1931 2824631612 2824626560 Bacteria 8813858
1932 2824641698 2824635225 Bacteria 8785348
1933 2824649360 2824644064 Bacteria 8743947
1934 2824713657 2824704595 Bacteria 9667483
1935 2824719187 2824714736 Bacteria 8717648
1936 2824729604 2824723954 Bacteria 8758240
1937 2824758461 2824753945 Bacteria 9787441
1938 2824770045 2824763712 Bacteria 9792355
1939 2836164696 2836160341 Unclassified 5867367
1940 2841959784 2841957949 Bacteria 8652217
1941 2842040562 2842038055 Bacteria 8002051
1942 2842046492 2842045827 Bacteria 8006841
1943 2847937237 2847930680 Bacteria 9342022
1944 2874607295 2874604998 Bacteria 7834745
1945 2874614665 2874612657 Bacteria 8252029
1946 2874627989 2874620515 Bacteria 8290088
1947 2876766184 2876761206 Bacteria 10111113
1948 2876814532 2876808645 Bacteria 8824342
1949 2879088465 2879083081 Bacteria 8587928
1950 2879114627 2879110137 Bacteria 8907982
1951 2881371546 2881364244 Bacteria 7710352
1952 2881671842 2881665667 Bacteria 8175609
1953 2885369883 2885366525 Bacteria 8326213
1954 2885379649 2885374607 Bacteria 8927485
1955 2885412280 2885409591 Bacteria 9235467
1956 2888385362 2888378607 Bacteria 9652610
1957 2889038110 2889033259 Bacteria 9099371
1958 2903752507 2903748898 Bacteria 9972761
1959 2904674393 2904666416 Bacteria 8226587
1960 2904691286 2904690495 Bacteria 9412302
1961 2904704891
1962 2904712072 2904711408 Bacteria 9771557
1963 2906616616
1964 2906635400 2906635258 Bacteria 8601019
1965 2906649362 2906643746 Bacteria 8722424
1966 2906666945 2906660503 Bacteria 8595048
1967 2908741782 2908739725 Bacteria 8628932
1968 2908759072 2908756301 Bacteria 8864324
1969 2922368588 2922361189 Bacteria 7436256
1970 2922431363
1971 2935633959 2935630451 Bacteria 8169952
1972 2941510738 2941507105 Bacteria 8166816
1973 2941518122 2941515067 Bacteria 8166720
1974 2941527007 2941523033 Bacteria 8169134
1975 8006930880 8006926726 Bacteria 6749210
1976 8006939554 8006933436 Bacteria 10410654
1977 8006968361 8006964411 Bacteria 8966052
1978 8006979305 8006973647 Bacteria 10679141
1979 8006989197 8006984368 Bacteria 9651211
1980 8006994809 8006994254 Bacteria 8309700
1981 8019575534 8019565922 Bacteria 9639779
1982 8056681019 8056673599 Bacteria 7871253
1983 8056693407 8056689827 Bacteria 6712655
1984 JGI25404J52841_10006413
1985 RicEn_C2512
1986 2214745216
1987 ARSoilYngRDRAFT_c00191
1988 ARcpr5yngRDRAFT_c000145
1989 ARSoilOldRDRAFT_c000016
1990 ARCol0oldRDRAFT_c00161
1991 ARCol0yngRDRAFT_1000187
1992 JGI24032J14994_102107
1993 JGI24746J21847_1001112
1994 JGI24746J21847_1006035
1995 JGI24740J21852_10025456
1996 JGI24739J22299_10001106
1997 JGI24737J22298_10010720
1998 JGI24737J22298_10027266
1999 JGI24743J22301_10026795
2000 JGI24735J21928_10028666
2001 JGI24745J21846_1000214
2002 JGI24748J21848_1010542
2003 JGI24738J21930_10004532
2004 JGI24749J21850_1006566
2005 JGI24035J26624_1002401
2006 JGI24033J26618_1017191
2007 JGI24034J26672_10007006
2008 JGI24742J22300_10002116
2009 JGI24742J22300_10002245
2010 JGI24742J22300_10006662
2011 JGI24742J22300_10007686
2012 JGI24742J22300_10039293
2013 JGI24751J29686_10003559
2014 JGI24751J29686_10016566
2015 JGI24751J29686_10048232
2016 Ga0006759J45824_1016848
2017 JGI25406J46586_10002634
2018 JGI25153J46596_10000632
2019 JGI25153J46596_10003303
2020 JGI25160J50197_1007144
2021 JGI25160J50197_1016309
2022 Ga0058859_10005899
2023 Ga0058860_10029185
2024 Ga0065165_1001679
2025 Ga0065714_10032781
2026 Ga0065704_10096121
2027 Ga0065712_10039456
2028 Ga0065712_10072238
2029 Ga0065712_10121301
2030 Ga0065712_10147584
2031 Ga0065715_10056642
2032 Ga0065715_10201834
2033 Ga0065715_10224079
2034 Ga0065707_10147313
2035 Ga0065707_10200827
2036 Ga0065707_10242627
2037 Ga0070658_10482792
2038 Ga0070676_10003681
2039 Ga0070676_10024186
2040 Ga0070676_10074811
2041 Ga0070676_10347673
2042 Ga0070676_10425296
2043 Ga0070683_100010409
2044 Ga0070683_100019681
2045 Ga0070683_100307391
2046 Ga0070690_100005755
2047 Ga0070690_100104361
2048 Ga0070690_100303423
2049 Ga0070670_100014637
2050 Ga0070670_100035140
2051 Ga0070670_100035513
2052 Ga0070670_100036571
2053 Ga0070670_100857778
2054 Ga0070670_101241656
2055 Ga0070677_10000046
2056 Ga0070677_10004236
2057 Ga0070677_10010099
2058 Ga0068869_100000900
2059 Ga0068869_100319141
2060 Ga0068869_100438424
2061 Ga0068869_100861791
2062 Ga0070666_10008419
2063 Ga0070666_10029279
2064 Ga0070666_10185925
2065 Ga0070666_10541099
2066 Ga0070680_100013751
2067 Ga0070680_100314262
2068 Ga0070682_100000920
2069 Ga0070682_100065469
2070 Ga0070682_100112701
2071 Ga0068868_100074087
2072 Ga0068868_100163283
2073 Ga0068868_100199663
2074 Ga0068868_100326725
2075 Ga0070660_100002099
2076 Ga0070660_100021171
2077 Ga0070660_100060234
2078 Ga0070660_100255481
2079 Ga0070689_100031944
2080 Ga0070689_100036745
2081 Ga0070689_100061023
2082 Ga0070689_100162213
2083 Ga0070689_100806770
2084 Ga0070687_100000217
2085 Ga0070687_100240828
2086 Ga0070687_100270606
2087 Ga0070661_100193041
2088 Ga0070661_100892389
2089 Ga0070668_100126408
2090 Ga0070668_100327847
2091 Ga0070669_100040867
2092 Ga0070669_100043787
2093 Ga0070669_100199255
2094 Ga0070669_100956167
2095 Ga0070675_100004785
2096 Ga0070675_100324326
2097 Ga0070675_100502510
2098 Ga0070675_100622786
2099 Ga0070675_101276596
2100 Ga0070671_100005407
2101 Ga0070671_100011957
2102 Ga0070671_100016718
2103 Ga0070671_100033894
2104 Ga0070671_100049957
2105 Ga0070671_100055944
2106 Ga0070671_100316123
2107 Ga0070674_100000375
2108 Ga0070674_100000893
2109 Ga0070674_100001474
2110 Ga0070674_100161671
2111 Ga0070674_100194081
2112 Ga0070674_100288239
2113 Ga0070674_100365945
2114 Ga0070674_100404699
2115 Ga0070673_100000470
2116 Ga0070673_100018635
2117 Ga0070688_100016929
2118 Ga0070688_100080542
2119 Ga0070688_100124721
2120 Ga0070688_100239881
2121 Ga0070688_100368375
2122 Ga0070659_100006204
2123 Ga0070667_100012633
2124 Ga0070667_100041130
2125 Ga0070667_100233536
2126 Ga0070667_100467640
2127 Ga0070667_100736038
2128 Ga0070709_10005104
2129 Ga0070709_10006845
2130 Ga0070709_10080910
2131 Ga0070709_10141911
2132 Ga0070709_10392129
2133 Ga0070714_100002780
2134 Ga0070714_100018995
2135 Ga0070714_100111744
2136 Ga0070713_100017941
2137 Ga0070713_100181064
2138 Ga0070713_100469847
2139 Ga0070710_10016995
2140 Ga0070710_10023746
2141 Ga0070710_10088442
2142 Ga0070710_10124786
2143 Ga0070701_10186895
2144 Ga0070701_10231618
2145 Ga0070711_100244836
2146 Ga0070711_100486816
2147 Ga0070711_100548466
2148 Ga0070705_100000204
2149 Ga0070705_100306506
2150 Ga0070705_100362657
2151 Ga0070705_100417666
2152 Ga0070705_100751926
2153 Ga0070700_100319833
2154 Ga0070700_100417222
2155 Ga0070700_100533032
2156 Ga0070694_100450974
2157 Ga0070663_100026729
2158 Ga0070663_100328207
2159 Ga0070663_100726371
2160 Ga0070678_100002319
2161 Ga0070678_100014852
2162 Ga0070678_100047057
2163 Ga0070662_100013235
2164 Ga0070662_100512516
2165 Ga0070681_10061201
2166 Ga0070681_10360321
2167 Ga0070681_10621943
2168 Ga0068867_100004027
2169 Ga0068867_100006503
2170 Ga0068867_101246686
2171 Ga0070685_10001617
2172 Ga0070685_10008570
2173 Ga0070685_10041027
2174 Ga0070685_10206947
2175 Ga0074259_10896662
2176 Ga0070699_100462520
2177 Ga0070699_100536465
2178 Ga0070699_100786324
2179 Ga0070679_100025312
2180 Ga0070679_100159196
2181 Ga0070684_100008508
2182 Ga0070684_100029649
2183 Ga0070684_100112955
2184 Ga0070697_100132093
2185 Ga0068853_100033577
2186 Ga0068853_100067830
2187 Ga0068853_100092887
2188 Ga0068853_100234876
2189 Ga0068853_100351911
2190 Ga0068853_100356024
2191 Ga0068853_100484304
2192 Ga0068853_100630652
2193 Ga0070672_100015602
2194 Ga0070672_100046664
2195 Ga0070672_100216997
2196 Ga0070686_100018072
2197 Ga0070686_100048208
2198 Ga0070686_100119889
2199 Ga0070686_100231573
2200 Ga0070686_100305331
2201 Ga0070695_100114448
2202 Ga0070695_100561926
2203 Ga0070696_100073889
2204 Ga0070696_100511780
2205 Ga0070693_100025149
2206 Ga0070693_100238020
2207 Ga0070665_100136427
2208 Ga0070665_100159772
2209 Ga0070665_100168616
2210 Ga0070665_100172989
2211 Ga0070665_100213906
2212 Ga0070665_100551647
2213 Ga0070704_100158213
2214 Ga0068855_100007909
2215 Ga0068855_100087873
2216 Ga0068855_100232331
2217 Ga0070664_100003650
2218 Ga0070664_100160089
2219 Ga0070664_100218015
2220 Ga0068857_100002698
2221 Ga0068857_100051580
2222 Ga0068857_100097530
2223 Ga0068857_100165918
2224 Ga0068857_100670601
2225 Ga0068854_100046914
2226 Ga0068854_100120058
2227 Ga0068854_100129469
2228 Ga0068854_100453231
2229 Ga0068856_100005538
2230 Ga0068856_100045821
2231 Ga0068856_100226569
2232 Ga0068856_100282875
2233 Ga0068856_100632430
2234 Ga0070702_100000758
2235 Ga0070702_100002474
2236 Ga0070702_100005458
2237 Ga0070702_100061626
2238 Ga0070702_100093906
2239 Ga0070702_100214701
2240 Ga0070702_100423573
2241 Ga0068852_100025773
2242 Ga0068859_100020242
2243 Ga0068859_100023296
2244 Ga0068859_100078546
2245 Ga0068859_100752895
2246 Ga0068864_100000443
2247 Ga0068864_100004887
2248 Ga0068864_100020334
2249 Ga0068864_100033589
2250 Ga0068864_100048665
2251 Ga0068864_100644235
2252 Ga0068866_10000908
2253 Ga0068866_10164879
2254 Ga0068861_100007339
2255 Ga0068861_100033080
2256 Ga0068861_100679237
2257 Ga0068870_10000734
2258 Ga0068870_10060901
2259 Ga0068870_10083312
2260 Ga0068863_100007663
2261 Ga0068863_100054632
2262 Ga0068863_100298475
2263 Ga0068863_100360320
2264 Ga0068863_100523151
2265 Ga0068863_100856859
2266 Ga0068858_100003447
2267 Ga0068858_100060090
2268 Ga0068858_100085044
2269 Ga0068858_100095118
2270 Ga0068858_100533274
2271 Ga0068860_100354400
2272 Ga0068860_100417277
2273 Ga0068862_100008086
2274 Ga0068862_100352462
2275 Ga0081455_10019100
2276 Ga0081455_10024219
2277 Ga0081455_10221049
2278 Ga0081455_10247539
2279 Ga0081538_10002974
2280 Ga0081538_10125128
2281 Ga0081540_1000140
2282 Ga0081540_1008037
2283 Ga0081540_1041211
2284 Ga0081540_1134370
2285 Ga0081540_1182014
2286 Ga0081539_10004161
2287 Ga0070717_10004047
2288 Ga0070717_10013853
2289 Ga0070717_10410194
2290 Ga0070717_10906302
2291 Ga0075365_10048713
2292 Ga0075365_10062317
2293 Ga0075365_10063600
2294 Ga0075365_10151459
2295 Ga0075365_10175006
2296 Ga0075365_10250989
2297 Ga0075365_10343220
2298 Ga0075365_10522901
2299 Ga0075368_10045053
2300 Ga0075368_10058301
2301 Ga0075368_10061023
2302 Ga0075363_100012895
2303 Ga0075363_100179641
2304 Ga0075363_100190585
2305 Ga0075363_100418033
2306 Ga0075363_100498411
2307 Ga0075364_10008807
2308 Ga0075364_10050422
2309 Ga0075364_10324493
2310 Ga0075364_10351445
2311 Ga0075364_10561853
2312 Ga0075432_10046599
2313 Ga0075432_10053596
2314 Ga0070715_10000352
2315 Ga0070715_10003497
2316 Ga0070715_10177149
2317 Ga0070716_100000521
2318 Ga0070716_100007900
2319 Ga0070716_100244255
2320 Ga0070716_100319368
2321 Ga0070712_100053418
2322 Ga0070712_100112599
2323 Ga0070712_100225902
2324 Ga0070712_100356239
2325 Ga0070712_100598293
2326 Ga0075362_10073571
2327 Ga0075367_10019468
2328 Ga0075367_10024342
2329 Ga0075367_10057607
2330 Ga0075367_10132826
2331 Ga0075367_10211134
2332 Ga0075367_10306161
2333 Ga0075369_10085867
2334 Ga0075366_10025202
2335 Ga0075366_10101432
2336 Ga0075366_10250736
2337 Ga0097621_100000435
2338 Ga0097621_100072099
2339 Ga0097621_100263162
2340 Ga0097621_100383900
2341 Ga0075370_10033603
2342 Ga0075370_10045809
2343 Ga0075370_10140482
2344 Ga0075370_10176599
2345 Ga0068871_100012417
2346 Ga0068871_100081619
2347 Ga0068871_100205915
2348 Ga0068871_100312046
2349 Ga0068871_100694977
2350 Ga0075428_100191902
2351 Ga0075428_100332413
2352 Ga0075428_100342286
2353 Ga0075428_101026227
2354 Ga0075428_101055374
2355 Ga0075430_100010823
2356 Ga0075430_100231826
2357 Ga0075431_100000020
2358 Ga0075431_100008458
2359 Ga0075431_100208400
2360 Ga0075431_100277984
2361 Ga0075431_100366055
2362 Ga0075431_100468385
2363 Ga0075431_100982760
2364 Ga0075431_101477921
2365 Ga0075433_10018880
2366 Ga0075433_10062667
2367 Ga0075433_10289422
2368 Ga0075433_10805682
2369 Ga0075434_100003352
2370 Ga0075434_100011154
2371 Ga0075434_100185713
2372 Ga0075429_100015669
2373 Ga0075429_100323427
2374 Ga0075429_100332978
2375 Ga0075429_100451746
2376 Ga0075429_100638716
2377 Ga0068865_100000485
2378 Ga0068865_100012411
2379 Ga0068865_100053945
2380 Ga0068865_100059221
2381 Ga0068865_100157100
2382 Ga0068865_101250436
2383 Ga0075436_100208924
2384 Ga0075436_100441214
2385 Ga0097620_100020243
2386 Ga0097620_100023296
2387 Ga0097620_100078551
2388 Ga0097620_100752838
2389 Ga0075435_100089882
2390 Ga0075435_100494239
2391 Ga0099794_10015955
2392 Ga0099795_10000648
2393 Ga0099795_10024650
2394 Ga0099795_10034727
2395 Ga0099795_10063687
2396 Ga0099795_10108818
2397 Ga0099795_10148233
2398 Ga0099795_10201972
2399 Ga0105251_10030260
2400 Ga0105251_10050543
2401 Ga0105244_10108496
2402 Ga0105250_10033276
2403 Ga0105240_10130732
2404 Ga0105240_10352859
2405 Ga0111539_10000167
2406 Ga0111539_10027723
2407 Ga0111539_10038414
2408 Ga0111539_10050859
2409 Ga0111539_10334252
2410 Ga0111539_10497695
2411 Ga0111539_10522767
2412 Ga0111539_11254150
2413 Ga0111539_11745084
2414 Ga0105245_10004286
2415 Ga0105245_10008339
2416 Ga0105245_10065446
2417 Ga0105245_10079827
2418 Ga0105245_10115240
2419 Ga0105245_11718779
2420 Ga0105245_11842643
2421 Ga0105247_10009390
2422 Ga0105247_10028516
2423 Ga0105247_10046178
2424 Ga0105247_10233872
2425 Ga0105247_10498355
2426 Ga0105247_10825026
2427 Ga0114129_10003047
2428 Ga0114129_10015940
2429 Ga0114129_10056117
2430 Ga0114129_10192494
2431 Ga0114129_10244766
2432 Ga0114129_10508315
2433 Ga0114129_10794122
2434 Ga0114129_10846802
2435 Ga0114129_11145646
2436 Ga0114129_11538054
2437 Ga0105243_10033625
2438 Ga0105243_10121717
2439 Ga0105243_10148011
2440 Ga0105243_10151959
2441 Ga0105243_10169286
2442 Ga0105243_11462591
2443 Ga0105241_10032007
2444 Ga0105241_10041491
2445 Ga0105241_10046934
2446 Ga0105241_10122616
2447 Ga0105241_10126944
2448 Ga0105241_10314966
2449 Ga0105241_10553089
2450 Ga0105242_10074853
2451 Ga0105242_10144189
2452 Ga0105242_10152776
2453 Ga0105242_10238535
2454 Ga0105242_10337825
2455 Ga0105242_10681706
2456 Ga0105242_11269755
2457 Ga0105248_10096003
2458 Ga0105248_10125981
2459 Ga0105248_10232856
2460 Ga0105248_10599454
2461 Ga0105237_10032875
2462 Ga0105237_10044558
2463 Ga0105237_10058881
2464 Ga0105237_10087376
2465 Ga0105237_10101576
2466 Ga0105237_10107873
2467 Ga0105237_10132663
2468 Ga0105237_10164128
2469 Ga0105238_10011666
2470 Ga0105238_10014012
2471 Ga0105238_10030098
2472 Ga0105238_10064680
2473 Ga0105238_10200783
2474 Ga0105238_10248589
2475 Ga0105238_10296057
2476 Ga0105238_10303495
2477 Ga0105249_10057994
2478 Ga0105249_10122241
2479 Ga0105249_10197068
2480 Ga0105249_10700638
2481 Ga0105249_11043569
2482 Ga0099796_10000265
2483 Ga0099796_10007182
2484 Ga0099796_10024637
2485 Ga0099796_10034554
2486 Ga0099796_10137756
2487 Ga0105239_10004659
2488 Ga0105239_10013269
2489 Ga0105239_10093866
2490 Ga0105239_10102663
2491 Ga0105239_10133836
2492 Ga0105239_10143653
2493 Ga0105239_10176938
2494 Ga0105239_10440731
2495 Ga0105239_10688221
2496 Ga0105246_10025897
2497 Ga0105246_10084828
2498 Ga0105246_10659942
2499 Ga0105246_10893052
2500 Ga0157346_1003509
2501 Ga0157341_1002432
2502 Ga0157323_1002561
2503 Ga0157313_1009676
2504 Ga0157342_1000683
2505 Ga0157316_1023090
2506 Ga0157371_10133354
2507 Ga0157371_10209600
2508 Ga0157371_10271568
2509 Ga0157370_10127401
2510 Ga0157370_10132132
2511 Ga0157370_10199482
2512 Ga0157369_10016835
2513 Ga0157369_10269640
2514 Ga0157369_10577588
2515 Ga0157374_10004303
2516 Ga0157374_10039082
2517 Ga0157374_10067422
2518 Ga0157374_10187920
2519 Ga0157374_10953995
2520 Ga0157378_10003893
2521 Ga0157378_10009387
2522 Ga0157378_10030439
2523 Ga0157378_10030828
2524 Ga0157378_10032444
2525 Ga0157378_10109632
2526 Ga0157378_10120946
2527 Ga0157378_10271919
2528 Ga0157378_10353221
2529 Ga0157378_10653726
2530 Ga0163162_10183755
2531 Ga0163162_10205336
2532 Ga0163162_10801032
2533 Ga0163162_11429929
2534 Ga0157372_10302570
2535 Ga0157372_11454882
2536 Ga0157375_10050882
2537 Ga0157375_10313984
2538 Ga0157375_10682618
2539 Ga0157375_10750634
2540 Ga0157375_11847156
2541 Ga0163163_10007071
2542 Ga0163163_10020427
2543 Ga0163163_10030125
2544 Ga0163163_10034989
2545 Ga0163163_10035700
2546 Ga0163163_10140778
2547 Ga0163163_10614641
2548 Ga0157380_10003632
2549 Ga0157380_10133478
2550 Ga0157380_10185561
2551 Ga0157380_10236115
2552 Ga0157377_10000432
2553 Ga0157377_10081564
2554 Ga0157377_10220246
2555 Ga0157377_10399894
2556 Ga0157379_10148279
2557 Ga0157379_10333519
2558 Ga0157379_10480655
2559 Ga0157379_10896128
2560 Ga0157376_10032211
2561 Ga0157376_10048633
2562 Ga0157376_10254265
2563 Ga0182007_10064525
2564 Ga0163161_10002081
2565 Ga0163161_10022770
2566 Ga0163161_10686903
2567 Ga0206356_10720898
2568 Ga0213873_10016781
2569 Ga0213875_10072544
2570 Ga0207666_1000028
2571 Ga0209130_1031527
2572 Ga0207673_1003204
2573 Ga0209758_1000365
2574 Ga0209256_1027726
2575 Ga0207426_1000620
2576 Ga0207426_1091643
2577 Ga0209257_1024757
2578 Ga0209257_1038323
2579 Ga0207697_10043143
2580 Ga0207697_10117666
2581 Ga0207656_10095591
2582 Ga0207656_10138308
2583 Ga0207696_1029645
2584 Ga0207655_1116701
2585 Ga0207653_10006097
2586 Ga0207682_10000640
2587 Ga0207682_10002485
2588 Ga0207682_10009098
2589 Ga0207692_10003023
2590 Ga0207692_10037773
2591 Ga0207642_10022716
2592 Ga0207642_10119391
2593 Ga0207642_10417167
2594 Ga0207710_10004196
2595 Ga0207710_10008402
2596 Ga0207710_10046025
2597 Ga0207710_10106992
2598 Ga0207710_10225945
2599 Ga0207688_10000088
2600 Ga0207688_10007354
2601 Ga0207688_10026961
2602 Ga0207688_10066454
2603 Ga0207688_10096042
2604 Ga0207688_10480997
2605 Ga0207680_10060673
2606 Ga0207680_10128477
2607 Ga0207680_10311273
2608 Ga0207680_10418409
2609 Ga0207647_10030620
2610 Ga0207647_10227752
2611 Ga0207699_10025289
2612 Ga0207699_10120198
2613 Ga0207645_10002863
2614 Ga0207645_10115125
2615 Ga0207645_10146462
2616 Ga0207645_10373518
2617 Ga0207643_10000085
2618 Ga0207643_10024148
2619 Ga0207643_10037649
2620 Ga0207684_10046815
2621 Ga0207654_10000373
2622 Ga0207654_10245862
2623 Ga0207654_10553910
2624 Ga0207695_10106623
2625 Ga0207671_10160163
2626 Ga0207671_10391560
2627 Ga0207671_10484080
2628 Ga0207693_10003902
2629 Ga0207693_10019378
2630 Ga0207693_10161394
2631 Ga0207660_10220496
2632 Ga0207662_10000339
2633 Ga0207662_10020438
2634 Ga0207662_10052177
2635 Ga0207662_10067003
2636 Ga0207657_10040320
2637 Ga0207657_10066425
2638 Ga0207657_10155102
2639 Ga0207657_10439651
2640 Ga0207657_10617051
2641 Ga0207649_10151151
2642 Ga0207649_10263137
2643 Ga0207649_10315794
2644 Ga0207649_10483364
2645 Ga0207652_10328765
2646 Ga0207652_10382514
2647 Ga0207681_10002232
2648 Ga0207681_10055014
2649 Ga0207681_10151240
2650 Ga0207681_10217859
2651 Ga0207681_10357048
2652 Ga0207681_10387612
2653 Ga0207681_10773471
2654 Ga0207694_10065814
2655 Ga0207694_10307947
2656 Ga0207650_10004558
2657 Ga0207650_10019027
2658 Ga0207650_10073393
2659 Ga0207650_10542726
2660 Ga0207659_10000200
2661 Ga0207659_10057893
2662 Ga0207659_10094040
2663 Ga0207659_10153311
2664 Ga0207659_10776934
2665 Ga0207687_10015071
2666 Ga0207687_10039006
2667 Ga0207687_10127218
2668 Ga0207687_10602183
2669 Ga0207700_10051991
2670 Ga0207700_10121169
2671 Ga0207700_10584548
2672 Ga0207664_10012242
2673 Ga0207664_10042377
2674 Ga0207664_10181896
2675 Ga0207644_10000867
2676 Ga0207644_10223595
2677 Ga0207644_10431864
2678 Ga0207644_10614865
2679 Ga0207644_11029016
2680 Ga0207690_10003950
2681 Ga0207690_10011516
2682 Ga0207690_10409120
2683 Ga0207706_10017547
2684 Ga0207706_10132071
2685 Ga0207686_10001404
2686 Ga0207686_10109020
2687 Ga0207686_10220609
2688 Ga0207686_10391527
2689 Ga0207709_10001343
2690 Ga0207709_10010649
2691 Ga0207709_10081472
2692 Ga0207709_10170268
2693 Ga0207709_10214736
2694 Ga0207709_10250423
2695 Ga0207709_10780686
2696 Ga0207670_10000398
2697 Ga0207670_10049599
2698 Ga0207670_10137623
2699 Ga0207669_10000129
2700 Ga0207669_10003951
2701 Ga0207669_10004285
2702 Ga0207669_10022028
2703 Ga0207669_10101901
2704 Ga0207669_10141449
2705 Ga0207669_10571335
2706 Ga0207704_10001904
2707 Ga0207704_10012182
2708 Ga0207704_10048853
2709 Ga0207704_10356655
2710 Ga0207704_10848757
2711 Ga0207665_10001387
2712 Ga0207665_10049257
2713 Ga0207665_10078193
2714 Ga0207665_10391624
2715 Ga0207691_10069299
2716 Ga0207691_10916550
2717 Ga0207711_10017080
2718 Ga0207711_10199467
2719 Ga0207711_10763488
2720 Ga0207689_10000547
2721 Ga0207689_10339556
2722 Ga0207661_10004288
2723 Ga0207661_10050124
2724 Ga0207661_10079137
2725 Ga0207679_10000558
2726 Ga0207679_10030376
2727 Ga0207679_10206653
2728 Ga0207667_10007300
2729 Ga0207667_10119406
2730 Ga0207667_10120691
2731 Ga0207651_10000790
2732 Ga0207651_10009960
2733 Ga0207651_10055107
2734 Ga0207651_10210802
2735 Ga0207651_10331489
2736 Ga0207651_10610433
2737 Ga0207712_10007058
2738 Ga0207712_10071902
2739 Ga0207712_10399669
2740 Ga0207668_10002729
2741 Ga0207640_10058086
2742 Ga0207640_10296952
2743 Ga0207640_10455943
2744 Ga0207658_10003874
2745 Ga0207658_10016875
2746 Ga0207658_10152763
2747 Ga0207658_10549181
2748 Ga0207658_11141663
2749 Ga0207677_10005171
2750 Ga0207677_10045803
2751 Ga0207677_10313952
2752 Ga0207677_10406995
2753 Ga0207703_10000644
2754 Ga0207703_10320184
2755 Ga0207703_10567591
2756 Ga0207703_10629172
2757 Ga0207639_10034810
2758 Ga0207678_10016400
2759 Ga0207678_10020707
2760 Ga0207678_10260816
2761 Ga0207678_11113786
2762 Ga0207708_10068669
2763 Ga0207708_10185080
2764 Ga0207708_10197695
2765 Ga0207708_10220307
2766 Ga0207702_10000243
2767 Ga0207702_10012908
2768 Ga0207702_10466793
2769 Ga0207702_10776128
2770 Ga0207702_11295314
2771 Ga0207641_10001185
2772 Ga0207641_10003587
2773 Ga0207641_10072216
2774 Ga0207641_10157664
2775 Ga0207641_10248173
2776 Ga0207641_10313507
2777 Ga0207648_10002538
2778 Ga0207648_10017413
2779 Ga0207648_11143643
2780 Ga0207676_10003948
2781 Ga0207676_10007042
2782 Ga0207676_10057920
2783 Ga0207676_10064493
2784 Ga0207676_10112099
2785 Ga0207674_10018619
2786 Ga0207674_10124866
2787 Ga0207674_10606714
2788 Ga0207675_100008179
2789 Ga0207675_100061200
2790 Ga0207675_100070938
2791 Ga0207675_100077967
2792 Ga0207675_100396191
2793 Ga0207675_100699335
2794 Ga0207683_10003695
2795 Ga0207683_10005841
2796 Ga0207683_10012937
2797 Ga0207683_10022205
2798 Ga0207683_10056654
2799 Ga0207698_10065550
2800 Ga0207698_10852441
2801 Ga0209389_1000001
2802 Ga0209589_1000033
2803 Ga0209489_100040
2804 Ga0209489_111101
2805 Ga0209700_100007
2806 Ga0209981_1022404
2807 Ga0209996_1017111
2808 Ga0209984_1002986
2809 Ga0209995_1004548
2810 Ga0209179_1007538
2811 Ga0209999_1042680
2812 Ga0209982_1004605
2813 Ga0209970_1025045
2814 Ga0210002_1002707
2815 Ga0209983_1021928
2816 Ga0209588_1017279
2817 Ga0209971_1011063
2818 Ga0209966_1000401
2819 Ga0209813_10014033
2820 Ga0209813_10066481
2821 Ga0209813_10074315
2822 Ga0207428_10000055
2823 Ga0207428_10000664
2824 Ga0207428_10004496
2825 Ga0207428_10013539
2826 Ga0207428_10038968
2827 Ga0207428_10181740
2828 Ga0207428_10231565
2829 Ga0268266_10034374
2830 Ga0268266_10075860
2831 Ga0268266_10250329
2832 Ga0268266_10271509
2833 Ga0268266_10575926
2834 Ga0268266_10773313
2835 Ga0268266_10898176
2836 Ga0268265_10011790
2837 Ga0268265_10076192
2838 Ga0268265_10699873
2839 Ga0268265_10739965
2840 Ga0268264_10049815
2841 Ga0268264_10246818
2842 Ga0268264_10840666
2843 Ga0265318_10008361
2844 Ga0307515_10573132
2845 Ga0265338_10040637
2846 Ga0265338_10243378
2847 Ga0265338_10271405
2848 Ga0265771_1001725
2849 Ga0265330_10005858
2850 Ga0265332_10000641
2851 Ga0265332_10095195
2852 Ga0265332_10201261
2853 Ga0265320_10012872
2854 Ga0265325_10005224
2855 Ga0265325_10017063
2856 Ga0265325_10035241
2857 Ga0265329_10007481
2858 Ga0265340_10004511
2859 Ga0265340_10004663
2860 Ga0265340_10010325
2861 Ga0265340_10137825
2862 Ga0265339_10003204
2863 Ga0265339_10006269
2864 Ga0265339_10086100
2865 Ga0265331_10056584
2866 Ga0265331_10069200
2867 Ga0265316_10082491
2868 Ga0265316_10153653
2869 Ga0265316_10562091
2870 Ga0265316_10574905
2871 Ga0307513_10481132
2872 Ga0307408_100265679
2873 Ga0265313_10010495
2874 Ga0265313_10020356
2875 Ga0265313_10021730
2876 Ga0265313_10050212
2877 Ga0316575_10042005
2878 Ga0265314_10012502
2879 Ga0265342_10000282
2880 Ga0265342_10011053
2881 Ga0265342_10020118
2882 Ga0265342_10343505
2883 Ga0316576_10157407
2884 Ga0316578_10034384
2885 Ga0307516_10305913
2886 Ga0316577_10230631
2887 Ga0307413_10040352
2888 Ga0307410_10024175
2889 Ga0307410_10900364
2890 Ga0307406_10031987
2891 Ga0307406_11151487
2892 Ga0307407_10053100
2893 Ga0307412_10837602
2894 Ga0307412_10917064
2895 Ga0307409_100091683
2896 Ga0307409_100521271
2897 Ga0307409_100991263
2898 Ga0307416_100098002
2899 Ga0307411_10050524
2900 Ga0307411_10521142
2901 Ga0307411_10726885
2902 Ga0307415_100636557
2903 Ga0316583_10000114
2904 Ga0307507_10164021
2905 Ga0307510_10041923
2906 Ga0373930_0000142
2907 Ga0373948_0085747
2908 Ga0373950_0000162
2909 Ga0373958_0000310
2910 Ga0373959_0001515
2911 Ga0373959_0048333
2912 Ga0373938_0000124
2913 Ga0373938_0046958
2914 Ga0373928_0000366
2915 Ga0373928_0023056
2916 Ga0373929_0000321
2917 Ga0373934_0005198
2918 Ga0373934_0136381
2919 Ga0373940_0000053
2920 Ga0373944_0158725
2921 Ga0373949_0000761
2922 Ga0373949_0043436
2923 Ga0373951_0005041
2924 Ga0373951_0115354
2925 Ga0373952_0000668
2926 Ga0373952_0049121
2927 Ga0373923_0003286
2928 Ga0373923_0193464
2929 Ga0373932_0137000
2930 Ga0373932_0228937
2931 Ga0373936_0013171
2932 Ga0373936_0036262
2933 Ga0373936_0049667
2934 Ga0373936_0125661
2935 Ga0373936_0313487
2936 Ga0373939_0000855
2937 Ga0373939_0011251
2938 Ga0373939_0084704
2939 Ga0373939_0108185
2940 Ga0373945_0084067
2941 Ga0373953_0008645
2942 Ga0373953_0012266
2943 Ga0373953_0016153
2944 Ga0373953_0029442
2945 Ga0373953_0074233
2946 Ga0373954_0001141
2947 Ga0373954_0012463
2948 Ga0373954_0014468
2949 Ga0373954_0015482
2950 Ga0373956_0001770
2951 Ga0373956_0007856
2952 Ga0373956_0081040
2953 Ga0373957_0003776
2954 Ga0373957_0042367
2955 Ga0373960_0001357
2956 Ga0373960_0030810
2957 Ga0373943_0124400
2958 Ga0373943_0154707
2959 Ga0373943_0244481
2960 Ga0373946_0071296
2961 Ga0373946_0081077
2962 Ga0373946_0092999
2963 Ga0373946_0207943
2964 Ga0373946_0334029
2965 Ga0373955_0001039
2966 Ga0373955_0010151
2967 Ga0373955_0039022
2968 Ga0373955_0040170
2969 Ga0373955_0323326
2970 Ga0373942_0004939
2971 Ga0373942_0050359
2972 Ga0373961_0033135
2973 Ga0373961_0051661
2974 Ga0373961_0142071
2975 Ga0373962_0000078
2976 Ga0373962_0078897
2977 Ga0316574_0020651
2978 Ga0373924_0002945
2979 Ga0373924_0010518
2980 Ga0373924_0041585
2981 Ga0373924_0073796
2982 Ga0373931_0003029
2983 Ga0373931_0007166
2984 Ga0373931_0031269
2985 Ga0373931_0047034
2986 Ga0373931_0052636
2987 Ga0373931_0126248
2988 Ga0373931_0723548
2989 Ga0373935_0042469
2990 Ga0373935_0055098
2991 Ga0373935_0243077
2992 Ga0373935_0272398
2993 Ga0373935_0345596
2994 Ga0373935_0500773
2995 Ga0373927_0002439
2996 Ga0373927_0035146
2997 Ga0373927_0039369
2998 Ga0373927_0074463
2999 Ga0373933_0001176
3000 Ga0373933_0003616
3001 Ga0373933_0005523
3002 Ga0373933_0020771
3003 Ga0373933_0038938
3004 Ga0373933_0586954
3005 Ga0373933_0845074
3006 Ga0373947_0011631
3007 Ga0373947_0012163
3008 Ga0373947_0166705
3009 Ga0373947_0217401
3010 Ga0373937_0004370
3011 Ga0373937_0007299
3012 Ga0373937_0012395
3013 Ga0373937_0016330
3014 Ga0373937_0027073
3015 Ga0373937_0047990
3016 Ga0373937_0328431
3017 Ga0373937_0749498
3018 Ga0316582_0222711
3019 Ga0316584_0013710
3020 Ga0373925_0033621
3021 Ga0373925_0058797
3022 Ga0373925_0059519
3023 Ga0373925_0060739
3024 Ga0373925_0109019
3025 Ga0373925_0253366
3026 Ga0373925_0258352
3027 Ga0373925_0379881
3028 Ga0373925_0680786
3029 Ga0395900_0001529
3030 Ga0395898_0005283
3031 Ga0395898_0100534
3032 Ga0395905_0009682
3033 Ga0395905_0352196
3034 Ga0395905_0624396
3035 Ga0436364_0151426
3036 Ga0436364_0178002
3037 Ga0436364_0449892
3038 Ga0436364_0682938
3039 Ga0436364_0690770
3040 Ga0395901_0011625
3041 Ga0395901_0118144
3042 Ga0242420_016255
3043 Ga0436365_0062708
3044 Ga0436365_0191965
3045 Ga0436365_0343292
3046 Ga0436360_0579576
3047 Ga0436360_0996754
3048 Ga0436361_0357546
3049 Ga0436363_0511827
3050 Ga0436363_0597243
3051 Ga0436363_0655408
3052 Ga0436363_0767052
3053 Ga0436363_1430348
3054 Ga0436362_0173083
3055 Ga0436362_0297855
3056 Ga0436362_1296428
3057 Ga0439453_0000053
3058 Ga0439453_0008707
3059 Ga0439466_0167669
3060 Ga0439465_0049910
3061 Ga0451787_808973
3062 Ga0451791_1200117
3063 Ga0451793_1238971
3064 Ga0451797_0556017
3065 Ga0451795_0815001
3066 Ga0451802_1763825
3067 Ga0451807_0886678
3068 Ga0451807_2188998
3069 Ga0451835_0276910
3070 Ga0451845_0923467
3071 Ga0451847_0233955
3072 Ga0439443_004635
3073 Ga0439445_0044869
3074 Ga0439448_0120978
3075 Ga0439450_057016
3076 Ga0439455_0100033
3077 Ga0439463_019984
3078 Ga0439446_0042517
3079 Ga0439446_0092976
3080 Ga0439458_0101087
3081 Ga0439435_0000678
3082 Ga0439459_0007786
3083 Ga0439464_0012113
3084 Ga0439464_0057733
3085 Ga0439460_0038009
3086 Ga0451577_0171992
3087 Ga0439440_0056720
3088 Ga0466969_0020427
3089 Ga0466972_0000333
3090 Ga0466972_0208586
3091 Ga0466966_0046761
3092 Ga0466963_0339535
3093 Ga0453684_1652533
3094 Ga0466968_0010020
3095 Ga0466968_0413493
3096 Ga0466957_0063718
3097 Ga0466957_0172040
3098 Ga0466960_0009504
3099 Ga0466960_0043264
3100 Ga0466959_0177173
3101 Ga0451576_1208535
3102 Ga0466958_0060744
3103 Ga0466967_0047293
3104 Ga0466967_0611811
3105 Ga0495627_050057
3106 Ga0495592_0001529
3107 Ga0495592_0002728
3108 Ga0495592_0004236
3109 Ga0495592_0045149
3110 Ga0495592_0122154
3111 Ga0495592_0145649
3112 Ga0495592_0278130
3113 Ga0495603_0035549
3114 Ga0495603_0066995
3115 Ga0495590_0014239
3116 Ga0495590_0049465
3117 Ga0495629_0003844
3118 Ga0495629_0005031
3119 Ga0495629_0108958
3120 Ga0495629_0143127
3121 Ga0495629_0153766
3122 Ga0495629_0707691
3123 Ga0495638_0023480
3124 Ga0495638_0047066
3125 Ga0495641_0051051
3126 Ga0495641_0207686
3127 Ga0495651_0001050
3128 Ga0495651_0023047
3129 Ga0495651_0028941
3130 Ga0495653_0000513
3131 Ga0495653_0005821
3132 Ga0495653_0012012
3133 Ga0495653_0049040
3134 Ga0495650_0051836
3135 Ga0495650_0055945
3136 Ga0495582_0100275
3137 Ga0495582_0159047
3138 Ga0495605_0036148
3139 Ga0495605_0062814
3140 Ga0495605_0076397
3141 Ga0495639_0031208
3142 Ga0495639_0089626
3143 Ga0495639_0124961
3144 Ga0495639_0370037
3145 Ga0495639_0458663
3146 Ga0495662_0130354
3147 Ga0495664_0015254
3148 Ga0495664_0077438
3149 Ga0495664_0079992
3150 Ga0495664_0165213
3151 Ga0495664_0254309
3152 Ga0495664_0308653
3153 Ga0495664_0427658
3154 Ga0495584_0098425
3155 Ga0495584_0118134
3156 Ga0495584_0157352
3157 Ga0495584_0201040
3158 Ga0495585_0036252
3159 Ga0495585_0049564
3160 Ga0495585_0164648
3161 Ga0495594_0139803
3162 Ga0495596_0017806
3163 Ga0495596_0053354
3164 Ga0495596_0091482
3165 Ga0495583_0095999
3166 Ga0495583_0311352
3167 Ga0495606_0038140
3168 Ga0495608_0000910
3169 Ga0495608_0004294
3170 Ga0495608_0012541
3171 Ga0495608_0097283
3172 Ga0495608_0127816
3173 Ga0495610_0031329
3174 Ga0495616_0019622
3175 Ga0495616_0093382
3176 Ga0495618_0013782
3177 Ga0495618_0027302
3178 Ga0495618_0057323
3179 Ga0495618_0060670
3180 Ga0495618_0139691
3181 Ga0495628_0001000
3182 Ga0495628_0005038
3183 Ga0495628_0007197
3184 Ga0495628_0054618
3185 Ga0495628_0660412
3186 Ga0495630_0035402
3187 Ga0495630_0218915
3188 Ga0495630_0590567
3189 Ga0495631_0053956
3190 Ga0495631_0191919
3191 Ga0495632_0144704
3192 Ga0495632_0145487
3193 Ga0495637_0077466
3194 Ga0495637_0101462
3195 Ga0495643_0003266
3196 Ga0495644_0031147
3197 Ga0495644_0089326
3198 Ga0495666_0060266
3199 Ga0495642_0022245
3200 Ga0495652_0004645
3201 Ga0495652_0020289
3202 Ga0495652_0021614
3203 Ga0495652_0108100
3204 Ga0495652_0267732
3205 Ga0495652_0338793
3206 Ga0495652_0382011
3207 Ga0495652_0383544
3208 Ga0495654_0209825
3209 Ga0495654_0329971
3210 Ga0495640_0014255
3211 Ga0495640_0027945
3212 Ga0495640_0048808
3213 Ga0495640_0071628
3214 Ga0495640_0130972
3215 Ga0495640_0182841
3216 Ga0495640_0195587
3217 Ga0495586_0031809
3218 Ga0495587_0004074
3219 Ga0495587_0005057
3220 Ga0495587_0017667
3221 Ga0495587_0021173
3222 Ga0495587_0219467
3223 Ga0495587_0305160
3224 Ga0495598_0008957
3225 Ga0495598_0087453
3226 Ga0495609_0023003
3227 Ga0495609_0135281
3228 Ga0495621_0004613
3229 Ga0495621_0019734
3230 Ga0495621_0075419
3231 Ga0495597_0022020
3232 Ga0495597_0091715
3233 Ga0495645_0000411
3234 Ga0495645_0006906
3235 Ga0495645_0010435
3236 Ga0495645_0010890
3237 Ga0495645_0218221
3238 Ga0495622_0004278
3239 Ga0495622_0078279
3240 Ga0495622_0108318
3241 Ga0495633_0031508
3242 Ga0495633_0045705
3243 Ga0495667_0000399
3244 Ga0495667_0003789
3245 Ga0495667_0006144
3246 Ga0495667_0130731
3247 Ga0495667_0259461
3248 Ga0495656_0026731
3249 Ga0495656_0034480
3250 Ga0495668_0055740
3251 Ga0495668_0139956
3252 Ga0495634_0031038
3253 Ga0495634_0038394
3254 Ga0495634_0093363
3255 Ga0495634_0118730
3256 Ga0495634_0164049
3257 Ga0495611_0014614
3258 Ga0495611_0180671
3259 Ga0495625_0065754
3260 Ga0495625_0483772
3261 Ga0495635_0000211
3262 Ga0495635_0001031
3263 Ga0495635_0023129
3264 Ga0495635_0023663
3265 Ga0495635_0038006
3266 Ga0495659_0008931
3267 Ga0495588_0046496
3268 Ga0495657_0001810
3269 Ga0495657_0002321
3270 Ga0495657_0141925
3271 Ga0495657_0180227
3272 Ga0495599_0000957
3273 Ga0495599_0027152
3274 Ga0495599_0031838
3275 Ga0495599_0083380
3276 Ga0495599_0458834
3277 Ga0495623_0005094
3278 Ga0495623_0005834
3279 Ga0495623_0013653
3280 Ga0495623_0013867
3281 Ga0495623_0038133
3282 Ga0495646_0001814
3283 Ga0495646_0004069
3284 Ga0495646_0072401
3285 Ga0495647_0049450
3286 Ga0495647_0061242
3287 Ga0495647_0252117
3288 Ga0495658_0026853
3289 Ga0495658_0081955
3290 Ga0495658_0112671
3291 Ga0495658_0366583
3292 Ga0495669_0023843
3293 Ga0495613_0008427
3294 Ga0495613_0032899
3295 Ga0495613_0211295
3296 Ga0495624_0050047
3297 Ga0495624_0495348
3298 Ga0495670_0380480
3299 Ga0495671_0129106
3300 Ga0495671_0183339
3301 Ga0495671_0189079
3302 Ga0495649_0033966
3303 Ga0495649_0135354
3304 Ga0495649_0313912
3305 Ga0495589_0080801
3306 Ga0495600_0006411
3307 Ga0495600_0013832
3308 Ga0495600_0019824
3309 Ga0495600_0291696
3310 Ga0495600_0294156
3311 Ga0495660_0189023
3312 Ga0495581_0235415
3313 Ga0495581_0423308
3314 Ga0495604_0002733
3315 Ga0495604_0006074
3316 Ga0495604_0006930
3317 Ga0495604_0009592
3318 Ga0495604_0010845
3319 Ga0495604_0589279
3320 Ga0495636_0046748
3321 Ga0495636_0048470
3322 Ga0495674_0001693
3323 Ga0495674_0013996
3324 Ga0495674_0030166
3325 Ga0495674_0031972
3326 Ga0495674_0050926
3327 Ga0495674_0055361
3328 Ga0495674_0103100
3329 Ga0495674_0134788
3330 Ga0495674_0393229
3331 Ga0495672_0037216
3332 Ga0495672_0053767
3333 Ga0495672_0061604
3334 Ga0495672_0068356
3335 Ga0495672_0088611
3336 Ga0495672_0096380
3337 Ga0495672_0111174
3338 Ga0495672_0206936
3339 Ga0495672_0215598
3340 Ga0495676_0203139
3341 Ga0495676_0247761
3342 Ga0495676_0356239
3343 Ga0495680_0001112
3344 Ga0495680_0004228
3345 Ga0495680_0006158
3346 Ga0495680_0021510
3347 Ga0495680_0044833
3348 Ga0495680_0072530
3349 Ga0495680_0308760
3350 Ga0495680_0310922
3351 Ga0495680_0537376
3352 Ga0495683_0037174
3353 Ga0495683_0203472
3354 Ga0495687_010582
3355 Ga0495687_099324
3356 Ga0495675_0001324
3357 Ga0495675_0007639
3358 Ga0495675_0025334
3359 Ga0495675_0083197
3360 Ga0495675_0184389
3361 Ga0495684_0015971
3362 Ga0495684_0020317
3363 Ga0495684_0029872
3364 Ga0495684_0037641
3365 Ga0495684_0266704
3366 Ga0495686_0034271
3367 Ga0495686_0220937
3368 Ga0495593_0002923
3369 Ga0495593_0036009
3370 Ga0495593_0127282
3371 Ga0495602_0000965
3372 Ga0495602_0006595
3373 Ga0495602_0008570
3374 Ga0495602_0041931
3375 Ga0495602_0213520
3376 Ga0495602_0307064
3377 Ga0495615_0001775
3378 Ga0495615_0002752
3379 Ga0495615_0008706
3380 Ga0495615_0050964
3381 Ga0495626_0019232
3382 Ga0496100_0002382
3383 Ga0496100_0014232
3384 Ga0496100_0047643
3385 Ga0496100_0057810
3386 Ga0496100_0111412
3387 Ga0496100_0257738
3388 Ga0496100_0264505
3389 Ga0496100_0305837
3390 Ga0496101_0006609
3391 Ga0496101_0012677
3392 Ga0496101_0022688
3393 Ga0496101_0047225
3394 Ga0496101_0163170
3395 Ga0496101_0641045
3396 Ga0496102_0010844
3397 Ga0496102_0020999
3398 Ga0496102_0045634
3399 Ga0496102_0046713
3400 Ga0496102_0082115
3401 Ga0496102_0105735
3402 Ga0496102_0304428
3403 Ga0496102_0342681
3404 Ga0496102_0585870
3405 Ga0496103_0001419
3406 Ga0496103_0002062
3407 Ga0496103_0023756
3408 Ga0496103_0051560
3409 Ga0496103_0072196
3410 Ga0496103_0113002
3411 Ga0496103_0241484
3412 Ga0496104_0000140
3413 Ga0496104_0004452
3414 Ga0496104_0008421
3415 Ga0496104_0039302
3416 Ga0496104_0058499
3417 Ga0496104_0071910
3418 Ga0496104_0090536
3419 Ga0496104_0111274
3420 Ga0496104_0143567
3421 Ga0496104_0161654
3422 Ga0496104_0182846
3423 Ga0496104_0383469
3424 Ga0496104_0463606
3425 Ga0496104_0465559
3426 Ga0496104_0584170
3427 Ga0496105_0000043
3428 Ga0496105_0001390
3429 Ga0496105_0006096
3430 Ga0496105_0006732
3431 Ga0496105_0025833
3432 Ga0496105_0066445
3433 Ga0496105_0068744
3434 Ga0496105_0210178
3435 Ga0496105_0232880
3436 Ga0496105_0351797
3437 Ga0496105_0359571
3438 Ga0496105_0461199
3439 Ga0496106_0005076
3440 Ga0496106_0006330
3441 Ga0496106_0006503
3442 Ga0496106_0014137
3443 Ga0496106_0035723
3444 Ga0496106_0107271
3445 Ga0496106_0132066
3446 Ga0496106_0188677
3447 Ga0496106_0332789
3448 Ga0496106_0909481
3449 Ga0496107_0006319
3450 Ga0496107_0014188
3451 Ga0496107_0017343
3452 Ga0496107_0019745
3453 Ga0496107_0034155
3454 Ga0496107_0065142
3455 Ga0496107_0210274
3456 Ga0496107_0420564
3457 Ga0496107_0665198
3458 Ga0496108_0000449
3459 Ga0496108_0000845
3460 Ga0496108_0001227
3461 Ga0496108_0018642
3462 Ga0496108_0022690
3463 Ga0496108_0067630
3464 Ga0496108_0115483
3465 Ga0496108_0296107
3466 Ga0496108_0466440
3467 Ga0496108_0471213
3468 Ga0496108_0624047
3469 Ga0496109_0000592
3470 Ga0496109_0000896
3471 Ga0496109_0001611
3472 Ga0496109_0002747
3473 Ga0496109_0052497
3474 Ga0496109_0159366
3475 Ga0496109_0170979
3476 Ga0496109_0271921
3477 Ga0496109_0514765
3478 Ga0496109_0605327
3479 Ga0496109_0728453
3480 Ga0496110_0025034
3481 Ga0496110_0040389
3482 Ga0496110_0054663
3483 Ga0496110_0060173
3484 Ga0496110_0068694
3485 Ga0496110_0117351
3486 Ga0496110_0156060
3487 Ga0496110_0181993
3488 Ga0496110_0213957
3489 Ga0496110_0325869
3490 Ga0496110_0460770
3491 Ga0496110_0572726
3492 Ga0496111_0001189
3493 Ga0496111_0001965
3494 Ga0496111_0041773
3495 Ga0496111_0048896
3496 Ga0496111_0092622
3497 Ga0496111_0148066
3498 Ga0496111_0212255
3499 Ga0496111_0349793
3500 Ga0496112_0001178
3501 Ga0496112_0002006
3502 Ga0496112_0010720
3503 Ga0496112_0014863
3504 Ga0496112_0017698
3505 Ga0496112_0030697
3506 Ga0496112_0345767
3507 Ga0496112_0432434
3508 Ga0496112_0611316
3509 Ga0496112_0737280
3510 Ga0496113_0000507
3511 Ga0496113_0000911
3512 Ga0496113_0001342
3513 Ga0496113_0016467
3514 Ga0496113_0042838
3515 Ga0496113_0932551
3516 Ga0496114_0003476
3517 Ga0496114_0007914
3518 Ga0496114_0054340
3519 Ga0496114_0154390
3520 Ga0496114_0193357
3521 Ga0496114_0222469
3522 Ga0496114_0354882
3523 Ga0496115_0001082
3524 Ga0496115_0015997
3525 Ga0496115_0030182
3526 Ga0496115_0033375
3527 Ga0496115_0056942
3528 Ga0496115_0067466
3529 Ga0496115_0082658
3530 Ga0496115_0153536
3531 Ga0496115_0211374
3532 Ga0496115_0281254
3533 Ga0496115_0411480
3534 Ga0496115_0593531
3535 Ga0496115_0793748
3536 Ga0496115_0795474
3537 Ga0496116_0172725
3538 Ga0496117_0039541
3539 Ga0496117_0284201
3540 Ga0496118_0003113
3541 Ga0496118_0012566
3542 Ga0496119_0024068
3543 Ga0496119_0111262
3544 Ga0496119_0178687
3545 Ga0496120_0116930
3546 Ga0496120_0294849
3547 Ga0496120_0374167
3548 Ga0496121_0000886
3549 Ga0496121_0002017
3550 Ga0496121_0017513
3551 Ga0496121_0049748
3552 Ga0496121_0215718
3553 Ga0496121_0255633
3554 Ga0496122_0071623
3555 Ga0496124_0013881
3556 Ga0496124_0144905
3557 Ga0496124_0156452
3558 Ga0496125_0018812
3559 Ga0496125_0034757
3560 Ga0496125_0050051
3561 Ga0496125_0181019
3562 Ga0496126_0017266
3563 Ga0496126_0044034
3564 Ga0496126_0076736
3565 Ga0496126_0166185
3566 Ga0496126_0963885
3567 Ga0501309_024232
3568 Ga0495678_037461
3569 Ga0495682_0045975
3570 Ga0495682_0082909
3571 Ga0501033_0134455
3572 Ga0501033_0164043
3573 Ga0501034_0073120
3574 Ga0501034_0675434
3575 Ga0501036_0063664
3576 Ga0501036_0200803
3577 Ga0501036_0448230
3578 Ga0501037_0272014
3579 Ga0501038_0093943
3580 Ga0501038_0375293
3581 Ga0501038_0410248
3582 Ga0501039_0144968
3583 Ga0501041_0043056
3584 Ga0501042_0393614
3585 Ga0501043_0584704
3586 Ga0501046_0026812
3587 Ga0501046_0249702
3588 Ga0501047_0108340
3589 Ga0501047_0701833
3590 Ga0501048_0333066
3591 Ga0501048_0395781
3592 Ga0501048_0695419
3593 Ga0501067_0029147
3594 Ga0501068_0336607
3595 Ga0501070_0049621
3596 Ga0501071_0101042
3597 Ga0501071_0175580
3598 Ga0501071_0227380
3599 Ga0501071_0964315
3600 Ga0501072_0008000
3601 Ga0501072_0017905
3602 Ga0501072_0352048
3603 Ga0501073_0074697
3604 Ga0501073_0405085
3605 Ga0501073_0639138
3606 Ga0501075_0020214
3607 Ga0501075_0051469
3608 Ga0501075_0100730
3609 Ga0501075_0398654
3610 Ga0501076_0026146
3611 Ga0501076_0056326
3612 Ga0501076_0090946
3613 Ga0501076_0232587
3614 Ga0501076_0344665
3615 Ga0501076_0493584
3616 Ga0501076_0611521
3617 Ga0501077_0068698
3618 Ga0501077_0093371
3619 Ga0501077_0589818
3620 Ga0501077_0622669
3621 Ga0501079_0022862
3622 Ga0501079_0129953
3623 Ga0501079_0139630
3624 Ga0501079_0350733
3625 Ga0501079_0617329
3626 Ga0501079_1146054
3627 Ga0501080_0245615
3628 Ga0501080_0545869
3629 Ga0501081_0081615
3630 Ga0501081_0151462
3631 Ga0501081_0281312
3632 Ga0501081_0282723
3633 Ga0501081_0378489
3634 Ga0501081_0433568
3635 Ga0501081_0728988
3636 Ga0501081_0880596
3637 Ga0501083_0003903
3638 Ga0501083_0013908
3639 Ga0501083_0115837
3640 Ga0501083_0247446
3641 Ga0501035_0182194
3642 Ga0501044_0029667
3643 Ga0501044_1100295
3644 Ga0501045_0033295
3645 Ga0501045_0228042
3646 Ga0501045_0369617
3647 nmdc:mga03683_119971_c1
3648 nmdc:mga03683_274542_c1
3649 nmdc:mga03683_34584_c1
3650 nmdc:mga03683_4641_c1
3651 nmdc:mga03683_78970_c1
3652 nmdc:mga03n38_10463_c1
3653 nmdc:mga03n38_170575_c1
3654 nmdc:mga03n38_349289_c1
3655 nmdc:mga03n38_45781_c1
3656 nmdc:mga03n38_59539_c1
3657 nmdc:mga03n38_6717_c1
3658 nmdc:mga03n38_68457_c1
3659 nmdc:mga00v17_207358_c1
3660 nmdc:mga00v17_274513_c1
3661 nmdc:mga00v17_429911_c1
3662 nmdc:mga00v17_43255_c1
3663 nmdc:mga00v17_59880_c1
3664 nmdc:mga0yw44_11255_c1
3665 nmdc:mga0yw44_118837_c1
3666 nmdc:mga0yw44_150798_c1
3667 nmdc:mga0yw44_198523_c1
3668 nmdc:mga0yw44_255925_c1
3669 nmdc:mga0yw44_28117_c1
3670 nmdc:mga0yw44_281998_c1
3671 nmdc:mga0yw44_30505_c1
3672 nmdc:mga0yw44_30604_c1
3673 nmdc:mga0yw44_331605_c1
3674 nmdc:mga0yw44_43345_c1
3675 nmdc:mga0yw44_4648_c1
3676 nmdc:mga0yw44_517042_c1
3677 nmdc:mga0yw44_78004_c1
3678 nmdc:mga0k408_122033_c1
3679 nmdc:mga0k408_207440_c1
3680 nmdc:mga0k408_31601_c1
3681 nmdc:mga0k408_383483_c1
3682 nmdc:mga0k408_54735_c1
3683 nmdc:mga0k408_78564_c1
3684 nmdc:mga0k408_8031_c1
3685 nmdc:mga0k408_82626_c1
3686 nmdc:mga0k408_91669_c1
3687 nmdc:mga0k408_92254_c1
3688 nmdc:mga06z11_102584_c1
3689 nmdc:mga06z11_106571_c1
3690 nmdc:mga06z11_121587_c1
3691 nmdc:mga06z11_124756_c1
3692 nmdc:mga06z11_214875_c1
3693 nmdc:mga06z11_276345_c1
3694 nmdc:mga06z11_34496_c1
3695 nmdc:mga06z11_44322_c1
3696 nmdc:mga06z11_50325_c1
3697 nmdc:mga06z11_525023_c1
3698 nmdc:mga06z11_64594_c1
3699 nmdc:mga06z11_75107_c1
3700 nmdc:mga04h51_107365_c1
3701 nmdc:mga04h51_107883_c1
3702 nmdc:mga04h51_1239_c1
3703 nmdc:mga04h51_1563_c1
3704 nmdc:mga04h51_23183_c1
3705 nmdc:mga04h51_255299_c1
3706 nmdc:mga04h51_42321_c1
3707 nmdc:mga04h51_67446_c1
3708 nmdc:mga07m45_15871_c1
3709 nmdc:mga07m45_215588_c2
3710 nmdc:mga07m45_23262_c1
3711 nmdc:mga07m45_349640_c1
3712 nmdc:mga07m45_431249_c1
3713 nmdc:mga07m45_587041_c1
3714 nmdc:mga05p37_1180728_c1
3715 nmdc:mga05p37_118439_c1
3716 nmdc:mga05p37_156170_c1
3717 nmdc:mga05p37_22407_c1
3718 nmdc:mga05p37_413180_c1
3719 nmdc:mga05p37_481_c1
3720 nmdc:mga05p37_56162_c1
3721 nmdc:mga05p37_89411_c1
3722 nmdc:mga05p37_91321_c1
3723 nmdc:mga09592_1486_c1
3724 nmdc:mga09592_183634_c1
3725 nmdc:mga09592_211036_c1
3726 nmdc:mga09592_359431_c1
3727 nmdc:mga0qj67_111_c1
3728 nmdc:mga0qj67_194899_c1
3729 nmdc:mga0qj67_42686_c1
3730 nmdc:mga0qj67_511437_c1
3731 nmdc:mga0qj67_545_c1
3732 nmdc:mga06r32_1300867_c1
3733 nmdc:mga06r32_158652_c1
3734 nmdc:mga06r32_16404_c1
3735 nmdc:mga06r32_32_c1
3736 nmdc:mga06r32_461652_c1
3737 nmdc:mga06r32_596492_c1
3738 nmdc:mga06r32_723428_c1
3739 nmdc:mga08y16_233645_c1
3740 nmdc:mga08y16_268625_c1
3741 nmdc:mga08y16_29056_c1
3742 nmdc:mga08y16_315591_c1
3743 nmdc:mga08y16_37_c1
3744 nmdc:mga08y16_50185_c1
3745 nmdc:mga08y16_53825_c1
3746 nmdc:mga08y16_73437_c1
3747 nmdc:mga08y16_7415_c1
3748 nmdc:mga08y16_975869_c1
3749 nmdc:mga08y16_983593_c1
3750 nmdc:mga0n895_129713_c1
3751 nmdc:mga0n895_197525_c1
3752 nmdc:mga0n895_21007_c1
3753 nmdc:mga0n895_30774_c1
3754 nmdc:mga0rr50_132058_c1
3755 nmdc:mga0rr50_182900_c1
3756 nmdc:mga0rr50_372834_c1
3757 nmdc:mga0rr50_831076_c1
3758 nmdc:mga08x19_201358_c1
3759 nmdc:mga08x19_226002_c1
3760 nmdc:mga0a205_302815_c1
3761 nmdc:mga0a205_325570_c1
3762 nmdc:mga0a205_367707_c1
3763 nmdc:mga0a205_48670_c1
3764 nmdc:mga0a205_69199_c1
3765 nmdc:mga0a205_72778_c1
3766 nmdc:mga0a205_916012_c1
3767 nmdc:mga0sz30_120911_c1
3768 nmdc:mga0sz30_1617_c1
3769 nmdc:mga0sz30_222244_c1
3770 nmdc:mga0sz30_47446_c1
3771 nmdc:mga0sz30_64811_c1
3772 nmdc:mga0sz30_66961_c1
3773 nmdc:mga0sz30_9308_c2
3774 Ga0495601_0000467
3775 Ga0495601_0000861
3776 Ga0495601_0001456
3777 Ga0495601_0005945
3778 Ga0495601_0011563
3779 Ga0495601_0095822
3780 Ga0495601_0115884
3781 Ga0495601_0201605
3782 Ga0495612_0000575
3783 Ga0495612_0004648
3784 Ga0495612_0012284
3785 Ga0495612_0149889
3786 Ga0500610_0035592
3787 Ga0500635_0004759
3788 Ga0495655_0003619
3789 Ga0495595_0000635
3790 Ga0495595_0001020
3791 Ga0495595_0004731
3792 Ga0495595_0015661
3793 Ga0495595_0022205
3794 Ga0495595_0034075
3795 Ga0495595_0041025
3796 Ga0495595_0253401
3797 Ga0495619_0000016
3798 Ga0495619_0002154
3799 Ga0495619_0003042
3800 Ga0495619_0004154
3801 Ga0495619_0012362
3802 Ga0495619_0016222
3803 Ga0495619_0045937
3804 Ga0495619_0093467
3805 Ga0495619_0140872
3806 Ga0495619_0321836
3807 Ga0495619_0347848
3808 Ga0500578_0051516
3809 Ga0500578_0377718
3810 Ga0500644_0064861
3811 Ga0500646_0106468
3812 Ga0500651_0191576
3813 Ga0500566_0004766
3814 Ga0500566_0022772
3815 Ga0500566_0296634
3816 Ga0500641_0008154
3817 Ga0500641_0021665
3818 Ga0500641_0023473
3819 Ga0500650_0096145
3820 Ga0500650_0240431
3821 Ga0500555_041263
3822 Ga0500558_055504
3823 Ga0500572_000093
3824 Ga0500582_173345
3825 Ga0500592_020606
3826 Ga0500594_0045023
3827 Ga0500595_001406
3828 Ga0500595_001750
3829 Ga0500595_009426
3830 Ga0500595_016335
3831 Ga0500595_073355
3832 Ga0500608_060376
3833 Ga0500618_035027
3834 Ga0500626_073006
3835 Ga0500642_0022506
3836 Ga0500652_146848
3837 Ga0500655_003381
3838 Ga0500658_0025355
3839 Ga0500559_0000242
3840 Ga0500559_0026137
3841 Ga0500559_0090946
3842 Ga0500568_0006307
3843 Ga0500568_0078438
3844 Ga0500568_0118598
3845 Ga0500573_0136887
3846 Ga0500577_0035215
3847 Ga0500588_0207952
3848 Ga0500589_022266
3849 Ga0500604_0017013
3850 Ga0500604_0073716
3851 Ga0500604_0092872
3852 Ga0500616_0025644
3853 Ga0500616_0148295
3854 Ga0500619_132158
3855 Ga0500622_0020471
3856 Ga0500622_0111697
3857 Ga0500627_0190400
3858 Ga0500633_0219929
3859 Ga0500634_0082277
3860 Ga0500638_000402
3861 Ga0500639_001904
3862 Ga0500637_0002381
3863 Ga0500611_052981
3864 Ga0500611_143867
3865 Ga0500657_094878
3866 Ga0500645_029155
3867 Ga0500645_040182
3868 Ga0500645_129448
3869 Ga0500609_007246
3870 Ga0500656_015415
3871 Ga0500552_001834
3872 Ga0500596_000350
3873 Ga0500596_001100
3874 Ga0501084_0061368
3875 Ga0501084_0100910
3876 Ga0501084_0156432
3877 Ga0501084_0206589
3878 Ga0501084_0447580
3879 Ga0501084_0842730
3880 Ga0501084_1015190
3881 Ga0500661_000108
3882 Ga0590071_003417
3883 Ga0587093_032290
3884 Ga0587083_0075839
3885 Ga0587085_032574
3886 Ga0587086_023435
3887 Ga0587068_052867
3888 Ga0501082_0000106
3889 Ga0501082_0043636
3890 Ga0501082_0049770
3891 Ga0501082_0081512
3892 Ga0501082_0292811
3893 Ga0501082_0758478
3894 Ga0501082_0790114
3895 Ga0501082_1155901
3896 Ga0530510_0017881
3897 Ga0530510_0020095
3898 Ga0530510_0213744
3899 Ga0530510_0266002
3900 Ga0530510_0545461
3901 2509149394
3902 2513622966
3903 2513699544
3904 2517104065
3905 2517891444
3906 2524436375
3907 2524538381
3908 2603861422
3909 2643758643
3910 2728750139
3911 2745080671
3912 2818236462
3913 2824621920
3914 2824631612
3915 2824641698
3916 2824649360
3917 2824713657
3918 2824719187
3919 2824729604
3920 2824758461
3921 2824770045
3922 2836164696
3923 2841959784
3924 2842040562
3925 2842046492
3926 2847937237
3927 2874607295
3928 2874614665
3929 2874627989
3930 2876766184
3931 2876814532
3932 2879088465
3933 2879114627
3934 2881371546
3935 2881671842
3936 2885369883
3937 2885379649
3938 2885412280
3939 2888385362
3940 2889038110
3941 2903752507
3942 2904674393
3943 2904691286
3944 2904704891
3945 2904712072
3946 2906616616
3947 2906635400
3948 2906649362
3949 2906666945
3950 2908741782
3951 2908759072
3952 2922368588
3953 2922431363
3954 2935633959
3955 2941510738
3956 2941518122
3957 2941527007
3958 8006930880
3959 8006939554
3960 8006968361
3961 8006979305
3962 8006989197
3963 8006994809
3964 8019575534
3965 8056681019
3966 8056693407

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

61

127

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

162

211

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

157

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go1-assembly1.cif.gz_A-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9801 135 168
2w48-assembly1.cif.gz_B crystal structure of the full-length sorbitol operon regulator sorc from klebsiella pneumoniae 0.9682 136 174
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9594 132 179
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9486 116 186
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9435 121 177
ID Description Score Start End Superfamily
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9744 9 90 1.10.1740.10
2w48B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9682 136 174 1.10.10.60
af_O06371_1_115_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9663 136 168 1.10.10.60
af_P13445_245_318_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9592 111 179 1.10.10.10
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9591 9 91 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A4P9Z6S1-F1-model_v4 Peptidase S8/S53 domain-containing protein 0.5408 25 183 GO:0003677
GO:0004252
GO:0006352
GO:0006508
GO:0016020
GO:0016987
AF-A0A537TZN1-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.5319 6 181 GO:0003677
GO:0006352
GO:0016987
AF-A0A317HYH0-F1-model_v4 deleted 0.5294 6 181
AF-A0A1K1M515-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.5235 6 179 GO:0003677
GO:0006352
GO:0016987
AF-A6EK26-F1-model_v4 RNA polymerase ECF-type sigma factor 0.5227 6 178 GO:0003677
GO:0006352
GO:0016987

Map