F496167

General Info

Members Datasets Scaffolds Average Seq Length
1967 675 1910 173

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_1496887|Ga0453684_1496887_79_675
Length 191
Sequence MRRRASRASAAKSCASWRKENGIMSRVAKKPIALPKGIELNVQAESVSVKGPKGTLSIAAVENGTAQLSANDAALVPMTGTLRAILANMVHGVSQGFERKLELVGVGYRASMQGKDLNIALGFSHPVVFPSPEGITIATPTQTEIVVSGADKQRVGEVAAKIRGFRPPEPYKGKGVKYSDETIIRKEAKKA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2643221586 Lysobacter sp. Root667 Isolate Unclassified
11 2643221593 Lysobacter sp. Root690 Isolate Unclassified
12 2643221612 Lysobacter sp. Root76 Isolate Unclassified
13 2643221695 Lysobacter sp. Root494 Isolate Unclassified
14 2643221720 Lysobacter sp. Root916 Isolate Unclassified
15 2643221727 Lysobacter sp. Root96 Isolate Unclassified
16 2643221728 Lysobacter sp. Root983 Isolate Unclassified
17 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
18 2734482264 Dyella sp. AD052 Isolate Unclassified
19 2739367700 Dyella sp. YR388 Isolate Unclassified
20 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
21 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
22 2818991457 Xanthomonas translucens 569 Isolate Unclassified
23 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
24 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
25 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
26 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
27 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
28 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
29 2884411467 Dyella sp. AD56 Isolate Rhizosphere
30 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
31 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
32 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
33 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
34 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
35 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
36 2919085039 Luteibacter sp. 1214 Isolate Unclassified
37 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
38 2919513703 Luteimonas sp. 3794 Isolate Unclassified
39 2919675420 Luteimonas terrae 4099 Isolate Unclassified
40 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
41 2928963466 Dyella japonica 1073 Isolate Unclassified
42 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
43 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
44 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
45 2941471342 Luteibacter sp. 621 Isolate Unclassified
46 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
47 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
48 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
49 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
50 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
51 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
52 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
53 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
54 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
55 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
60 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
61 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
62 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
63 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
64 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
65 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
66 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
71 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
72 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
73 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
74 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
75 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
81 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
82 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
83 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
88 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
93 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
96 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
101 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
102 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
103 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
104 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
105 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
106 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
113 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
114 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
120 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
121 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
122 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
129 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
134 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
149 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
150 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
151 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
152 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
153 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
154 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
155 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
158 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
160 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
161 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
162 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
163 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
164 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
165 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
166 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
167 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
168 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
169 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
170 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
171 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
172 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
176 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
182 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
183 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
184 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
185 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
186 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
187 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
188 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
189 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
190 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
191 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
192 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
193 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
194 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
195 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
196 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
197 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
198 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
199 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
200 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
201 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
202 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
203 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
204 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
205 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
206 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
207 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
208 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
209 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
210 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
211 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
212 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
213 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
214 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
215 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
216 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
219 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
220 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
226 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
227 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
229 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
230 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
231 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
233 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
234 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
235 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
239 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
242 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
243 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
244 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
321 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
326 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
327 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
328 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
329 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
330 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
331 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
332 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
333 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
334 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
336 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
337 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
338 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
339 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
340 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
341 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
342 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
343 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
344 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
345 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
346 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
347 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
348 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
349 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
350 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
351 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
352 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
353 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
354 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
355 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
356 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
357 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
358 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
359 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
360 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
361 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
364 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
365 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
366 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
367 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
369 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
375 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
376 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
377 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
379 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
380 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
381 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
382 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
383 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
384 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
385 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
386 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
387 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
388 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
389 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
390 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
391 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
392 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
393 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
394 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
395 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
396 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
397 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
398 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
399 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
400 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
401 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
402 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
403 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
404 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
405 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
406 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
407 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
408 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
409 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
410 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
411 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
412 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
413 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
414 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
415 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
416 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
417 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
418 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
419 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
420 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
421 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
422 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
423 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
424 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
425 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
426 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
427 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
428 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
429 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
430 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
431 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
432 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
433 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
434 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
435 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
436 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
437 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
438 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
439 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
440 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
441 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
442 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
443 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
444 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
445 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
446 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
447 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
448 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
449 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
450 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
451 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
452 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
453 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
454 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
455 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
456 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
457 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
458 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
459 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
460 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
461 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
462 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
463 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
464 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
465 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
466 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
467 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
468 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
469 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
470 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
471 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
472 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
473 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
474 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
475 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
476 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
477 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
478 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
479 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
480 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
481 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
482 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
483 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
484 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
485 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
486 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
487 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
488 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
489 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
490 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
491 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
492 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
493 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
494 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
495 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
496 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
497 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
498 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
499 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
500 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
501 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
502 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
503 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
504 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
505 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
506 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
507 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
508 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
509 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
510 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
511 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
512 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
513 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
514 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
515 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
516 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
517 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
518 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
519 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
520 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
521 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
522 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
523 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
524 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
525 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
526 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
527 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
528 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
529 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
530 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
531 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
532 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
533 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
534 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
535 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
536 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
537 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
538 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
539 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
540 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
541 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
542 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
543 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
544 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
545 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
546 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
547 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
548 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
549 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
550 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
551 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
552 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
553 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
562 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
563 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
564 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
565 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
589 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
591 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
595 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
596 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
604 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
605 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
606 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
607 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
608 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
609 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
610 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
611 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
612 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
613 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
614 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
615 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
616 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
617 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
618 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
619 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
620 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
621 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
622 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
623 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
624 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
625 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
626 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
627 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
628 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
629 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
630 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
631 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
632 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
633 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
637 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
638 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
639 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
640 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
641 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
642 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
643 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
644 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
645 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
646 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
647 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
648 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
649 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
650 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
651 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
652 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
653 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
654 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
655 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
656 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
657 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
658 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
659 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
660 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
661 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
662 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
663 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
664 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
665 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
666 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
667 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
668 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
669 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
670 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
671 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
672 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
673 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
674 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
675 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 4.73
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 4.12
Rhizosphere 81.14
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000834 3300001904 Bacteria 5687
2 JGI24736J21556_1047468 3300001904 Bacteria 660
3 JGI24740J21852_10035166 3300001979 Bacteria 1569
4 JGI24739J22299_10040522 3300001989 Bacteria 1554
5 JGI24737J22298_10054758 3300001990 Bacteria 1207
6 JGI24735J21928_10003017 3300002067 Bacteria 5789
7 JGI24735J21928_10108296 3300002067 Bacteria 799
8 JGI24735J21928_10114158 3300002067 Bacteria 777
9 JGI24744J21845_10037822 3300002077 Bacteria 908
10 JGI25156J39149_1008281 3300002705 Bacteria 2635
11 JGI25156J39149_1018608 3300002705 Bacteria 1278
12 JGI25162J39368_1003971 3300002737 Bacteria 3768
13 JGI25162J39368_1003976 3300002737 Bacteria 3764
14 JGI25157J39369_1002257 3300002741 Bacteria 5167
15 JGI25157J39369_1002916 3300002741 Bacteria 3795
16 JGI25163J39215_1001042 3300002771 Bacteria 5954
17 JGI25164J39214_1000781 3300002772 Bacteria 11524
18 JGI25152J39213_1000284 3300002773 Bacteria 33794
19 JGI25150J39212_1000359 3300002774 Bacteria 22362
20 JGI25151J46595_10000875 3300003187 Bacteria 23771
21 JGI25151J46595_10000895 3300003187 Bacteria 23452
22 JGI25165J46597_1001532 3300003214 Bacteria 11524
23 JGI25153J46596_10000050 3300003215 Bacteria 140710
24 Ga0006770J48903_1011541 3300003305 Bacteria 1524
25 rootH2_10053540 3300003320 Bacteria 3889
26 JGI26145J50221_1000790 3300003371 Bacteria 2592
27 Ga0055538_1000680 3300003751 Bacteria 10513
28 Ga0055533_1001562 3300003756 Bacteria 5959
29 Ga0055527_1004213 3300003760 Bacteria 2006
30 Ga0055535_1000430 3300003761 Bacteria 39174
31 Ga0055542_1003964 3300003762 Bacteria 3768
32 Ga0055542_1003969 3300003762 Bacteria 3766
33 Ga0055529_1000211 3300003763 Bacteria 76826
34 Ga0055526_1002877 3300003771 Bacteria 11337
35 Ga0055526_1007687 3300003771 Bacteria 5542
36 Ga0055537_1000851 3300003773 Bacteria 14843
37 Ga0055537_1001096 3300003773 Bacteria 11761
38 Ga0055524_1002940 3300003775 Bacteria 8496
39 Ga0055524_1003518 3300003775 Bacteria 7575
40 Ga0055536_1005265 3300003781 Bacteria 6371
41 Ga0055534_1000515 3300003784 Bacteria 20870
42 Ga0055534_1000766 3300003784 Bacteria 15218
43 Ga0055528_1000337 3300003790 Bacteria 39377
44 Ga0055528_1001961 3300003790 Bacteria 11621
45 Ga0055530_10033191 3300003791 Bacteria 1334
46 Ga0055530_10042052 3300003791 Bacteria 1111
47 Ga0055531_10010210 3300003794 Bacteria 4695
48 Ga0055531_10036708 3300003794 Bacteria 1505
49 Ga0058692_1000748 3300003856 Bacteria 13063
50 Ga0058861_11979571 3300004800 Bacteria 1763
51 Ga0058860_10022916 3300004801 Bacteria 2974
52 Ga0065165_1029273 3300005262 Bacteria 1767
53 Ga0065714_10068935 3300005288 Bacteria 4441
54 Ga0065704_10071113 3300005289 Bacteria 13091
55 Ga0065704_10100294 3300005289 Bacteria 2279
56 Ga0065704_10232484 3300005289 Bacteria 1039
57 Ga0065715_10192822 3300005293 Bacteria 1405
58 Ga0065715_10203690 3300005293 Bacteria 1332
59 Ga0065715_10234020 3300005293 Bacteria 1223
60 Ga0070658_10028046 3300005327 Bacteria 4519
61 Ga0070658_10332034 3300005327 Bacteria 1299
62 Ga0070658_10557595 3300005327 Bacteria 992
63 Ga0070683_100005998 3300005329 Bacteria 10179
64 Ga0070683_100472128 3300005329 Bacteria 1198
65 Ga0070690_100087300 3300005330 Bacteria 2048
66 Ga0070690_100113234 3300005330 Bacteria 1813
67 Ga0070690_100503144 3300005330 Bacteria 907
68 Ga0070670_100009626 3300005331 Bacteria 8248
69 Ga0070670_100066391 3300005331 Bacteria 3095
70 Ga0070670_100322590 3300005331 Bacteria 1353
71 Ga0070670_100345019 3300005331 Bacteria 1307
72 Ga0070670_100442210 3300005331 Bacteria 1151
73 Ga0070670_100919229 3300005331 Bacteria 794
74 Ga0070670_101127536 3300005331 Bacteria 716
75 Ga0068869_100051998 3300005334 Bacteria 2973
76 Ga0068869_100126554 3300005334 Bacteria 1960
77 Ga0068869_100185294 3300005334 Bacteria 1633
78 Ga0068869_100272095 3300005334 Bacteria 1359
79 Ga0068869_100618088 3300005334 Bacteria 917
80 Ga0068869_100820176 3300005334 Bacteria 801
81 Ga0068869_100886187 3300005334 Bacteria 771
82 Ga0068869_101334180 3300005334 Bacteria 633
83 Ga0070666_10039068 3300005335 Bacteria 3161
84 Ga0070666_10126568 3300005335 Bacteria 1773
85 Ga0070666_10128706 3300005335 Bacteria 1758
86 Ga0070680_100009233 3300005336 Bacteria 7563
87 Ga0070680_100117602 3300005336 Bacteria 2216
88 Ga0070680_100168471 3300005336 Bacteria 1842
89 Ga0070680_100459420 3300005336 Bacteria 1088
90 Ga0070682_100031523 3300005337 Bacteria 3206
91 Ga0070682_100093827 3300005337 Bacteria 1968
92 Ga0070682_100149406 3300005337 Bacteria 1601
93 Ga0070682_100305205 3300005337 Bacteria 1170
94 Ga0070682_100633926 3300005337 Bacteria 849
95 Ga0068868_100046236 3300005338 Bacteria 3407
96 Ga0068868_100140719 3300005338 Bacteria 1981
97 Ga0068868_100671446 3300005338 Bacteria 924
98 Ga0068868_101147625 3300005338 Bacteria 716
99 Ga0070660_100235475 3300005339 Bacteria 1490
100 Ga0070660_100500606 3300005339 Bacteria 1011
101 Ga0070660_100510198 3300005339 Bacteria 1001
102 Ga0070660_100663788 3300005339 Bacteria 873
103 Ga0070689_100013126 3300005340 Bacteria 5987
104 Ga0070689_100015417 3300005340 Bacteria 5572
105 Ga0070689_100271608 3300005340 Bacteria 1404
106 Ga0070689_100278193 3300005340 Bacteria 1388
107 Ga0070691_10557179 3300005341 Bacteria 671
108 Ga0070687_100132497 3300005343 Bacteria 1441
109 Ga0070661_100041400 3300005344 Bacteria 3362
110 Ga0070661_100043750 3300005344 Bacteria 3271
111 Ga0070661_100132456 3300005344 Bacteria 1873
112 Ga0070661_100188710 3300005344 Bacteria 1571
113 Ga0070661_100242423 3300005344 Bacteria 1388
114 Ga0070661_100683924 3300005344 Bacteria 835
115 Ga0070668_100004499 3300005347 Bacteria 10338
116 Ga0070668_100005082 3300005347 Bacteria 9743
117 Ga0070668_100021079 3300005347 Bacteria 4925
118 Ga0070668_100109540 3300005347 Bacteria 2197
119 Ga0070668_100241825 3300005347 Bacteria 1495
120 Ga0070668_100437102 3300005347 Bacteria 1123
121 Ga0070669_100034453 3300005353 Bacteria 3666
122 Ga0070669_100157626 3300005353 Bacteria 1762
123 Ga0070669_100574888 3300005353 Bacteria 942
124 Ga0070675_100156884 3300005354 Bacteria 1954
125 Ga0070675_100188013 3300005354 Bacteria 1788
126 Ga0070675_100625047 3300005354 Bacteria 978
127 Ga0070671_100019224 3300005355 Bacteria 5558
128 Ga0070671_100024367 3300005355 Bacteria 4953
129 Ga0070671_100080639 3300005355 Bacteria 2721
130 Ga0070671_100264946 3300005355 Bacteria 1460
131 Ga0070671_100642465 3300005355 Bacteria 918
132 Ga0070674_100304962 3300005356 Bacteria 1271
133 Ga0070674_100313065 3300005356 Bacteria 1256
134 Ga0070674_100364718 3300005356 Bacteria 1171
135 Ga0070674_100764365 3300005356 Bacteria 831
136 Ga0070674_101000898 3300005356 Bacteria 733
137 Ga0070674_101052170 3300005356 Bacteria 716
138 Ga0070673_100015167 3300005364 Bacteria 5401
139 Ga0070673_100069532 3300005364 Bacteria 2822
140 Ga0070673_100101289 3300005364 Bacteria 2372
141 Ga0070673_100120687 3300005364 Bacteria 2186
142 Ga0070673_100124144 3300005364 Bacteria 2158
143 Ga0070673_100655023 3300005364 Bacteria 961
144 Ga0070688_100100587 3300005365 Bacteria 1905
145 Ga0070688_100567565 3300005365 Bacteria 865
146 Ga0070659_100054696 3300005366 Bacteria 3144
147 Ga0070659_100214052 3300005366 Bacteria 1588
148 Ga0070667_100000041 3300005367 Bacteria 170008
149 Ga0070667_100019921 3300005367 Bacteria 5566
150 Ga0070667_100048376 3300005367 Bacteria 3579
151 Ga0070667_100052533 3300005367 Bacteria 3439
152 Ga0070667_100129962 3300005367 Bacteria 2197
153 Ga0070667_100169391 3300005367 Bacteria 1927
154 Ga0070667_100185543 3300005367 Bacteria 1841
155 Ga0070667_100246143 3300005367 Bacteria 1597
156 Ga0070667_101037565 3300005367 Bacteria 765
157 Ga0070709_11242304 3300005434 Bacteria 600
158 Ga0070714_100050142 3300005435 Bacteria 3555
159 Ga0070701_10012276 3300005438 Bacteria 3858
160 Ga0070711_100102588 3300005439 Bacteria 2083
161 Ga0070711_100249802 3300005439 Bacteria 1391
162 Ga0070705_100034980 3300005440 Bacteria 2813
163 Ga0070705_100038178 3300005440 Bacteria 2715
164 Ga0070705_100183457 3300005440 Bacteria 1419
165 Ga0070700_100366844 3300005441 Bacteria 1072
166 Ga0070663_100005120 3300005455 Bacteria 7762
167 Ga0070663_100201519 3300005455 Bacteria 1553
168 Ga0070678_100003045 3300005456 Bacteria 9285
169 Ga0070678_100354484 3300005456 Bacteria 1262
170 Ga0070678_100473856 3300005456 Bacteria 1100
171 Ga0070662_100046907 3300005457 Bacteria 3106
172 Ga0070662_100156849 3300005457 Bacteria 1777
173 Ga0070681_10161015 3300005458 Bacteria 2168
174 Ga0070681_10648487 3300005458 Bacteria 971
175 Ga0068867_100054381 3300005459 Bacteria 2958
176 Ga0068867_100100023 3300005459 Bacteria 2213
177 Ga0068867_100131746 3300005459 Bacteria 1944
178 Ga0068867_100166242 3300005459 Bacteria 1743
179 Ga0068867_100292499 3300005459 Bacteria 1340
180 Ga0068867_100408075 3300005459 Bacteria 1147
181 Ga0068867_101339846 3300005459 Bacteria 662
182 Ga0070685_10001821 3300005466 Bacteria 11090
183 Ga0070685_10002255 3300005466 Bacteria 9947
184 Ga0070685_10075272 3300005466 Bacteria 2010
185 Ga0070685_10101298 3300005466 Bacteria 1759
186 Ga0070679_100051814 3300005530 Bacteria 4089
187 Ga0070679_100092348 3300005530 Bacteria 3014
188 Ga0070679_100110859 3300005530 Bacteria 2730
189 Ga0070684_100247020 3300005535 Bacteria 1631
190 Ga0070684_100293550 3300005535 Bacteria 1491
191 Ga0070684_100650158 3300005535 Bacteria 981
192 Ga0068853_100008715 3300005539 Bacteria 8157
193 Ga0068853_100015734 3300005539 Bacteria 6213
194 Ga0068853_100025130 3300005539 Bacteria 4997
195 Ga0068853_100057074 3300005539 Bacteria 3368
196 Ga0068853_100067142 3300005539 Bacteria 3115
197 Ga0068853_100413888 3300005539 Bacteria 1263
198 Ga0068853_101352240 3300005539 Bacteria 689
199 Ga0070672_100003683 3300005543 Bacteria 9963
200 Ga0070672_100029396 3300005543 Bacteria 4120
201 Ga0070672_101057477 3300005543 Bacteria 720
202 Ga0070686_100162059 3300005544 Bacteria 1576
203 Ga0070686_101147146 3300005544 Bacteria 644
204 Ga0070693_100005307 3300005547 Bacteria 6176
205 Ga0070693_100007266 3300005547 Bacteria 5408
206 Ga0070693_100092699 3300005547 Bacteria 1824
207 Ga0070665_100000175 3300005548 Bacteria 113874
208 Ga0070665_100003465 3300005548 Bacteria 16812
209 Ga0070665_100016134 3300005548 Bacteria 7496
210 Ga0070665_100022127 3300005548 Bacteria 6394
211 Ga0070665_100052341 3300005548 Bacteria 4095
212 Ga0070665_100056908 3300005548 Bacteria 3921
213 Ga0070665_100088333 3300005548 Bacteria 3105
214 Ga0070665_100280401 3300005548 Bacteria 1668
215 Ga0070665_100313974 3300005548 Bacteria 1571
216 Ga0070665_100373744 3300005548 Bacteria 1432
217 Ga0070665_100401076 3300005548 Bacteria 1379
218 Ga0070665_100766688 3300005548 Bacteria 978
219 Ga0070704_100096958 3300005549 Bacteria 2212
220 Ga0068855_100015530 3300005563 Bacteria 9167
221 Ga0068855_100171806 3300005563 Bacteria 2454
222 Ga0068855_100185140 3300005563 Bacteria 2352
223 Ga0068855_100186783 3300005563 Bacteria 2340
224 Ga0068855_100547571 3300005563 Bacteria 1253
225 Ga0068855_100718752 3300005563 Bacteria 1067
226 Ga0068855_101410246 3300005563 Bacteria 718
227 Ga0068855_101444303 3300005563 Bacteria 708
228 Ga0070664_100014116 3300005564 Bacteria 6515
229 Ga0070664_100047403 3300005564 Bacteria 3630
230 Ga0070664_100206298 3300005564 Bacteria 1755
231 Ga0070664_100909069 3300005564 Bacteria 825
232 Ga0070664_101227016 3300005564 Bacteria 708
233 Ga0068857_100003667 3300005577 Bacteria 12865
234 Ga0068857_100061917 3300005577 Bacteria 3325
235 Ga0068857_100108711 3300005577 Bacteria 2491
236 Ga0068857_100176336 3300005577 Bacteria 1944
237 Ga0068857_101107039 3300005577 Bacteria 765
238 Ga0068854_100166565 3300005578 Bacteria 1711
239 Ga0068854_100196395 3300005578 Bacteria 1583
240 Ga0068854_100335677 3300005578 Bacteria 1233
241 Ga0068856_100014197 3300005614 Bacteria 7699
242 Ga0068856_100065387 3300005614 Bacteria 3594
243 Ga0068856_100345963 3300005614 Bacteria 1505
244 Ga0068856_100399164 3300005614 Bacteria 1395
245 Ga0070702_100390337 3300005615 Bacteria 992
246 Ga0068852_100064710 3300005616 Bacteria 3188
247 Ga0068852_100212363 3300005616 Bacteria 1836
248 Ga0068852_100328351 3300005616 Bacteria 1488
249 Ga0068852_100335718 3300005616 Bacteria 1472
250 Ga0068852_100373462 3300005616 Bacteria 1397
251 Ga0068852_100392425 3300005616 Bacteria 1364
252 Ga0068852_100601611 3300005616 Bacteria 1104
253 Ga0068852_100703433 3300005616 Bacteria 1021
254 Ga0068852_100727088 3300005616 Bacteria 1004
255 Ga0068859_100000821 3300005617 Bacteria 31644
256 Ga0068859_100047020 3300005617 Bacteria 4334
257 Ga0068859_100077312 3300005617 Bacteria 3369
258 Ga0068859_100100348 3300005617 Bacteria 2950
259 Ga0068859_100295949 3300005617 Bacteria 1712
260 Ga0068859_100469890 3300005617 Bacteria 1353
261 Ga0068864_100043033 3300005618 Bacteria 3866
262 Ga0068864_100100368 3300005618 Bacteria 2565
263 Ga0068864_100182189 3300005618 Bacteria 1921
264 Ga0068864_100410441 3300005618 Bacteria 1288
265 Ga0068864_101208762 3300005618 Bacteria 755
266 Ga0068866_10091532 3300005718 Bacteria 1657
267 Ga0068861_100097092 3300005719 Bacteria 2336
268 Ga0068861_100131242 3300005719 Bacteria 2034
269 Ga0068861_100977739 3300005719 Bacteria 806
270 Ga0068861_101204233 3300005719 Bacteria 732
271 Ga0068861_101298344 3300005719 Bacteria 707
272 Ga0068851_10001861 3300005834 Bacteria 9259
273 Ga0068851_10032527 3300005834 Bacteria 2595
274 Ga0068851_10166835 3300005834 Bacteria 1213
275 Ga0068851_10390735 3300005834 Bacteria 817
276 Ga0068870_10001674 3300005840 Bacteria 9068
277 Ga0068870_10164633 3300005840 Bacteria 1318
278 Ga0068863_100034622 3300005841 Bacteria 4809
279 Ga0068863_100075635 3300005841 Bacteria 3186
280 Ga0068863_100095504 3300005841 Bacteria 2821
281 Ga0068863_100133077 3300005841 Bacteria 2375
282 Ga0068863_100133664 3300005841 Bacteria 2369
283 Ga0068863_100156589 3300005841 Bacteria 2181
284 Ga0068863_100263747 3300005841 Bacteria 1666
285 Ga0068863_100302884 3300005841 Bacteria 1551
286 Ga0068863_100314929 3300005841 Bacteria 1519
287 Ga0068863_100316460 3300005841 Bacteria 1515
288 Ga0068863_100368482 3300005841 Bacteria 1401
289 Ga0068863_100430014 3300005841 Bacteria 1294
290 Ga0068863_101228667 3300005841 Bacteria 755
291 Ga0068858_100120642 3300005842 Bacteria 2452
292 Ga0068858_100189100 3300005842 Bacteria 1945
293 Ga0068858_100243518 3300005842 Bacteria 1707
294 Ga0068858_100282235 3300005842 Bacteria 1581
295 Ga0068860_100055255 3300005843 Bacteria 3774
296 Ga0068860_100071711 3300005843 Bacteria 3291
297 Ga0068860_100074726 3300005843 Bacteria 3223
298 Ga0068860_100094498 3300005843 Bacteria 2850
299 Ga0068860_100196548 3300005843 Bacteria 1953
300 Ga0068860_100248523 3300005843 Bacteria 1731
301 Ga0068860_100950479 3300005843 Bacteria 876
302 Ga0068862_100007184 3300005844 Bacteria 9248
303 Ga0068862_100010918 3300005844 Bacteria 7499
304 Ga0068862_100098243 3300005844 Bacteria 2557
305 Ga0068862_100145559 3300005844 Bacteria 2106
306 Ga0068862_100198509 3300005844 Bacteria 1808
307 Ga0068862_100368143 3300005844 Bacteria 1337
308 Ga0081455_10005678 3300005937 Bacteria 13615
309 Ga0081455_10008699 3300005937 Bacteria 10513
310 Ga0081455_10219098 3300005937 Bacteria 1412
311 Ga0081540_1000720 3300005983 Bacteria 30494
312 Ga0075365_10097727 3300006038 Bacteria 2008
313 Ga0075365_10219488 3300006038 Bacteria 1334
314 Ga0075368_10066230 3300006042 Bacteria 1452
315 Ga0075368_10109359 3300006042 Bacteria 1139
316 Ga0075363_100177225 3300006048 Bacteria 1212
317 Ga0075364_10005109 3300006051 Bacteria 7606
318 Ga0075364_10023952 3300006051 Bacteria 3870
319 Ga0075364_10107669 3300006051 Bacteria 1858
320 Ga0075364_10271566 3300006051 Bacteria 1153
321 Ga0070712_100962528 3300006175 Bacteria 738
322 Ga0075367_10075360 3300006178 Bacteria 2035
323 Ga0075367_10079340 3300006178 Bacteria 1984
324 Ga0075367_10088726 3300006178 Bacteria 1879
325 Ga0075367_10339350 3300006178 Bacteria 948
326 Ga0075369_10001295 3300006186 Bacteria 8496
327 Ga0075366_10007118 3300006195 Bacteria 6159
328 Ga0075366_10284117 3300006195 Bacteria 1011
329 Ga0075366_10560333 3300006195 Bacteria 708
330 Ga0097621_100044846 3300006237 Bacteria 3569
331 Ga0097621_100201163 3300006237 Bacteria 1729
332 Ga0097621_100201179 3300006237 Bacteria 1729
333 Ga0097621_100217295 3300006237 Bacteria 1664
334 Ga0097621_100292058 3300006237 Bacteria 1437
335 Ga0097621_100317375 3300006237 Bacteria 1379
336 Ga0097621_100474772 3300006237 Bacteria 1130
337 Ga0097621_100537699 3300006237 Bacteria 1062
338 Ga0097621_100620308 3300006237 Bacteria 990
339 Ga0068871_100083209 3300006358 Bacteria 2654
340 Ga0068871_100119596 3300006358 Bacteria 2224
341 Ga0068871_100124683 3300006358 Bacteria 2179
342 Ga0068871_100125011 3300006358 Bacteria 2176
343 Ga0068871_100149876 3300006358 Bacteria 1988
344 Ga0068871_100197537 3300006358 Bacteria 1735
345 Ga0068871_100289939 3300006358 Bacteria 1434
346 Ga0068871_100316311 3300006358 Bacteria 1373
347 Ga0068871_100425426 3300006358 Bacteria 1186
348 Ga0068871_100577275 3300006358 Bacteria 1020
349 Ga0068871_100796156 3300006358 Bacteria 871
350 Ga0075428_101428756 3300006844 Bacteria 726
351 Ga0075431_101131372 3300006847 Bacteria 747
352 Ga0075429_100844714 3300006880 Bacteria 802
353 Ga0068865_100010514 3300006881 Bacteria 5763
354 Ga0068865_100021451 3300006881 Bacteria 4200
355 Ga0068865_100043232 3300006881 Bacteria 3077
356 Ga0068865_100091433 3300006881 Bacteria 2208
357 Ga0068865_100111188 3300006881 Bacteria 2021
358 Ga0068865_100331613 3300006881 Bacteria 1227
359 Ga0068865_100463145 3300006881 Bacteria 1050
360 Ga0068865_100581801 3300006881 Bacteria 944
361 Ga0097620_100000821 3300006931 Bacteria 31644
362 Ga0097620_100047018 3300006931 Bacteria 4334
363 Ga0097620_100077315 3300006931 Bacteria 3369
364 Ga0097620_100100349 3300006931 Bacteria 2950
365 Ga0097620_100295946 3300006931 Bacteria 1712
366 Ga0097620_100469899 3300006931 Bacteria 1353
367 Ga0105251_10003747 3300009011 Bacteria 10880
368 Ga0105251_10004901 3300009011 Bacteria 8928
369 Ga0105251_10197764 3300009011 Bacteria 906
370 Ga0105244_10017928 3300009036 Bacteria 3986
371 Ga0105240_10079328 3300009093 Bacteria 4040
372 Ga0105240_10086775 3300009093 Bacteria 3833
373 Ga0105240_10128791 3300009093 Bacteria 3038
374 Ga0105240_10160771 3300009093 Bacteria 2667
375 Ga0105240_10202641 3300009093 Bacteria 2324
376 Ga0105240_10238665 3300009093 Bacteria 2109
377 Ga0105240_10715373 3300009093 Bacteria 1092
378 Ga0111539_10529840 3300009094 Bacteria 1372
379 Ga0111539_11260745 3300009094 Bacteria 858
380 Ga0105245_10179992 3300009098 Bacteria 2019
381 Ga0105245_10484807 3300009098 Bacteria 1250
382 Ga0105245_10522000 3300009098 Bacteria 1206
383 Ga0105245_10605088 3300009098 Bacteria 1123
384 Ga0105245_12192708 3300009098 Bacteria 606
385 Ga0105247_10001324 3300009101 Bacteria 18074
386 Ga0105247_10174964 3300009101 Bacteria 1429
387 Ga0105243_10023664 3300009148 Bacteria 4680
388 Ga0105243_10194189 3300009148 Bacteria 1775
389 Ga0105243_10386395 3300009148 Bacteria 1296
390 Ga0105241_10005273 3300009174 Bacteria 9548
391 Ga0105241_10066619 3300009174 Bacteria 2785
392 Ga0105241_10109453 3300009174 Bacteria 2210
393 Ga0105241_10131531 3300009174 Bacteria 2027
394 Ga0105241_10238080 3300009174 Bacteria 1537
395 Ga0105241_10998717 3300009174 Bacteria 783
396 Ga0105242_10003026 3300009176 Bacteria 13137
397 Ga0105242_10091596 3300009176 Bacteria 2560
398 Ga0105242_10656164 3300009176 Bacteria 1021
399 Ga0105242_10830223 3300009176 Bacteria 918
400 Ga0105248_10001072 3300009177 Bacteria 30268
401 Ga0105248_10123110 3300009177 Bacteria 2926
402 Ga0105248_10199596 3300009177 Bacteria 2254
403 Ga0105248_10208334 3300009177 Bacteria 2203
404 Ga0105248_10293579 3300009177 Bacteria 1830
405 Ga0105248_10364582 3300009177 Bacteria 1627
406 Ga0105248_10429223 3300009177 Bacteria 1488
407 Ga0105248_10579378 3300009177 Bacteria 1266
408 Ga0105237_10001741 3300009545 Bacteria 28104
409 Ga0105237_10068309 3300009545 Bacteria 3548
410 Ga0105237_10114626 3300009545 Bacteria 2688
411 Ga0105237_10191009 3300009545 Bacteria 2048
412 Ga0105237_10196600 3300009545 Bacteria 2016
413 Ga0105237_10323642 3300009545 Bacteria 1546
414 Ga0105237_10552835 3300009545 Bacteria 1158
415 Ga0105237_11472593 3300009545 Bacteria 687
416 Ga0105238_10011245 3300009551 Bacteria 9007
417 Ga0105238_10016928 3300009551 Bacteria 7398
418 Ga0105238_10090969 3300009551 Bacteria 3039
419 Ga0105238_10175046 3300009551 Bacteria 2123
420 Ga0105238_10302652 3300009551 Bacteria 1583
421 Ga0105238_10327654 3300009551 Bacteria 1518
422 Ga0105238_10387569 3300009551 Bacteria 1389
423 Ga0105238_10551670 3300009551 Bacteria 1157
424 Ga0105238_10570893 3300009551 Bacteria 1137
425 Ga0105238_11102043 3300009551 Bacteria 817
426 Ga0105249_10011360 3300009553 Bacteria 7819
427 Ga0105249_10057209 3300009553 Bacteria 3572
428 Ga0105249_10062574 3300009553 Bacteria 3417
429 Ga0105249_10484018 3300009553 Bacteria 1281
430 Ga0105249_11463031 3300009553 Bacteria 755
431 Ga0105249_11813606 3300009553 Bacteria 683
432 Ga0105032_101157 3300009979 Bacteria 2439
433 Ga0105029_100427 3300009984 Bacteria 2249
434 Ga0105239_10003327 3300010375 Bacteria 19782
435 Ga0105239_10016344 3300010375 Bacteria 8207
436 Ga0105239_10018940 3300010375 Bacteria 7607
437 Ga0105239_10020863 3300010375 Bacteria 7229
438 Ga0105239_10042333 3300010375 Bacteria 4991
439 Ga0105239_10055573 3300010375 Bacteria 4342
440 Ga0105239_10120664 3300010375 Bacteria 2911
441 Ga0105239_10143682 3300010375 Bacteria 2660
442 Ga0105239_10149661 3300010375 Bacteria 2605
443 Ga0105239_10154924 3300010375 Bacteria 2559
444 Ga0105239_10189726 3300010375 Bacteria 2301
445 Ga0105239_10200501 3300010375 Bacteria 2235
446 Ga0105239_10238652 3300010375 Bacteria 2040
447 Ga0105239_10757263 3300010375 Bacteria 1112
448 Ga0105239_11378191 3300010375 Bacteria 814
449 Ga0105239_11825833 3300010375 Bacteria 704
450 Ga0105246_10178170 3300011119 Bacteria 1634
451 Ga0105246_10197230 3300011119 Bacteria 1562
452 Ga0157346_1003663 3300012480 Bacteria 871
453 Ga0157318_1000250 3300012482 Bacteria 2118
454 Ga0157318_1003764 3300012482 Bacteria 896
455 Ga0157343_1004258 3300012488 Bacteria 878
456 Ga0157314_1001705 3300012500 Bacteria 1546
457 Ga0157342_1001415 3300012507 Bacteria 1772
458 Ga0157315_1006471 3300012508 Bacteria 917
459 Ga0157316_1000683 3300012510 Bacteria 1864
460 Ga0157316_1004647 3300012510 Bacteria 1051
461 Ga0157373_10080169 3300013100 Bacteria 2302
462 Ga0157373_10245558 3300013100 Bacteria 1266
463 Ga0157373_10259665 3300013100 Bacteria 1229
464 Ga0157373_10352023 3300013100 Bacteria 1051
465 Ga0157373_10367408 3300013100 Bacteria 1028
466 Ga0157373_10394601 3300013100 Bacteria 991
467 Ga0157371_10038945 3300013102 Bacteria 3400
468 Ga0157371_10108905 3300013102 Bacteria 1966
469 Ga0157371_10204654 3300013102 Bacteria 1416
470 Ga0157370_10039480 3300013104 Bacteria 4562
471 Ga0157370_10081384 3300013104 Bacteria 3047
472 Ga0157370_10087152 3300013104 Bacteria 2932
473 Ga0157370_10142708 3300013104 Bacteria 2231
474 Ga0157370_10206127 3300013104 Bacteria 1823
475 Ga0157370_10221701 3300013104 Bacteria 1751
476 Ga0157370_10240141 3300013104 Bacteria 1676
477 Ga0157370_10318935 3300013104 Bacteria 1434
478 Ga0157369_10000125 3300013105 Bacteria 110481
479 Ga0157369_10004613 3300013105 Bacteria 16198
480 Ga0157369_10132341 3300013105 Bacteria 2642
481 Ga0157369_10149485 3300013105 Bacteria 2469
482 Ga0157369_10253792 3300013105 Bacteria 1835
483 Ga0157369_10429424 3300013105 Bacteria 1369
484 Ga0157369_10529157 3300013105 Bacteria 1219
485 Ga0157374_10029479 3300013296 Bacteria 4970
486 Ga0157374_10036326 3300013296 Bacteria 4511
487 Ga0157374_10060988 3300013296 Bacteria 3531
488 Ga0157374_10113252 3300013296 Bacteria 2611
489 Ga0157374_10129052 3300013296 Bacteria 2445
490 Ga0157374_10209599 3300013296 Bacteria 1910
491 Ga0157374_11601822 3300013296 Bacteria 675
492 Ga0157378_10000289 3300013297 Bacteria 49048
493 Ga0157378_10368614 3300013297 Bacteria 1407
494 Ga0157378_10430644 3300013297 Bacteria 1305
495 Ga0157378_10941009 3300013297 Bacteria 896
496 Ga0157378_11082657 3300013297 Bacteria 838
497 Ga0163162_10008705 3300013306 Bacteria 9877
498 Ga0163162_10056316 3300013306 Bacteria 3960
499 Ga0163162_10158528 3300013306 Bacteria 2384
500 Ga0163162_10272283 3300013306 Bacteria 1825
501 Ga0163162_10459335 3300013306 Bacteria 1405
502 Ga0163162_10491825 3300013306 Bacteria 1358
503 Ga0163162_11132640 3300013306 Bacteria 887
504 Ga0163162_12658820 3300013306 Bacteria 576
505 Ga0157372_10009889 3300013307 Bacteria 10145
506 Ga0157372_10070322 3300013307 Bacteria 3937
507 Ga0157372_10099846 3300013307 Bacteria 3311
508 Ga0157372_10364036 3300013307 Bacteria 1685
509 Ga0157372_10488599 3300013307 Bacteria 1435
510 Ga0157372_10549579 3300013307 Bacteria 1346
511 Ga0157372_10990840 3300013307 Bacteria 973
512 Ga0157372_11169011 3300013307 Bacteria 889
513 Ga0157375_10000319 3300013308 Bacteria 43172
514 Ga0157375_10234646 3300013308 Bacteria 1994
515 Ga0157375_10250739 3300013308 Bacteria 1931
516 Ga0157375_10456203 3300013308 Bacteria 1444
517 Ga0157375_10531501 3300013308 Bacteria 1339
518 Ga0163163_10000243 3300014325 Bacteria 55738
519 Ga0163163_10004211 3300014325 Bacteria 12260
520 Ga0163163_10045808 3300014325 Bacteria 4295
521 Ga0163163_10309542 3300014325 Bacteria 1632
522 Ga0163163_10877917 3300014325 Bacteria 960
523 Ga0163163_11428822 3300014325 Bacteria 753
524 Ga0157380_11176081 3300014326 Bacteria 809
525 Ga0157380_11356146 3300014326 Bacteria 760
526 Ga0182008_10003539 3300014497 Bacteria 9385
527 Ga0182008_10007339 3300014497 Bacteria 6095
528 Ga0182008_10039020 3300014497 Bacteria 2374
529 Ga0182008_10105113 3300014497 Bacteria 1397
530 Ga0182008_10638279 3300014497 Bacteria 602
531 Ga0157377_10356871 3300014745 Bacteria 983
532 Ga0157377_10858131 3300014745 Bacteria 675
533 Ga0157379_10010490 3300014968 Bacteria 8076
534 Ga0157379_10037733 3300014968 Bacteria 4309
535 Ga0157379_10655356 3300014968 Bacteria 983
536 Ga0157379_11040273 3300014968 Bacteria 782
537 Ga0157376_10009877 3300014969 Bacteria 6959
538 Ga0157376_10011086 3300014969 Bacteria 6629
539 Ga0157376_10091888 3300014969 Bacteria 2630
540 Ga0157376_10098195 3300014969 Bacteria 2552
541 Ga0157376_10278682 3300014969 Bacteria 1574
542 Ga0157376_10426428 3300014969 Bacteria 1288
543 Ga0157376_11100555 3300014969 Bacteria 820
544 Ga0157376_11310112 3300014969 Bacteria 754
545 Ga0157376_11318156 3300014969 Bacteria 752
546 Ga0182006_1002396 3300015261 Bacteria 10274
547 Ga0182006_1024641 3300015261 Bacteria 2479
548 Ga0182006_1070199 3300015261 Bacteria 1301
549 Ga0182007_10000883 3300015262 Bacteria 16636
550 Ga0182007_10001054 3300015262 Bacteria 15057
551 Ga0182007_10072019 3300015262 Bacteria 1132
552 Ga0182005_1003027 3300015265 Bacteria 5808
553 Ga0182005_1003380 3300015265 Bacteria 5432
554 Ga0182005_1014000 3300015265 Bacteria 2250
555 Ga0182005_1037697 3300015265 Bacteria 1315
556 Ga0183368_1002 3300015687 Bacteria 1865598
557 Ga0183360_10001 3300015689 Bacteria 3943671
558 Ga0163161_10083892 3300017792 Bacteria 2349
559 Ga0163161_10094734 3300017792 Bacteria 2214
560 Ga0163161_10134116 3300017792 Bacteria 1870
561 Ga0163161_10244943 3300017792 Bacteria 1395
562 Ga0163161_10748008 3300017792 Bacteria 818
563 Ga0163161_10762085 3300017792 Bacteria 810
564 Ga0163161_10833961 3300017792 Bacteria 777
565 Ga0206349_1250353 3300020075 Bacteria 5036
566 Ga0206352_10090970 3300020078 Bacteria 962
567 Ga0213872_10000672 3300021361 Bacteria 25868
568 Ga0209435_104191 3300025206 Bacteria 1634
569 Ga0209760_100502 3300025207 Bacteria 8253
570 Ga0209784_100167 3300025224 Bacteria 56563
571 Ga0209566_101978 3300025225 Bacteria 4388
572 Ga0209674_100043 3300025226 Bacteria 369728
573 Ga0209672_101977 3300025228 Bacteria 5753
574 Ga0209672_103115 3300025228 Bacteria 3578
575 Ga0207427_100144 3300025231 Bacteria 82742
576 Ga0209437_100193 3300025233 Bacteria 122027
577 Ga0209437_100256 3300025233 Bacteria 82734
578 Ga0209258_101240 3300025242 Bacteria 9825
579 Ga0207425_1000117 3300025245 Bacteria 74911
580 Ga0209646_1002570 3300025246 Bacteria 3949
581 Ga0209026_1000293 3300025250 Bacteria 55650
582 Ga0209148_1000002 3300025254 Bacteria 2399500
583 Ga0209148_1000010 3300025254 Bacteria 1265567
584 Ga0209759_1002020 3300025256 Bacteria 9629
585 Ga0209759_1013219 3300025256 Bacteria 2245
586 Ga0209129_1000011 3300025258 Bacteria 568657
587 Ga0209129_1003310 3300025258 Bacteria 7112
588 Ga0209233_1000009 3300025261 Bacteria 1265567
589 Ga0209565_1000001 3300025263 Bacteria 2950419
590 Ga0209565_1000415 3300025263 Bacteria 35224
591 Ga0209455_1000086 3300025272 Bacteria 244650
592 Ga0209673_1000001 3300025273 Bacteria 3176258
593 Ga0209673_1000204 3300025273 Bacteria 119618
594 Ga0209130_1012770 3300025284 Bacteria 2179
595 Ga0209675_1000001 3300025291 Bacteria 2950293
596 Ga0209675_1000015 3300025291 Bacteria 403517
597 Ga0209676_1000110 3300025292 Bacteria 214083
598 Ga0209676_1000156 3300025292 Bacteria 163255
599 Ga0209025_1000002 3300025294 Bacteria 1393142
600 Ga0209025_1017430 3300025294 Bacteria 4145
601 Ga0209564_1000001 3300025295 Bacteria 3176258
602 Ga0209564_1000037 3300025295 Bacteria 414794
603 Ga0209758_1000003 3300025297 Bacteria 1398533
604 Ga0209758_1018540 3300025297 Bacteria 3403
605 Ga0209050_1010446 3300025298 Bacteria 4577
606 Ga0209050_1026970 3300025298 Bacteria 1907
607 Ga0209256_1000002 3300025299 Bacteria 1906740
608 Ga0209256_1002932 3300025299 Bacteria 12813
609 Ga0209256_1013162 3300025299 Bacteria 3093
610 Ga0209256_1028523 3300025299 Bacteria 1572
611 Ga0209051_1001513 3300025303 Bacteria 19394
612 Ga0209051_1024620 3300025303 Bacteria 2469
613 Ga0209051_1039458 3300025303 Bacteria 1705
614 Ga0209257_1000129 3300025304 Bacteria 214155
615 Ga0209257_1002665 3300025304 Bacteria 17133
616 Ga0209257_1005259 3300025304 Bacteria 9234
617 Ga0209257_1042061 3300025304 Bacteria 1351
618 Ga0207656_10040929 3300025321 Bacteria 1966
619 Ga0207656_10048920 3300025321 Bacteria 1822
620 Ga0207656_10084250 3300025321 Bacteria 1434
621 Ga0207655_1014195 3300025728 Bacteria 4519
622 Ga0207713_1000294 3300025735 Bacteria 57476
623 Ga0207713_1004451 3300025735 Bacteria 9073
624 Ga0207682_10077687 3300025893 Bacteria 1417
625 Ga0207642_10421197 3300025899 Bacteria 803
626 Ga0207642_10453907 3300025899 Bacteria 777
627 Ga0207710_10032773 3300025900 Bacteria 2277
628 Ga0207688_10210242 3300025901 Bacteria 1169
629 Ga0207680_10001411 3300025903 Bacteria 11370
630 Ga0207680_10191216 3300025903 Bacteria 1389
631 Ga0207680_10191365 3300025903 Bacteria 1389
632 Ga0207680_10193240 3300025903 Bacteria 1383
633 Ga0207647_10000287 3300025904 Bacteria 41379
634 Ga0207647_10005585 3300025904 Bacteria 9197
635 Ga0207647_10066967 3300025904 Bacteria 2177
636 Ga0207647_10172186 3300025904 Bacteria 1260
637 Ga0207699_10078220 3300025906 Bacteria 2043
638 Ga0207645_10015068 3300025907 Bacteria 5149
639 Ga0207645_10015789 3300025907 Bacteria 5006
640 Ga0207645_10027678 3300025907 Bacteria 3659
641 Ga0207645_10346081 3300025907 Bacteria 994
642 Ga0207643_10002762 3300025908 Bacteria 9490
643 Ga0207654_10001703 3300025911 Bacteria 11472
644 Ga0207654_10015953 3300025911 Bacteria 3907
645 Ga0207654_10127096 3300025911 Bacteria 1609
646 Ga0207654_10279526 3300025911 Bacteria 1129
647 Ga0207654_10426440 3300025911 Bacteria 926
648 Ga0207707_10145441 3300025912 Bacteria 2072
649 Ga0207707_10477161 3300025912 Bacteria 1065
650 Ga0207695_10000032 3300025913 Bacteria 521283
651 Ga0207695_10000818 3300025913 Bacteria 57675
652 Ga0207695_10007681 3300025913 Bacteria 13658
653 Ga0207695_10125253 3300025913 Bacteria 2532
654 Ga0207695_10140705 3300025913 Bacteria 2362
655 Ga0207671_10002946 3300025914 Bacteria 17539
656 Ga0207671_10010858 3300025914 Bacteria 7471
657 Ga0207671_10033838 3300025914 Bacteria 3801
658 Ga0207671_10043174 3300025914 Bacteria 3334
659 Ga0207671_10096565 3300025914 Bacteria 2233
660 Ga0207671_10139503 3300025914 Bacteria 1867
661 Ga0207671_10707905 3300025914 Bacteria 801
662 Ga0207663_10030730 3300025916 Bacteria 3171
663 Ga0207663_10208351 3300025916 Bacteria 1415
664 Ga0207660_10078084 3300025917 Bacteria 2425
665 Ga0207660_10224211 3300025917 Bacteria 1476
666 Ga0207662_10036401 3300025918 Bacteria 2876
667 Ga0207657_10006384 3300025919 Bacteria 12243
668 Ga0207657_10006666 3300025919 Bacteria 11947
669 Ga0207657_10218405 3300025919 Bacteria 1528
670 Ga0207657_10621398 3300025919 Bacteria 842
671 Ga0207649_10011159 3300025920 Bacteria 4946
672 Ga0207649_10064309 3300025920 Bacteria 2319
673 Ga0207649_10183146 3300025920 Bacteria 1467
674 Ga0207649_10351279 3300025920 Bacteria 1091
675 Ga0207649_10372255 3300025920 Bacteria 1063
676 Ga0207649_10386034 3300025920 Bacteria 1045
677 Ga0207649_10499779 3300025920 Bacteria 925
678 Ga0207652_10082620 3300025921 Bacteria 2811
679 Ga0207652_10088092 3300025921 Bacteria 2723
680 Ga0207652_11231777 3300025921 Bacteria 650
681 Ga0207681_10019048 3300025923 Bacteria 4332
682 Ga0207681_10040667 3300025923 Bacteria 3095
683 Ga0207681_10063718 3300025923 Bacteria 2543
684 Ga0207681_10071603 3300025923 Bacteria 2418
685 Ga0207681_11074458 3300025923 Bacteria 676
686 Ga0207694_10002856 3300025924 Bacteria 13931
687 Ga0207694_10007300 3300025924 Bacteria 8385
688 Ga0207694_10191145 3300025924 Bacteria 1663
689 Ga0207694_10235479 3300025924 Bacteria 1496
690 Ga0207694_10673340 3300025924 Bacteria 872
691 Ga0207694_10816024 3300025924 Bacteria 788
692 Ga0207650_10004000 3300025925 Bacteria 10085
693 Ga0207650_10054455 3300025925 Bacteria 2967
694 Ga0207650_10058608 3300025925 Bacteria 2867
695 Ga0207650_10159979 3300025925 Bacteria 1784
696 Ga0207650_10221148 3300025925 Bacteria 1524
697 Ga0207650_10232422 3300025925 Bacteria 1487
698 Ga0207650_10287109 3300025925 Bacteria 1341
699 Ga0207650_10647117 3300025925 Bacteria 891
700 Ga0207650_10766846 3300025925 Bacteria 817
701 Ga0207650_10942844 3300025925 Bacteria 733
702 Ga0207659_10313018 3300025926 Bacteria 1293
703 Ga0207659_11007108 3300025926 Bacteria 717
704 Ga0207687_10303682 3300025927 Bacteria 1286
705 Ga0207687_10384998 3300025927 Bacteria 1150
706 Ga0207664_10163325 3300025929 Bacteria 1901
707 Ga0207644_10004894 3300025931 Bacteria 8728
708 Ga0207644_10039738 3300025931 Bacteria 3322
709 Ga0207644_10073408 3300025931 Bacteria 2508
710 Ga0207690_10189815 3300025932 Bacteria 1553
711 Ga0207690_10777465 3300025932 Bacteria 790
712 Ga0207706_10111217 3300025933 Bacteria 2410
713 Ga0207706_10180634 3300025933 Bacteria 1853
714 Ga0207706_10645938 3300025933 Bacteria 906
715 Ga0207686_10025532 3300025934 Bacteria 3437
716 Ga0207686_10072816 3300025934 Bacteria 2215
717 Ga0207686_10231745 3300025934 Bacteria 1339
718 Ga0207686_10638517 3300025934 Bacteria 841
719 Ga0207709_10012784 3300025935 Bacteria 4629
720 Ga0207709_10273035 3300025935 Bacteria 1245
721 Ga0207670_10008334 3300025936 Bacteria 5845
722 Ga0207670_10600580 3300025936 Bacteria 904
723 Ga0207669_10068174 3300025937 Bacteria 2220
724 Ga0207669_10093241 3300025937 Bacteria 1967
725 Ga0207669_10115623 3300025937 Bacteria 1809
726 Ga0207669_10273837 3300025937 Bacteria 1269
727 Ga0207669_11058137 3300025937 Bacteria 684
728 Ga0207704_10014528 3300025938 Bacteria 3978
729 Ga0207704_10434786 3300025938 Bacteria 1044
730 Ga0207704_10435295 3300025938 Bacteria 1043
731 Ga0207704_10509913 3300025938 Bacteria 971
732 Ga0207704_10596041 3300025938 Bacteria 904
733 Ga0207704_10697062 3300025938 Bacteria 840
734 Ga0207691_10022829 3300025940 Bacteria 5898
735 Ga0207691_10049133 3300025940 Bacteria 3865
736 Ga0207691_10104939 3300025940 Bacteria 2518
737 Ga0207691_10216133 3300025940 Bacteria 1663
738 Ga0207691_10242604 3300025940 Bacteria 1557
739 Ga0207711_10000272 3300025941 Bacteria 55799
740 Ga0207711_10134873 3300025941 Bacteria 2216
741 Ga0207711_10137508 3300025941 Bacteria 2195
742 Ga0207711_10347201 3300025941 Bacteria 1374
743 Ga0207711_10377945 3300025941 Bacteria 1314
744 Ga0207711_10619696 3300025941 Bacteria 1010
745 Ga0207711_11046483 3300025941 Bacteria 756
746 Ga0207711_11551853 3300025941 Bacteria 605
747 Ga0207689_10071888 3300025942 Bacteria 2842
748 Ga0207689_10884372 3300025942 Bacteria 754
749 Ga0207689_11139053 3300025942 Bacteria 657
750 Ga0207661_10084038 3300025944 Bacteria 2635
751 Ga0207661_10611615 3300025944 Bacteria 1001
752 Ga0207661_10646984 3300025944 Bacteria 971
753 Ga0207661_10872355 3300025944 Bacteria 829
754 Ga0207679_10517079 3300025945 Bacteria 1067
755 Ga0207679_10765066 3300025945 Bacteria 879
756 Ga0207679_11012493 3300025945 Bacteria 761
757 Ga0207667_10020508 3300025949 Bacteria 7348
758 Ga0207667_10050717 3300025949 Bacteria 4377
759 Ga0207667_10139378 3300025949 Bacteria 2497
760 Ga0207667_10139893 3300025949 Bacteria 2492
761 Ga0207667_10240327 3300025949 Bacteria 1853
762 Ga0207667_10610072 3300025949 Bacteria 1100
763 Ga0207651_10025701 3300025960 Bacteria 3665
764 Ga0207651_10049602 3300025960 Bacteria 2845
765 Ga0207651_10056314 3300025960 Bacteria 2705
766 Ga0207651_10352293 3300025960 Bacteria 1240
767 Ga0207651_10943476 3300025960 Bacteria 769
768 Ga0207712_10003232 3300025961 Bacteria 10354
769 Ga0207712_10035515 3300025961 Bacteria 3387
770 Ga0207712_10123444 3300025961 Bacteria 1963
771 Ga0207712_10407343 3300025961 Bacteria 1144
772 Ga0207668_10004407 3300025972 Bacteria 8268
773 Ga0207668_10008346 3300025972 Bacteria 6168
774 Ga0207668_10014483 3300025972 Bacteria 4881
775 Ga0207668_10022453 3300025972 Bacteria 4040
776 Ga0207668_10289715 3300025972 Bacteria 1346
777 Ga0207668_10835325 3300025972 Bacteria 817
778 Ga0207668_10938069 3300025972 Bacteria 771
779 Ga0207640_10118504 3300025981 Bacteria 1891
780 Ga0207640_10197310 3300025981 Bacteria 1522
781 Ga0207640_10418540 3300025981 Bacteria 1096
782 Ga0207640_10498702 3300025981 Bacteria 1013
783 Ga0207658_10000028 3300025986 Bacteria 174550
784 Ga0207658_10108411 3300025986 Bacteria 2190
785 Ga0207658_10130366 3300025986 Bacteria 2019
786 Ga0207658_10148872 3300025986 Bacteria 1904
787 Ga0207658_10151207 3300025986 Bacteria 1891
788 Ga0207658_10353963 3300025986 Bacteria 1279
789 Ga0207658_10631166 3300025986 Bacteria 964
790 Ga0207658_10716012 3300025986 Bacteria 905
791 Ga0207658_10900631 3300025986 Bacteria 805
792 Ga0207677_10151396 3300026023 Bacteria 1790
793 Ga0207677_10290892 3300026023 Bacteria 1345
794 Ga0207677_10740140 3300026023 Bacteria 875
795 Ga0207703_10020068 3300026035 Bacteria 5223
796 Ga0207703_10177951 3300026035 Bacteria 1875
797 Ga0207703_10199434 3300026035 Bacteria 1778
798 Ga0207703_10203487 3300026035 Bacteria 1760
799 Ga0207703_10787636 3300026035 Bacteria 907
800 Ga0207703_11000081 3300026035 Bacteria 802
801 Ga0207703_11057049 3300026035 Bacteria 779
802 Ga0207639_10000901 3300026041 Bacteria 20110
803 Ga0207639_10000916 3300026041 Bacteria 19977
804 Ga0207639_10001149 3300026041 Bacteria 18005
805 Ga0207639_10048697 3300026041 Bacteria 3209
806 Ga0207639_10086982 3300026041 Bacteria 2490
807 Ga0207639_10137617 3300026041 Bacteria 2030
808 Ga0207639_10141337 3300026041 Bacteria 2006
809 Ga0207639_10222763 3300026041 Bacteria 1630
810 Ga0207639_10298455 3300026041 Bacteria 1423
811 Ga0207639_10523341 3300026041 Bacteria 1086
812 Ga0207639_10648817 3300026041 Bacteria 976
813 Ga0207678_10082301 3300026067 Bacteria 2754
814 Ga0207678_10108467 3300026067 Bacteria 2368
815 Ga0207678_10133286 3300026067 Bacteria 2120
816 Ga0207678_10230487 3300026067 Bacteria 1586
817 Ga0207678_10654881 3300026067 Bacteria 923
818 Ga0207708_10036414 3300026075 Bacteria 3746
819 Ga0207708_10210046 3300026075 Bacteria 1556
820 Ga0207708_10642775 3300026075 Bacteria 902
821 Ga0207708_10922123 3300026075 Bacteria 757
822 Ga0207702_10004420 3300026078 Bacteria 12499
823 Ga0207702_10035143 3300026078 Bacteria 4190
824 Ga0207702_10183528 3300026078 Bacteria 1928
825 Ga0207702_10197120 3300026078 Bacteria 1864
826 Ga0207702_10308339 3300026078 Bacteria 1504
827 Ga0207702_10524843 3300026078 Bacteria 1156
828 Ga0207641_10009230 3300026088 Bacteria 8134
829 Ga0207641_10043452 3300026088 Bacteria 3774
830 Ga0207641_10052864 3300026088 Bacteria 3441
831 Ga0207641_10069802 3300026088 Bacteria 3018
832 Ga0207641_10092132 3300026088 Bacteria 2654
833 Ga0207641_10103130 3300026088 Bacteria 2516
834 Ga0207641_10106203 3300026088 Bacteria 2481
835 Ga0207641_10144239 3300026088 Bacteria 2151
836 Ga0207641_10360433 3300026088 Bacteria 1388
837 Ga0207641_10409168 3300026088 Bacteria 1304
838 Ga0207641_10590788 3300026088 Bacteria 1086
839 Ga0207648_10019320 3300026089 Bacteria 6150
840 Ga0207648_10027626 3300026089 Bacteria 5037
841 Ga0207648_10200666 3300026089 Bacteria 1769
842 Ga0207648_10257059 3300026089 Bacteria 1558
843 Ga0207648_10379894 3300026089 Bacteria 1277
844 Ga0207676_10035173 3300026095 Bacteria 3799
845 Ga0207676_10035413 3300026095 Bacteria 3788
846 Ga0207676_10038749 3300026095 Bacteria 3640
847 Ga0207676_10191906 3300026095 Bacteria 1798
848 Ga0207676_10247505 3300026095 Bacteria 1603
849 Ga0207676_10546143 3300026095 Bacteria 1106
850 Ga0207676_10680064 3300026095 Bacteria 995
851 Ga0207674_10001554 3300026116 Bacteria 29587
852 Ga0207674_10020002 3300026116 Bacteria 7244
853 Ga0207674_10214578 3300026116 Bacteria 1873
854 Ga0207674_10223223 3300026116 Bacteria 1832
855 Ga0207674_10522194 3300026116 Bacteria 1147
856 Ga0207674_10645375 3300026116 Bacteria 1022
857 Ga0207675_100041536 3300026118 Bacteria 4295
858 Ga0207675_100142749 3300026118 Bacteria 2275
859 Ga0207675_100207937 3300026118 Bacteria 1881
860 Ga0207675_100264070 3300026118 Bacteria 1669
861 Ga0207675_100375270 3300026118 Bacteria 1398
862 Ga0207683_10022992 3300026121 Bacteria 5358
863 Ga0207683_10141534 3300026121 Bacteria 2168
864 Ga0207683_10228474 3300026121 Bacteria 1697
865 Ga0207683_11062979 3300026121 Bacteria 751
866 Ga0207683_11072706 3300026121 Bacteria 747
867 Ga0207683_11123922 3300026121 Bacteria 729
868 Ga0207683_11322595 3300026121 Bacteria 667
869 Ga0207698_10016127 3300026142 Bacteria 5026
870 Ga0207698_10071100 3300026142 Bacteria 2760
871 Ga0207698_10220186 3300026142 Bacteria 1715
872 Ga0207698_10244818 3300026142 Bacteria 1637
873 Ga0207698_10287818 3300026142 Bacteria 1523
874 Ga0207698_10345373 3300026142 Bacteria 1403
875 Ga0207698_10731999 3300026142 Bacteria 986
876 Ga0209973_1030038 3300027252 Bacteria 762
877 Ga0209371_1000004 3300027312 Bacteria 1098197
878 Ga0209371_1000294 3300027312 Bacteria 56307
879 Ga0209969_1000299 3300027360 Bacteria 6621
880 Ga0209967_1001629 3300027364 Bacteria 2885
881 Ga0209981_1002456 3300027378 Bacteria 2364
882 Ga0209981_1027816 3300027378 Bacteria 824
883 Ga0210000_1002592 3300027462 Bacteria 2577
884 Ga0209999_1000336 3300027543 Bacteria 7061
885 Ga0209982_1000032 3300027552 Bacteria 12541
886 Ga0209970_1000770 3300027614 Bacteria 5599
887 Ga0210002_1015401 3300027617 Bacteria 1204
888 Ga0209983_1000295 3300027665 Bacteria 10386
889 Ga0209971_1000410 3300027682 Bacteria 11534
890 Ga0209813_10088547 3300027866 Bacteria 1035
891 Ga0209974_10005623 3300027876 Bacteria 4400
892 Ga0209974_10102993 3300027876 Bacteria 999
893 Ga0268266_10000001 3300028379 Bacteria 4040580
894 Ga0268266_10012447 3300028379 Bacteria 7353
895 Ga0268266_10013518 3300028379 Bacteria 7028
896 Ga0268266_10015947 3300028379 Bacteria 6428
897 Ga0268266_10082273 3300028379 Bacteria 2808
898 Ga0268266_10091837 3300028379 Bacteria 2663
899 Ga0268266_10262814 3300028379 Bacteria 1600
900 Ga0268266_10392653 3300028379 Bacteria 1310
901 Ga0268266_10538686 3300028379 Bacteria 1117
902 Ga0268266_11008536 3300028379 Bacteria 805
903 Ga0268266_11142849 3300028379 Bacteria 753
904 Ga0268265_10000444 3300028380 Bacteria 43696
905 Ga0268265_10134808 3300028380 Bacteria 2058
906 Ga0268265_10144177 3300028380 Bacteria 1998
907 Ga0268265_10288108 3300028380 Bacteria 1473
908 Ga0268265_10430344 3300028380 Bacteria 1228
909 Ga0268265_10433464 3300028380 Bacteria 1223
910 Ga0268265_10745987 3300028380 Bacteria 950
911 Ga0268265_11365613 3300028380 Bacteria 710
912 Ga0268264_10008596 3300028381 Bacteria 8483
913 Ga0268264_10027927 3300028381 Bacteria 4613
914 Ga0268264_10045943 3300028381 Bacteria 3627
915 Ga0268264_10090304 3300028381 Bacteria 2640
916 Ga0268264_10134912 3300028381 Bacteria 2193
917 Ga0268264_10194786 3300028381 Bacteria 1850
918 Ga0268264_10200295 3300028381 Bacteria 1826
919 Ga0268264_11202568 3300028381 Bacteria 767
920 Ga0307517_10106007 3300028786 Bacteria 2177
921 Ga0307517_10444953 3300028786 Bacteria 673
922 Ga0307515_10283273 3300028794 Bacteria 1362
923 Ga0265338_10362361 3300028800 Bacteria 1040
924 Ga0268256_1000005 3300030500 Bacteria 1082342
925 Ga0268256_1000258 3300030500 Bacteria 56249
926 Ga0316177_1141886 3300030731 Bacteria 1249
927 Ga0314311_1167649 3300030733 Bacteria 6487
928 Ga0316180_1166273 3300030736 Bacteria 868
929 Ga0316183_1180277 3300030742 Bacteria 5731
930 Ga0316182_1171684 3300030745 Bacteria 688
931 Ga0265766_1001654 3300030863 Bacteria 1153
932 Ga0265328_10031723 3300031239 Bacteria 1963
933 Ga0265325_10126063 3300031241 Bacteria 1230
934 Ga0265340_10010398 3300031247 Bacteria 4978
935 Ga0265340_10035092 3300031247 Bacteria 2491
936 Ga0265339_10002105 3300031249 Bacteria 14517
937 Ga0265331_10134070 3300031250 Bacteria 1129
938 Ga0307513_10007825 3300031456 Bacteria 13780
939 Ga0307513_10058418 3300031456 Bacteria 4100
940 Ga0307513_10097095 3300031456 Bacteria 2982
941 Ga0307513_10098847 3300031456 Bacteria 2948
942 Ga0307513_10262845 3300031456 Bacteria 1514
943 Ga0307509_10091388 3300031507 Bacteria 3115
944 Ga0307408_100101410 3300031548 Bacteria 2194
945 Ga0307408_100186366 3300031548 Bacteria 1668
946 Ga0307408_101518893 3300031548 Bacteria 634
947 Ga0265313_10000031 3300031595 Bacteria 128981
948 Ga0265313_10025985 3300031595 Bacteria 3093
949 Ga0265313_10049622 3300031595 Bacteria 2018
950 Ga0307508_10168909 3300031616 Bacteria 1791
951 Ga0307508_10226410 3300031616 Bacteria 1469
952 Ga0307508_10461006 3300031616 Bacteria 864
953 Ga0307514_10104256 3300031649 Bacteria 2029
954 Ga0316575_10007064 3300031665 Bacteria 4062
955 Ga0316575_10022019 3300031665 Bacteria 2457
956 Ga0316579_10000104 3300031691 Bacteria 22526
957 Ga0316579_10021848 3300031691 Bacteria 2856
958 Ga0265342_10002950 3300031712 Bacteria 14314
959 Ga0316576_10000067 3300031727 Bacteria 34602
960 Ga0316576_10012044 3300031727 Bacteria 5699
961 Ga0316576_10042328 3300031727 Bacteria 3282
962 Ga0316576_10073603 3300031727 Bacteria 2524
963 Ga0316576_10108522 3300031727 Bacteria 2079
964 Ga0316576_10140454 3300031727 Bacteria 1818
965 Ga0316576_10401515 3300031727 Bacteria 1016
966 Ga0316578_10000046 3300031728 Bacteria 25015
967 Ga0316578_10000445 3300031728 Bacteria 13704
968 Ga0316578_10006563 3300031728 Bacteria 5757
969 Ga0316578_10033675 3300031728 Bacteria 2937
970 Ga0316578_10094728 3300031728 Bacteria 1786
971 Ga0307516_10019611 3300031730 Bacteria 7000
972 Ga0307405_10122558 3300031731 Bacteria 1781
973 Ga0307405_10155277 3300031731 Bacteria 1614
974 Ga0307405_10205900 3300031731 Bacteria 1432
975 Ga0307405_10436031 3300031731 Bacteria 1035
976 Ga0307405_10729647 3300031731 Bacteria 823
977 Ga0316577_10001071 3300031733 Bacteria 12388
978 Ga0316577_10001498 3300031733 Bacteria 11066
979 Ga0316577_10128000 3300031733 Bacteria 1429
980 Ga0307413_10001429 3300031824 Bacteria 9034
981 Ga0307413_10035769 3300031824 Bacteria 2852
982 Ga0307413_10125812 3300031824 Bacteria 1745
983 Ga0307413_10414448 3300031824 Bacteria 1059
984 Ga0307413_10435631 3300031824 Bacteria 1036
985 Ga0307410_10002645 3300031852 Bacteria 8733
986 Ga0307410_10006977 3300031852 Bacteria 6149
987 Ga0307410_11065142 3300031852 Bacteria 700
988 Ga0307410_11071849 3300031852 Bacteria 697
989 Ga0307406_10054966 3300031901 Bacteria 2543
990 Ga0307406_10156537 3300031901 Bacteria 1632
991 Ga0307406_10439795 3300031901 Bacteria 1043
992 Ga0307406_10641910 3300031901 Bacteria 880
993 Ga0307407_10006994 3300031903 Bacteria 5072
994 Ga0307407_10007323 3300031903 Bacteria 4990
995 Ga0307407_10054255 3300031903 Bacteria 2310
996 Ga0307407_10443898 3300031903 Bacteria 940
997 Ga0307407_10687430 3300031903 Bacteria 769
998 Ga0307412_10113655 3300031911 Bacteria 1937
999 Ga0307412_10131943 3300031911 Bacteria 1816
1000 Ga0307412_10174216 3300031911 Bacteria 1611
1001 Ga0307412_10275217 3300031911 Bacteria 1319
1002 Ga0307412_10446504 3300031911 Bacteria 1064
1003 Ga0307409_100018987 3300031995 Bacteria 4642
1004 Ga0307409_100034200 3300031995 Bacteria 3708
1005 Ga0307409_100112232 3300031995 Bacteria 2288
1006 Ga0307416_100050392 3300032002 Bacteria 3318
1007 Ga0307416_100059572 3300032002 Bacteria 3103
1008 Ga0307416_100134698 3300032002 Bacteria 2232
1009 Ga0307416_100492320 3300032002 Bacteria 1288
1010 Ga0307416_101448975 3300032002 Bacteria 792
1011 Ga0307416_102066744 3300032002 Bacteria 672
1012 Ga0307414_10002120 3300032004 Bacteria 10346
1013 Ga0307414_10007043 3300032004 Bacteria 6304
1014 Ga0307414_10037722 3300032004 Bacteria 3238
1015 Ga0307414_10073519 3300032004 Bacteria 2473
1016 Ga0307414_10117431 3300032004 Bacteria 2038
1017 Ga0307414_10179544 3300032004 Bacteria 1701
1018 Ga0307414_10225388 3300032004 Bacteria 1541
1019 Ga0307414_10269547 3300032004 Bacteria 1425
1020 Ga0307414_10325115 3300032004 Bacteria 1310
1021 Ga0307414_10425080 3300032004 Bacteria 1159
1022 Ga0307414_10851907 3300032004 Bacteria 833
1023 Ga0307414_11658556 3300032004 Bacteria 596
1024 Ga0307411_10001998 3300032005 Bacteria 8755
1025 Ga0307411_10034772 3300032005 Bacteria 3139
1026 Ga0307411_10038180 3300032005 Bacteria 3026
1027 Ga0307411_10040313 3300032005 Bacteria 2961
1028 Ga0307411_10372223 3300032005 Bacteria 1172
1029 Ga0307411_10377004 3300032005 Bacteria 1165
1030 Ga0307411_10739631 3300032005 Bacteria 860
1031 Ga0307415_100210379 3300032126 Bacteria 1551
1032 Ga0307415_100239312 3300032126 Bacteria 1467
1033 Ga0307415_100278380 3300032126 Bacteria 1374
1034 Ga0307415_100710509 3300032126 Bacteria 908
1035 Ga0307415_100773268 3300032126 Bacteria 874
1036 Ga0316583_10117150 3300032133 Bacteria 929
1037 Ga0316585_10000029 3300032137 Bacteria 21513
1038 Ga0316580_10000016 3300032139 Bacteria 26098
1039 Ga0316580_10001102 3300032139 Bacteria 6814
1040 Ga0316580_10002227 3300032139 Bacteria 5295
1041 Ga0316593_10000041 3300032168 Bacteria 14110
1042 Ga0316593_10000198 3300032168 Bacteria 9333
1043 Ga0316593_10000239 3300032168 Bacteria 8907
1044 Ga0316593_10000257 3300032168 Bacteria 8797
1045 Ga0316593_10000468 3300032168 Bacteria 7436
1046 Ga0316593_10000658 3300032168 Bacteria 6651
1047 Ga0316593_10004460 3300032168 Bacteria 3596
1048 Ga0316593_10009756 3300032168 Bacteria 2725
1049 Ga0316593_10036241 3300032168 Bacteria 1626
1050 Ga0316593_10036917 3300032168 Bacteria 1613
1051 Ga0316593_10038722 3300032168 Bacteria 1579
1052 Ga0316593_10042380 3300032168 Bacteria 1518
1053 Ga0316593_10044635 3300032168 Bacteria 1484
1054 Ga0316593_10092358 3300032168 Bacteria 1067
1055 Ga0316593_10095073 3300032168 Bacteria 1052
1056 Ga0307507_10039101 3300033179 Bacteria 4794
1057 Ga0316592_1000041 3300033524 Bacteria 10240
1058 Ga0316592_1000052 3300033524 Bacteria 9955
1059 Ga0316592_1000138 3300033524 Bacteria 8013
1060 Ga0316592_1001786 3300033524 Bacteria 3582
1061 Ga0316592_1006701 3300033524 Bacteria 2228
1062 Ga0316592_1071308 3300033524 Bacteria 785
1063 Ga0316586_1000334 3300033527 Bacteria 4367
1064 Ga0316586_1003233 3300033527 Bacteria 2119
1065 Ga0316586_1013069 3300033527 Bacteria 1295
1066 Ga0316586_1016855 3300033527 Bacteria 1175
1067 Ga0316588_1000073 3300033528 Bacteria 8863
1068 Ga0316588_1000187 3300033528 Bacteria 7035
1069 Ga0316588_1005083 3300033528 Bacteria 2537
1070 Ga0316587_1003230 3300033529 Bacteria 2267
1071 Ga0316596_1000014 3300033541 Bacteria 16366
1072 Ga0316596_1000038 3300033541 Bacteria 13809
1073 Ga0316596_1016205 3300033541 Bacteria 1865
1074 Ga0316596_1031171 3300033541 Bacteria 1384
1075 Ga0316596_1049180 3300033541 Bacteria 1115
1076 Ga0316596_1084777 3300033541 Bacteria 852
1077 Ga0316596_1170617 3300033541 Bacteria 600
1078 Ga0373958_0003362 3300034819 Bacteria 2301
1079 Ga0373926_0045218 3300035083 Bacteria 1578
1080 Ga0373944_0101215 3300035089 Bacteria 974
1081 Ga0373936_0123083 3300035113 Bacteria 1110
1082 Ga0373936_0245409 3300035113 Bacteria 799
1083 Ga0373941_0119753 3300035115 Bacteria 937
1084 Ga0373953_0207512 3300035117 Bacteria 848
1085 Ga0373954_0675266 3300035118 Bacteria 512
1086 Ga0373956_0085842 3300035119 Bacteria 1448
1087 Ga0373956_0359667 3300035119 Bacteria 694
1088 Ga0373957_0044948 3300035120 Bacteria 1672
1089 Ga0373957_0074900 3300035120 Bacteria 1329
1090 Ga0373943_0006870 3300035170 Bacteria 5105
1091 Ga0373943_0457818 3300035170 Bacteria 742
1092 Ga0373946_0057466 3300035171 Bacteria 1646
1093 Ga0373955_0018160 3300035172 Bacteria 3494
1094 Ga0373961_0309321 3300035241 Bacteria 587
1095 Ga0316574_0000016 3300035398 Bacteria 41302
1096 Ga0316574_0003365 3300035398 Bacteria 8235
1097 Ga0316574_0044745 3300035398 Bacteria 2739
1098 Ga0316574_0168517 3300035398 Bacteria 1410
1099 Ga0316574_0396457 3300035398 Bacteria 869
1100 Ga0373924_0114764 3300035410 Bacteria 1166
1101 Ga0373931_0473241 3300035691 Bacteria 804
1102 Ga0373931_0574466 3300035691 Bacteria 735
1103 Ga0373927_0003573 3300035695 Bacteria 11101
1104 Ga0373933_0255306 3300035724 Bacteria 1129
1105 Ga0373933_0468974 3300035724 Bacteria 824
1106 Ga0373947_0269760 3300035725 Bacteria 1129
1107 Ga0373947_0639671 3300035725 Bacteria 725
1108 Ga0373937_0065988 3300036401 Bacteria 3332
1109 Ga0373937_0120811 3300036401 Bacteria 2441
1110 Ga0316582_0000015 3300036647 Bacteria 41441
1111 Ga0316582_0003997 3300036647 Bacteria 7369
1112 Ga0316582_0084010 3300036647 Bacteria 2084
1113 Ga0316582_0124550 3300036647 Bacteria 1727
1114 Ga0316584_0000487 3300036712 Bacteria 20931
1115 Ga0316584_0001578 3300036712 Bacteria 13834
1116 Ga0316584_0046995 3300036712 Bacteria 3224
1117 Ga0373925_0089443 3300037068 Bacteria 2352
1118 Ga0373925_0145852 3300037068 Bacteria 1856
1119 Ga0373925_0377381 3300037068 Bacteria 1154
1120 Ga0395899_0035628 3300037312 Bacteria 3735
1121 Ga0395899_0212745 3300037312 Bacteria 1343
1122 Ga0395899_0376508 3300037312 Bacteria 944
1123 Ga0395900_0143919 3300037418 Bacteria 2439
1124 Ga0395900_1137513 3300037418 Bacteria 697
1125 Ga0395898_0107583 3300037466 Bacteria 2674
1126 Ga0395898_0221184 3300037466 Bacteria 1806
1127 Ga0395898_0340453 3300037466 Bacteria 1430
1128 Ga0395905_0116800 3300037471 Bacteria 2507
1129 Ga0395905_0120737 3300037471 Bacteria 2463
1130 Ga0395901_0043833 3300038443 Bacteria 4640
1131 Ga0395901_0125960 3300038443 Bacteria 2692
1132 Ga0237819_05943 3300038705 Bacteria 1875
1133 Ga0400484_10568 3300038725 Bacteria 4359
1134 Ga0400485_14862 3300038735 Bacteria 1612
1135 Ga0400488_15834 3300038741 Bacteria 1167
1136 Ga0400488_59057 3300038741 Bacteria 3347
1137 Ga0400483_140144 3300039062 Bacteria 16717
1138 Ga0400489_31397 3300039093 Bacteria 1547
1139 Ga0400487_33555 3300039110 Bacteria 69184
1140 Ga0400487_54841 3300039110 Bacteria 3504
1141 Ga0237816_00020 3300039145 Bacteria 9419
1142 Ga0439436_0052601 3300041404 Bacteria 1148
1143 Ga0439436_0091880 3300041404 Bacteria 845
1144 Ga0439447_003122 3300041407 Bacteria 5909
1145 Ga0439461_0005177 3300041410 Bacteria 2213
1146 Ga0439465_0024089 3300041413 Bacteria 1917
1147 Ga0439465_0026055 3300041413 Bacteria 1847
1148 Ga0451787_099732 3300041441 Bacteria 1451
1149 Ga0451787_607505 3300041441 Bacteria 1330
1150 Ga0451789_0764343 3300041443 Bacteria 1458
1151 Ga0451791_0506135 3300041451 Bacteria 1230
1152 Ga0451791_1505001 3300041451 Bacteria 1115
1153 Ga0451791_1817012 3300041451 Bacteria 628
1154 Ga0451797_0992688 3300041453 Bacteria 605
1155 Ga0451795_0171946 3300041456 Bacteria 1134
1156 Ga0451798_0267471 3300041458 Bacteria 764
1157 Ga0451800_0897629 3300041459 Bacteria 780
1158 Ga0451800_1057945 3300041459 Bacteria 15810
1159 Ga0451800_1532477 3300041459 Bacteria 994
1160 Ga0451802_0044776 3300041460 Bacteria 821
1161 Ga0451802_0404479 3300041460 Bacteria 2404
1162 Ga0451802_0473044 3300041460 Bacteria 1461
1163 Ga0451806_234332 3300041462 Bacteria 19745
1164 Ga0451804_0663040 3300041463 Bacteria 1336
1165 Ga0451804_1098159 3300041463 Bacteria 3420
1166 Ga0451807_0070153 3300041486 Bacteria 5783
1167 Ga0451807_0646883 3300041486 Bacteria 1463
1168 Ga0451807_0984280 3300041486 Bacteria 1424
1169 Ga0451807_1118642 3300041486 Bacteria 672
1170 Ga0451807_1695146 3300041486 Bacteria 1260
1171 Ga0451807_1755414 3300041486 Bacteria 1734
1172 Ga0451837_1441521 3300041494 Bacteria 1149
1173 Ga0451839_1146372 3300041496 Bacteria 1466
1174 Ga0451841_0449820 3300041498 Bacteria 2014
1175 Ga0451845_0350394 3300041501 Bacteria 758
1176 Ga0451847_0693251 3300041503 Bacteria 619
1177 Ga0451849_0948594 3300041505 Bacteria 1124
1178 Ga0451851_1226210 3300041507 Bacteria 959
1179 Ga0451843_0964265 3300041509 Bacteria 2339
1180 Ga0451843_1079775 3300041509 Bacteria 736
1181 Ga0451855_0121750 3300041511 Bacteria 1026
1182 Ga0451853_0647492 3300041512 Bacteria 1677
1183 Ga0451853_0694569 3300041512 Bacteria 1631
1184 Ga0451853_2593270 3300041512 Bacteria 1086
1185 Ga0451853_2928813 3300041512 Bacteria 1032
1186 Ga0451853_2991773 3300041512 Bacteria 996
1187 Ga0451853_3390094 3300041512 Bacteria 1598
1188 Ga0439431_0016181 3300041997 Bacteria 1743
1189 Ga0439442_022993 3300042002 Bacteria 1295
1190 Ga0439445_0007238 3300042004 Bacteria 2571
1191 Ga0439445_0161806 3300042004 Bacteria 654
1192 Ga0439432_016566 3300042006 Bacteria 2479
1193 Ga0439432_033010 3300042006 Bacteria 1667
1194 Ga0439432_037894 3300042006 Bacteria 1537
1195 Ga0439432_041986 3300042006 Bacteria 1447
1196 Ga0439432_106296 3300042006 Bacteria 837
1197 Ga0439449_0005045 3300042007 Bacteria 5078
1198 Ga0439449_0007990 3300042007 Bacteria 4019
1199 Ga0439449_0008538 3300042007 Bacteria 3890
1200 Ga0439449_0015318 3300042007 Bacteria 2881
1201 Ga0439449_0022350 3300042007 Bacteria 2368
1202 Ga0439449_0047494 3300042007 Bacteria 1589
1203 Ga0439449_0095744 3300042007 Bacteria 1097
1204 Ga0439450_025118 3300042008 Bacteria 1304
1205 Ga0439457_029323 3300042014 Bacteria 1219
1206 Ga0450890_026351 3300042127 Bacteria 810
1207 Ga0450905_016525 3300042142 Bacteria 1065
1208 Ga0439446_0045963 3300042156 Bacteria 1296
1209 Ga0439434_0024212 3300042435 Bacteria 1831
1210 Ga0439434_0024628 3300042435 Bacteria 1816
1211 Ga0439444_0041877 3300042437 Bacteria 903
1212 Ga0439464_0026196 3300042439 Bacteria 1617
1213 Ga0439460_0044635 3300042461 Bacteria 1313
1214 Ga0451577_0099931 3300042876 Bacteria 2591
1215 Ga0451577_0137034 3300042876 Bacteria 2198
1216 Ga0466969_0024286 3300044656 Bacteria 3117
1217 Ga0466965_0039569 3300044683 Bacteria 2318
1218 Ga0466966_0017507 3300044684 Bacteria 4735
1219 Ga0466961_0000649 3300044693 Bacteria 21880
1220 Ga0466961_0022301 3300044693 Bacteria 4073
1221 Ga0466964_0064024 3300044706 Bacteria 1537
1222 Ga0466964_0264206 3300044706 Bacteria 854
1223 Ga0453684_1496887 3300044712 Bacteria 696
1224 Ga0466968_0006325 3300044735 Bacteria 4460
1225 Ga0466957_0003550 3300044842 Bacteria 8589
1226 Ga0466959_0073651 3300045049 Bacteria 2470
1227 Ga0466967_1806319 3300045976 Bacteria 608
1228 Ga0495617_077418 3300046452 Bacteria 1091
1229 Ga0495627_036255 3300046453 Bacteria 1533
1230 Ga0495627_052708 3300046453 Bacteria 1219
1231 Ga0495603_0000280 3300046455 Bacteria 27139
1232 Ga0495603_0366178 3300046455 Bacteria 827
1233 Ga0495590_0053840 3300046457 Bacteria 1405
1234 Ga0495629_0000177 3300046459 Bacteria 56906
1235 Ga0495629_0072401 3300046459 Bacteria 2405
1236 Ga0495629_0463250 3300046459 Bacteria 857
1237 Ga0495638_0010203 3300046460 Bacteria 6539
1238 Ga0495638_0020600 3300046460 Bacteria 4356
1239 Ga0495638_0023580 3300046460 Bacteria 4022
1240 Ga0495638_0049756 3300046460 Bacteria 2619
1241 Ga0495638_0259209 3300046460 Bacteria 954
1242 Ga0495638_0387812 3300046460 Bacteria 728
1243 Ga0495641_0017665 3300046461 Bacteria 3708
1244 Ga0495641_0029673 3300046461 Bacteria 2633
1245 Ga0495650_0000202 3300046471 Bacteria 129910
1246 Ga0495650_0040100 3300046471 Bacteria 2014
1247 Ga0495580_0002426 3300046472 Bacteria 16287
1248 Ga0495582_0000185 3300046473 Bacteria 34065
1249 Ga0495605_0081056 3300046474 Bacteria 1518
1250 Ga0495639_0001788 3300046475 Bacteria 9521
1251 Ga0495639_0023140 3300046475 Bacteria 2729
1252 Ga0495639_0035801 3300046475 Bacteria 2221
1253 Ga0495584_0001537 3300046491 Bacteria 13711
1254 Ga0495594_0000224 3300046499 Bacteria 27588
1255 Ga0495594_0022504 3300046499 Bacteria 3372
1256 Ga0495594_0405366 3300046499 Bacteria 776
1257 Ga0495607_0022784 3300046501 Bacteria 3929
1258 Ga0495606_0001329 3300046507 Bacteria 33751
1259 Ga0495606_0006502 3300046507 Bacteria 10753
1260 Ga0495606_0016668 3300046507 Bacteria 5589
1261 Ga0495606_0061939 3300046507 Bacteria 2390
1262 Ga0495606_0122208 3300046507 Bacteria 1557
1263 Ga0495606_0188528 3300046507 Bacteria 1183
1264 Ga0495610_0021781 3300046512 Bacteria 3518
1265 Ga0495610_0063008 3300046512 Bacteria 1757
1266 Ga0495616_0006494 3300046513 Bacteria 7072
1267 Ga0495616_0084886 3300046513 Bacteria 1508
1268 Ga0495616_0093680 3300046513 Bacteria 1418
1269 Ga0495616_0122636 3300046513 Bacteria 1198
1270 Ga0495620_0030788 3300046515 Bacteria 2466
1271 Ga0495620_0052998 3300046515 Bacteria 1719
1272 Ga0495630_0305079 3300046517 Bacteria 1217
1273 Ga0495630_0357791 3300046517 Bacteria 1117
1274 Ga0495632_0005327 3300046519 Bacteria 8538
1275 Ga0495632_0071946 3300046519 Bacteria 1660
1276 Ga0495632_0083777 3300046519 Bacteria 1518
1277 Ga0495643_0019386 3300046522 Bacteria 3935
1278 Ga0495643_0227566 3300046522 Bacteria 881
1279 Ga0495644_0008623 3300046523 Bacteria 3926
1280 Ga0495648_0157259 3300046524 Bacteria 1179
1281 Ga0495663_0001032 3300046525 Bacteria 9218
1282 Ga0495663_0011905 3300046525 Bacteria 2423
1283 Ga0495666_0020979 3300046526 Bacteria 3235
1284 Ga0495665_0131706 3300046531 Bacteria 1309
1285 Ga0495587_0286128 3300046536 Bacteria 923
1286 Ga0495598_0187757 3300046537 Bacteria 741
1287 Ga0495609_0295726 3300046538 Bacteria 660
1288 Ga0495621_0014526 3300046539 Bacteria 2493
1289 Ga0495621_0041194 3300046539 Bacteria 1621
1290 Ga0495621_0155687 3300046539 Bacteria 901
1291 Ga0495597_0178188 3300046542 Bacteria 860
1292 Ga0495622_0000916 3300046557 Bacteria 15986
1293 Ga0495622_0093643 3300046557 Bacteria 1379
1294 Ga0495633_0032624 3300046558 Bacteria 2515
1295 Ga0495667_0353282 3300046559 Bacteria 928
1296 Ga0495656_0001410 3300046615 Bacteria 7850
1297 Ga0495656_0027892 3300046615 Bacteria 2259
1298 Ga0495656_0028830 3300046615 Bacteria 2229
1299 Ga0495668_0003983 3300046616 Bacteria 10759
1300 Ga0495668_0046721 3300046616 Bacteria 2405
1301 Ga0495668_0112676 3300046616 Bacteria 1488
1302 Ga0495634_0003557 3300046642 Bacteria 12469
1303 Ga0495625_0020303 3300046660 Bacteria 5131
1304 Ga0495625_0026649 3300046660 Bacteria 4365
1305 Ga0495625_0165569 3300046660 Bacteria 1478
1306 Ga0495625_0238949 3300046660 Bacteria 1183
1307 Ga0495625_0308568 3300046660 Bacteria 1010
1308 Ga0495625_0349129 3300046660 Bacteria 935
1309 Ga0495635_0098468 3300046663 Bacteria 1999
1310 Ga0495635_0316962 3300046663 Bacteria 1044
1311 Ga0495635_0396059 3300046663 Bacteria 918
1312 Ga0495659_0015449 3300046664 Bacteria 2510
1313 Ga0495588_0000617 3300046674 Bacteria 16755
1314 Ga0495599_0196548 3300046678 Bacteria 1240
1315 Ga0495647_0001129 3300046681 Bacteria 8180
1316 Ga0495647_0064560 3300046681 Bacteria 1452
1317 Ga0495658_0007723 3300046683 Bacteria 5329
1318 Ga0495658_0197867 3300046683 Bacteria 1252
1319 Ga0495658_0668355 3300046683 Bacteria 665
1320 Ga0495669_0103028 3300046684 Bacteria 1327
1321 Ga0495613_0037438 3300046689 Bacteria 3596
1322 Ga0495670_0023274 3300046691 Bacteria 3058
1323 Ga0495670_0042455 3300046691 Bacteria 2269
1324 Ga0495670_0082264 3300046691 Bacteria 1641
1325 Ga0495670_0099127 3300046691 Bacteria 1499
1326 Ga0495671_0040600 3300046692 Bacteria 2346
1327 Ga0495671_0300596 3300046692 Bacteria 772
1328 Ga0495649_0000383 3300046694 Bacteria 38398
1329 Ga0495649_0322006 3300046694 Bacteria 784
1330 Ga0495589_0196971 3300046794 Bacteria 952
1331 Ga0495600_0284384 3300046809 Bacteria 1046
1332 Ga0495600_0609105 3300046809 Bacteria 663
1333 Ga0495660_0050999 3300046810 Bacteria 2252
1334 Ga0495660_0113426 3300046810 Bacteria 1380
1335 Ga0495660_0156785 3300046810 Bacteria 1120
1336 Ga0495581_0001367 3300047315 Bacteria 13506
1337 Ga0495581_0011471 3300047315 Bacteria 5129
1338 Ga0495636_0109909 3300047318 Bacteria 1212
1339 Ga0495636_0164923 3300047318 Bacteria 999
1340 Ga0495636_0296589 3300047318 Bacteria 755
1341 Ga0495672_0016078 3300047320 Bacteria 5059
1342 Ga0495672_0016648 3300047320 Bacteria 4943
1343 Ga0495676_0022271 3300047321 Bacteria 5516
1344 Ga0495680_0034950 3300047322 Bacteria 4053
1345 Ga0495680_0062566 3300047322 Bacteria 2861
1346 Ga0495680_0208146 3300047322 Bacteria 1401
1347 Ga0495683_0001368 3300047323 Bacteria 16223
1348 Ga0495673_0004383 3300047469 Bacteria 8851
1349 Ga0495673_0280345 3300047469 Bacteria 602
1350 Ga0495681_0048784 3300047470 Bacteria 2005
1351 Ga0495684_0171957 3300047471 Bacteria 1611
1352 Ga0495686_0002623 3300047472 Bacteria 16652
1353 Ga0495686_0016058 3300047472 Bacteria 5088
1354 Ga0495686_0020835 3300047472 Bacteria 4368
1355 Ga0495686_0090147 3300047472 Bacteria 1862
1356 Ga0495686_0132209 3300047472 Bacteria 1478
1357 Ga0495686_0174002 3300047472 Bacteria 1251
1358 Ga0495593_0001943 3300047673 Bacteria 12328
1359 Ga0495614_0000618 3300048089 Bacteria 14895
1360 Ga0495626_0131805 3300048091 Bacteria 1067
1361 Ga0496100_0170883 3300048903 Bacteria 1565
1362 Ga0496100_0380764 3300048903 Bacteria 1071
1363 Ga0496100_0518741 3300048903 Bacteria 919
1364 Ga0496101_0013058 3300048904 Bacteria 5557
1365 Ga0496101_0036782 3300048904 Bacteria 3468
1366 Ga0496101_0124830 3300048904 Bacteria 1950
1367 Ga0496101_0539933 3300048904 Bacteria 922
1368 Ga0496102_0050617 3300048905 Bacteria 3783
1369 Ga0496102_0098286 3300048905 Bacteria 2716
1370 Ga0496102_0386817 3300048905 Bacteria 1316
1371 Ga0496102_1117668 3300048905 Bacteria 708
1372 Ga0496103_0020839 3300048906 Bacteria 3942
1373 Ga0496103_0064524 3300048906 Bacteria 2283
1374 Ga0496103_0280959 3300048906 Bacteria 1071
1375 Ga0496103_0388693 3300048906 Bacteria 896
1376 Ga0496104_0000099 3300048907 Bacteria 84201
1377 Ga0496104_0152095 3300048907 Bacteria 2221
1378 Ga0496104_1091374 3300048907 Bacteria 702
1379 Ga0496105_0000021 3300048908 Bacteria 164255
1380 Ga0496105_0047563 3300048908 Bacteria 3540
1381 Ga0496105_0210949 3300048908 Bacteria 1583
1382 Ga0496105_0289678 3300048908 Bacteria 1318
1383 Ga0496106_0003988 3300048909 Bacteria 11030
1384 Ga0496106_0008692 3300048909 Bacteria 7515
1385 Ga0496107_0010615 3300048910 Bacteria 6403
1386 Ga0496107_0107909 3300048910 Bacteria 2044
1387 Ga0496107_0351638 3300048910 Bacteria 1097
1388 Ga0496108_0001932 3300048911 Bacteria 16608
1389 Ga0496108_0075478 3300048911 Bacteria 2848
1390 Ga0496108_0242809 3300048911 Bacteria 1567
1391 Ga0496108_0279880 3300048911 Bacteria 1452
1392 Ga0496108_0487406 3300048911 Bacteria 1077
1393 Ga0496109_0020058 3300048912 Bacteria 5904
1394 Ga0496109_0154445 3300048912 Bacteria 2149
1395 Ga0496109_0321773 3300048912 Bacteria 1460
1396 Ga0496110_0126246 3300048913 Bacteria 2308
1397 Ga0496111_0003793 3300048914 Bacteria 9425
1398 Ga0496112_0052028 3300048915 Bacteria 4018
1399 Ga0496112_0187566 3300048915 Bacteria 2031
1400 Ga0496112_0583745 3300048915 Bacteria 1050
1401 Ga0496113_0016963 3300048916 Bacteria 5042
1402 Ga0496113_0042432 3300048916 Bacteria 3361
1403 Ga0496113_0136295 3300048916 Bacteria 1929
1404 Ga0496113_0283266 3300048916 Bacteria 1325
1405 Ga0496113_0906873 3300048916 Bacteria 697
1406 Ga0496114_0009046 3300048917 Bacteria 7897
1407 Ga0496114_0031674 3300048917 Bacteria 4350
1408 Ga0496114_0059922 3300048917 Bacteria 3180
1409 Ga0496114_0066989 3300048917 Bacteria 3011
1410 Ga0496114_0076184 3300048917 Bacteria 2826
1411 Ga0496114_0092630 3300048917 Bacteria 2568
1412 Ga0496115_0002269 3300048918 Bacteria 13760
1413 Ga0496115_0002549 3300048918 Bacteria 13090
1414 Ga0496115_0192416 3300048918 Bacteria 1685
1415 Ga0496115_0322756 3300048918 Bacteria 1262
1416 Ga0496115_0458302 3300048918 Bacteria 1029
1417 Ga0496115_1035865 3300048918 Bacteria 625
1418 Ga0496116_0060116 3300048919 Bacteria 2466
1419 Ga0496116_0182500 3300048919 Bacteria 1121
1420 Ga0496116_0200164 3300048919 Bacteria 1046
1421 Ga0496116_0224422 3300048919 Bacteria 959
1422 Ga0496117_0038261 3300048920 Bacteria 3561
1423 Ga0496117_0048335 3300048920 Bacteria 3041
1424 Ga0496117_0088673 3300048920 Bacteria 2000
1425 Ga0496117_0132932 3300048920 Bacteria 1504
1426 Ga0496117_0241518 3300048920 Bacteria 991
1427 Ga0496117_0250817 3300048920 Bacteria 965
1428 Ga0496117_0271007 3300048920 Bacteria 914
1429 Ga0496118_0012660 3300048921 Bacteria 8071
1430 Ga0496118_0017126 3300048921 Bacteria 6612
1431 Ga0496118_0035846 3300048921 Bacteria 4019
1432 Ga0496118_0081719 3300048921 Bacteria 2267
1433 Ga0496118_0148790 3300048921 Bacteria 1469
1434 Ga0496118_0195736 3300048921 Bacteria 1203
1435 Ga0496118_0240812 3300048921 Bacteria 1036
1436 Ga0496118_0259181 3300048921 Bacteria 983
1437 Ga0496118_0348164 3300048921 Bacteria 791
1438 Ga0496119_0003231 3300048922 Bacteria 17062
1439 Ga0496119_0020091 3300048922 Bacteria 4885
1440 Ga0496120_0007517 3300048923 Bacteria 8089
1441 Ga0496120_0009138 3300048923 Bacteria 7068
1442 Ga0496121_0000290 3300048924 Bacteria 104280
1443 Ga0496121_0005001 3300048924 Bacteria 17352
1444 Ga0496121_0041619 3300048924 Bacteria 4012
1445 Ga0496121_0054269 3300048924 Bacteria 3350
1446 Ga0496121_0072653 3300048924 Bacteria 2761
1447 Ga0496121_0117591 3300048924 Bacteria 2014
1448 Ga0496121_0195020 3300048924 Bacteria 1448
1449 Ga0496121_0236715 3300048924 Bacteria 1275
1450 Ga0496122_0001230 3300048925 Bacteria 43287
1451 Ga0496122_0011228 3300048925 Bacteria 9105
1452 Ga0496122_0018830 3300048925 Bacteria 6348
1453 Ga0496122_0041301 3300048925 Bacteria 3649
1454 Ga0496122_0046603 3300048925 Bacteria 3355
1455 Ga0496122_0065909 3300048925 Bacteria 2621
1456 Ga0496122_0088624 3300048925 Bacteria 2119
1457 Ga0496122_0115961 3300048925 Bacteria 1743
1458 Ga0496122_0122978 3300048925 Bacteria 1668
1459 Ga0496122_0196517 3300048925 Bacteria 1184
1460 Ga0496123_0001008 3300048926 Bacteria 43023
1461 Ga0496123_0003328 3300048926 Bacteria 18200
1462 Ga0496123_0012847 3300048926 Bacteria 7092
1463 Ga0496123_0066416 3300048926 Bacteria 2284
1464 Ga0496123_0078476 3300048926 Bacteria 2022
1465 Ga0496123_0093154 3300048926 Bacteria 1780
1466 Ga0496123_0093871 3300048926 Bacteria 1770
1467 Ga0496123_0164721 3300048926 Bacteria 1177
1468 Ga0496123_0198923 3300048926 Bacteria 1029
1469 Ga0496124_0000018 3300048927 Bacteria 442940
1470 Ga0496124_0000472 3300048927 Bacteria 69226
1471 Ga0496124_0003716 3300048927 Bacteria 18420
1472 Ga0496124_0103293 3300048927 Bacteria 2305
1473 Ga0496124_0107130 3300048927 Bacteria 2255
1474 Ga0496124_0155935 3300048927 Bacteria 1786
1475 Ga0496124_0223602 3300048927 Bacteria 1413
1476 Ga0496124_0531639 3300048927 Bacteria 780
1477 Ga0496124_0531649 3300048927 Bacteria 780
1478 Ga0496125_0027337 3300048928 Bacteria 5173
1479 Ga0496125_0036008 3300048928 Bacteria 4329
1480 Ga0496125_0050036 3300048928 Bacteria 3465
1481 Ga0496125_0062163 3300048928 Bacteria 2989
1482 Ga0496125_0197686 3300048928 Bacteria 1320
1483 Ga0496125_0250246 3300048928 Bacteria 1118
1484 Ga0496125_0407423 3300048928 Bacteria 793
1485 Ga0496126_0000033 3300048929 Bacteria 368851
1486 Ga0496126_0007636 3300048929 Bacteria 11804
1487 Ga0496126_0062723 3300048929 Bacteria 3334
1488 Ga0496126_0104107 3300048929 Bacteria 2479
1489 Ga0496126_0116836 3300048929 Bacteria 2318
1490 Ga0496126_0195426 3300048929 Bacteria 1711
1491 Ga0496126_0220758 3300048929 Bacteria 1592
1492 Ga0496126_0330299 3300048929 Bacteria 1251
1493 Ga0496126_0569278 3300048929 Bacteria 896
1494 Ga0496126_0968335 3300048929 Bacteria 640
1495 Ga0501306_001780 3300049127 Bacteria 2099
1496 Ga0501306_005676 3300049127 Bacteria 1440
1497 Ga0501308_000488 3300049128 Bacteria 2619
1498 Ga0501308_000777 3300049128 Bacteria 2275
1499 Ga0501308_050856 3300049128 Bacteria 607
1500 Ga0501309_004802 3300049129 Bacteria 1587
1501 Ga0501310_000758 3300049130 Bacteria 2862
1502 Ga0501310_003470 3300049130 Bacteria 1540
1503 Ga0501310_015527 3300049130 Bacteria 904
1504 Ga0501343_013739 3300049132 Bacteria 680
1505 Ga0501304_000546 3300049160 Bacteria 2014
1506 Ga0501305_001737 3300049161 Bacteria 2209
1507 Ga0501305_005772 3300049161 Bacteria 1515
1508 Ga0501305_006326 3300049161 Bacteria 1467
1509 Ga0501307_001101 3300049162 Bacteria 2163
1510 Ga0501307_046379 3300049162 Bacteria 643
1511 Ga0495682_0005558 3300049460 Bacteria 5218
1512 Ga0501290_000463 3300049513 Bacteria 6299
1513 Ga0501294_026264 3300049517 Bacteria 658
1514 Ga0501300_005042 3300049523 Bacteria 1951
1515 Ga0501311_013019 3300049527 Bacteria 1045
1516 Ga0501312_001049 3300049528 Bacteria 2569
1517 Ga0501312_004227 3300049528 Bacteria 1679
1518 Ga0501313_012506 3300049529 Bacteria 989
1519 Ga0501314_005871 3300049530 Bacteria 1056
1520 Ga0501315_001594 3300049531 Bacteria 1981
1521 Ga0501315_063067 3300049531 Bacteria 603
1522 Ga0501316_044012 3300049532 Bacteria 629
1523 Ga0501317_005176 3300049533 Bacteria 1388
1524 Ga0501318_014963 3300049534 Bacteria 922
1525 Ga0501319_000796 3300049535 Bacteria 1641
1526 Ga0501320_001303 3300049536 Bacteria 1794
1527 Ga0501320_001705 3300049536 Bacteria 1657
1528 Ga0501321_003285 3300049537 Bacteria 1469
1529 Ga0501323_000045 3300049539 Bacteria 5899
1530 Ga0501323_013709 3300049539 Bacteria 1006
1531 Ga0501323_061396 3300049539 Bacteria 587
1532 Ga0501324_000219 3300049540 Bacteria 2723
1533 Ga0501324_001839 3300049540 Bacteria 1473
1534 Ga0501324_006088 3300049540 Bacteria 1006
1535 Ga0501325_001704 3300049541 Bacteria 1401
1536 Ga0501325_002598 3300049541 Bacteria 1250
1537 Ga0501326_00317 3300049542 Bacteria 1841
1538 Ga0501327_01567 3300049543 Bacteria 1112
1539 Ga0501328_03766 3300049544 Bacteria 714
1540 Ga0501329_00156 3300049545 Bacteria 1890
1541 Ga0501330_000068 3300049546 Bacteria 2957
1542 Ga0501332_09979 3300049548 Bacteria 630
1543 Ga0501333_002823 3300049549 Bacteria 1036
1544 Ga0501335_009797 3300049551 Bacteria 917
1545 Ga0501336_015297 3300049552 Bacteria 657
1546 Ga0501336_018977 3300049552 Bacteria 613
1547 Ga0501031_0002025 3300049568 Bacteria 12754
1548 Ga0501031_0013723 3300049568 Bacteria 5280
1549 Ga0501031_0037502 3300049568 Bacteria 3162
1550 Ga0501031_0149599 3300049568 Bacteria 1525
1551 Ga0501031_0215625 3300049568 Bacteria 1250
1552 Ga0501031_0394411 3300049568 Bacteria 895
1553 Ga0501031_0424205 3300049568 Bacteria 860
1554 Ga0501032_0002031 3300049569 Bacteria 15969
1555 Ga0501032_0002355 3300049569 Bacteria 14808
1556 Ga0501032_0017302 3300049569 Bacteria 5061
1557 Ga0501032_0017477 3300049569 Bacteria 5037
1558 Ga0501032_0035974 3300049569 Bacteria 3382
1559 Ga0501032_0125719 3300049569 Bacteria 1694
1560 Ga0501032_0204779 3300049569 Bacteria 1287
1561 Ga0501033_0000337 3300049570 Bacteria 44892
1562 Ga0501033_0003263 3300049570 Bacteria 13428
1563 Ga0501033_0004251 3300049570 Bacteria 11520
1564 Ga0501033_0005276 3300049570 Bacteria 10253
1565 Ga0501033_0036983 3300049570 Bacteria 3656
1566 Ga0501033_0041308 3300049570 Bacteria 3441
1567 Ga0501034_0000903 3300049571 Bacteria 43233
1568 Ga0501034_0002672 3300049571 Bacteria 21050
1569 Ga0501034_0005654 3300049571 Bacteria 13601
1570 Ga0501034_0007020 3300049571 Bacteria 12012
1571 Ga0501034_0007261 3300049571 Bacteria 11821
1572 Ga0501034_0019460 3300049571 Bacteria 6944
1573 Ga0501034_0043520 3300049571 Bacteria 4544
1574 Ga0501034_0046150 3300049571 Bacteria 4402
1575 Ga0501034_0058437 3300049571 Bacteria 3876
1576 Ga0501034_0067458 3300049571 Bacteria 3590
1577 Ga0501034_0168049 3300049571 Bacteria 2161
1578 Ga0501034_0363427 3300049571 Bacteria 1374
1579 Ga0501034_0826174 3300049571 Bacteria 818
1580 Ga0501034_0985161 3300049571 Bacteria 727
1581 Ga0501036_0006195 3300049572 Bacteria 9705
1582 Ga0501036_0025050 3300049572 Bacteria 5031
1583 Ga0501036_0061179 3300049572 Bacteria 3190
1584 Ga0501036_0062381 3300049572 Bacteria 3157
1585 Ga0501036_0063713 3300049572 Bacteria 3120
1586 Ga0501036_0066071 3300049572 Bacteria 3060
1587 Ga0501036_0090769 3300049572 Bacteria 2581
1588 Ga0501036_0173660 3300049572 Bacteria 1815
1589 Ga0501036_0375010 3300049572 Bacteria 1187
1590 Ga0501036_0403716 3300049572 Bacteria 1140
1591 Ga0501036_0485581 3300049572 Bacteria 1028
1592 Ga0501036_0608447 3300049572 Bacteria 906
1593 Ga0501037_0001372 3300049573 Bacteria 17876
1594 Ga0501037_0002914 3300049573 Bacteria 12409
1595 Ga0501037_0027308 3300049573 Bacteria 4217
1596 Ga0501037_0063741 3300049573 Bacteria 2686
1597 Ga0501037_0125311 3300049573 Bacteria 1845
1598 Ga0501037_0133453 3300049573 Bacteria 1779
1599 Ga0501037_0146633 3300049573 Bacteria 1688
1600 Ga0501037_0146894 3300049573 Bacteria 1686
1601 Ga0501037_0169994 3300049573 Bacteria 1550
1602 Ga0501037_0694921 3300049573 Bacteria 677
1603 Ga0501038_0000314 3300049574 Bacteria 41462
1604 Ga0501038_0002396 3300049574 Bacteria 17463
1605 Ga0501038_0014829 3300049574 Bacteria 7097
1606 Ga0501038_0022943 3300049574 Bacteria 5586
1607 Ga0501038_0023939 3300049574 Bacteria 5453
1608 Ga0501038_0155996 3300049574 Bacteria 1858
1609 Ga0501038_0161708 3300049574 Bacteria 1819
1610 Ga0501038_0400170 3300049574 Bacteria 1062
1611 Ga0501038_0847556 3300049574 Bacteria 677
1612 Ga0501039_0002463 3300049575 Bacteria 13782
1613 Ga0501039_0003833 3300049575 Bacteria 11292
1614 Ga0501039_0012529 3300049575 Bacteria 6477
1615 Ga0501039_0036478 3300049575 Bacteria 3794
1616 Ga0501039_0056068 3300049575 Bacteria 3052
1617 Ga0501039_0122949 3300049575 Bacteria 2034
1618 Ga0501039_0622365 3300049575 Bacteria 846
1619 Ga0501039_0623123 3300049575 Bacteria 845
1620 Ga0501039_0988887 3300049575 Bacteria 654
1621 Ga0501040_0025390 3300049576 Bacteria 3983
1622 Ga0501040_0041806 3300049576 Bacteria 3122
1623 Ga0501040_0112261 3300049576 Bacteria 1906
1624 Ga0501040_0120531 3300049576 Bacteria 1840
1625 Ga0501041_0030250 3300049577 Bacteria 3268
1626 Ga0501041_0056868 3300049577 Bacteria 2391
1627 Ga0501041_0174619 3300049577 Bacteria 1345
1628 Ga0501041_0701259 3300049577 Bacteria 648
1629 Ga0501042_0105484 3300049578 Bacteria 2028
1630 Ga0501042_0150335 3300049578 Bacteria 1679
1631 Ga0501042_0157647 3300049578 Bacteria 1637
1632 Ga0501042_0222762 3300049578 Bacteria 1360
1633 Ga0501043_0001324 3300049579 Bacteria 21677
1634 Ga0501043_0048418 3300049579 Bacteria 3341
1635 Ga0501043_0073094 3300049579 Bacteria 2693
1636 Ga0501043_0123690 3300049579 Bacteria 2028
1637 Ga0501043_0157471 3300049579 Bacteria 1776
1638 Ga0501043_0227760 3300049579 Bacteria 1440
1639 Ga0501043_0293659 3300049579 Bacteria 1243
1640 Ga0501043_0341615 3300049579 Bacteria 1139
1641 Ga0501043_0422890 3300049579 Bacteria 1004
1642 Ga0501043_0442666 3300049579 Bacteria 977
1643 Ga0501046_0001012 3300049580 Bacteria 27395
1644 Ga0501046_0032649 3300049580 Bacteria 4214
1645 Ga0501046_0034719 3300049580 Bacteria 4067
1646 Ga0501046_0056315 3300049580 Bacteria 3087
1647 Ga0501046_0105474 3300049580 Bacteria 2158
1648 Ga0501046_0129715 3300049580 Bacteria 1913
1649 Ga0501046_0130950 3300049580 Bacteria 1903
1650 Ga0501046_0203878 3300049580 Bacteria 1471
1651 Ga0501046_0278251 3300049580 Bacteria 1226
1652 Ga0501047_0000250 3300049581 Bacteria 63699
1653 Ga0501047_0003863 3300049581 Bacteria 14104
1654 Ga0501047_0004195 3300049581 Bacteria 13568
1655 Ga0501047_0023755 3300049581 Bacteria 5885
1656 Ga0501047_0030355 3300049581 Bacteria 5211
1657 Ga0501047_0038158 3300049581 Bacteria 4646
1658 Ga0501047_0081417 3300049581 Bacteria 3112
1659 Ga0501047_0095690 3300049581 Bacteria 2848
1660 Ga0501047_0100304 3300049581 Bacteria 2774
1661 Ga0501047_0245353 3300049581 Bacteria 1640
1662 Ga0501047_0377820 3300049581 Bacteria 1251
1663 Ga0501047_0450453 3300049581 Bacteria 1116
1664 Ga0501047_0508199 3300049581 Bacteria 1031
1665 Ga0501048_0017587 3300049582 Bacteria 5264
1666 Ga0501048_0077415 3300049582 Bacteria 2347
1667 Ga0501048_0149473 3300049582 Bacteria 1652
1668 Ga0501048_0168400 3300049582 Bacteria 1551
1669 Ga0501048_0282946 3300049582 Bacteria 1179
1670 Ga0501048_0781075 3300049582 Bacteria 686
1671 Ga0501067_0004260 3300049583 Bacteria 7890
1672 Ga0501067_0007342 3300049583 Bacteria 6124
1673 Ga0501067_0031215 3300049583 Bacteria 2956
1674 Ga0501067_0031483 3300049583 Bacteria 2943
1675 Ga0501067_0038285 3300049583 Bacteria 2663
1676 Ga0501067_0279514 3300049583 Bacteria 929
1677 Ga0501068_0001465 3300049584 Bacteria 12558
1678 Ga0501068_0028942 3300049584 Bacteria 3279
1679 Ga0501068_0090035 3300049584 Bacteria 1892
1680 Ga0501068_0097691 3300049584 Bacteria 1817
1681 Ga0501068_0101141 3300049584 Bacteria 1787
1682 Ga0501068_0122300 3300049584 Bacteria 1623
1683 Ga0501068_0316674 3300049584 Bacteria 1000
1684 Ga0501068_0318710 3300049584 Bacteria 996
1685 Ga0501068_0366512 3300049584 Bacteria 927
1686 Ga0501068_0394082 3300049584 Bacteria 892
1687 Ga0501069_0005572 3300049585 Bacteria 6552
1688 Ga0501069_0008370 3300049585 Bacteria 5432
1689 Ga0501069_0034143 3300049585 Bacteria 2802
1690 Ga0501069_0056888 3300049585 Bacteria 2179
1691 Ga0501069_0187904 3300049585 Bacteria 1195
1692 Ga0501069_0444079 3300049585 Bacteria 771
1693 Ga0501070_0003498 3300049586 Bacteria 13605
1694 Ga0501070_0012103 3300049586 Bacteria 7282
1695 Ga0501070_0032811 3300049586 Bacteria 4344
1696 Ga0501070_0036607 3300049586 Bacteria 4098
1697 Ga0501070_0052444 3300049586 Bacteria 3385
1698 Ga0501070_0059664 3300049586 Bacteria 3162
1699 Ga0501070_0145613 3300049586 Bacteria 1955
1700 Ga0501070_0169408 3300049586 Bacteria 1799
1701 Ga0501070_0188996 3300049586 Bacteria 1693
1702 Ga0501070_0222501 3300049586 Bacteria 1547
1703 Ga0501070_0282726 3300049586 Bacteria 1353
1704 Ga0501070_0379810 3300049586 Bacteria 1144
1705 Ga0501070_0406056 3300049586 Bacteria 1101
1706 Ga0501070_0426311 3300049586 Bacteria 1071
1707 Ga0501071_0019646 3300049587 Bacteria 4688
1708 Ga0501071_0042445 3300049587 Bacteria 3259
1709 Ga0501071_0107543 3300049587 Bacteria 2059
1710 Ga0501071_0144858 3300049587 Bacteria 1770
1711 Ga0501071_0228529 3300049587 Bacteria 1401
1712 Ga0501071_0268065 3300049587 Bacteria 1290
1713 Ga0501071_0710782 3300049587 Bacteria 774
1714 Ga0501072_0002407 3300049588 Bacteria 14033
1715 Ga0501072_0014748 3300049588 Bacteria 5992
1716 Ga0501072_0039445 3300049588 Bacteria 3708
1717 Ga0501072_0101863 3300049588 Bacteria 2282
1718 Ga0501072_0144574 3300049588 Bacteria 1896
1719 Ga0501072_0272117 3300049588 Bacteria 1347
1720 Ga0501073_0000196 3300049589 Bacteria 40033
1721 Ga0501073_0000525 3300049589 Bacteria 26880
1722 Ga0501073_0012347 3300049589 Bacteria 6233
1723 Ga0501073_0019511 3300049589 Bacteria 4893
1724 Ga0501073_0022305 3300049589 Bacteria 4561
1725 Ga0501073_0055413 3300049589 Bacteria 2774
1726 Ga0501073_0065047 3300049589 Bacteria 2543
1727 Ga0501073_0096535 3300049589 Bacteria 2052
1728 Ga0501073_0103044 3300049589 Bacteria 1981
1729 Ga0501073_0194049 3300049589 Bacteria 1405
1730 Ga0501073_0213490 3300049589 Bacteria 1333
1731 Ga0501073_0216221 3300049589 Bacteria 1324
1732 Ga0501073_0225558 3300049589 Bacteria 1294
1733 Ga0501073_0293596 3300049589 Bacteria 1121
1734 Ga0501074_0001124 3300049590 Bacteria 17502
1735 Ga0501074_0034376 3300049590 Bacteria 3674
1736 Ga0501074_0038575 3300049590 Bacteria 3461
1737 Ga0501074_0051494 3300049590 Bacteria 2971
1738 Ga0501074_0072834 3300049590 Bacteria 2467
1739 Ga0501074_0099909 3300049590 Bacteria 2077
1740 Ga0501074_0100501 3300049590 Bacteria 2070
1741 Ga0501074_0135574 3300049590 Bacteria 1761
1742 Ga0501074_0135788 3300049590 Bacteria 1759
1743 Ga0501074_0153018 3300049590 Bacteria 1648
1744 Ga0501074_0204683 3300049590 Bacteria 1406
1745 Ga0501074_0232763 3300049590 Bacteria 1311
1746 Ga0501074_0384787 3300049590 Bacteria 995
1747 Ga0501074_0399860 3300049590 Bacteria 974
1748 Ga0501075_0017316 3300049591 Bacteria 5204
1749 Ga0501075_0057084 3300049591 Bacteria 2939
1750 Ga0501075_0163387 3300049591 Bacteria 1699
1751 Ga0501075_0496325 3300049591 Bacteria 931
1752 Ga0501076_0028505 3300049592 Bacteria 4336
1753 Ga0501076_0114286 3300049592 Bacteria 2184
1754 Ga0501076_0147253 3300049592 Bacteria 1915
1755 Ga0501076_0173537 3300049592 Bacteria 1757
1756 Ga0501076_0179602 3300049592 Bacteria 1725
1757 Ga0501076_0242983 3300049592 Bacteria 1473
1758 Ga0501076_0282242 3300049592 Bacteria 1360
1759 Ga0501077_0002875 3300049593 Bacteria 10325
1760 Ga0501077_0013704 3300049593 Bacteria 5081
1761 Ga0501077_0020871 3300049593 Bacteria 4147
1762 Ga0501077_0110900 3300049593 Bacteria 1739
1763 Ga0501077_0117550 3300049593 Bacteria 1685
1764 Ga0501077_0188768 3300049593 Bacteria 1309
1765 Ga0501077_0272343 3300049593 Bacteria 1077
1766 Ga0501217_084378 3300049661 Bacteria 884
1767 Ga0501223_003806 3300049663 Bacteria 3261
1768 Ga0501235_025754 3300049669 Bacteria 1316
1769 Ga0501239_046041 3300049672 Bacteria 618
1770 Ga0501242_028665 3300049674 Bacteria 744
1771 Ga0501253_014398 3300049683 Bacteria 1280
1772 Ga0501259_033855 3300049688 Bacteria 977
1773 Ga0501259_066471 3300049688 Bacteria 765
1774 Ga0501261_012252 3300049690 Bacteria 1152
1775 Ga0501221_086240 3300049704 Bacteria 762
1776 Ga0501225_0023498 3300049705 Bacteria 1698
1777 Ga0501079_0004772 3300049741 Bacteria 10039
1778 Ga0501079_0012910 3300049741 Bacteria 6376
1779 Ga0501079_0064512 3300049741 Bacteria 2825
1780 Ga0501079_0170571 3300049741 Bacteria 1697
1781 Ga0501079_0177596 3300049741 Bacteria 1661
1782 Ga0501080_0001373 3300049742 Bacteria 20360
1783 Ga0501080_0004228 3300049742 Bacteria 12741
1784 Ga0501080_0005488 3300049742 Bacteria 11318
1785 Ga0501080_0010339 3300049742 Bacteria 8535
1786 Ga0501080_0018049 3300049742 Bacteria 6532
1787 Ga0501080_0021132 3300049742 Bacteria 6023
1788 Ga0501080_0026073 3300049742 Bacteria 5430
1789 Ga0501080_0033694 3300049742 Bacteria 4781
1790 Ga0501080_0041576 3300049742 Bacteria 4282
1791 Ga0501080_0043698 3300049742 Bacteria 4172
1792 Ga0501080_0047460 3300049742 Bacteria 3998
1793 Ga0501080_0082197 3300049742 Bacteria 2992
1794 Ga0501080_0100770 3300049742 Bacteria 2679
1795 Ga0501080_0109324 3300049742 Bacteria 2562
1796 Ga0501080_0159566 3300049742 Bacteria 2083
1797 Ga0501080_0204536 3300049742 Bacteria 1811
1798 Ga0501080_0246985 3300049742 Bacteria 1627
1799 Ga0501080_0590651 3300049742 Bacteria 986
1800 Ga0501080_0798337 3300049742 Bacteria 828
1801 Ga0501081_0097937 3300049743 Bacteria 2070
1802 Ga0501081_0145138 3300049743 Bacteria 1702
1803 Ga0501081_0387202 3300049743 Bacteria 1034
1804 Ga0501081_0664046 3300049743 Bacteria 782
1805 Ga0501081_0928491 3300049743 Bacteria 657
1806 Ga0501083_0000869 3300049744 Bacteria 19958
1807 Ga0501083_0004501 3300049744 Bacteria 9845
1808 Ga0501083_0021498 3300049744 Bacteria 4483
1809 Ga0501083_0091220 3300049744 Bacteria 2012
1810 Ga0501083_0184560 3300049744 Bacteria 1361
1811 Ga0501083_0200719 3300049744 Bacteria 1301
1812 Ga0501083_0266013 3300049744 Bacteria 1115
1813 Ga0501083_0291073 3300049744 Bacteria 1062
1814 Ga0501265_003694 3300049762 Bacteria 1739
1815 Ga0501266_010008 3300049763 Bacteria 1202
1816 Ga0501268_001085 3300049765 Bacteria 3269
1817 Ga0501270_004217 3300049767 Bacteria 1602
1818 Ga0501275_000325 3300049772 Bacteria 5423
1819 Ga0501035_0000666 3300049822 Bacteria 37861
1820 Ga0501035_0003746 3300049822 Bacteria 14504
1821 Ga0501035_0023174 3300049822 Bacteria 5695
1822 Ga0501035_0025382 3300049822 Bacteria 5433
1823 Ga0501035_0047025 3300049822 Bacteria 3877
1824 Ga0501035_0240284 3300049822 Bacteria 1541
1825 Ga0501035_0299528 3300049822 Bacteria 1355
1826 Ga0501035_0315951 3300049822 Bacteria 1313
1827 Ga0501035_0689638 3300049822 Bacteria 825
1828 Ga0501044_0003730 3300049823 Bacteria 17110
1829 Ga0501044_0004802 3300049823 Bacteria 15112
1830 Ga0501044_0014874 3300049823 Bacteria 8389
1831 Ga0501044_0020968 3300049823 Bacteria 6978
1832 Ga0501044_0028230 3300049823 Bacteria 5923
1833 Ga0501044_0052796 3300049823 Bacteria 4185
1834 Ga0501044_0062975 3300049823 Bacteria 3790
1835 Ga0501044_0097351 3300049823 Bacteria 2963
1836 Ga0501044_0115022 3300049823 Bacteria 2695
1837 Ga0501044_0169027 3300049823 Bacteria 2159
1838 Ga0501044_0174050 3300049823 Bacteria 2122
1839 Ga0501044_0344411 3300049823 Bacteria 1411
1840 Ga0501044_0472794 3300049823 Bacteria 1157
1841 Ga0501045_0091755 3300049824 Bacteria 2245
1842 Ga0501045_0127077 3300049824 Bacteria 1894
1843 Ga0501045_0337496 3300049824 Bacteria 1121
1844 Ga0501212_031705 3300049851 Bacteria 854
1845 nmdc:mga03683_332218_c1 3300050489 Bacteria 717
1846 nmdc:mga00v17_2568_c1 3300050491 Bacteria 9325
1847 nmdc:mga00v17_267434_c1 3300050491 Bacteria 1110
1848 nmdc:mga00v17_5329_c1 3300050491 Bacteria 6775
1849 nmdc:mga00v17_5359_c1 3300050491 Bacteria 6753
1850 nmdc:mga00v17_81641_c1 3300050491 Bacteria 2020
1851 nmdc:mga0yw44_629040_c1 3300050492 Bacteria 729
1852 nmdc:mga0k408_1928_c1 3300050493 Bacteria 11118
1853 nmdc:mga0k408_433156_c1 3300050493 Bacteria 781
1854 nmdc:mga06z11_8708_c1 3300050494 Bacteria 4247
1855 nmdc:mga06z11_99456_c1 3300050494 Bacteria 1593
1856 nmdc:mga04h51_159777_c1 3300050495 Bacteria 866
1857 nmdc:mga04h51_87027_c1 3300050495 Bacteria 1118
1858 nmdc:mga06r32_525665_c1 3300050510 Bacteria 1158
1859 nmdc:mga06r32_90056_c1 3300050510 Bacteria 2996
1860 nmdc:mga08y16_208685_c1 3300050511 Bacteria 2023
1861 nmdc:mga08y16_397291_c1 3300050511 Bacteria 1411
1862 nmdc:mga08y16_485070_c1 3300050511 Bacteria 1257
1863 nmdc:mga0n895_1429225_c1 3300050512 Bacteria 659
1864 nmdc:mga0sz30_1133_c1 3300050516 Bacteria 9551
1865 Ga0500610_0000159 3300053079 Bacteria 20234
1866 Ga0495655_0027539 3300053083 Bacteria 1349
1867 Ga0495595_0047137 3300053084 Bacteria 1987
1868 Ga0495619_0001164 3300053085 Bacteria 17272
1869 Ga0495619_0938094 3300053085 Bacteria 581
1870 Ga0500643_000120 3300053087 Bacteria 81701
1871 Ga0500643_001959 3300053087 Bacteria 11154
1872 Ga0500583_0130815 3300053092 Bacteria 1245
1873 Ga0500651_0003432 3300053093 Bacteria 8658
1874 Ga0500641_0008546 3300053096 Bacteria 3658
1875 Ga0500555_001019 3300053103 Bacteria 9511
1876 Ga0500597_002753 3300053120 Bacteria 4989
1877 Ga0500614_027889 3300053123 Bacteria 1361
1878 Ga0500614_146339 3300053123 Bacteria 709
1879 Ga0500628_019518 3300053129 Bacteria 1350
1880 Ga0500568_0000319 3300053139 Bacteria 38374
1881 Ga0500633_0006586 3300053160 Bacteria 2860
1882 Ga0500634_0035981 3300053161 Bacteria 2695
1883 Ga0500637_0392942 3300053178 Bacteria 723
1884 Ga0500609_026506 3300053731 Bacteria 794
1885 Ga0500565_000972 3300053734 Bacteria 1779
1886 Ga0501084_0022568 3300054114 Bacteria 5252
1887 Ga0501084_0104394 3300054114 Bacteria 2380
1888 Ga0501084_0110341 3300054114 Bacteria 2311
1889 Ga0501084_0119653 3300054114 Bacteria 2214
1890 Ga0501084_0140781 3300054114 Bacteria 2031
1891 Ga0501084_0167684 3300054114 Bacteria 1853
1892 Ga0501084_0185358 3300054114 Bacteria 1756
1893 Ga0501084_0255215 3300054114 Bacteria 1480
1894 Ga0501084_0502676 3300054114 Bacteria 1024
1895 Ga0501084_0548787 3300054114 Bacteria 976
1896 Ga0501084_0990308 3300054114 Bacteria 706
1897 Ga0500661_009513 3300055283 Bacteria 1778
1898 Ga0587088_018017 3300059508 Bacteria 1144
1899 Ga0587069_012743 3300059642 Bacteria 1145
1900 Ga0587114_031834 3300059655 Bacteria 811
1901 Ga0501082_0000351 3300060353 Bacteria 40723
1902 Ga0501082_0017998 3300060353 Bacteria 6085
1903 Ga0501082_0035796 3300060353 Bacteria 4278
1904 Ga0501082_0075942 3300060353 Bacteria 2895
1905 Ga0501082_0203241 3300060353 Bacteria 1724
1906 Ga0501082_0212313 3300060353 Bacteria 1683
1907 Ga0501082_0537132 3300060353 Bacteria 1022
1908 Ga0501082_0705965 3300060353 Bacteria 883
1909 Ga0530510_0023701 3300061734 Bacteria 4376
1910 Ga0530510_0024355 3300061734 Bacteria 4318

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_2991773 Ga0451853_2991773_24_449 141
2 3300031595 Ga0265313_10049622 Ga0265313_100496224 145
3 3300013296 Ga0157374_10036326 Ga0157374_100363266 146
4 3300014969 Ga0157376_10098195 Ga0157376_100981956 146
5 3300048905 Ga0496102_0098286 Ga0496102_0098286_405_929 146
6 3300048906 Ga0496103_0020839 Ga0496103_0020839_3226_3750 146
7 3300048918 Ga0496115_0002549 Ga0496115_0002549_7557_8081 146
8 3300048921 Ga0496118_0035846 Ga0496118_0035846_3040_3564 146
9 3300048929 Ga0496126_0000033 Ga0496126_0000033_37986_38510 146
10 3300049574 Ga0501038_0847556 Ga0501038_0847556_38_571 146
11 3300032133 Ga0316583_10117150 Ga0316583_101171502 147
12 3300049569 Ga0501032_0125719 Ga0501032_0125719_371_904 147
13 3300049575 Ga0501039_0623123 Ga0501039_0623123_196_729 147
14 3300049580 Ga0501046_0105474 Ga0501046_0105474_1198_1731 147
15 3300049581 Ga0501047_0030355 Ga0501047_0030355_108_641 147
16 3300049583 Ga0501067_0279514 Ga0501067_0279514_109_642 147
17 3300049584 Ga0501068_0318710 Ga0501068_0318710_323_856 147
18 3300049585 Ga0501069_0008370 Ga0501069_0008370_2104_2637 147
19 3300049586 Ga0501070_0282726 Ga0501070_0282726_220_753 147
20 3300049589 Ga0501073_0293596 Ga0501073_0293596_107_640 147
21 3300049590 Ga0501074_0051494 Ga0501074_0051494_1697_2230 147
22 3300049742 Ga0501080_0010339 Ga0501080_0010339_3995_4528 147
23 3300049742 Ga0501080_0082197 Ga0501080_0082197_2132_2665 147
24 3300049744 Ga0501083_0184560 Ga0501083_0184560_678_1211 147
25 3300049822 Ga0501035_0047025 Ga0501035_0047025_1640_2173 147
26 3300060353 Ga0501082_0212313 Ga0501082_0212313_1063_1596 147
27 3300049590 Ga0501074_0135574 Ga0501074_0135574_711_1244 148
28 3300049592 Ga0501076_0114286 Ga0501076_0114286_227_760 148
29 3300049741 Ga0501079_0170571 Ga0501079_0170571_537_1070 148
30 3300054114 Ga0501084_0990308 Ga0501084_0990308_91_624 148
31 3300060353 Ga0501082_0017998 Ga0501082_0017998_4606_5139 148
32 3300025299 Ga0209256_1013162 Ga0209256_10131622 150
33 3300048925 Ga0496122_0018830 Ga0496122_0018830_4256_4783 151
34 3300048926 Ga0496123_0012847 Ga0496123_0012847_5139_5666 151
35 3300048929 Ga0496126_0220758 Ga0496126_0220758_866_1393 151
36 3300033524 Ga0316592_1006701 Ga0316592_10067013 152
37 3300005614 Ga0068856_100014197 Ga0068856_10001419711 153
38 3300026078 Ga0207702_10004420 Ga0207702_100044209 153
39 3300031824 Ga0307413_10125812 Ga0307413_101258124 153
40 3300041441 Ga0451787_607505 Ga0451787_607505_418_945 153
41 3300041486 Ga0451807_1755414 Ga0451807_1755414_468_995 153
42 3300041496 Ga0451839_1146372 Ga0451839_1146372_837_1364 153
43 3300054114 Ga0501084_0119653 Ga0501084_0119653_1257_1790 153
44 3300003794 Ga0055531_10036708 Ga0055531_100367083 154
45 3300025304 Ga0209257_1002665 Ga0209257_100266513 154
46 3300028379 Ga0268266_10091837 Ga0268266_100918372 154
47 3300041459 Ga0451800_1057945 Ga0451800_1057945_7905_8432 154
48 3300041462 Ga0451806_234332 Ga0451806_234332_11314_11841 154
49 3300041463 Ga0451804_1098159 Ga0451804_1098159_1664_2191 154
50 3300041486 Ga0451807_0070153 Ga0451807_0070153_4267_4794 154
51 3300048925 Ga0496122_0065909 Ga0496122_0065909_1326_1853 154
52 3300053139 Ga0500568_0000319 Ga0500568_0000319_4479_5006 154
53 3300005337 Ga0070682_100305205 Ga0070682_1003052052 155
54 3300005344 Ga0070661_100132456 Ga0070661_1001324562 155
55 3300009174 Ga0105241_10109453 Ga0105241_101094535 155
56 3300009545 Ga0105237_10323642 Ga0105237_103236422 155
57 3300025914 Ga0207671_10139503 Ga0207671_101395032 155
58 3300025920 Ga0207649_10386034 Ga0207649_103860342 155
59 3300025924 Ga0207694_10191145 Ga0207694_101911452 155
60 3300025981 Ga0207640_10498702 Ga0207640_104987022 155
61 3300041404 Ga0439436_0091880 Ga0439436_0091880_68_577 155
62 3300048917 Ga0496114_0059922 Ga0496114_0059922_2270_2797 155
63 3300048918 Ga0496115_0192416 Ga0496115_0192416_706_1233 155
64 3300048929 Ga0496126_0195426 Ga0496126_0195426_676_1203 155
65 3300049742 Ga0501080_0246985 Ga0501080_0246985_630_1157 155
66 3300049823 Ga0501044_0472794 Ga0501044_0472794_357_884 155
67 3300005367 Ga0070667_100246143 Ga0070667_1002461431 156
68 3300005548 Ga0070665_100000175 Ga0070665_10000017597 156
69 3300013104 Ga0157370_10206127 Ga0157370_102061271 156
70 3300028379 Ga0268266_10000001 Ga0268266_100000013270 156
71 3300031456 Ga0307513_10262845 Ga0307513_102628452 156
72 3300041443 Ga0451789_0764343 Ga0451789_0764343_624_1151 156
73 3300041460 Ga0451802_0473044 Ga0451802_0473044_812_1339 156
74 3300005289 Ga0065704_10100294 Ga0065704_101002945 157
75 3300005466 Ga0070685_10001821 Ga0070685_1000182114 157
76 3300005616 Ga0068852_100601611 Ga0068852_1006016112 157
77 3300009093 Ga0105240_10079328 Ga0105240_100793287 157
78 3300009551 Ga0105238_10175046 Ga0105238_101750463 157
79 3300010375 Ga0105239_10757263 Ga0105239_107572633 157
80 3300025913 Ga0207695_10000032 Ga0207695_10000032121 157
81 3300025924 Ga0207694_10007300 Ga0207694_100073008 157
82 3300026142 Ga0207698_10071100 Ga0207698_100711004 157
83 3300032168 Ga0316593_10009756 Ga0316593_100097562 157
84 3300033527 Ga0316586_1016855 Ga0316586_10168552 157
85 3300035118 Ga0373954_0675266 Ga0373954_0675266_29_502 157
86 3300039145 Ga0237816_00020 Ga0237816_00020_1338_1865 157
87 3300046809 Ga0495600_0609105 Ga0495600_0609105_180_653 157
88 3300048906 Ga0496103_0280959 Ga0496103_0280959_228_755 157
89 3300048917 Ga0496114_0031674 Ga0496114_0031674_597_1124 157
90 3300048924 Ga0496121_0236715 Ga0496121_0236715_784_1257 157
91 3300048929 Ga0496126_0062723 Ga0496126_0062723_1814_2341 157
92 3300049513 Ga0501290_000463 Ga0501290_000463_4751_5278 157
93 3300049523 Ga0501300_005042 Ga0501300_005042_1083_1610 157
94 3300049568 Ga0501031_0215625 Ga0501031_0215625_587_1114 157
95 3300049569 Ga0501032_0017477 Ga0501032_0017477_1637_2164 157
96 3300049570 Ga0501033_0036983 Ga0501033_0036983_2449_2976 157
97 3300049571 Ga0501034_0043520 Ga0501034_0043520_2785_3312 157
98 3300049571 Ga0501034_0168049 Ga0501034_0168049_451_978 157
99 3300049573 Ga0501037_0146894 Ga0501037_0146894_689_1216 157
100 3300049574 Ga0501038_0022943 Ga0501038_0022943_2610_3137 157
101 3300049575 Ga0501039_0036478 Ga0501039_0036478_830_1357 157
102 3300049579 Ga0501043_0227760 Ga0501043_0227760_299_826 157
103 3300049586 Ga0501070_0012103 Ga0501070_0012103_5676_6203 157
104 3300049762 Ga0501265_003694 Ga0501265_003694_716_1243 157
105 3300049772 Ga0501275_000325 Ga0501275_000325_299_826 157
106 3300049822 Ga0501035_0025382 Ga0501035_0025382_2880_3407 157
107 3300049823 Ga0501044_0014874 Ga0501044_0014874_2471_2998 157
108 3300055283 Ga0500661_009513 Ga0500661_009513_733_1260 157
109 3300005334 Ga0068869_100185294 Ga0068869_1001852942 158
110 3300006237 Ga0097621_100292058 Ga0097621_1002920582 158
111 3300013104 Ga0157370_10318935 Ga0157370_103189353 158
112 3300013105 Ga0157369_10429424 Ga0157369_104294243 158
113 3300014969 Ga0157376_10091888 Ga0157376_100918883 158
114 3300025933 Ga0207706_10645938 Ga0207706_106459382 158
115 3300030733 Ga0314311_1167649 Ga0314311_11676499 158
116 3300041410 Ga0439461_0005177 Ga0439461_0005177_833_1360 158
117 3300041413 Ga0439465_0024089 Ga0439465_0024089_636_1163 158
118 3300041997 Ga0439431_0016181 Ga0439431_0016181_483_1010 158
119 3300042004 Ga0439445_0007238 Ga0439445_0007238_393_920 158
120 3300042004 Ga0439445_0161806 Ga0439445_0161806_58_585 158
121 3300042006 Ga0439432_106296 Ga0439432_106296_142_669 158
122 3300042007 Ga0439449_0007990 Ga0439449_0007990_1043_1570 158
123 3300042007 Ga0439449_0095744 Ga0439449_0095744_101_628 158
124 3300042156 Ga0439446_0045963 Ga0439446_0045963_76_603 158
125 3300042435 Ga0439434_0024212 Ga0439434_0024212_568_1095 158
126 3300046459 Ga0495629_0072401 Ga0495629_0072401_29_520 158
127 3300046475 Ga0495639_0035801 Ga0495639_0035801_73_564 158
128 3300046525 Ga0495663_0001032 Ga0495663_0001032_5662_6189 158
129 3300046692 Ga0495671_0040600 Ga0495671_0040600_641_1168 158
130 3300047315 Ga0495581_0011471 Ga0495581_0011471_3234_3725 158
131 3300048904 Ga0496101_0124830 Ga0496101_0124830_77_604 158
132 3300049568 Ga0501031_0002025 Ga0501031_0002025_10846_11373 158
133 3300049569 Ga0501032_0017302 Ga0501032_0017302_2607_3134 158
134 3300049571 Ga0501034_0007020 Ga0501034_0007020_4917_5444 158
135 3300049573 Ga0501037_0002914 Ga0501037_0002914_1311_1838 158
136 3300049574 Ga0501038_0002396 Ga0501038_0002396_7669_8196 158
137 3300049575 Ga0501039_0012529 Ga0501039_0012529_2034_2561 158
138 3300049581 Ga0501047_0095690 Ga0501047_0095690_940_1467 158
139 3300049583 Ga0501067_0007342 Ga0501067_0007342_756_1289 158
140 3300049587 Ga0501071_0042445 Ga0501071_0042445_2659_3186 158
141 3300049589 Ga0501073_0022305 Ga0501073_0022305_1382_1909 158
142 3300049593 Ga0501077_0188768 Ga0501077_0188768_595_1128 158
143 3300049742 Ga0501080_0043698 Ga0501080_0043698_3006_3533 158
144 3300049822 Ga0501035_0003746 Ga0501035_0003746_8125_8652 158
145 3300049823 Ga0501044_0003730 Ga0501044_0003730_6163_6690 158
146 3300053731 Ga0500609_026506 Ga0500609_026506_124_651 158
147 3300054114 Ga0501084_0502676 Ga0501084_0502676_84_617 158
148 3300032004 Ga0307414_10225388 Ga0307414_102253882 159
149 3300044693 Ga0466961_0022301 Ga0466961_0022301_3112_3639 159
150 3300005356 Ga0070674_100313065 Ga0070674_1003130652 160
151 3300005548 Ga0070665_100401076 Ga0070665_1004010762 160
152 3300005719 Ga0068861_100131242 Ga0068861_1001312421 160
153 3300015262 Ga0182007_10072019 Ga0182007_100720192 160
154 3300025937 Ga0207669_10115623 Ga0207669_101156233 160
155 3300026067 Ga0207678_10082301 Ga0207678_100823016 160
156 3300028379 Ga0268266_11008536 Ga0268266_110085361 160
157 3300046615 Ga0495656_0028830 Ga0495656_0028830_216_743 160
158 3300005340 Ga0070689_100015417 Ga0070689_10001541712 161
159 3300026088 Ga0207641_10092132 Ga0207641_100921326 161
160 3300030736 Ga0316180_1166273 Ga0316180_11662732 161
161 3300003794 Ga0055531_10010210 Ga0055531_100102103 162
162 3300010375 Ga0105239_11825833 Ga0105239_118258332 162
163 3300025298 Ga0209050_1026970 Ga0209050_10269703 162
164 3300025304 Ga0209257_1005259 Ga0209257_100525918 162
165 3300032168 Ga0316593_10004460 Ga0316593_100044605 163
166 3300039062 Ga0400483_140144 Ga0400483_140144_7827_8360 163
167 3300041453 Ga0451797_0992688 Ga0451797_0992688_43_570 164
168 3300025906 Ga0207699_10078220 Ga0207699_100782203 165
169 3300038735 Ga0400485_14862 Ga0400485_14862_175_708 165
170 3300038741 Ga0400488_15834 Ga0400488_15834_324_857 165
171 3300039093 Ga0400489_31397 Ga0400489_31397_671_1204 165
172 3300039110 Ga0400487_54841 Ga0400487_54841_1028_1561 165
173 3300041509 Ga0451843_1079775 Ga0451843_1079775_89_616 166
174 3300035398 Ga0316574_0044745 Ga0316574_0044745_2205_2717 167
175 3300042007 Ga0439449_0005045 Ga0439449_0005045_4428_4955 167
176 3300060353 Ga0501082_0705965 Ga0501082_0705965_10_519 167
177 3300005440 Ga0070705_100038178 Ga0070705_1000381782 168
178 3300032168 Ga0316593_10000239 Ga0316593_1000023911 168
179 3300035119 Ga0373956_0359667 Ga0373956_0359667_32_553 168
180 3300037068 Ga0373925_0145852 Ga0373925_0145852_187_693 168
181 3300037068 Ga0373925_0377381 Ga0373925_0377381_297_818 168
182 3300044712 Ga0453684_1496887 Ga0453684_1496887_79_675 168
183 3300047322 Ga0495680_0208146 Ga0495680_0208146_766_1287 168
184 3300009098 Ga0105245_10179992 Ga0105245_101799922 169
185 3300009551 Ga0105238_10011245 Ga0105238_100112452 169
186 3300009551 Ga0105238_10570893 Ga0105238_105708932 169
187 3300013296 Ga0157374_10129052 Ga0157374_101290524 169
188 3300013297 Ga0157378_10368614 Ga0157378_103686143 169
189 3300013297 Ga0157378_10430644 Ga0157378_104306443 169
190 3300013306 Ga0163162_11132640 Ga0163162_111326402 169
191 3300013308 Ga0157375_10456203 Ga0157375_104562032 169
192 3300014325 Ga0163163_10877917 Ga0163163_108779172 169
193 3300014968 Ga0157379_11040273 Ga0157379_110402731 169
194 3300014969 Ga0157376_10011086 Ga0157376_100110866 169
195 3300031616 Ga0307508_10461006 Ga0307508_104610062 169
196 3300035691 Ga0373931_0574466 Ga0373931_0574466_172_681 169
197 3300046678 Ga0495599_0196548 Ga0495599_0196548_516_1025 169
198 3300046683 Ga0495658_0197867 Ga0495658_0197867_71_580 169
199 3300053085 Ga0495619_0938094 Ga0495619_0938094_21_530 169
200 3300042876 Ga0451577_0099931 Ga0451577_0099931_783_1310 170
201 iso_pu_bacteria 2524614729 2525556143 171
202 iso_pu_bacteria 2571042365 2572256429 171
203 iso_pu_bacteria 2576861471 2578459509 171
204 iso_pu_bacteria 2593339239 2595451356 171
205 iso_pu_bacteria 2627854209 2630648925 171
206 iso_pu_bacteria 2643221559 2643816142 171
207 iso_pu_bacteria 2643221573 2643877948 171
208 iso_pu_bacteria 2643221579 2643906216 171
209 iso_pu_bacteria 2643221581 2643915236 171
210 iso_pu_bacteria 2643221586 2643938170 171
211 iso_pu_bacteria 2643221593 2643975375 171
212 iso_pu_bacteria 2643221612 2644077742 171
213 iso_pu_bacteria 2643221695 2644530903 171
214 iso_pu_bacteria 2643221720 2644659258 171
215 iso_pu_bacteria 2643221727 2644695965 171
216 iso_pu_bacteria 2643221728 2644698596 171
217 iso_pu_bacteria 2718218334 2721028609 171
218 iso_pu_bacteria 2734482264 2735835800 171
219 iso_pu_bacteria 2739367700 2739732109 171
220 iso_pu_bacteria 2747842501 2748018108 171
221 iso_pu_bacteria 2818991440 2819566544 171
222 iso_pu_bacteria 2818991457 2819660628 171
223 iso_pu_bacteria 2842780639 2842781635 171
224 iso_pu_bacteria 2842914999 2842915016 171
225 iso_pu_bacteria 2852649853 2852653114 171
226 iso_pu_bacteria 2852684882 2852688832 171
227 iso_pu_bacteria 2857442823 2857445098 171
228 iso_pu_bacteria 2884338543 2884339578 171
229 iso_pu_bacteria 2884411467 2884413743 171
230 iso_pu_bacteria 2894414249 2894414509 171
231 iso_pu_bacteria 2895498888 2895501285 171
232 iso_pu_bacteria 2895511927 2895514428 171
233 iso_pu_bacteria 2895522137 2895524090 171
234 iso_pu_bacteria 2895525241 2895527578 171
235 iso_pu_bacteria 2904463128 2904467200 171
236 iso_pu_bacteria 2919085039 2919086785 171
237 iso_pu_bacteria 2919130084 2919130101 171
238 iso_pu_bacteria 2919513703 2919515177 171
239 iso_pu_bacteria 2919675420 2919678194 171
240 iso_pu_bacteria 2923516293 2923519214 171
241 iso_pu_bacteria 2928963466 2928964807 171
242 iso_pu_bacteria 2929195423 2929198904 171
243 iso_pu_bacteria 2939589442 2939591873 171
244 iso_pu_bacteria 2939622612 2939625899 171
245 iso_pu_bacteria 2941471342 2941473836 171
246 iso_pu_bacteria 2941475908 2941477264 171
247 iso_pu_bacteria 2941489479 2941490062 171
248 iso_pu_bacteria 2974307012 2974309962 171
249 iso_pu_bacteria 2977247770 2977250697 171
250 iso_pu_bacteria 2984514374 2984514818 171
251 iso_pu_bacteria 2987605356 2987605662 171
252 iso_pu_bacteria 2995948881 2995950378 171
253 iso_pu_bacteria 2998344455 2998344570 171
254 iso_pu_bacteria 8002869464 8002871459 171
255 iso_pu_bacteria 8021622325 8021626336 171
256 iso_pu_bacteria 8021626552 8021629629 171
257 iso_pu_bacteria 8021648035 8021649670 171
258 3300009174 Ga0105241_10005273 Ga0105241_1000527310 173
259 3300013104 Ga0157370_10081384 Ga0157370_100813845 173
260 3300020078 Ga0206352_10090970 Ga0206352_100909702 173
261 3300025911 Ga0207654_10001703 Ga0207654_100017038 173
262 3300031727 Ga0316576_10042328 Ga0316576_100423288 173
263 3300031728 Ga0316578_10094728 Ga0316578_100947283 173
264 3300032168 Ga0316593_10044635 Ga0316593_100446352 173
265 3300033527 Ga0316586_1013069 Ga0316586_10130692 173
266 3300033541 Ga0316596_1016205 Ga0316596_10162053 173
267 3300035398 Ga0316574_0168517 Ga0316574_0168517_209_736 173
268 3300049569 Ga0501032_0035974 Ga0501032_0035974_1203_1727 173
269 3300049571 Ga0501034_0019460 Ga0501034_0019460_4499_5023 173
270 3300049571 Ga0501034_0046150 Ga0501034_0046150_365_889 173
271 3300049571 Ga0501034_0058437 Ga0501034_0058437_1117_1641 173
272 3300049572 Ga0501036_0066071 Ga0501036_0066071_1040_1564 173
273 3300049572 Ga0501036_0375010 Ga0501036_0375010_353_877 173
274 3300049573 Ga0501037_0169994 Ga0501037_0169994_815_1339 173
275 3300049573 Ga0501037_0694921 Ga0501037_0694921_35_559 173
276 3300049574 Ga0501038_0014829 Ga0501038_0014829_1990_2514 173
277 3300049575 Ga0501039_0622365 Ga0501039_0622365_256_780 173
278 3300049579 Ga0501043_0157471 Ga0501043_0157471_492_1016 173
279 3300049580 Ga0501046_0032649 Ga0501046_0032649_3464_3988 173
280 3300049580 Ga0501046_0130950 Ga0501046_0130950_335_871 173
281 3300049581 Ga0501047_0000250 Ga0501047_0000250_7411_7935 173
282 3300049581 Ga0501047_0003863 Ga0501047_0003863_3698_4222 173
283 3300049581 Ga0501047_0023755 Ga0501047_0023755_4929_5453 173
284 3300049581 Ga0501047_0081417 Ga0501047_0081417_2577_3101 173
285 3300049583 Ga0501067_0004260 Ga0501067_0004260_3525_4049 173
286 3300049584 Ga0501068_0028942 Ga0501068_0028942_2311_2835 173
287 3300049586 Ga0501070_0003498 Ga0501070_0003498_9239_9763 173
288 3300049586 Ga0501070_0059664 Ga0501070_0059664_2146_2670 173
289 3300049588 Ga0501072_0002407 Ga0501072_0002407_11000_11524 173
290 3300049589 Ga0501073_0000196 Ga0501073_0000196_32032_32556 173
291 3300049589 Ga0501073_0103044 Ga0501073_0103044_1106_1630 173
292 3300049589 Ga0501073_0225558 Ga0501073_0225558_374_898 173
293 3300049590 Ga0501074_0034376 Ga0501074_0034376_2953_3477 173
294 3300049590 Ga0501074_0072834 Ga0501074_0072834_537_1061 173
295 3300049590 Ga0501074_0135788 Ga0501074_0135788_206_730 173
296 3300049590 Ga0501074_0204683 Ga0501074_0204683_88_612 173
297 3300049742 Ga0501080_0005488 Ga0501080_0005488_7478_8002 173
298 3300049742 Ga0501080_0021132 Ga0501080_0021132_5007_5531 173
299 3300049742 Ga0501080_0033694 Ga0501080_0033694_2543_3067 173
300 3300049742 Ga0501080_0204536 Ga0501080_0204536_726_1250 173
301 3300049744 Ga0501083_0000869 Ga0501083_0000869_801_1325 173
302 3300049822 Ga0501035_0299528 Ga0501035_0299528_559_1083 173
303 3300049823 Ga0501044_0062975 Ga0501044_0062975_2465_2989 173
304 3300049823 Ga0501044_0169027 Ga0501044_0169027_231_755 173
305 3300054114 Ga0501084_0167684 Ga0501084_0167684_1106_1630 173
306 3300005340 Ga0070689_100271608 Ga0070689_1002716083 174
307 3300005618 Ga0068864_100043033 Ga0068864_10004303310 174
308 3300005844 Ga0068862_100368143 Ga0068862_1003681432 174
309 3300009177 Ga0105248_10579378 Ga0105248_105793781 174
310 3300027312 Ga0209371_1000004 Ga0209371_10000041029 174
311 3300028380 Ga0268265_10430344 Ga0268265_104303443 174
312 3300030500 Ga0268256_1000005 Ga0268256_100000518 174
313 3300046455 Ga0495603_0366178 Ga0495603_0366178_125_664 174
314 3300046499 Ga0495594_0022504 Ga0495594_0022504_371_910 174
315 3300046681 Ga0495647_0064560 Ga0495647_0064560_619_1143 174
316 3300047321 Ga0495676_0022271 Ga0495676_0022271_4045_4584 174
317 3300001904 JGI24736J21556_1000834 JGI24736J21556_100083413 175
318 3300001904 JGI24736J21556_1047468 JGI24736J21556_10474681 175
319 3300001979 JGI24740J21852_10035166 JGI24740J21852_100351662 175
320 3300001989 JGI24739J22299_10040522 JGI24739J22299_100405223 175
321 3300001990 JGI24737J22298_10054758 JGI24737J22298_100547582 175
322 3300002067 JGI24735J21928_10003017 JGI24735J21928_100030175 175
323 3300002067 JGI24735J21928_10108296 JGI24735J21928_101082962 175
324 3300002067 JGI24735J21928_10114158 JGI24735J21928_101141582 175
325 3300002077 JGI24744J21845_10037822 JGI24744J21845_100378221 175
326 3300002705 JGI25156J39149_1008281 JGI25156J39149_10082813 175
327 3300002705 JGI25156J39149_1018608 JGI25156J39149_10186082 175
328 3300002737 JGI25162J39368_1003971 JGI25162J39368_10039711 175
329 3300002737 JGI25162J39368_1003976 JGI25162J39368_10039766 175
330 3300002741 JGI25157J39369_1002257 JGI25157J39369_10022576 175
331 3300002741 JGI25157J39369_1002916 JGI25157J39369_10029161 175
332 3300002771 JGI25163J39215_1001042 JGI25163J39215_100104210 175
333 3300002772 JGI25164J39214_1000781 JGI25164J39214_100078119 175
334 3300002773 JGI25152J39213_1000284 JGI25152J39213_100028427 175
335 3300002774 JGI25150J39212_1000359 JGI25150J39212_100035917 175
336 3300003187 JGI25151J46595_10000875 JGI25151J46595_1000087528 175
337 3300003187 JGI25151J46595_10000895 JGI25151J46595_1000089519 175
338 3300003214 JGI25165J46597_1001532 JGI25165J46597_10015326 175
339 3300003215 JGI25153J46596_10000050 JGI25153J46596_10000050140 175
340 3300003305 Ga0006770J48903_1011541 Ga0006770J48903_10115412 175
341 3300003320 rootH2_10053540 rootH2_100535408 175
342 3300003371 JGI26145J50221_1000790 JGI26145J50221_10007904 175
343 3300003751 Ga0055538_1000680 Ga0055538_10006807 175
344 3300003756 Ga0055533_1001562 Ga0055533_10015626 175
345 3300003760 Ga0055527_1004213 Ga0055527_10042132 175
346 3300003761 Ga0055535_1000430 Ga0055535_10004302 175
347 3300003762 Ga0055542_1003964 Ga0055542_10039641 175
348 3300003762 Ga0055542_1003969 Ga0055542_10039691 175
349 3300003763 Ga0055529_1000211 Ga0055529_100021171 175
350 3300003771 Ga0055526_1002877 Ga0055526_100287714 175
351 3300003771 Ga0055526_1007687 Ga0055526_10076876 175
352 3300003773 Ga0055537_1000851 Ga0055537_100085118 175
353 3300003773 Ga0055537_1001096 Ga0055537_100109617 175
354 3300003775 Ga0055524_1002940 Ga0055524_10029406 175
355 3300003775 Ga0055524_1003518 Ga0055524_100351813 175
356 3300003781 Ga0055536_1005265 Ga0055536_10052659 175
357 3300003784 Ga0055534_1000515 Ga0055534_10005159 175
358 3300003784 Ga0055534_1000766 Ga0055534_100076617 175
359 3300003790 Ga0055528_1000337 Ga0055528_10003379 175
360 3300003790 Ga0055528_1001961 Ga0055528_100196118 175
361 3300003791 Ga0055530_10033191 Ga0055530_100331913 175
362 3300003791 Ga0055530_10042052 Ga0055530_100420521 175
363 3300003856 Ga0058692_1000748 Ga0058692_100074817 175
364 3300004800 Ga0058861_11979571 Ga0058861_119795712 175
365 3300004801 Ga0058860_10022916 Ga0058860_100229166 175
366 3300005262 Ga0065165_1029273 Ga0065165_10292732 175
367 3300005288 Ga0065714_10068935 Ga0065714_100689353 175
368 3300005289 Ga0065704_10071113 Ga0065704_1007111313 175
369 3300005289 Ga0065704_10232484 Ga0065704_102324841 175
370 3300005293 Ga0065715_10192822 Ga0065715_101928222 175
371 3300005293 Ga0065715_10203690 Ga0065715_102036901 175
372 3300005293 Ga0065715_10234020 Ga0065715_102340203 175
373 3300005327 Ga0070658_10028046 Ga0070658_100280469 175
374 3300005327 Ga0070658_10332034 Ga0070658_103320342 175
375 3300005327 Ga0070658_10557595 Ga0070658_105575952 175
376 3300005329 Ga0070683_100005998 Ga0070683_10000599810 175
377 3300005329 Ga0070683_100472128 Ga0070683_1004721282 175
378 3300005330 Ga0070690_100087300 Ga0070690_1000873002 175
379 3300005330 Ga0070690_100113234 Ga0070690_1001132343 175
380 3300005330 Ga0070690_100503144 Ga0070690_1005031442 175
381 3300005331 Ga0070670_100009626 Ga0070670_1000096268 175
382 3300005331 Ga0070670_100066391 Ga0070670_1000663912 175
383 3300005331 Ga0070670_100322590 Ga0070670_1003225901 175
384 3300005331 Ga0070670_100345019 Ga0070670_1003450191 175
385 3300005331 Ga0070670_100442210 Ga0070670_1004422102 175
386 3300005331 Ga0070670_100919229 Ga0070670_1009192291 175
387 3300005331 Ga0070670_101127536 Ga0070670_1011275361 175
388 3300005334 Ga0068869_100051998 Ga0068869_1000519985 175
389 3300005334 Ga0068869_100126554 Ga0068869_1001265543 175
390 3300005334 Ga0068869_100272095 Ga0068869_1002720953 175
391 3300005334 Ga0068869_100618088 Ga0068869_1006180881 175
392 3300005334 Ga0068869_100820176 Ga0068869_1008201761 175
393 3300005334 Ga0068869_100886187 Ga0068869_1008861871 175
394 3300005334 Ga0068869_101334180 Ga0068869_1013341801 175
395 3300005335 Ga0070666_10039068 Ga0070666_100390686 175
396 3300005335 Ga0070666_10126568 Ga0070666_101265682 175
397 3300005335 Ga0070666_10128706 Ga0070666_101287062 175
398 3300005336 Ga0070680_100009233 Ga0070680_1000092336 175
399 3300005336 Ga0070680_100117602 Ga0070680_1001176022 175
400 3300005336 Ga0070680_100168471 Ga0070680_1001684712 175
401 3300005336 Ga0070680_100459420 Ga0070680_1004594201 175
402 3300005337 Ga0070682_100031523 Ga0070682_1000315236 175
403 3300005337 Ga0070682_100093827 Ga0070682_1000938273 175
404 3300005337 Ga0070682_100149406 Ga0070682_1001494063 175
405 3300005337 Ga0070682_100633926 Ga0070682_1006339262 175
406 3300005338 Ga0068868_100046236 Ga0068868_1000462364 175
407 3300005338 Ga0068868_100140719 Ga0068868_1001407193 175
408 3300005338 Ga0068868_100671446 Ga0068868_1006714462 175
409 3300005338 Ga0068868_101147625 Ga0068868_1011476251 175
410 3300005339 Ga0070660_100235475 Ga0070660_1002354752 175
411 3300005339 Ga0070660_100500606 Ga0070660_1005006062 175
412 3300005339 Ga0070660_100510198 Ga0070660_1005101982 175
413 3300005339 Ga0070660_100663788 Ga0070660_1006637882 175
414 3300005340 Ga0070689_100013126 Ga0070689_10001312613 175
415 3300005340 Ga0070689_100278193 Ga0070689_1002781933 175
416 3300005341 Ga0070691_10557179 Ga0070691_105571791 175
417 3300005343 Ga0070687_100132497 Ga0070687_1001324972 175
418 3300005344 Ga0070661_100041400 Ga0070661_1000414006 175
419 3300005344 Ga0070661_100043750 Ga0070661_1000437506 175
420 3300005344 Ga0070661_100188710 Ga0070661_1001887102 175
421 3300005344 Ga0070661_100242423 Ga0070661_1002424232 175
422 3300005344 Ga0070661_100683924 Ga0070661_1006839241 175
423 3300005347 Ga0070668_100004499 Ga0070668_1000044999 175
424 3300005347 Ga0070668_100005082 Ga0070668_10000508210 175
425 3300005347 Ga0070668_100021079 Ga0070668_10002107910 175
426 3300005347 Ga0070668_100109540 Ga0070668_1001095403 175
427 3300005347 Ga0070668_100241825 Ga0070668_1002418251 175
428 3300005347 Ga0070668_100437102 Ga0070668_1004371021 175
429 3300005353 Ga0070669_100034453 Ga0070669_1000344535 175
430 3300005353 Ga0070669_100157626 Ga0070669_1001576262 175
431 3300005353 Ga0070669_100574888 Ga0070669_1005748881 175
432 3300005354 Ga0070675_100156884 Ga0070675_1001568843 175
433 3300005354 Ga0070675_100188013 Ga0070675_1001880134 175
434 3300005354 Ga0070675_100625047 Ga0070675_1006250471 175
435 3300005355 Ga0070671_100019224 Ga0070671_1000192243 175
436 3300005355 Ga0070671_100024367 Ga0070671_1000243676 175
437 3300005355 Ga0070671_100080639 Ga0070671_1000806394 175
438 3300005355 Ga0070671_100264946 Ga0070671_1002649463 175
439 3300005355 Ga0070671_100642465 Ga0070671_1006424652 175
440 3300005356 Ga0070674_100304962 Ga0070674_1003049623 175
441 3300005356 Ga0070674_100364718 Ga0070674_1003647181 175
442 3300005356 Ga0070674_100764365 Ga0070674_1007643651 175
443 3300005356 Ga0070674_101000898 Ga0070674_1010008981 175
444 3300005356 Ga0070674_101052170 Ga0070674_1010521701 175
445 3300005364 Ga0070673_100015167 Ga0070673_1000151678 175
446 3300005364 Ga0070673_100069532 Ga0070673_1000695323 175
447 3300005364 Ga0070673_100101289 Ga0070673_1001012892 175
448 3300005364 Ga0070673_100120687 Ga0070673_1001206874 175
449 3300005364 Ga0070673_100124144 Ga0070673_1001241442 175
450 3300005364 Ga0070673_100655023 Ga0070673_1006550232 175
451 3300005365 Ga0070688_100100587 Ga0070688_1001005874 175
452 3300005365 Ga0070688_100567565 Ga0070688_1005675651 175
453 3300005366 Ga0070659_100054696 Ga0070659_1000546966 175
454 3300005366 Ga0070659_100214052 Ga0070659_1002140522 175
455 3300005367 Ga0070667_100000041 Ga0070667_10000004110 175
456 3300005367 Ga0070667_100019921 Ga0070667_1000199216 175
457 3300005367 Ga0070667_100048376 Ga0070667_1000483767 175
458 3300005367 Ga0070667_100052533 Ga0070667_1000525335 175
459 3300005367 Ga0070667_100129962 Ga0070667_1001299623 175
460 3300005367 Ga0070667_100169391 Ga0070667_1001693912 175
461 3300005367 Ga0070667_100185543 Ga0070667_1001855433 175
462 3300005367 Ga0070667_101037565 Ga0070667_1010375651 175
463 3300005434 Ga0070709_11242304 Ga0070709_112423041 175
464 3300005435 Ga0070714_100050142 Ga0070714_1000501423 175
465 3300005438 Ga0070701_10012276 Ga0070701_100122761 175
466 3300005439 Ga0070711_100102588 Ga0070711_1001025884 175
467 3300005439 Ga0070711_100249802 Ga0070711_1002498022 175
468 3300005440 Ga0070705_100034980 Ga0070705_1000349806 175
469 3300005440 Ga0070705_100183457 Ga0070705_1001834572 175
470 3300005441 Ga0070700_100366844 Ga0070700_1003668442 175
471 3300005455 Ga0070663_100005120 Ga0070663_1000051206 175
472 3300005455 Ga0070663_100201519 Ga0070663_1002015191 175
473 3300005456 Ga0070678_100003045 Ga0070678_1000030456 175
474 3300005456 Ga0070678_100354484 Ga0070678_1003544843 175
475 3300005456 Ga0070678_100473856 Ga0070678_1004738561 175
476 3300005457 Ga0070662_100046907 Ga0070662_1000469072 175
477 3300005457 Ga0070662_100156849 Ga0070662_1001568493 175
478 3300005458 Ga0070681_10161015 Ga0070681_101610153 175
479 3300005458 Ga0070681_10648487 Ga0070681_106484872 175
480 3300005459 Ga0068867_100054381 Ga0068867_1000543813 175
481 3300005459 Ga0068867_100100023 Ga0068867_1001000234 175
482 3300005459 Ga0068867_100131746 Ga0068867_1001317462 175
483 3300005459 Ga0068867_100166242 Ga0068867_1001662422 175
484 3300005459 Ga0068867_100292499 Ga0068867_1002924993 175
485 3300005459 Ga0068867_100408075 Ga0068867_1004080752 175
486 3300005459 Ga0068867_101339846 Ga0068867_1013398461 175
487 3300005466 Ga0070685_10002255 Ga0070685_1000225516 175
488 3300005466 Ga0070685_10075272 Ga0070685_100752724 175
489 3300005466 Ga0070685_10101298 Ga0070685_101012982 175
490 3300005530 Ga0070679_100051814 Ga0070679_1000518145 175
491 3300005530 Ga0070679_100092348 Ga0070679_1000923483 175
492 3300005530 Ga0070679_100110859 Ga0070679_1001108593 175
493 3300005535 Ga0070684_100247020 Ga0070684_1002470204 175
494 3300005535 Ga0070684_100293550 Ga0070684_1002935502 175
495 3300005535 Ga0070684_100650158 Ga0070684_1006501581 175
496 3300005539 Ga0068853_100008715 Ga0068853_10000871516 175
497 3300005539 Ga0068853_100015734 Ga0068853_1000157342 175
498 3300005539 Ga0068853_100025130 Ga0068853_1000251306 175
499 3300005539 Ga0068853_100057074 Ga0068853_1000570743 175
500 3300005539 Ga0068853_100067142 Ga0068853_1000671425 175
501 3300005539 Ga0068853_100413888 Ga0068853_1004138882 175
502 3300005539 Ga0068853_101352240 Ga0068853_1013522401 175
503 3300005543 Ga0070672_100003683 Ga0070672_10000368316 175
504 3300005543 Ga0070672_100029396 Ga0070672_1000293966 175
505 3300005543 Ga0070672_101057477 Ga0070672_1010574772 175
506 3300005544 Ga0070686_100162059 Ga0070686_1001620593 175
507 3300005544 Ga0070686_101147146 Ga0070686_1011471461 175
508 3300005547 Ga0070693_100005307 Ga0070693_1000053076 175
509 3300005547 Ga0070693_100007266 Ga0070693_1000072663 175
510 3300005547 Ga0070693_100092699 Ga0070693_1000926992 175
511 3300005548 Ga0070665_100003465 Ga0070665_10000346510 175
512 3300005548 Ga0070665_100016134 Ga0070665_1000161346 175
513 3300005548 Ga0070665_100022127 Ga0070665_1000221273 175
514 3300005548 Ga0070665_100052341 Ga0070665_1000523416 175
515 3300005548 Ga0070665_100056908 Ga0070665_1000569083 175
516 3300005548 Ga0070665_100088333 Ga0070665_1000883337 175
517 3300005548 Ga0070665_100280401 Ga0070665_1002804012 175
518 3300005548 Ga0070665_100313974 Ga0070665_1003139742 175
519 3300005548 Ga0070665_100373744 Ga0070665_1003737442 175
520 3300005548 Ga0070665_100766688 Ga0070665_1007666881 175
521 3300005549 Ga0070704_100096958 Ga0070704_1000969584 175
522 3300005563 Ga0068855_100015530 Ga0068855_1000155308 175
523 3300005563 Ga0068855_100171806 Ga0068855_1001718063 175
524 3300005563 Ga0068855_100185140 Ga0068855_1001851401 175
525 3300005563 Ga0068855_100186783 Ga0068855_1001867832 175
526 3300005563 Ga0068855_100547571 Ga0068855_1005475712 175
527 3300005563 Ga0068855_100718752 Ga0068855_1007187521 175
528 3300005563 Ga0068855_101410246 Ga0068855_1014102461 175
529 3300005563 Ga0068855_101444303 Ga0068855_1014443032 175
530 3300005564 Ga0070664_100014116 Ga0070664_1000141168 175
531 3300005564 Ga0070664_100047403 Ga0070664_1000474034 175
532 3300005564 Ga0070664_100206298 Ga0070664_1002062983 175
533 3300005564 Ga0070664_100909069 Ga0070664_1009090692 175
534 3300005564 Ga0070664_101227016 Ga0070664_1012270162 175
535 3300005577 Ga0068857_100003667 Ga0068857_10000366718 175
536 3300005577 Ga0068857_100061917 Ga0068857_1000619173 175
537 3300005577 Ga0068857_100108711 Ga0068857_1001087115 175
538 3300005577 Ga0068857_100176336 Ga0068857_1001763362 175
539 3300005577 Ga0068857_101107039 Ga0068857_1011070391 175
540 3300005578 Ga0068854_100166565 Ga0068854_1001665653 175
541 3300005578 Ga0068854_100196395 Ga0068854_1001963951 175
542 3300005578 Ga0068854_100335677 Ga0068854_1003356772 175
543 3300005614 Ga0068856_100065387 Ga0068856_1000653873 175
544 3300005614 Ga0068856_100345963 Ga0068856_1003459633 175
545 3300005614 Ga0068856_100399164 Ga0068856_1003991642 175
546 3300005615 Ga0070702_100390337 Ga0070702_1003903371 175
547 3300005616 Ga0068852_100064710 Ga0068852_1000647105 175
548 3300005616 Ga0068852_100212363 Ga0068852_1002123632 175
549 3300005616 Ga0068852_100328351 Ga0068852_1003283512 175
550 3300005616 Ga0068852_100335718 Ga0068852_1003357182 175
551 3300005616 Ga0068852_100373462 Ga0068852_1003734623 175
552 3300005616 Ga0068852_100392425 Ga0068852_1003924252 175
553 3300005616 Ga0068852_100703433 Ga0068852_1007034332 175
554 3300005616 Ga0068852_100727088 Ga0068852_1007270882 175
555 3300005617 Ga0068859_100000821 Ga0068859_10000082110 175
556 3300005617 Ga0068859_100047020 Ga0068859_1000470207 175
557 3300005617 Ga0068859_100077312 Ga0068859_1000773123 175
558 3300005617 Ga0068859_100100348 Ga0068859_1001003484 175
559 3300005617 Ga0068859_100295949 Ga0068859_1002959492 175
560 3300005617 Ga0068859_100469890 Ga0068859_1004698902 175
561 3300005618 Ga0068864_100100368 Ga0068864_1001003682 175
562 3300005618 Ga0068864_100182189 Ga0068864_1001821893 175
563 3300005618 Ga0068864_100410441 Ga0068864_1004104413 175
564 3300005618 Ga0068864_101208762 Ga0068864_1012087622 175
565 3300005718 Ga0068866_10091532 Ga0068866_100915324 175
566 3300005719 Ga0068861_100097092 Ga0068861_1000970926 175
567 3300005719 Ga0068861_100977739 Ga0068861_1009777392 175
568 3300005719 Ga0068861_101204233 Ga0068861_1012042332 175
569 3300005719 Ga0068861_101298344 Ga0068861_1012983442 175
570 3300005834 Ga0068851_10001861 Ga0068851_100018619 175
571 3300005834 Ga0068851_10032527 Ga0068851_100325273 175
572 3300005834 Ga0068851_10166835 Ga0068851_101668352 175
573 3300005834 Ga0068851_10390735 Ga0068851_103907352 175
574 3300005840 Ga0068870_10001674 Ga0068870_1000167416 175
575 3300005840 Ga0068870_10164633 Ga0068870_101646331 175
576 3300005841 Ga0068863_100034622 Ga0068863_1000346226 175
577 3300005841 Ga0068863_100075635 Ga0068863_1000756356 175
578 3300005841 Ga0068863_100095504 Ga0068863_1000955042 175
579 3300005841 Ga0068863_100133077 Ga0068863_1001330774 175
580 3300005841 Ga0068863_100133664 Ga0068863_1001336642 175
581 3300005841 Ga0068863_100156589 Ga0068863_1001565893 175
582 3300005841 Ga0068863_100263747 Ga0068863_1002637472 175
583 3300005841 Ga0068863_100302884 Ga0068863_1003028842 175
584 3300005841 Ga0068863_100314929 Ga0068863_1003149292 175
585 3300005841 Ga0068863_100316460 Ga0068863_1003164604 175
586 3300005841 Ga0068863_100368482 Ga0068863_1003684821 175
587 3300005841 Ga0068863_100430014 Ga0068863_1004300142 175
588 3300005841 Ga0068863_101228667 Ga0068863_1012286672 175
589 3300005842 Ga0068858_100120642 Ga0068858_1001206422 175
590 3300005842 Ga0068858_100189100 Ga0068858_1001891002 175
591 3300005842 Ga0068858_100243518 Ga0068858_1002435184 175
592 3300005842 Ga0068858_100282235 Ga0068858_1002822351 175
593 3300005843 Ga0068860_100055255 Ga0068860_1000552556 175
594 3300005843 Ga0068860_100071711 Ga0068860_1000717114 175
595 3300005843 Ga0068860_100074726 Ga0068860_1000747263 175
596 3300005843 Ga0068860_100094498 Ga0068860_1000944983 175
597 3300005843 Ga0068860_100196548 Ga0068860_1001965483 175
598 3300005843 Ga0068860_100248523 Ga0068860_1002485232 175
599 3300005843 Ga0068860_100950479 Ga0068860_1009504792 175
600 3300005844 Ga0068862_100007184 Ga0068862_10000718413 175
601 3300005844 Ga0068862_100010918 Ga0068862_1000109186 175
602 3300005844 Ga0068862_100098243 Ga0068862_1000982435 175
603 3300005844 Ga0068862_100145559 Ga0068862_1001455591 175
604 3300005844 Ga0068862_100198509 Ga0068862_1001985094 175
605 3300005937 Ga0081455_10005678 Ga0081455_1000567814 175
606 3300005937 Ga0081455_10008699 Ga0081455_1000869913 175
607 3300005937 Ga0081455_10219098 Ga0081455_102190982 175
608 3300005983 Ga0081540_1000720 Ga0081540_100072025 175
609 3300006038 Ga0075365_10097727 Ga0075365_100977274 175
610 3300006038 Ga0075365_10219488 Ga0075365_102194881 175
611 3300006042 Ga0075368_10066230 Ga0075368_100662302 175
612 3300006042 Ga0075368_10109359 Ga0075368_101093592 175
613 3300006048 Ga0075363_100177225 Ga0075363_1001772252 175
614 3300006051 Ga0075364_10005109 Ga0075364_1000510911 175
615 3300006051 Ga0075364_10023952 Ga0075364_100239526 175
616 3300006051 Ga0075364_10107669 Ga0075364_101076693 175
617 3300006051 Ga0075364_10271566 Ga0075364_102715662 175
618 3300006175 Ga0070712_100962528 Ga0070712_1009625281 175
619 3300006178 Ga0075367_10075360 Ga0075367_100753603 175
620 3300006178 Ga0075367_10079340 Ga0075367_100793402 175
621 3300006178 Ga0075367_10088726 Ga0075367_100887262 175
622 3300006178 Ga0075367_10339350 Ga0075367_103393501 175
623 3300006186 Ga0075369_10001295 Ga0075369_100012956 175
624 3300006195 Ga0075366_10007118 Ga0075366_100071186 175
625 3300006195 Ga0075366_10284117 Ga0075366_102841172 175
626 3300006195 Ga0075366_10560333 Ga0075366_105603332 175
627 3300006237 Ga0097621_100044846 Ga0097621_1000448462 175
628 3300006237 Ga0097621_100201163 Ga0097621_1002011632 175
629 3300006237 Ga0097621_100201179 Ga0097621_1002011794 175
630 3300006237 Ga0097621_100217295 Ga0097621_1002172952 175
631 3300006237 Ga0097621_100317375 Ga0097621_1003173753 175
632 3300006237 Ga0097621_100474772 Ga0097621_1004747722 175
633 3300006237 Ga0097621_100537699 Ga0097621_1005376992 175
634 3300006237 Ga0097621_100620308 Ga0097621_1006203082 175
635 3300006358 Ga0068871_100083209 Ga0068871_1000832092 175
636 3300006358 Ga0068871_100119596 Ga0068871_1001195964 175
637 3300006358 Ga0068871_100124683 Ga0068871_1001246833 175
638 3300006358 Ga0068871_100125011 Ga0068871_1001250112 175
639 3300006358 Ga0068871_100149876 Ga0068871_1001498762 175
640 3300006358 Ga0068871_100197537 Ga0068871_1001975373 175
641 3300006358 Ga0068871_100289939 Ga0068871_1002899393 175
642 3300006358 Ga0068871_100316311 Ga0068871_1003163113 175
643 3300006358 Ga0068871_100425426 Ga0068871_1004254263 175
644 3300006358 Ga0068871_100577275 Ga0068871_1005772751 175
645 3300006358 Ga0068871_100796156 Ga0068871_1007961562 175
646 3300006844 Ga0075428_101428756 Ga0075428_1014287562 175
647 3300006847 Ga0075431_101131372 Ga0075431_1011313721 175
648 3300006880 Ga0075429_100844714 Ga0075429_1008447142 175
649 3300006881 Ga0068865_100010514 Ga0068865_1000105146 175
650 3300006881 Ga0068865_100021451 Ga0068865_1000214519 175
651 3300006881 Ga0068865_100043232 Ga0068865_1000432324 175
652 3300006881 Ga0068865_100091433 Ga0068865_1000914334 175
653 3300006881 Ga0068865_100111188 Ga0068865_1001111882 175
654 3300006881 Ga0068865_100331613 Ga0068865_1003316132 175
655 3300006881 Ga0068865_100463145 Ga0068865_1004631452 175
656 3300006881 Ga0068865_100581801 Ga0068865_1005818012 175
657 3300006931 Ga0097620_100000821 Ga0097620_10000082132 175
658 3300006931 Ga0097620_100047018 Ga0097620_1000470185 175
659 3300006931 Ga0097620_100077315 Ga0097620_1000773153 175
660 3300006931 Ga0097620_100100349 Ga0097620_1001003494 175
661 3300006931 Ga0097620_100295946 Ga0097620_1002959462 175
662 3300006931 Ga0097620_100469899 Ga0097620_1004698992 175
663 3300009011 Ga0105251_10003747 Ga0105251_100037478 175
664 3300009011 Ga0105251_10004901 Ga0105251_100049018 175
665 3300009011 Ga0105251_10197764 Ga0105251_101977643 175
666 3300009036 Ga0105244_10017928 Ga0105244_100179286 175
667 3300009093 Ga0105240_10086775 Ga0105240_100867756 175
668 3300009093 Ga0105240_10128791 Ga0105240_101287913 175
669 3300009093 Ga0105240_10160771 Ga0105240_101607712 175
670 3300009093 Ga0105240_10202641 Ga0105240_102026414 175
671 3300009093 Ga0105240_10238665 Ga0105240_102386653 175
672 3300009093 Ga0105240_10715373 Ga0105240_107153732 175
673 3300009094 Ga0111539_10529840 Ga0111539_105298403 175
674 3300009094 Ga0111539_11260745 Ga0111539_112607451 175
675 3300009098 Ga0105245_10484807 Ga0105245_104848072 175
676 3300009098 Ga0105245_10522000 Ga0105245_105220001 175
677 3300009098 Ga0105245_10605088 Ga0105245_106050882 175
678 3300009098 Ga0105245_12192708 Ga0105245_121927081 175
679 3300009101 Ga0105247_10001324 Ga0105247_1000132418 175
680 3300009101 Ga0105247_10174964 Ga0105247_101749642 175
681 3300009148 Ga0105243_10023664 Ga0105243_100236646 175
682 3300009148 Ga0105243_10194189 Ga0105243_101941892 175
683 3300009148 Ga0105243_10386395 Ga0105243_103863953 175
684 3300009174 Ga0105241_10066619 Ga0105241_100666197 175
685 3300009174 Ga0105241_10131531 Ga0105241_101315313 175
686 3300009174 Ga0105241_10238080 Ga0105241_102380803 175
687 3300009174 Ga0105241_10998717 Ga0105241_109987172 175
688 3300009176 Ga0105242_10003026 Ga0105242_1000302618 175
689 3300009176 Ga0105242_10091596 Ga0105242_100915964 175
690 3300009176 Ga0105242_10656164 Ga0105242_106561642 175
691 3300009176 Ga0105242_10830223 Ga0105242_108302232 175
692 3300009177 Ga0105248_10001072 Ga0105248_1000107210 175
693 3300009177 Ga0105248_10123110 Ga0105248_101231106 175
694 3300009177 Ga0105248_10199596 Ga0105248_101995963 175
695 3300009177 Ga0105248_10208334 Ga0105248_102083343 175
696 3300009177 Ga0105248_10293579 Ga0105248_102935794 175
697 3300009177 Ga0105248_10364582 Ga0105248_103645822 175
698 3300009177 Ga0105248_10429223 Ga0105248_104292233 175
699 3300009545 Ga0105237_10001741 Ga0105237_1000174126 175
700 3300009545 Ga0105237_10068309 Ga0105237_100683095 175
701 3300009545 Ga0105237_10114626 Ga0105237_101146266 175
702 3300009545 Ga0105237_10191009 Ga0105237_101910094 175
703 3300009545 Ga0105237_10196600 Ga0105237_101966003 175
704 3300009545 Ga0105237_10552835 Ga0105237_105528352 175
705 3300009545 Ga0105237_11472593 Ga0105237_114725931 175
706 3300009551 Ga0105238_10016928 Ga0105238_100169282 175
707 3300009551 Ga0105238_10090969 Ga0105238_100909693 175
708 3300009551 Ga0105238_10302652 Ga0105238_103026523 175
709 3300009551 Ga0105238_10327654 Ga0105238_103276543 175
710 3300009551 Ga0105238_10387569 Ga0105238_103875693 175
711 3300009551 Ga0105238_10551670 Ga0105238_105516702 175
712 3300009551 Ga0105238_11102043 Ga0105238_111020432 175
713 3300009553 Ga0105249_10011360 Ga0105249_100113608 175
714 3300009553 Ga0105249_10057209 Ga0105249_100572099 175
715 3300009553 Ga0105249_10062574 Ga0105249_100625743 175
716 3300009553 Ga0105249_10484018 Ga0105249_104840181 175
717 3300009553 Ga0105249_11463031 Ga0105249_114630311 175
718 3300009553 Ga0105249_11813606 Ga0105249_118136062 175
719 3300009979 Ga0105032_101157 Ga0105032_1011575 175
720 3300009984 Ga0105029_100427 Ga0105029_1004272 175
721 3300010375 Ga0105239_10003327 Ga0105239_1000332722 175
722 3300010375 Ga0105239_10016344 Ga0105239_100163449 175
723 3300010375 Ga0105239_10018940 Ga0105239_100189406 175
724 3300010375 Ga0105239_10020863 Ga0105239_1002086311 175
725 3300010375 Ga0105239_10042333 Ga0105239_100423337 175
726 3300010375 Ga0105239_10055573 Ga0105239_100555732 175
727 3300010375 Ga0105239_10120664 Ga0105239_101206645 175
728 3300010375 Ga0105239_10143682 Ga0105239_101436825 175
729 3300010375 Ga0105239_10149661 Ga0105239_101496613 175
730 3300010375 Ga0105239_10154924 Ga0105239_101549244 175
731 3300010375 Ga0105239_10189726 Ga0105239_101897264 175
732 3300010375 Ga0105239_10200501 Ga0105239_102005012 175
733 3300010375 Ga0105239_10238652 Ga0105239_102386523 175
734 3300010375 Ga0105239_11378191 Ga0105239_113781912 175
735 3300011119 Ga0105246_10178170 Ga0105246_101781703 175
736 3300011119 Ga0105246_10197230 Ga0105246_101972303 175
737 3300012480 Ga0157346_1003663 Ga0157346_10036632 175
738 3300012482 Ga0157318_1000250 Ga0157318_10002503 175
739 3300012482 Ga0157318_1003764 Ga0157318_10037641 175
740 3300012488 Ga0157343_1004258 Ga0157343_10042582 175
741 3300012500 Ga0157314_1001705 Ga0157314_10017051 175
742 3300012507 Ga0157342_1001415 Ga0157342_10014152 175
743 3300012508 Ga0157315_1006471 Ga0157315_10064712 175
744 3300012510 Ga0157316_1000683 Ga0157316_10006832 175
745 3300012510 Ga0157316_1004647 Ga0157316_10046472 175
746 3300013100 Ga0157373_10080169 Ga0157373_100801694 175
747 3300013100 Ga0157373_10245558 Ga0157373_102455582 175
748 3300013100 Ga0157373_10259665 Ga0157373_102596652 175
749 3300013100 Ga0157373_10352023 Ga0157373_103520232 175
750 3300013100 Ga0157373_10367408 Ga0157373_103674082 175
751 3300013100 Ga0157373_10394601 Ga0157373_103946012 175
752 3300013102 Ga0157371_10038945 Ga0157371_100389456 175
753 3300013102 Ga0157371_10108905 Ga0157371_101089054 175
754 3300013102 Ga0157371_10204654 Ga0157371_102046542 175
755 3300013104 Ga0157370_10039480 Ga0157370_1003948010 175
756 3300013104 Ga0157370_10087152 Ga0157370_100871525 175
757 3300013104 Ga0157370_10142708 Ga0157370_101427083 175
758 3300013104 Ga0157370_10221701 Ga0157370_102217014 175
759 3300013104 Ga0157370_10240141 Ga0157370_102401412 175
760 3300013105 Ga0157369_10000125 Ga0157369_10000125103 175
761 3300013105 Ga0157369_10004613 Ga0157369_1000461317 175
762 3300013105 Ga0157369_10132341 Ga0157369_101323413 175
763 3300013105 Ga0157369_10149485 Ga0157369_101494851 175
764 3300013105 Ga0157369_10253792 Ga0157369_102537924 175
765 3300013105 Ga0157369_10529157 Ga0157369_105291572 175
766 3300013296 Ga0157374_10029479 Ga0157374_1002947910 175
767 3300013296 Ga0157374_10060988 Ga0157374_100609886 175
768 3300013296 Ga0157374_10113252 Ga0157374_101132525 175
769 3300013296 Ga0157374_10209599 Ga0157374_102095994 175
770 3300013296 Ga0157374_11601822 Ga0157374_116018221 175
771 3300013297 Ga0157378_10000289 Ga0157378_1000028951 175
772 3300013297 Ga0157378_10941009 Ga0157378_109410092 175
773 3300013297 Ga0157378_11082657 Ga0157378_110826572 175
774 3300013306 Ga0163162_10008705 Ga0163162_100087056 175
775 3300013306 Ga0163162_10056316 Ga0163162_100563167 175
776 3300013306 Ga0163162_10158528 Ga0163162_101585284 175
777 3300013306 Ga0163162_10272283 Ga0163162_102722833 175
778 3300013306 Ga0163162_10459335 Ga0163162_104593352 175
779 3300013306 Ga0163162_10491825 Ga0163162_104918252 175
780 3300013306 Ga0163162_12658820 Ga0163162_126588201 175
781 3300013307 Ga0157372_10009889 Ga0157372_1000988913 175
782 3300013307 Ga0157372_10070322 Ga0157372_100703226 175
783 3300013307 Ga0157372_10099846 Ga0157372_100998463 175
784 3300013307 Ga0157372_10364036 Ga0157372_103640361 175
785 3300013307 Ga0157372_10488599 Ga0157372_104885992 175
786 3300013307 Ga0157372_10549579 Ga0157372_105495793 175
787 3300013307 Ga0157372_10990840 Ga0157372_109908402 175
788 3300013307 Ga0157372_11169011 Ga0157372_111690111 175
789 3300013308 Ga0157375_10000319 Ga0157375_1000031917 175
790 3300013308 Ga0157375_10234646 Ga0157375_102346462 175
791 3300013308 Ga0157375_10250739 Ga0157375_102507392 175
792 3300013308 Ga0157375_10531501 Ga0157375_105315012 175
793 3300014325 Ga0163163_10000243 Ga0163163_1000024357 175
794 3300014325 Ga0163163_10004211 Ga0163163_100042118 175
795 3300014325 Ga0163163_10045808 Ga0163163_100458086 175
796 3300014325 Ga0163163_10309542 Ga0163163_103095422 175
797 3300014325 Ga0163163_11428822 Ga0163163_114288221 175
798 3300014326 Ga0157380_11176081 Ga0157380_111760811 175
799 3300014326 Ga0157380_11356146 Ga0157380_113561461 175
800 3300014497 Ga0182008_10003539 Ga0182008_100035398 175
801 3300014497 Ga0182008_10007339 Ga0182008_100073393 175
802 3300014497 Ga0182008_10039020 Ga0182008_100390203 175
803 3300014497 Ga0182008_10105113 Ga0182008_101051132 175
804 3300014497 Ga0182008_10638279 Ga0182008_106382791 175
805 3300014745 Ga0157377_10356871 Ga0157377_103568712 175
806 3300014745 Ga0157377_10858131 Ga0157377_108581311 175
807 3300014968 Ga0157379_10010490 Ga0157379_100104904 175
808 3300014968 Ga0157379_10037733 Ga0157379_100377331 175
809 3300014968 Ga0157379_10655356 Ga0157379_106553562 175
810 3300014969 Ga0157376_10009877 Ga0157376_1000987715 175
811 3300014969 Ga0157376_10278682 Ga0157376_102786823 175
812 3300014969 Ga0157376_10426428 Ga0157376_104264282 175
813 3300014969 Ga0157376_11100555 Ga0157376_111005552 175
814 3300014969 Ga0157376_11310112 Ga0157376_113101122 175
815 3300014969 Ga0157376_11318156 Ga0157376_113181561 175
816 3300015261 Ga0182006_1002396 Ga0182006_100239613 175
817 3300015261 Ga0182006_1024641 Ga0182006_10246412 175
818 3300015261 Ga0182006_1070199 Ga0182006_10701993 175
819 3300015262 Ga0182007_10000883 Ga0182007_1000088319 175
820 3300015262 Ga0182007_10001054 Ga0182007_1000105410 175
821 3300015265 Ga0182005_1003027 Ga0182005_10030274 175
822 3300015265 Ga0182005_1003380 Ga0182005_10033803 175
823 3300015265 Ga0182005_1014000 Ga0182005_10140004 175
824 3300015265 Ga0182005_1037697 Ga0182005_10376972 175
825 3300015687 Ga0183368_1002 Ga0183368_1002381 175
826 3300015689 Ga0183360_10001 Ga0183360_100012713 175
827 3300017792 Ga0163161_10083892 Ga0163161_100838924 175
828 3300017792 Ga0163161_10094734 Ga0163161_100947344 175
829 3300017792 Ga0163161_10134116 Ga0163161_101341163 175
830 3300017792 Ga0163161_10244943 Ga0163161_102449432 175
831 3300017792 Ga0163161_10748008 Ga0163161_107480082 175
832 3300017792 Ga0163161_10762085 Ga0163161_107620852 175
833 3300017792 Ga0163161_10833961 Ga0163161_108339612 175
834 3300020075 Ga0206349_1250353 Ga0206349_125035310 175
835 3300021361 Ga0213872_10000672 Ga0213872_1000067218 175
836 3300025206 Ga0209435_104191 Ga0209435_1041912 175
837 3300025207 Ga0209760_100502 Ga0209760_10050210 175
838 3300025224 Ga0209784_100167 Ga0209784_10016747 175
839 3300025225 Ga0209566_101978 Ga0209566_1019787 175
840 3300025226 Ga0209674_100043 Ga0209674_100043349 175
841 3300025228 Ga0209672_101977 Ga0209672_1019779 175
842 3300025228 Ga0209672_103115 Ga0209672_1031156 175
843 3300025231 Ga0207427_100144 Ga0207427_10014418 175
844 3300025233 Ga0209437_100193 Ga0209437_10019393 175
845 3300025233 Ga0209437_100256 Ga0209437_10025671 175
846 3300025242 Ga0209258_101240 Ga0209258_10124010 175
847 3300025245 Ga0207425_1000117 Ga0207425_100011727 175
848 3300025246 Ga0209646_1002570 Ga0209646_10025707 175
849 3300025250 Ga0209026_1000293 Ga0209026_100029347 175
850 3300025254 Ga0209148_1000002 Ga0209148_10000021296 175
851 3300025254 Ga0209148_1000010 Ga0209148_10000101151 175
852 3300025256 Ga0209759_1002020 Ga0209759_100202018 175
853 3300025256 Ga0209759_1013219 Ga0209759_10132195 175
854 3300025258 Ga0209129_1000011 Ga0209129_1000011354 175
855 3300025258 Ga0209129_1003310 Ga0209129_10033103 175
856 3300025261 Ga0209233_1000009 Ga0209233_100000918 175
857 3300025263 Ga0209565_1000001 Ga0209565_10000011160 175
858 3300025263 Ga0209565_1000415 Ga0209565_100041529 175
859 3300025272 Ga0209455_1000086 Ga0209455_100008618 175
860 3300025273 Ga0209673_1000001 Ga0209673_10000011160 175
861 3300025273 Ga0209673_1000204 Ga0209673_100020431 175
862 3300025284 Ga0209130_1012770 Ga0209130_10127702 175
863 3300025291 Ga0209675_1000001 Ga0209675_10000011373 175
864 3300025291 Ga0209675_1000015 Ga0209675_100001572 175
865 3300025292 Ga0209676_1000110 Ga0209676_100011018 175
866 3300025292 Ga0209676_1000156 Ga0209676_100015618 175
867 3300025294 Ga0209025_1000002 Ga0209025_1000002444 175
868 3300025294 Ga0209025_1017430 Ga0209025_101743010 175
869 3300025295 Ga0209564_1000001 Ga0209564_10000011535 175
870 3300025295 Ga0209564_1000037 Ga0209564_1000037296 175
871 3300025297 Ga0209758_1000003 Ga0209758_1000003451 175
872 3300025297 Ga0209758_1018540 Ga0209758_10185402 175
873 3300025298 Ga0209050_1010446 Ga0209050_10104466 175
874 3300025299 Ga0209256_1000002 Ga0209256_100000218 175
875 3300025299 Ga0209256_1002932 Ga0209256_100293219 175
876 3300025299 Ga0209256_1028523 Ga0209256_10285233 175
877 3300025303 Ga0209051_1001513 Ga0209051_100151315 175
878 3300025303 Ga0209051_1024620 Ga0209051_10246203 175
879 3300025303 Ga0209051_1039458 Ga0209051_10394583 175
880 3300025304 Ga0209257_1000129 Ga0209257_100012918 175
881 3300025304 Ga0209257_1042061 Ga0209257_10420612 175
882 3300025321 Ga0207656_10040929 Ga0207656_100409293 175
883 3300025321 Ga0207656_10048920 Ga0207656_100489204 175
884 3300025321 Ga0207656_10084250 Ga0207656_100842502 175
885 3300025728 Ga0207655_1014195 Ga0207655_10141956 175
886 3300025735 Ga0207713_1000294 Ga0207713_100029451 175
887 3300025735 Ga0207713_1004451 Ga0207713_10044513 175
888 3300025893 Ga0207682_10077687 Ga0207682_100776872 175
889 3300025899 Ga0207642_10421197 Ga0207642_104211972 175
890 3300025899 Ga0207642_10453907 Ga0207642_104539072 175
891 3300025900 Ga0207710_10032773 Ga0207710_100327733 175
892 3300025901 Ga0207688_10210242 Ga0207688_102102423 175
893 3300025903 Ga0207680_10001411 Ga0207680_100014113 175
894 3300025903 Ga0207680_10191216 Ga0207680_101912162 175
895 3300025903 Ga0207680_10191365 Ga0207680_101913652 175
896 3300025903 Ga0207680_10193240 Ga0207680_101932403 175
897 3300025904 Ga0207647_10000287 Ga0207647_1000028713 175
898 3300025904 Ga0207647_10005585 Ga0207647_100055856 175
899 3300025904 Ga0207647_10066967 Ga0207647_100669672 175
900 3300025904 Ga0207647_10172186 Ga0207647_101721862 175
901 3300025907 Ga0207645_10015068 Ga0207645_100150687 175
902 3300025907 Ga0207645_10015789 Ga0207645_100157895 175
903 3300025907 Ga0207645_10027678 Ga0207645_100276786 175
904 3300025907 Ga0207645_10346081 Ga0207645_103460812 175
905 3300025908 Ga0207643_10002762 Ga0207643_1000276216 175
906 3300025911 Ga0207654_10015953 Ga0207654_100159534 175
907 3300025911 Ga0207654_10127096 Ga0207654_101270962 175
908 3300025911 Ga0207654_10279526 Ga0207654_102795262 175
909 3300025911 Ga0207654_10426440 Ga0207654_104264401 175
910 3300025912 Ga0207707_10145441 Ga0207707_101454413 175
911 3300025912 Ga0207707_10477161 Ga0207707_104771612 175
912 3300025913 Ga0207695_10000818 Ga0207695_1000081832 175
913 3300025913 Ga0207695_10007681 Ga0207695_1000768116 175
914 3300025913 Ga0207695_10125253 Ga0207695_101252535 175
915 3300025913 Ga0207695_10140705 Ga0207695_101407055 175
916 3300025914 Ga0207671_10002946 Ga0207671_1000294620 175
917 3300025914 Ga0207671_10010858 Ga0207671_1001085810 175
918 3300025914 Ga0207671_10033838 Ga0207671_100338385 175
919 3300025914 Ga0207671_10043174 Ga0207671_100431743 175
920 3300025914 Ga0207671_10096565 Ga0207671_100965654 175
921 3300025914 Ga0207671_10707905 Ga0207671_107079052 175
922 3300025916 Ga0207663_10030730 Ga0207663_100307301 175
923 3300025916 Ga0207663_10208351 Ga0207663_102083512 175
924 3300025917 Ga0207660_10078084 Ga0207660_100780843 175
925 3300025917 Ga0207660_10224211 Ga0207660_102242112 175
926 3300025918 Ga0207662_10036401 Ga0207662_100364013 175
927 3300025919 Ga0207657_10006384 Ga0207657_1000638418 175
928 3300025919 Ga0207657_10006666 Ga0207657_100066663 175
929 3300025919 Ga0207657_10218405 Ga0207657_102184052 175
930 3300025919 Ga0207657_10621398 Ga0207657_106213982 175
931 3300025920 Ga0207649_10011159 Ga0207649_100111596 175
932 3300025920 Ga0207649_10064309 Ga0207649_100643091 175
933 3300025920 Ga0207649_10183146 Ga0207649_101831463 175
934 3300025920 Ga0207649_10351279 Ga0207649_103512792 175
935 3300025920 Ga0207649_10372255 Ga0207649_103722552 175
936 3300025920 Ga0207649_10499779 Ga0207649_104997791 175
937 3300025921 Ga0207652_10082620 Ga0207652_100826205 175
938 3300025921 Ga0207652_10088092 Ga0207652_100880922 175
939 3300025921 Ga0207652_11231777 Ga0207652_112317771 175
940 3300025923 Ga0207681_10019048 Ga0207681_100190483 175
941 3300025923 Ga0207681_10040667 Ga0207681_100406674 175
942 3300025923 Ga0207681_10063718 Ga0207681_100637182 175
943 3300025923 Ga0207681_10071603 Ga0207681_100716033 175
944 3300025923 Ga0207681_11074458 Ga0207681_110744581 175
945 3300025924 Ga0207694_10002856 Ga0207694_1000285616 175
946 3300025924 Ga0207694_10235479 Ga0207694_102354793 175
947 3300025924 Ga0207694_10673340 Ga0207694_106733401 175
948 3300025924 Ga0207694_10816024 Ga0207694_108160241 175
949 3300025925 Ga0207650_10004000 Ga0207650_1000400018 175
950 3300025925 Ga0207650_10054455 Ga0207650_100544553 175
951 3300025925 Ga0207650_10058608 Ga0207650_100586086 175
952 3300025925 Ga0207650_10159979 Ga0207650_101599792 175
953 3300025925 Ga0207650_10221148 Ga0207650_102211481 175
954 3300025925 Ga0207650_10232422 Ga0207650_102324222 175
955 3300025925 Ga0207650_10287109 Ga0207650_102871091 175
956 3300025925 Ga0207650_10647117 Ga0207650_106471172 175
957 3300025925 Ga0207650_10766846 Ga0207650_107668462 175
958 3300025925 Ga0207650_10942844 Ga0207650_109428442 175
959 3300025926 Ga0207659_10313018 Ga0207659_103130182 175
960 3300025926 Ga0207659_11007108 Ga0207659_110071081 175
961 3300025927 Ga0207687_10303682 Ga0207687_103036822 175
962 3300025927 Ga0207687_10384998 Ga0207687_103849982 175
963 3300025929 Ga0207664_10163325 Ga0207664_101633253 175
964 3300025931 Ga0207644_10004894 Ga0207644_1000489418 175
965 3300025931 Ga0207644_10039738 Ga0207644_100397382 175
966 3300025931 Ga0207644_10073408 Ga0207644_100734084 175
967 3300025932 Ga0207690_10189815 Ga0207690_101898152 175
968 3300025932 Ga0207690_10777465 Ga0207690_107774652 175
969 3300025933 Ga0207706_10111217 Ga0207706_101112175 175
970 3300025933 Ga0207706_10180634 Ga0207706_101806344 175
971 3300025934 Ga0207686_10025532 Ga0207686_100255322 175
972 3300025934 Ga0207686_10072816 Ga0207686_100728162 175
973 3300025934 Ga0207686_10231745 Ga0207686_102317452 175
974 3300025934 Ga0207686_10638517 Ga0207686_106385171 175
975 3300025935 Ga0207709_10012784 Ga0207709_100127846 175
976 3300025935 Ga0207709_10273035 Ga0207709_102730352 175
977 3300025936 Ga0207670_10008334 Ga0207670_100083343 175
978 3300025936 Ga0207670_10600580 Ga0207670_106005802 175
979 3300025937 Ga0207669_10068174 Ga0207669_100681745 175
980 3300025937 Ga0207669_10093241 Ga0207669_100932413 175
981 3300025937 Ga0207669_10273837 Ga0207669_102738372 175
982 3300025937 Ga0207669_11058137 Ga0207669_110581371 175
983 3300025938 Ga0207704_10014528 Ga0207704_1001452810 175
984 3300025938 Ga0207704_10434786 Ga0207704_104347862 175
985 3300025938 Ga0207704_10435295 Ga0207704_104352952 175
986 3300025938 Ga0207704_10509913 Ga0207704_105099131 175
987 3300025938 Ga0207704_10596041 Ga0207704_105960412 175
988 3300025938 Ga0207704_10697062 Ga0207704_106970622 175
989 3300025940 Ga0207691_10022829 Ga0207691_100228297 175
990 3300025940 Ga0207691_10049133 Ga0207691_100491333 175
991 3300025940 Ga0207691_10104939 Ga0207691_101049391 175
992 3300025940 Ga0207691_10216133 Ga0207691_102161331 175
993 3300025940 Ga0207691_10242604 Ga0207691_102426041 175
994 3300025941 Ga0207711_10000272 Ga0207711_1000027231 175
995 3300025941 Ga0207711_10134873 Ga0207711_101348732 175
996 3300025941 Ga0207711_10137508 Ga0207711_101375084 175
997 3300025941 Ga0207711_10347201 Ga0207711_103472012 175
998 3300025941 Ga0207711_10377945 Ga0207711_103779452 175
999 3300025941 Ga0207711_10619696 Ga0207711_106196961 175
1000 3300025941 Ga0207711_11046483 Ga0207711_110464832 175
1001 3300025941 Ga0207711_11551853 Ga0207711_115518531 175
1002 3300025942 Ga0207689_10071888 Ga0207689_100718882 175
1003 3300025942 Ga0207689_10884372 Ga0207689_108843722 175
1004 3300025942 Ga0207689_11139053 Ga0207689_111390531 175
1005 3300025944 Ga0207661_10084038 Ga0207661_100840382 175
1006 3300025944 Ga0207661_10611615 Ga0207661_106116152 175
1007 3300025944 Ga0207661_10646984 Ga0207661_106469841 175
1008 3300025944 Ga0207661_10872355 Ga0207661_108723552 175
1009 3300025945 Ga0207679_10517079 Ga0207679_105170792 175
1010 3300025945 Ga0207679_10765066 Ga0207679_107650662 175
1011 3300025945 Ga0207679_11012493 Ga0207679_110124931 175
1012 3300025949 Ga0207667_10020508 Ga0207667_1002050810 175
1013 3300025949 Ga0207667_10050717 Ga0207667_100507179 175
1014 3300025949 Ga0207667_10139378 Ga0207667_101393785 175
1015 3300025949 Ga0207667_10139893 Ga0207667_101398932 175
1016 3300025949 Ga0207667_10240327 Ga0207667_102403274 175
1017 3300025949 Ga0207667_10610072 Ga0207667_106100722 175
1018 3300025960 Ga0207651_10025701 Ga0207651_100257016 175
1019 3300025960 Ga0207651_10049602 Ga0207651_100496024 175
1020 3300025960 Ga0207651_10056314 Ga0207651_100563143 175
1021 3300025960 Ga0207651_10352293 Ga0207651_103522931 175
1022 3300025960 Ga0207651_10943476 Ga0207651_109434762 175
1023 3300025961 Ga0207712_10003232 Ga0207712_1000323219 175
1024 3300025961 Ga0207712_10035515 Ga0207712_100355154 175
1025 3300025961 Ga0207712_10123444 Ga0207712_101234444 175
1026 3300025961 Ga0207712_10407343 Ga0207712_104073433 175
1027 3300025972 Ga0207668_10004407 Ga0207668_1000440711 175
1028 3300025972 Ga0207668_10008346 Ga0207668_1000834613 175
1029 3300025972 Ga0207668_10014483 Ga0207668_1001448310 175
1030 3300025972 Ga0207668_10022453 Ga0207668_100224534 175
1031 3300025972 Ga0207668_10289715 Ga0207668_102897152 175
1032 3300025972 Ga0207668_10835325 Ga0207668_108353252 175
1033 3300025972 Ga0207668_10938069 Ga0207668_109380692 175
1034 3300025981 Ga0207640_10118504 Ga0207640_101185044 175
1035 3300025981 Ga0207640_10197310 Ga0207640_101973102 175
1036 3300025981 Ga0207640_10418540 Ga0207640_104185402 175
1037 3300025986 Ga0207658_10000028 Ga0207658_10000028156 175
1038 3300025986 Ga0207658_10108411 Ga0207658_101084113 175
1039 3300025986 Ga0207658_10130366 Ga0207658_101303663 175
1040 3300025986 Ga0207658_10148872 Ga0207658_101488723 175
1041 3300025986 Ga0207658_10151207 Ga0207658_101512073 175
1042 3300025986 Ga0207658_10353963 Ga0207658_103539631 175
1043 3300025986 Ga0207658_10631166 Ga0207658_106311662 175
1044 3300025986 Ga0207658_10716012 Ga0207658_107160122 175
1045 3300025986 Ga0207658_10900631 Ga0207658_109006311 175
1046 3300026023 Ga0207677_10151396 Ga0207677_101513962 175
1047 3300026023 Ga0207677_10290892 Ga0207677_102908923 175
1048 3300026023 Ga0207677_10740140 Ga0207677_107401402 175
1049 3300026035 Ga0207703_10020068 Ga0207703_100200689 175
1050 3300026035 Ga0207703_10177951 Ga0207703_101779512 175
1051 3300026035 Ga0207703_10199434 Ga0207703_101994343 175
1052 3300026035 Ga0207703_10203487 Ga0207703_102034873 175
1053 3300026035 Ga0207703_10787636 Ga0207703_107876362 175
1054 3300026035 Ga0207703_11000081 Ga0207703_110000811 175
1055 3300026035 Ga0207703_11057049 Ga0207703_110570492 175
1056 3300026041 Ga0207639_10000901 Ga0207639_100009018 175
1057 3300026041 Ga0207639_10000916 Ga0207639_100009166 175
1058 3300026041 Ga0207639_10001149 Ga0207639_1000114916 175
1059 3300026041 Ga0207639_10048697 Ga0207639_100486976 175
1060 3300026041 Ga0207639_10086982 Ga0207639_100869826 175
1061 3300026041 Ga0207639_10137617 Ga0207639_101376175 175
1062 3300026041 Ga0207639_10141337 Ga0207639_101413373 175
1063 3300026041 Ga0207639_10222763 Ga0207639_102227632 175
1064 3300026041 Ga0207639_10298455 Ga0207639_102984552 175
1065 3300026041 Ga0207639_10523341 Ga0207639_105233411 175
1066 3300026041 Ga0207639_10648817 Ga0207639_106488172 175
1067 3300026067 Ga0207678_10108467 Ga0207678_101084674 175
1068 3300026067 Ga0207678_10133286 Ga0207678_101332864 175
1069 3300026067 Ga0207678_10230487 Ga0207678_102304872 175
1070 3300026067 Ga0207678_10654881 Ga0207678_106548812 175
1071 3300026075 Ga0207708_10036414 Ga0207708_100364146 175
1072 3300026075 Ga0207708_10210046 Ga0207708_102100462 175
1073 3300026075 Ga0207708_10642775 Ga0207708_106427751 175
1074 3300026075 Ga0207708_10922123 Ga0207708_109221232 175
1075 3300026078 Ga0207702_10035143 Ga0207702_100351436 175
1076 3300026078 Ga0207702_10183528 Ga0207702_101835284 175
1077 3300026078 Ga0207702_10197120 Ga0207702_101971202 175
1078 3300026078 Ga0207702_10308339 Ga0207702_103083393 175
1079 3300026078 Ga0207702_10524843 Ga0207702_105248432 175
1080 3300026088 Ga0207641_10009230 Ga0207641_100092303 175
1081 3300026088 Ga0207641_10043452 Ga0207641_100434523 175
1082 3300026088 Ga0207641_10052864 Ga0207641_100528646 175
1083 3300026088 Ga0207641_10069802 Ga0207641_100698022 175
1084 3300026088 Ga0207641_10103130 Ga0207641_101031304 175
1085 3300026088 Ga0207641_10106203 Ga0207641_101062034 175
1086 3300026088 Ga0207641_10144239 Ga0207641_101442394 175
1087 3300026088 Ga0207641_10360433 Ga0207641_103604333 175
1088 3300026088 Ga0207641_10409168 Ga0207641_104091682 175
1089 3300026088 Ga0207641_10590788 Ga0207641_105907882 175
1090 3300026089 Ga0207648_10019320 Ga0207648_100193206 175
1091 3300026089 Ga0207648_10027626 Ga0207648_100276265 175
1092 3300026089 Ga0207648_10200666 Ga0207648_102006663 175
1093 3300026089 Ga0207648_10257059 Ga0207648_102570594 175
1094 3300026089 Ga0207648_10379894 Ga0207648_103798942 175
1095 3300026095 Ga0207676_10035173 Ga0207676_100351736 175
1096 3300026095 Ga0207676_10035413 Ga0207676_100354134 175
1097 3300026095 Ga0207676_10038749 Ga0207676_1003874910 175
1098 3300026095 Ga0207676_10191906 Ga0207676_101919063 175
1099 3300026095 Ga0207676_10247505 Ga0207676_102475053 175
1100 3300026095 Ga0207676_10546143 Ga0207676_105461432 175
1101 3300026095 Ga0207676_10680064 Ga0207676_106800641 175
1102 3300026116 Ga0207674_10001554 Ga0207674_1000155417 175
1103 3300026116 Ga0207674_10020002 Ga0207674_100200022 175
1104 3300026116 Ga0207674_10214578 Ga0207674_102145782 175
1105 3300026116 Ga0207674_10223223 Ga0207674_102232232 175
1106 3300026116 Ga0207674_10522194 Ga0207674_105221942 175
1107 3300026116 Ga0207674_10645375 Ga0207674_106453752 175
1108 3300026118 Ga0207675_100041536 Ga0207675_1000415364 175
1109 3300026118 Ga0207675_100142749 Ga0207675_1001427491 175
1110 3300026118 Ga0207675_100207937 Ga0207675_1002079372 175
1111 3300026118 Ga0207675_100264070 Ga0207675_1002640703 175
1112 3300026118 Ga0207675_100375270 Ga0207675_1003752703 175
1113 3300026121 Ga0207683_10022992 Ga0207683_100229926 175
1114 3300026121 Ga0207683_10141534 Ga0207683_101415343 175
1115 3300026121 Ga0207683_10228474 Ga0207683_102284741 175
1116 3300026121 Ga0207683_11062979 Ga0207683_110629791 175
1117 3300026121 Ga0207683_11072706 Ga0207683_110727061 175
1118 3300026121 Ga0207683_11123922 Ga0207683_111239222 175
1119 3300026121 Ga0207683_11322595 Ga0207683_113225951 175
1120 3300026142 Ga0207698_10016127 Ga0207698_100161276 175
1121 3300026142 Ga0207698_10220186 Ga0207698_102201864 175
1122 3300026142 Ga0207698_10244818 Ga0207698_102448183 175
1123 3300026142 Ga0207698_10287818 Ga0207698_102878182 175
1124 3300026142 Ga0207698_10345373 Ga0207698_103453733 175
1125 3300026142 Ga0207698_10731999 Ga0207698_107319992 175
1126 3300027252 Ga0209973_1030038 Ga0209973_10300381 175
1127 3300027312 Ga0209371_1000294 Ga0209371_100029450 175
1128 3300027360 Ga0209969_1000299 Ga0209969_10002996 175
1129 3300027364 Ga0209967_1001629 Ga0209967_10016292 175
1130 3300027378 Ga0209981_1002456 Ga0209981_10024564 175
1131 3300027378 Ga0209981_1027816 Ga0209981_10278161 175
1132 3300027462 Ga0210000_1002592 Ga0210000_10025926 175
1133 3300027543 Ga0209999_1000336 Ga0209999_100033613 175
1134 3300027552 Ga0209982_1000032 Ga0209982_100003220 175
1135 3300027614 Ga0209970_1000770 Ga0209970_10007707 175
1136 3300027617 Ga0210002_1015401 Ga0210002_10154012 175
1137 3300027665 Ga0209983_1000295 Ga0209983_10002956 175
1138 3300027682 Ga0209971_1000410 Ga0209971_10004107 175
1139 3300027866 Ga0209813_10088547 Ga0209813_100885472 175
1140 3300027876 Ga0209974_10005623 Ga0209974_1000562310 175
1141 3300027876 Ga0209974_10102993 Ga0209974_101029932 175
1142 3300028379 Ga0268266_10012447 Ga0268266_1001244712 175
1143 3300028379 Ga0268266_10013518 Ga0268266_100135189 175
1144 3300028379 Ga0268266_10015947 Ga0268266_1001594710 175
1145 3300028379 Ga0268266_10082273 Ga0268266_100822736 175
1146 3300028379 Ga0268266_10262814 Ga0268266_102628142 175
1147 3300028379 Ga0268266_10392653 Ga0268266_103926532 175
1148 3300028379 Ga0268266_10538686 Ga0268266_105386862 175
1149 3300028379 Ga0268266_11142849 Ga0268266_111428492 175
1150 3300028380 Ga0268265_10000444 Ga0268265_1000044413 175
1151 3300028380 Ga0268265_10134808 Ga0268265_101348081 175
1152 3300028380 Ga0268265_10144177 Ga0268265_101441773 175
1153 3300028380 Ga0268265_10288108 Ga0268265_102881082 175
1154 3300028380 Ga0268265_10433464 Ga0268265_104334642 175
1155 3300028380 Ga0268265_10745987 Ga0268265_107459872 175
1156 3300028380 Ga0268265_11365613 Ga0268265_113656131 175
1157 3300028381 Ga0268264_10008596 Ga0268264_1000859615 175
1158 3300028381 Ga0268264_10027927 Ga0268264_100279276 175
1159 3300028381 Ga0268264_10045943 Ga0268264_100459436 175
1160 3300028381 Ga0268264_10090304 Ga0268264_100903046 175
1161 3300028381 Ga0268264_10134912 Ga0268264_101349124 175
1162 3300028381 Ga0268264_10194786 Ga0268264_101947864 175
1163 3300028381 Ga0268264_10200295 Ga0268264_102002952 175
1164 3300028381 Ga0268264_11202568 Ga0268264_112025682 175
1165 3300028786 Ga0307517_10106007 Ga0307517_101060073 175
1166 3300028786 Ga0307517_10444953 Ga0307517_104449531 175
1167 3300028794 Ga0307515_10283273 Ga0307515_102832732 175
1168 3300028800 Ga0265338_10362361 Ga0265338_103623612 175
1169 3300030500 Ga0268256_1000258 Ga0268256_100025818 175
1170 3300030731 Ga0316177_1141886 Ga0316177_11418862 175
1171 3300030742 Ga0316183_1180277 Ga0316183_11802779 175
1172 3300030745 Ga0316182_1171684 Ga0316182_11716842 175
1173 3300030863 Ga0265766_1001654 Ga0265766_10016542 175
1174 3300031239 Ga0265328_10031723 Ga0265328_100317234 175
1175 3300031241 Ga0265325_10126063 Ga0265325_101260633 175
1176 3300031247 Ga0265340_10010398 Ga0265340_100103986 175
1177 3300031247 Ga0265340_10035092 Ga0265340_100350924 175
1178 3300031249 Ga0265339_10002105 Ga0265339_1000210516 175
1179 3300031250 Ga0265331_10134070 Ga0265331_101340701 175
1180 3300031456 Ga0307513_10007825 Ga0307513_100078256 175
1181 3300031456 Ga0307513_10058418 Ga0307513_1005841810 175
1182 3300031456 Ga0307513_10097095 Ga0307513_100970953 175
1183 3300031456 Ga0307513_10098847 Ga0307513_100988473 175
1184 3300031507 Ga0307509_10091388 Ga0307509_100913882 175
1185 3300031548 Ga0307408_100101410 Ga0307408_1001014105 175
1186 3300031548 Ga0307408_100186366 Ga0307408_1001863663 175
1187 3300031548 Ga0307408_101518893 Ga0307408_1015188931 175
1188 3300031595 Ga0265313_10000031 Ga0265313_1000003194 175
1189 3300031595 Ga0265313_10025985 Ga0265313_100259854 175
1190 3300031616 Ga0307508_10168909 Ga0307508_101689093 175
1191 3300031616 Ga0307508_10226410 Ga0307508_102264101 175
1192 3300031649 Ga0307514_10104256 Ga0307514_101042563 175
1193 3300031665 Ga0316575_10007064 Ga0316575_100070646 175
1194 3300031665 Ga0316575_10022019 Ga0316575_100220195 175
1195 3300031691 Ga0316579_10000104 Ga0316579_1000010420 175
1196 3300031691 Ga0316579_10021848 Ga0316579_100218485 175
1197 3300031712 Ga0265342_10002950 Ga0265342_1000295019 175
1198 3300031727 Ga0316576_10000067 Ga0316576_1000006733 175
1199 3300031727 Ga0316576_10012044 Ga0316576_100120446 175
1200 3300031727 Ga0316576_10073603 Ga0316576_100736035 175
1201 3300031727 Ga0316576_10108522 Ga0316576_101085222 175
1202 3300031727 Ga0316576_10140454 Ga0316576_101404543 175
1203 3300031727 Ga0316576_10401515 Ga0316576_104015151 175
1204 3300031728 Ga0316578_10000046 Ga0316578_1000004618 175
1205 3300031728 Ga0316578_10000445 Ga0316578_100004457 175
1206 3300031728 Ga0316578_10006563 Ga0316578_1000656310 175
1207 3300031728 Ga0316578_10033675 Ga0316578_100336756 175
1208 3300031730 Ga0307516_10019611 Ga0307516_100196114 175
1209 3300031731 Ga0307405_10122558 Ga0307405_101225583 175
1210 3300031731 Ga0307405_10155277 Ga0307405_101552772 175
1211 3300031731 Ga0307405_10205900 Ga0307405_102059002 175
1212 3300031731 Ga0307405_10436031 Ga0307405_104360312 175
1213 3300031731 Ga0307405_10729647 Ga0307405_107296471 175
1214 3300031733 Ga0316577_10001071 Ga0316577_100010719 175
1215 3300031733 Ga0316577_10001498 Ga0316577_100014988 175
1216 3300031733 Ga0316577_10128000 Ga0316577_101280002 175
1217 3300031824 Ga0307413_10001429 Ga0307413_1000142916 175
1218 3300031824 Ga0307413_10035769 Ga0307413_100357692 175
1219 3300031824 Ga0307413_10414448 Ga0307413_104144482 175
1220 3300031824 Ga0307413_10435631 Ga0307413_104356311 175
1221 3300031852 Ga0307410_10002645 Ga0307410_1000264513 175
1222 3300031852 Ga0307410_10006977 Ga0307410_100069773 175
1223 3300031852 Ga0307410_11065142 Ga0307410_110651421 175
1224 3300031852 Ga0307410_11071849 Ga0307410_110718491 175
1225 3300031901 Ga0307406_10054966 Ga0307406_100549665 175
1226 3300031901 Ga0307406_10156537 Ga0307406_101565372 175
1227 3300031901 Ga0307406_10439795 Ga0307406_104397951 175
1228 3300031901 Ga0307406_10641910 Ga0307406_106419102 175
1229 3300031903 Ga0307407_10006994 Ga0307407_100069949 175
1230 3300031903 Ga0307407_10007323 Ga0307407_100073231 175
1231 3300031903 Ga0307407_10054255 Ga0307407_100542554 175
1232 3300031903 Ga0307407_10443898 Ga0307407_104438981 175
1233 3300031903 Ga0307407_10687430 Ga0307407_106874302 175
1234 3300031911 Ga0307412_10113655 Ga0307412_101136553 175
1235 3300031911 Ga0307412_10131943 Ga0307412_101319433 175
1236 3300031911 Ga0307412_10174216 Ga0307412_101742162 175
1237 3300031911 Ga0307412_10275217 Ga0307412_102752173 175
1238 3300031911 Ga0307412_10446504 Ga0307412_104465041 175
1239 3300031995 Ga0307409_100018987 Ga0307409_1000189876 175
1240 3300031995 Ga0307409_100034200 Ga0307409_1000342002 175
1241 3300031995 Ga0307409_100112232 Ga0307409_1001122322 175
1242 3300032002 Ga0307416_100050392 Ga0307416_1000503924 175
1243 3300032002 Ga0307416_100059572 Ga0307416_1000595726 175
1244 3300032002 Ga0307416_100134698 Ga0307416_1001346984 175
1245 3300032002 Ga0307416_100492320 Ga0307416_1004923202 175
1246 3300032002 Ga0307416_101448975 Ga0307416_1014489752 175
1247 3300032002 Ga0307416_102066744 Ga0307416_1020667441 175
1248 3300032004 Ga0307414_10002120 Ga0307414_100021206 175
1249 3300032004 Ga0307414_10007043 Ga0307414_100070432 175
1250 3300032004 Ga0307414_10037722 Ga0307414_100377224 175
1251 3300032004 Ga0307414_10073519 Ga0307414_100735194 175
1252 3300032004 Ga0307414_10117431 Ga0307414_101174313 175
1253 3300032004 Ga0307414_10179544 Ga0307414_101795443 175
1254 3300032004 Ga0307414_10269547 Ga0307414_102695473 175
1255 3300032004 Ga0307414_10325115 Ga0307414_103251152 175
1256 3300032004 Ga0307414_10425080 Ga0307414_104250802 175
1257 3300032004 Ga0307414_10851907 Ga0307414_108519071 175
1258 3300032004 Ga0307414_11658556 Ga0307414_116585561 175
1259 3300032005 Ga0307411_10001998 Ga0307411_1000199813 175
1260 3300032005 Ga0307411_10034772 Ga0307411_100347725 175
1261 3300032005 Ga0307411_10038180 Ga0307411_100381803 175
1262 3300032005 Ga0307411_10040313 Ga0307411_100403133 175
1263 3300032005 Ga0307411_10372223 Ga0307411_103722232 175
1264 3300032005 Ga0307411_10377004 Ga0307411_103770041 175
1265 3300032005 Ga0307411_10739631 Ga0307411_107396312 175
1266 3300032126 Ga0307415_100210379 Ga0307415_1002103792 175
1267 3300032126 Ga0307415_100239312 Ga0307415_1002393122 175
1268 3300032126 Ga0307415_100278380 Ga0307415_1002783802 175
1269 3300032126 Ga0307415_100710509 Ga0307415_1007105092 175
1270 3300032126 Ga0307415_100773268 Ga0307415_1007732682 175
1271 3300032137 Ga0316585_10000029 Ga0316585_1000002918 175
1272 3300032139 Ga0316580_10000016 Ga0316580_1000001622 175
1273 3300032139 Ga0316580_10001102 Ga0316580_1000110210 175
1274 3300032139 Ga0316580_10002227 Ga0316580_100022279 175
1275 3300032168 Ga0316593_10000041 Ga0316593_1000004113 175
1276 3300032168 Ga0316593_10000198 Ga0316593_100001985 175
1277 3300032168 Ga0316593_10000257 Ga0316593_1000025713 175
1278 3300032168 Ga0316593_10000468 Ga0316593_1000046812 175
1279 3300032168 Ga0316593_10000658 Ga0316593_1000065811 175
1280 3300032168 Ga0316593_10036241 Ga0316593_100362412 175
1281 3300032168 Ga0316593_10036917 Ga0316593_100369174 175
1282 3300032168 Ga0316593_10038722 Ga0316593_100387223 175
1283 3300032168 Ga0316593_10042380 Ga0316593_100423802 175
1284 3300032168 Ga0316593_10092358 Ga0316593_100923582 175
1285 3300032168 Ga0316593_10095073 Ga0316593_100950732 175
1286 3300033179 Ga0307507_10039101 Ga0307507_100391011 175
1287 3300033524 Ga0316592_1000041 Ga0316592_10000416 175
1288 3300033524 Ga0316592_1000052 Ga0316592_100005217 175
1289 3300033524 Ga0316592_1000138 Ga0316592_10001386 175
1290 3300033524 Ga0316592_1001786 Ga0316592_10017866 175
1291 3300033524 Ga0316592_1071308 Ga0316592_10713082 175
1292 3300033527 Ga0316586_1000334 Ga0316586_10003346 175
1293 3300033527 Ga0316586_1003233 Ga0316586_10032332 175
1294 3300033528 Ga0316588_1000073 Ga0316588_100007315 175
1295 3300033528 Ga0316588_1000187 Ga0316588_10001872 175
1296 3300033528 Ga0316588_1005083 Ga0316588_10050832 175
1297 3300033529 Ga0316587_1003230 Ga0316587_10032302 175
1298 3300033541 Ga0316596_1000014 Ga0316596_100001418 175
1299 3300033541 Ga0316596_1000038 Ga0316596_100003812 175
1300 3300033541 Ga0316596_1031171 Ga0316596_10311713 175
1301 3300033541 Ga0316596_1049180 Ga0316596_10491802 175
1302 3300033541 Ga0316596_1084777 Ga0316596_10847772 175
1303 3300033541 Ga0316596_1170617 Ga0316596_11706171 175
1304 3300034819 Ga0373958_0003362 Ga0373958_0003362_239_772 175
1305 3300035083 Ga0373926_0045218 Ga0373926_0045218_476_1009 175
1306 3300035089 Ga0373944_0101215 Ga0373944_0101215_191_718 175
1307 3300035113 Ga0373936_0123083 Ga0373936_0123083_65_598 175
1308 3300035113 Ga0373936_0245409 Ga0373936_0245409_200_727 175
1309 3300035115 Ga0373941_0119753 Ga0373941_0119753_171_698 175
1310 3300035117 Ga0373953_0207512 Ga0373953_0207512_222_749 175
1311 3300035119 Ga0373956_0085842 Ga0373956_0085842_546_1073 175
1312 3300035120 Ga0373957_0044948 Ga0373957_0044948_246_773 175
1313 3300035120 Ga0373957_0074900 Ga0373957_0074900_255_782 175
1314 3300035170 Ga0373943_0006870 Ga0373943_0006870_1751_2284 175
1315 3300035170 Ga0373943_0457818 Ga0373943_0457818_10_537 175
1316 3300035171 Ga0373946_0057466 Ga0373946_0057466_316_843 175
1317 3300035172 Ga0373955_0018160 Ga0373955_0018160_1209_1736 175
1318 3300035241 Ga0373961_0309321 Ga0373961_0309321_11_538 175
1319 3300035398 Ga0316574_0000016 Ga0316574_0000016_5193_5726 175
1320 3300035398 Ga0316574_0003365 Ga0316574_0003365_6271_6804 175
1321 3300035398 Ga0316574_0396457 Ga0316574_0396457_34_567 175
1322 3300035410 Ga0373924_0114764 Ga0373924_0114764_285_812 175
1323 3300035691 Ga0373931_0473241 Ga0373931_0473241_124_651 175
1324 3300035695 Ga0373927_0003573 Ga0373927_0003573_9834_10367 175
1325 3300035724 Ga0373933_0255306 Ga0373933_0255306_341_868 175
1326 3300035724 Ga0373933_0468974 Ga0373933_0468974_218_751 175
1327 3300035725 Ga0373947_0269760 Ga0373947_0269760_185_718 175
1328 3300035725 Ga0373947_0639671 Ga0373947_0639671_29_556 175
1329 3300036401 Ga0373937_0065988 Ga0373937_0065988_576_1103 175
1330 3300036401 Ga0373937_0120811 Ga0373937_0120811_750_1277 175
1331 3300036647 Ga0316582_0000015 Ga0316582_0000015_8380_8913 175
1332 3300036647 Ga0316582_0003997 Ga0316582_0003997_4384_4920 175
1333 3300036647 Ga0316582_0084010 Ga0316582_0084010_1394_1927 175
1334 3300036647 Ga0316582_0124550 Ga0316582_0124550_655_1188 175
1335 3300036712 Ga0316584_0000487 Ga0316584_0000487_13077_13610 175
1336 3300036712 Ga0316584_0001578 Ga0316584_0001578_5858_6394 175
1337 3300036712 Ga0316584_0046995 Ga0316584_0046995_2356_2889 175
1338 3300037068 Ga0373925_0089443 Ga0373925_0089443_599_1132 175
1339 3300037312 Ga0395899_0035628 Ga0395899_0035628_121_648 175
1340 3300037312 Ga0395899_0212745 Ga0395899_0212745_433_960 175
1341 3300037312 Ga0395899_0376508 Ga0395899_0376508_165_692 175
1342 3300037418 Ga0395900_0143919 Ga0395900_0143919_848_1375 175
1343 3300037418 Ga0395900_1137513 Ga0395900_1137513_86_613 175
1344 3300037466 Ga0395898_0107583 Ga0395898_0107583_230_757 175
1345 3300037466 Ga0395898_0221184 Ga0395898_0221184_248_775 175
1346 3300037466 Ga0395898_0340453 Ga0395898_0340453_642_1169 175
1347 3300037471 Ga0395905_0116800 Ga0395905_0116800_1133_1660 175
1348 3300037471 Ga0395905_0120737 Ga0395905_0120737_321_848 175
1349 3300038443 Ga0395901_0043833 Ga0395901_0043833_630_1157 175
1350 3300038443 Ga0395901_0125960 Ga0395901_0125960_642_1169 175
1351 3300038705 Ga0237819_05943 Ga0237819_05943_1182_1709 175
1352 3300038725 Ga0400484_10568 Ga0400484_10568_432_965 175
1353 3300038741 Ga0400488_59057 Ga0400488_59057_669_1202 175
1354 3300039110 Ga0400487_33555 Ga0400487_33555_67276_67809 175
1355 3300041404 Ga0439436_0052601 Ga0439436_0052601_82_609 175
1356 3300041407 Ga0439447_003122 Ga0439447_003122_1068_1595 175
1357 3300041413 Ga0439465_0026055 Ga0439465_0026055_708_1235 175
1358 3300041441 Ga0451787_099732 Ga0451787_099732_368_895 175
1359 3300041451 Ga0451791_0506135 Ga0451791_0506135_402_929 175
1360 3300041451 Ga0451791_1505001 Ga0451791_1505001_456_983 175
1361 3300041451 Ga0451791_1817012 Ga0451791_1817012_86_613 175
1362 3300041456 Ga0451795_0171946 Ga0451795_0171946_109_636 175
1363 3300041458 Ga0451798_0267471 Ga0451798_0267471_134_661 175
1364 3300041459 Ga0451800_0897629 Ga0451800_0897629_15_542 175
1365 3300041459 Ga0451800_1532477 Ga0451800_1532477_254_781 175
1366 3300041460 Ga0451802_0044776 Ga0451802_0044776_273_800 175
1367 3300041460 Ga0451802_0404479 Ga0451802_0404479_1100_1627 175
1368 3300041463 Ga0451804_0663040 Ga0451804_0663040_416_943 175
1369 3300041486 Ga0451807_0646883 Ga0451807_0646883_496_1023 175
1370 3300041486 Ga0451807_0984280 Ga0451807_0984280_602_1129 175
1371 3300041486 Ga0451807_1118642 Ga0451807_1118642_20_547 175
1372 3300041486 Ga0451807_1695146 Ga0451807_1695146_416_943 175
1373 3300041494 Ga0451837_1441521 Ga0451837_1441521_23_550 175
1374 3300041498 Ga0451841_0449820 Ga0451841_0449820_1339_1866 175
1375 3300041501 Ga0451845_0350394 Ga0451845_0350394_28_555 175
1376 3300041503 Ga0451847_0693251 Ga0451847_0693251_73_600 175
1377 3300041505 Ga0451849_0948594 Ga0451849_0948594_567_1094 175
1378 3300041507 Ga0451851_1226210 Ga0451851_1226210_397_924 175
1379 3300041509 Ga0451843_0964265 Ga0451843_0964265_987_1514 175
1380 3300041511 Ga0451855_0121750 Ga0451855_0121750_137_670 175
1381 3300041512 Ga0451853_0647492 Ga0451853_0647492_814_1341 175
1382 3300041512 Ga0451853_0694569 Ga0451853_0694569_652_1179 175
1383 3300041512 Ga0451853_2593270 Ga0451853_2593270_465_992 175
1384 3300041512 Ga0451853_2928813 Ga0451853_2928813_390_917 175
1385 3300041512 Ga0451853_3390094 Ga0451853_3390094_983_1510 175
1386 3300042002 Ga0439442_022993 Ga0439442_022993_226_753 175
1387 3300042006 Ga0439432_016566 Ga0439432_016566_896_1423 175
1388 3300042006 Ga0439432_033010 Ga0439432_033010_762_1289 175
1389 3300042006 Ga0439432_037894 Ga0439432_037894_378_905 175
1390 3300042006 Ga0439432_041986 Ga0439432_041986_898_1425 175
1391 3300042007 Ga0439449_0008538 Ga0439449_0008538_2684_3211 175
1392 3300042007 Ga0439449_0015318 Ga0439449_0015318_1047_1574 175
1393 3300042007 Ga0439449_0022350 Ga0439449_0022350_1126_1653 175
1394 3300042007 Ga0439449_0047494 Ga0439449_0047494_1047_1574 175
1395 3300042008 Ga0439450_025118 Ga0439450_025118_173_706 175
1396 3300042014 Ga0439457_029323 Ga0439457_029323_606_1133 175
1397 3300042127 Ga0450890_026351 Ga0450890_026351_147_674 175
1398 3300042142 Ga0450905_016525 Ga0450905_016525_483_1010 175
1399 3300042435 Ga0439434_0024628 Ga0439434_0024628_643_1170 175
1400 3300042437 Ga0439444_0041877 Ga0439444_0041877_73_606 175
1401 3300042439 Ga0439464_0026196 Ga0439464_0026196_892_1425 175
1402 3300042461 Ga0439460_0044635 Ga0439460_0044635_647_1180 175
1403 3300042876 Ga0451577_0137034 Ga0451577_0137034_364_891 175
1404 3300044656 Ga0466969_0024286 Ga0466969_0024286_1622_2155 175
1405 3300044683 Ga0466965_0039569 Ga0466965_0039569_1451_1984 175
1406 3300044684 Ga0466966_0017507 Ga0466966_0017507_3377_3910 175
1407 3300044693 Ga0466961_0000649 Ga0466961_0000649_20758_21291 175
1408 3300044706 Ga0466964_0064024 Ga0466964_0064024_261_788 175
1409 3300044706 Ga0466964_0264206 Ga0466964_0264206_156_689 175
1410 3300044735 Ga0466968_0006325 Ga0466968_0006325_3486_4013 175
1411 3300044842 Ga0466957_0003550 Ga0466957_0003550_1738_2265 175
1412 3300045049 Ga0466959_0073651 Ga0466959_0073651_866_1393 175
1413 3300045976 Ga0466967_1806319 Ga0466967_1806319_47_574 175
1414 3300046452 Ga0495617_077418 Ga0495617_077418_480_1007 175
1415 3300046453 Ga0495627_036255 Ga0495627_036255_833_1360 175
1416 3300046453 Ga0495627_052708 Ga0495627_052708_206_733 175
1417 3300046455 Ga0495603_0000280 Ga0495603_0000280_20559_21092 175
1418 3300046457 Ga0495590_0053840 Ga0495590_0053840_278_805 175
1419 3300046459 Ga0495629_0000177 Ga0495629_0000177_29706_30239 175
1420 3300046459 Ga0495629_0463250 Ga0495629_0463250_79_606 175
1421 3300046460 Ga0495638_0010203 Ga0495638_0010203_1074_1601 175
1422 3300046460 Ga0495638_0020600 Ga0495638_0020600_2706_3233 175
1423 3300046460 Ga0495638_0023580 Ga0495638_0023580_804_1331 175
1424 3300046460 Ga0495638_0049756 Ga0495638_0049756_1274_1801 175
1425 3300046460 Ga0495638_0259209 Ga0495638_0259209_202_729 175
1426 3300046460 Ga0495638_0387812 Ga0495638_0387812_125_652 175
1427 3300046461 Ga0495641_0017665 Ga0495641_0017665_1890_2417 175
1428 3300046461 Ga0495641_0029673 Ga0495641_0029673_303_836 175
1429 3300046471 Ga0495650_0000202 Ga0495650_0000202_18697_19224 175
1430 3300046471 Ga0495650_0040100 Ga0495650_0040100_493_1020 175
1431 3300046472 Ga0495580_0002426 Ga0495580_0002426_1077_1610 175
1432 3300046473 Ga0495582_0000185 Ga0495582_0000185_16631_17164 175
1433 3300046474 Ga0495605_0081056 Ga0495605_0081056_867_1394 175
1434 3300046475 Ga0495639_0001788 Ga0495639_0001788_537_1070 175
1435 3300046475 Ga0495639_0023140 Ga0495639_0023140_140_667 175
1436 3300046491 Ga0495584_0001537 Ga0495584_0001537_7934_8461 175
1437 3300046499 Ga0495594_0000224 Ga0495594_0000224_5101_5634 175
1438 3300046499 Ga0495594_0405366 Ga0495594_0405366_109_636 175
1439 3300046501 Ga0495607_0022784 Ga0495607_0022784_2060_2587 175
1440 3300046507 Ga0495606_0001329 Ga0495606_0001329_25255_25782 175
1441 3300046507 Ga0495606_0006502 Ga0495606_0006502_8564_9091 175
1442 3300046507 Ga0495606_0016668 Ga0495606_0016668_5029_5556 175
1443 3300046507 Ga0495606_0061939 Ga0495606_0061939_598_1125 175
1444 3300046507 Ga0495606_0122208 Ga0495606_0122208_96_623 175
1445 3300046507 Ga0495606_0188528 Ga0495606_0188528_561_1088 175
1446 3300046512 Ga0495610_0021781 Ga0495610_0021781_1198_1725 175
1447 3300046512 Ga0495610_0063008 Ga0495610_0063008_74_601 175
1448 3300046513 Ga0495616_0006494 Ga0495616_0006494_1674_2201 175
1449 3300046513 Ga0495616_0084886 Ga0495616_0084886_418_945 175
1450 3300046513 Ga0495616_0093680 Ga0495616_0093680_35_562 175
1451 3300046513 Ga0495616_0122636 Ga0495616_0122636_648_1175 175
1452 3300046515 Ga0495620_0030788 Ga0495620_0030788_1005_1532 175
1453 3300046515 Ga0495620_0052998 Ga0495620_0052998_936_1463 175
1454 3300046517 Ga0495630_0305079 Ga0495630_0305079_298_825 175
1455 3300046517 Ga0495630_0357791 Ga0495630_0357791_384_911 175
1456 3300046519 Ga0495632_0005327 Ga0495632_0005327_7712_8239 175
1457 3300046519 Ga0495632_0071946 Ga0495632_0071946_167_694 175
1458 3300046519 Ga0495632_0083777 Ga0495632_0083777_403_930 175
1459 3300046522 Ga0495643_0019386 Ga0495643_0019386_1432_1959 175
1460 3300046522 Ga0495643_0227566 Ga0495643_0227566_15_542 175
1461 3300046523 Ga0495644_0008623 Ga0495644_0008623_3272_3799 175
1462 3300046524 Ga0495648_0157259 Ga0495648_0157259_256_783 175
1463 3300046525 Ga0495663_0011905 Ga0495663_0011905_826_1353 175
1464 3300046526 Ga0495666_0020979 Ga0495666_0020979_2050_2583 175
1465 3300046531 Ga0495665_0131706 Ga0495665_0131706_289_816 175
1466 3300046536 Ga0495587_0286128 Ga0495587_0286128_190_717 175
1467 3300046537 Ga0495598_0187757 Ga0495598_0187757_165_692 175
1468 3300046538 Ga0495609_0295726 Ga0495609_0295726_10_537 175
1469 3300046539 Ga0495621_0014526 Ga0495621_0014526_159_686 175
1470 3300046539 Ga0495621_0041194 Ga0495621_0041194_706_1233 175
1471 3300046539 Ga0495621_0155687 Ga0495621_0155687_170_697 175
1472 3300046542 Ga0495597_0178188 Ga0495597_0178188_201_728 175
1473 3300046557 Ga0495622_0000916 Ga0495622_0000916_7368_7901 175
1474 3300046557 Ga0495622_0093643 Ga0495622_0093643_175_702 175
1475 3300046558 Ga0495633_0032624 Ga0495633_0032624_969_1496 175
1476 3300046559 Ga0495667_0353282 Ga0495667_0353282_244_771 175
1477 3300046615 Ga0495656_0001410 Ga0495656_0001410_5566_6093 175
1478 3300046615 Ga0495656_0027892 Ga0495656_0027892_1572_2099 175
1479 3300046616 Ga0495668_0003983 Ga0495668_0003983_5937_6464 175
1480 3300046616 Ga0495668_0046721 Ga0495668_0046721_1841_2368 175
1481 3300046616 Ga0495668_0112676 Ga0495668_0112676_554_1087 175
1482 3300046642 Ga0495634_0003557 Ga0495634_0003557_7393_7926 175
1483 3300046660 Ga0495625_0020303 Ga0495625_0020303_151_678 175
1484 3300046660 Ga0495625_0026649 Ga0495625_0026649_2784_3311 175
1485 3300046660 Ga0495625_0165569 Ga0495625_0165569_88_615 175
1486 3300046660 Ga0495625_0238949 Ga0495625_0238949_455_982 175
1487 3300046660 Ga0495625_0308568 Ga0495625_0308568_113_640 175
1488 3300046660 Ga0495625_0349129 Ga0495625_0349129_202_729 175
1489 3300046663 Ga0495635_0098468 Ga0495635_0098468_1082_1615 175
1490 3300046663 Ga0495635_0316962 Ga0495635_0316962_373_900 175
1491 3300046663 Ga0495635_0396059 Ga0495635_0396059_208_735 175
1492 3300046664 Ga0495659_0015449 Ga0495659_0015449_765_1292 175
1493 3300046674 Ga0495588_0000617 Ga0495588_0000617_5123_5656 175
1494 3300046681 Ga0495647_0001129 Ga0495647_0001129_5542_6075 175
1495 3300046683 Ga0495658_0007723 Ga0495658_0007723_3613_4146 175
1496 3300046683 Ga0495658_0668355 Ga0495658_0668355_65_592 175
1497 3300046684 Ga0495669_0103028 Ga0495669_0103028_591_1118 175
1498 3300046689 Ga0495613_0037438 Ga0495613_0037438_2088_2621 175
1499 3300046691 Ga0495670_0023274 Ga0495670_0023274_201_728 175
1500 3300046691 Ga0495670_0042455 Ga0495670_0042455_1058_1585 175
1501 3300046691 Ga0495670_0082264 Ga0495670_0082264_469_996 175
1502 3300046691 Ga0495670_0099127 Ga0495670_0099127_300_827 175
1503 3300046692 Ga0495671_0300596 Ga0495671_0300596_140_667 175
1504 3300046694 Ga0495649_0000383 Ga0495649_0000383_8168_8695 175
1505 3300046694 Ga0495649_0322006 Ga0495649_0322006_236_763 175
1506 3300046794 Ga0495589_0196971 Ga0495589_0196971_291_824 175
1507 3300046809 Ga0495600_0284384 Ga0495600_0284384_49_576 175
1508 3300046810 Ga0495660_0050999 Ga0495660_0050999_1090_1617 175
1509 3300046810 Ga0495660_0113426 Ga0495660_0113426_315_842 175
1510 3300046810 Ga0495660_0156785 Ga0495660_0156785_403_930 175
1511 3300047315 Ga0495581_0001367 Ga0495581_0001367_7400_7933 175
1512 3300047318 Ga0495636_0109909 Ga0495636_0109909_54_581 175
1513 3300047318 Ga0495636_0164923 Ga0495636_0164923_405_932 175
1514 3300047318 Ga0495636_0296589 Ga0495636_0296589_56_583 175
1515 3300047320 Ga0495672_0016078 Ga0495672_0016078_1094_1621 175
1516 3300047320 Ga0495672_0016648 Ga0495672_0016648_1953_2480 175
1517 3300047322 Ga0495680_0034950 Ga0495680_0034950_2620_3153 175
1518 3300047322 Ga0495680_0062566 Ga0495680_0062566_101_628 175
1519 3300047323 Ga0495683_0001368 Ga0495683_0001368_15233_15760 175
1520 3300047469 Ga0495673_0004383 Ga0495673_0004383_8241_8768 175
1521 3300047469 Ga0495673_0280345 Ga0495673_0280345_36_563 175
1522 3300047470 Ga0495681_0048784 Ga0495681_0048784_919_1446 175
1523 3300047471 Ga0495684_0171957 Ga0495684_0171957_623_1150 175
1524 3300047472 Ga0495686_0002623 Ga0495686_0002623_7707_8234 175
1525 3300047472 Ga0495686_0016058 Ga0495686_0016058_3656_4183 175
1526 3300047472 Ga0495686_0020835 Ga0495686_0020835_1759_2286 175
1527 3300047472 Ga0495686_0090147 Ga0495686_0090147_261_788 175
1528 3300047472 Ga0495686_0132209 Ga0495686_0132209_879_1406 175
1529 3300047472 Ga0495686_0174002 Ga0495686_0174002_587_1114 175
1530 3300047673 Ga0495593_0001943 Ga0495593_0001943_7823_8356 175
1531 3300048089 Ga0495614_0000618 Ga0495614_0000618_11769_12302 175
1532 3300048091 Ga0495626_0131805 Ga0495626_0131805_483_1016 175
1533 3300048903 Ga0496100_0170883 Ga0496100_0170883_343_870 175
1534 3300048903 Ga0496100_0380764 Ga0496100_0380764_396_923 175
1535 3300048903 Ga0496100_0518741 Ga0496100_0518741_182_709 175
1536 3300048904 Ga0496101_0013058 Ga0496101_0013058_4564_5091 175
1537 3300048904 Ga0496101_0036782 Ga0496101_0036782_199_726 175
1538 3300048904 Ga0496101_0539933 Ga0496101_0539933_37_564 175
1539 3300048905 Ga0496102_0050617 Ga0496102_0050617_2881_3408 175
1540 3300048905 Ga0496102_0386817 Ga0496102_0386817_400_933 175
1541 3300048905 Ga0496102_1117668 Ga0496102_1117668_16_543 175
1542 3300048906 Ga0496103_0064524 Ga0496103_0064524_597_1124 175
1543 3300048906 Ga0496103_0388693 Ga0496103_0388693_28_561 175
1544 3300048907 Ga0496104_0000099 Ga0496104_0000099_7785_8312 175
1545 3300048907 Ga0496104_0152095 Ga0496104_0152095_720_1247 175
1546 3300048907 Ga0496104_1091374 Ga0496104_1091374_137_664 175
1547 3300048908 Ga0496105_0000021 Ga0496105_0000021_87814_88341 175
1548 3300048908 Ga0496105_0047563 Ga0496105_0047563_1066_1593 175
1549 3300048908 Ga0496105_0210949 Ga0496105_0210949_260_787 175
1550 3300048908 Ga0496105_0289678 Ga0496105_0289678_358_891 175
1551 3300048909 Ga0496106_0003988 Ga0496106_0003988_7470_7997 175
1552 3300048909 Ga0496106_0008692 Ga0496106_0008692_5744_6271 175
1553 3300048910 Ga0496107_0010615 Ga0496107_0010615_166_699 175
1554 3300048910 Ga0496107_0107909 Ga0496107_0107909_475_1002 175
1555 3300048910 Ga0496107_0351638 Ga0496107_0351638_107_634 175
1556 3300048911 Ga0496108_0001932 Ga0496108_0001932_7582_8109 175
1557 3300048911 Ga0496108_0075478 Ga0496108_0075478_421_948 175
1558 3300048911 Ga0496108_0242809 Ga0496108_0242809_682_1209 175
1559 3300048911 Ga0496108_0279880 Ga0496108_0279880_585_1118 175
1560 3300048911 Ga0496108_0487406 Ga0496108_0487406_161_688 175
1561 3300048912 Ga0496109_0020058 Ga0496109_0020058_4780_5307 175
1562 3300048912 Ga0496109_0154445 Ga0496109_0154445_1265_1792 175
1563 3300048912 Ga0496109_0321773 Ga0496109_0321773_552_1079 175
1564 3300048913 Ga0496110_0126246 Ga0496110_0126246_466_993 175
1565 3300048914 Ga0496111_0003793 Ga0496111_0003793_7455_7982 175
1566 3300048915 Ga0496112_0052028 Ga0496112_0052028_1402_1929 175
1567 3300048915 Ga0496112_0187566 Ga0496112_0187566_353_880 175
1568 3300048915 Ga0496112_0583745 Ga0496112_0583745_217_744 175
1569 3300048916 Ga0496113_0016963 Ga0496113_0016963_658_1191 175
1570 3300048916 Ga0496113_0042432 Ga0496113_0042432_1433_1960 175
1571 3300048916 Ga0496113_0136295 Ga0496113_0136295_501_1028 175
1572 3300048916 Ga0496113_0283266 Ga0496113_0283266_333_860 175
1573 3300048916 Ga0496113_0906873 Ga0496113_0906873_83_610 175
1574 3300048917 Ga0496114_0009046 Ga0496114_0009046_5023_5550 175
1575 3300048917 Ga0496114_0066989 Ga0496114_0066989_936_1463 175
1576 3300048917 Ga0496114_0076184 Ga0496114_0076184_1720_2247 175
1577 3300048917 Ga0496114_0092630 Ga0496114_0092630_1471_2004 175
1578 3300048918 Ga0496115_0002269 Ga0496115_0002269_5451_5978 175
1579 3300048918 Ga0496115_0322756 Ga0496115_0322756_143_676 175
1580 3300048918 Ga0496115_0458302 Ga0496115_0458302_110_637 175
1581 3300048918 Ga0496115_1035865 Ga0496115_1035865_68_595 175
1582 3300048919 Ga0496116_0060116 Ga0496116_0060116_1858_2385 175
1583 3300048919 Ga0496116_0182500 Ga0496116_0182500_238_765 175
1584 3300048919 Ga0496116_0200164 Ga0496116_0200164_309_836 175
1585 3300048919 Ga0496116_0224422 Ga0496116_0224422_386_913 175
1586 3300048920 Ga0496117_0038261 Ga0496117_0038261_1103_1630 175
1587 3300048920 Ga0496117_0048335 Ga0496117_0048335_2351_2878 175
1588 3300048920 Ga0496117_0088673 Ga0496117_0088673_405_932 175
1589 3300048920 Ga0496117_0132932 Ga0496117_0132932_460_987 175
1590 3300048920 Ga0496117_0241518 Ga0496117_0241518_332_859 175
1591 3300048920 Ga0496117_0250817 Ga0496117_0250817_369_896 175
1592 3300048920 Ga0496117_0271007 Ga0496117_0271007_208_735 175
1593 3300048921 Ga0496118_0012660 Ga0496118_0012660_4711_5238 175
1594 3300048921 Ga0496118_0017126 Ga0496118_0017126_4949_5476 175
1595 3300048921 Ga0496118_0081719 Ga0496118_0081719_369_896 175
1596 3300048921 Ga0496118_0148790 Ga0496118_0148790_565_1092 175
1597 3300048921 Ga0496118_0195736 Ga0496118_0195736_513_1040 175
1598 3300048921 Ga0496118_0240812 Ga0496118_0240812_318_845 175
1599 3300048921 Ga0496118_0259181 Ga0496118_0259181_245_772 175
1600 3300048921 Ga0496118_0348164 Ga0496118_0348164_15_542 175
1601 3300048922 Ga0496119_0003231 Ga0496119_0003231_14890_15417 175
1602 3300048922 Ga0496119_0020091 Ga0496119_0020091_2040_2567 175
1603 3300048923 Ga0496120_0007517 Ga0496120_0007517_6060_6587 175
1604 3300048923 Ga0496120_0009138 Ga0496120_0009138_4581_5108 175
1605 3300048924 Ga0496121_0000290 Ga0496121_0000290_3906_4433 175
1606 3300048924 Ga0496121_0005001 Ga0496121_0005001_9195_9722 175
1607 3300048924 Ga0496121_0041619 Ga0496121_0041619_618_1145 175
1608 3300048924 Ga0496121_0054269 Ga0496121_0054269_1072_1599 175
1609 3300048924 Ga0496121_0072653 Ga0496121_0072653_1411_1938 175
1610 3300048924 Ga0496121_0117591 Ga0496121_0117591_1007_1534 175
1611 3300048924 Ga0496121_0195020 Ga0496121_0195020_463_990 175
1612 3300048925 Ga0496122_0001230 Ga0496122_0001230_35021_35548 175
1613 3300048925 Ga0496122_0011228 Ga0496122_0011228_4582_5109 175
1614 3300048925 Ga0496122_0041301 Ga0496122_0041301_924_1451 175
1615 3300048925 Ga0496122_0046603 Ga0496122_0046603_555_1082 175
1616 3300048925 Ga0496122_0088624 Ga0496122_0088624_778_1305 175
1617 3300048925 Ga0496122_0115961 Ga0496122_0115961_909_1436 175
1618 3300048925 Ga0496122_0122978 Ga0496122_0122978_1062_1589 175
1619 3300048925 Ga0496122_0196517 Ga0496122_0196517_484_1011 175
1620 3300048926 Ga0496123_0001008 Ga0496123_0001008_7711_8238 175
1621 3300048926 Ga0496123_0003328 Ga0496123_0003328_2349_2876 175
1622 3300048926 Ga0496123_0066416 Ga0496123_0066416_1466_1993 175
1623 3300048926 Ga0496123_0078476 Ga0496123_0078476_693_1220 175
1624 3300048926 Ga0496123_0093154 Ga0496123_0093154_132_659 175
1625 3300048926 Ga0496123_0093871 Ga0496123_0093871_932_1459 175
1626 3300048926 Ga0496123_0164721 Ga0496123_0164721_174_701 175
1627 3300048926 Ga0496123_0198923 Ga0496123_0198923_106_633 175
1628 3300048927 Ga0496124_0000018 Ga0496124_0000018_434704_435231 175
1629 3300048927 Ga0496124_0000472 Ga0496124_0000472_7825_8352 175
1630 3300048927 Ga0496124_0003716 Ga0496124_0003716_15294_15821 175
1631 3300048927 Ga0496124_0103293 Ga0496124_0103293_1121_1648 175
1632 3300048927 Ga0496124_0107130 Ga0496124_0107130_1111_1638 175
1633 3300048927 Ga0496124_0155935 Ga0496124_0155935_516_1043 175
1634 3300048927 Ga0496124_0223602 Ga0496124_0223602_465_992 175
1635 3300048927 Ga0496124_0531639 Ga0496124_0531639_66_593 175
1636 3300048927 Ga0496124_0531649 Ga0496124_0531649_66_593 175
1637 3300048928 Ga0496125_0027337 Ga0496125_0027337_90_617 175
1638 3300048928 Ga0496125_0036008 Ga0496125_0036008_2063_2590 175
1639 3300048928 Ga0496125_0050036 Ga0496125_0050036_968_1495 175
1640 3300048928 Ga0496125_0062163 Ga0496125_0062163_1728_2255 175
1641 3300048928 Ga0496125_0197686 Ga0496125_0197686_149_676 175
1642 3300048928 Ga0496125_0250246 Ga0496125_0250246_381_908 175
1643 3300048928 Ga0496125_0407423 Ga0496125_0407423_223_750 175
1644 3300048929 Ga0496126_0007636 Ga0496126_0007636_6148_6675 175
1645 3300048929 Ga0496126_0104107 Ga0496126_0104107_105_632 175
1646 3300048929 Ga0496126_0116836 Ga0496126_0116836_720_1247 175
1647 3300048929 Ga0496126_0330299 Ga0496126_0330299_105_632 175
1648 3300048929 Ga0496126_0569278 Ga0496126_0569278_29_556 175
1649 3300048929 Ga0496126_0968335 Ga0496126_0968335_13_540 175
1650 3300049127 Ga0501306_001780 Ga0501306_001780_863_1390 175
1651 3300049127 Ga0501306_005676 Ga0501306_005676_867_1394 175
1652 3300049128 Ga0501308_000488 Ga0501308_000488_340_867 175
1653 3300049128 Ga0501308_000777 Ga0501308_000777_348_875 175
1654 3300049128 Ga0501308_050856 Ga0501308_050856_58_585 175
1655 3300049129 Ga0501309_004802 Ga0501309_004802_518_1045 175
1656 3300049130 Ga0501310_000758 Ga0501310_000758_1368_1895 175
1657 3300049130 Ga0501310_003470 Ga0501310_003470_867_1394 175
1658 3300049130 Ga0501310_015527 Ga0501310_015527_345_872 175
1659 3300049132 Ga0501343_013739 Ga0501343_013739_51_578 175
1660 3300049160 Ga0501304_000546 Ga0501304_000546_948_1475 175
1661 3300049161 Ga0501305_001737 Ga0501305_001737_948_1475 175
1662 3300049161 Ga0501305_005772 Ga0501305_005772_542_1069 175
1663 3300049161 Ga0501305_006326 Ga0501305_006326_74_601 175
1664 3300049162 Ga0501307_001101 Ga0501307_001101_960_1487 175
1665 3300049162 Ga0501307_046379 Ga0501307_046379_35_562 175
1666 3300049460 Ga0495682_0005558 Ga0495682_0005558_1178_1705 175
1667 3300049517 Ga0501294_026264 Ga0501294_026264_14_541 175
1668 3300049527 Ga0501311_013019 Ga0501311_013019_47_574 175
1669 3300049528 Ga0501312_001049 Ga0501312_001049_1100_1627 175
1670 3300049528 Ga0501312_004227 Ga0501312_004227_1053_1580 175
1671 3300049529 Ga0501313_012506 Ga0501313_012506_347_874 175
1672 3300049530 Ga0501314_005871 Ga0501314_005871_109_636 175
1673 3300049531 Ga0501315_001594 Ga0501315_001594_592_1119 175
1674 3300049531 Ga0501315_063067 Ga0501315_063067_27_554 175
1675 3300049532 Ga0501316_044012 Ga0501316_044012_37_564 175
1676 3300049533 Ga0501317_005176 Ga0501317_005176_83_610 175
1677 3300049534 Ga0501318_014963 Ga0501318_014963_286_813 175
1678 3300049535 Ga0501319_000796 Ga0501319_000796_248_775 175
1679 3300049536 Ga0501320_001303 Ga0501320_001303_478_1005 175
1680 3300049536 Ga0501320_001705 Ga0501320_001705_401_928 175
1681 3300049537 Ga0501321_003285 Ga0501321_003285_500_1027 175
1682 3300049539 Ga0501323_000045 Ga0501323_000045_3012_3539 175
1683 3300049539 Ga0501323_013709 Ga0501323_013709_173_700 175
1684 3300049539 Ga0501323_061396 Ga0501323_061396_14_541 175
1685 3300049540 Ga0501324_000219 Ga0501324_000219_1360_1887 175
1686 3300049540 Ga0501324_001839 Ga0501324_001839_498_1025 175
1687 3300049540 Ga0501324_006088 Ga0501324_006088_181_708 175
1688 3300049541 Ga0501325_001704 Ga0501325_001704_99_626 175
1689 3300049541 Ga0501325_002598 Ga0501325_002598_665_1192 175
1690 3300049542 Ga0501326_00317 Ga0501326_00317_1272_1799 175
1691 3300049543 Ga0501327_01567 Ga0501327_01567_524_1051 175
1692 3300049544 Ga0501328_03766 Ga0501328_03766_112_639 175
1693 3300049545 Ga0501329_00156 Ga0501329_00156_1251_1778 175
1694 3300049546 Ga0501330_000068 Ga0501330_000068_1699_2226 175
1695 3300049548 Ga0501332_09979 Ga0501332_09979_25_552 175
1696 3300049549 Ga0501333_002823 Ga0501333_002823_458_985 175
1697 3300049551 Ga0501335_009797 Ga0501335_009797_99_626 175
1698 3300049552 Ga0501336_015297 Ga0501336_015297_111_638 175
1699 3300049552 Ga0501336_018977 Ga0501336_018977_38_565 175
1700 3300049568 Ga0501031_0013723 Ga0501031_0013723_1940_2467 175
1701 3300049568 Ga0501031_0037502 Ga0501031_0037502_1846_2373 175
1702 3300049568 Ga0501031_0149599 Ga0501031_0149599_147_680 175
1703 3300049568 Ga0501031_0394411 Ga0501031_0394411_90_617 175
1704 3300049568 Ga0501031_0424205 Ga0501031_0424205_206_733 175
1705 3300049569 Ga0501032_0002031 Ga0501032_0002031_11785_12312 175
1706 3300049569 Ga0501032_0002355 Ga0501032_0002355_7612_8139 175
1707 3300049569 Ga0501032_0204779 Ga0501032_0204779_39_572 175
1708 3300049570 Ga0501033_0000337 Ga0501033_0000337_7633_8160 175
1709 3300049570 Ga0501033_0003263 Ga0501033_0003263_7603_8130 175
1710 3300049570 Ga0501033_0004251 Ga0501033_0004251_6257_6784 175
1711 3300049570 Ga0501033_0005276 Ga0501033_0005276_5546_6073 175
1712 3300049570 Ga0501033_0041308 Ga0501033_0041308_2272_2799 175
1713 3300049571 Ga0501034_0000903 Ga0501034_0000903_3321_3848 175
1714 3300049571 Ga0501034_0002672 Ga0501034_0002672_18626_19153 175
1715 3300049571 Ga0501034_0005654 Ga0501034_0005654_6945_7472 175
1716 3300049571 Ga0501034_0007261 Ga0501034_0007261_10210_10737 175
1717 3300049571 Ga0501034_0067458 Ga0501034_0067458_2997_3530 175
1718 3300049571 Ga0501034_0363427 Ga0501034_0363427_215_742 175
1719 3300049571 Ga0501034_0826174 Ga0501034_0826174_162_689 175
1720 3300049571 Ga0501034_0985161 Ga0501034_0985161_158_691 175
1721 3300049572 Ga0501036_0006195 Ga0501036_0006195_1781_2308 175
1722 3300049572 Ga0501036_0025050 Ga0501036_0025050_185_712 175
1723 3300049572 Ga0501036_0061179 Ga0501036_0061179_2179_2706 175
1724 3300049572 Ga0501036_0062381 Ga0501036_0062381_2264_2797 175
1725 3300049572 Ga0501036_0063713 Ga0501036_0063713_667_1194 175
1726 3300049572 Ga0501036_0090769 Ga0501036_0090769_449_982 175
1727 3300049572 Ga0501036_0173660 Ga0501036_0173660_1098_1631 175
1728 3300049572 Ga0501036_0403716 Ga0501036_0403716_35_568 175
1729 3300049572 Ga0501036_0485581 Ga0501036_0485581_92_625 175
1730 3300049572 Ga0501036_0608447 Ga0501036_0608447_134_667 175
1731 3300049573 Ga0501037_0001372 Ga0501037_0001372_8877_9404 175
1732 3300049573 Ga0501037_0027308 Ga0501037_0027308_643_1170 175
1733 3300049573 Ga0501037_0063741 Ga0501037_0063741_1342_1869 175
1734 3300049573 Ga0501037_0125311 Ga0501037_0125311_530_1063 175
1735 3300049573 Ga0501037_0133453 Ga0501037_0133453_595_1128 175
1736 3300049573 Ga0501037_0146633 Ga0501037_0146633_1122_1649 175
1737 3300049574 Ga0501038_0000314 Ga0501038_0000314_7316_7843 175
1738 3300049574 Ga0501038_0023939 Ga0501038_0023939_4310_4843 175
1739 3300049574 Ga0501038_0155996 Ga0501038_0155996_1156_1683 175
1740 3300049574 Ga0501038_0161708 Ga0501038_0161708_921_1454 175
1741 3300049574 Ga0501038_0400170 Ga0501038_0400170_36_569 175
1742 3300049575 Ga0501039_0002463 Ga0501039_0002463_927_1454 175
1743 3300049575 Ga0501039_0003833 Ga0501039_0003833_10224_10751 175
1744 3300049575 Ga0501039_0056068 Ga0501039_0056068_618_1151 175
1745 3300049575 Ga0501039_0122949 Ga0501039_0122949_643_1170 175
1746 3300049575 Ga0501039_0988887 Ga0501039_0988887_16_549 175
1747 3300049576 Ga0501040_0025390 Ga0501040_0025390_423_950 175
1748 3300049576 Ga0501040_0041806 Ga0501040_0041806_563_1096 175
1749 3300049576 Ga0501040_0112261 Ga0501040_0112261_175_708 175
1750 3300049576 Ga0501040_0120531 Ga0501040_0120531_1185_1718 175
1751 3300049577 Ga0501041_0030250 Ga0501041_0030250_1261_1794 175
1752 3300049577 Ga0501041_0056868 Ga0501041_0056868_1182_1715 175
1753 3300049577 Ga0501041_0174619 Ga0501041_0174619_405_932 175
1754 3300049577 Ga0501041_0701259 Ga0501041_0701259_87_614 175
1755 3300049578 Ga0501042_0105484 Ga0501042_0105484_160_693 175
1756 3300049578 Ga0501042_0150335 Ga0501042_0150335_229_762 175
1757 3300049578 Ga0501042_0157647 Ga0501042_0157647_19_552 175
1758 3300049578 Ga0501042_0222762 Ga0501042_0222762_417_944 175
1759 3300049579 Ga0501043_0001324 Ga0501043_0001324_13545_14072 175
1760 3300049579 Ga0501043_0048418 Ga0501043_0048418_1927_2454 175
1761 3300049579 Ga0501043_0073094 Ga0501043_0073094_2120_2653 175
1762 3300049579 Ga0501043_0123690 Ga0501043_0123690_1120_1647 175
1763 3300049579 Ga0501043_0293659 Ga0501043_0293659_279_806 175
1764 3300049579 Ga0501043_0341615 Ga0501043_0341615_255_788 175
1765 3300049579 Ga0501043_0422890 Ga0501043_0422890_371_904 175
1766 3300049579 Ga0501043_0442666 Ga0501043_0442666_139_666 175
1767 3300049580 Ga0501046_0001012 Ga0501046_0001012_7587_8114 175
1768 3300049580 Ga0501046_0034719 Ga0501046_0034719_1057_1584 175
1769 3300049580 Ga0501046_0056315 Ga0501046_0056315_1056_1583 175
1770 3300049580 Ga0501046_0129715 Ga0501046_0129715_734_1267 175
1771 3300049580 Ga0501046_0203878 Ga0501046_0203878_94_627 175
1772 3300049580 Ga0501046_0278251 Ga0501046_0278251_52_585 175
1773 3300049581 Ga0501047_0004195 Ga0501047_0004195_5427_5954 175
1774 3300049581 Ga0501047_0038158 Ga0501047_0038158_1127_1654 175
1775 3300049581 Ga0501047_0100304 Ga0501047_0100304_2080_2613 175
1776 3300049581 Ga0501047_0245353 Ga0501047_0245353_266_793 175
1777 3300049581 Ga0501047_0377820 Ga0501047_0377820_641_1168 175
1778 3300049581 Ga0501047_0450453 Ga0501047_0450453_391_918 175
1779 3300049581 Ga0501047_0508199 Ga0501047_0508199_31_558 175
1780 3300049582 Ga0501048_0017587 Ga0501048_0017587_2098_2631 175
1781 3300049582 Ga0501048_0077415 Ga0501048_0077415_887_1414 175
1782 3300049582 Ga0501048_0149473 Ga0501048_0149473_1027_1554 175
1783 3300049582 Ga0501048_0168400 Ga0501048_0168400_581_1114 175
1784 3300049582 Ga0501048_0282946 Ga0501048_0282946_557_1084 175
1785 3300049582 Ga0501048_0781075 Ga0501048_0781075_24_551 175
1786 3300049583 Ga0501067_0031215 Ga0501067_0031215_2111_2638 175
1787 3300049583 Ga0501067_0031483 Ga0501067_0031483_1541_2068 175
1788 3300049583 Ga0501067_0038285 Ga0501067_0038285_1257_1784 175
1789 3300049584 Ga0501068_0001465 Ga0501068_0001465_6594_7121 175
1790 3300049584 Ga0501068_0090035 Ga0501068_0090035_946_1473 175
1791 3300049584 Ga0501068_0097691 Ga0501068_0097691_1135_1662 175
1792 3300049584 Ga0501068_0101141 Ga0501068_0101141_576_1109 175
1793 3300049584 Ga0501068_0122300 Ga0501068_0122300_279_806 175
1794 3300049584 Ga0501068_0316674 Ga0501068_0316674_384_917 175
1795 3300049584 Ga0501068_0366512 Ga0501068_0366512_188_721 175
1796 3300049584 Ga0501068_0394082 Ga0501068_0394082_282_809 175
1797 3300049585 Ga0501069_0005572 Ga0501069_0005572_2210_2737 175
1798 3300049585 Ga0501069_0034143 Ga0501069_0034143_553_1080 175
1799 3300049585 Ga0501069_0056888 Ga0501069_0056888_1435_1962 175
1800 3300049585 Ga0501069_0187904 Ga0501069_0187904_573_1106 175
1801 3300049585 Ga0501069_0444079 Ga0501069_0444079_145_678 175
1802 3300049586 Ga0501070_0032811 Ga0501070_0032811_1908_2435 175
1803 3300049586 Ga0501070_0036607 Ga0501070_0036607_2303_2854 175
1804 3300049586 Ga0501070_0052444 Ga0501070_0052444_2318_2845 175
1805 3300049586 Ga0501070_0145613 Ga0501070_0145613_1060_1593 175
1806 3300049586 Ga0501070_0169408 Ga0501070_0169408_465_992 175
1807 3300049586 Ga0501070_0188996 Ga0501070_0188996_464_991 175
1808 3300049586 Ga0501070_0222501 Ga0501070_0222501_760_1287 175
1809 3300049586 Ga0501070_0379810 Ga0501070_0379810_279_806 175
1810 3300049586 Ga0501070_0406056 Ga0501070_0406056_243_776 175
1811 3300049586 Ga0501070_0426311 Ga0501070_0426311_520_1053 175
1812 3300049587 Ga0501071_0019646 Ga0501071_0019646_2684_3211 175
1813 3300049587 Ga0501071_0107543 Ga0501071_0107543_600_1133 175
1814 3300049587 Ga0501071_0144858 Ga0501071_0144858_964_1491 175
1815 3300049587 Ga0501071_0228529 Ga0501071_0228529_251_778 175
1816 3300049587 Ga0501071_0268065 Ga0501071_0268065_457_990 175
1817 3300049587 Ga0501071_0710782 Ga0501071_0710782_79_606 175
1818 3300049588 Ga0501072_0014748 Ga0501072_0014748_2408_2935 175
1819 3300049588 Ga0501072_0039445 Ga0501072_0039445_834_1367 175
1820 3300049588 Ga0501072_0101863 Ga0501072_0101863_1245_1772 175
1821 3300049588 Ga0501072_0144574 Ga0501072_0144574_924_1457 175
1822 3300049588 Ga0501072_0272117 Ga0501072_0272117_28_561 175
1823 3300049589 Ga0501073_0000525 Ga0501073_0000525_9111_9638 175
1824 3300049589 Ga0501073_0012347 Ga0501073_0012347_4640_5167 175
1825 3300049589 Ga0501073_0019511 Ga0501073_0019511_1490_2017 175
1826 3300049589 Ga0501073_0055413 Ga0501073_0055413_634_1167 175
1827 3300049589 Ga0501073_0065047 Ga0501073_0065047_1112_1654 175
1828 3300049589 Ga0501073_0096535 Ga0501073_0096535_1289_1816 175
1829 3300049589 Ga0501073_0194049 Ga0501073_0194049_122_655 175
1830 3300049589 Ga0501073_0213490 Ga0501073_0213490_612_1145 175
1831 3300049589 Ga0501073_0216221 Ga0501073_0216221_584_1111 175
1832 3300049590 Ga0501074_0001124 Ga0501074_0001124_14377_14904 175
1833 3300049590 Ga0501074_0038575 Ga0501074_0038575_2110_2637 175
1834 3300049590 Ga0501074_0099909 Ga0501074_0099909_853_1386 175
1835 3300049590 Ga0501074_0100501 Ga0501074_0100501_637_1170 175
1836 3300049590 Ga0501074_0153018 Ga0501074_0153018_156_683 175
1837 3300049590 Ga0501074_0232763 Ga0501074_0232763_232_765 175
1838 3300049590 Ga0501074_0384787 Ga0501074_0384787_181_714 175
1839 3300049590 Ga0501074_0399860 Ga0501074_0399860_108_635 175
1840 3300049591 Ga0501075_0017316 Ga0501075_0017316_3906_4439 175
1841 3300049591 Ga0501075_0057084 Ga0501075_0057084_2043_2576 175
1842 3300049591 Ga0501075_0163387 Ga0501075_0163387_22_555 175
1843 3300049591 Ga0501075_0496325 Ga0501075_0496325_210_743 175
1844 3300049592 Ga0501076_0028505 Ga0501076_0028505_2422_2949 175
1845 3300049592 Ga0501076_0147253 Ga0501076_0147253_929_1477 175
1846 3300049592 Ga0501076_0173537 Ga0501076_0173537_454_987 175
1847 3300049592 Ga0501076_0179602 Ga0501076_0179602_147_680 175
1848 3300049592 Ga0501076_0242983 Ga0501076_0242983_443_976 175
1849 3300049592 Ga0501076_0282242 Ga0501076_0282242_546_1079 175
1850 3300049593 Ga0501077_0002875 Ga0501077_0002875_2911_3438 175
1851 3300049593 Ga0501077_0013704 Ga0501077_0013704_4304_4837 175
1852 3300049593 Ga0501077_0020871 Ga0501077_0020871_602_1135 175
1853 3300049593 Ga0501077_0110900 Ga0501077_0110900_397_930 175
1854 3300049593 Ga0501077_0117550 Ga0501077_0117550_346_879 175
1855 3300049593 Ga0501077_0272343 Ga0501077_0272343_502_1029 175
1856 3300049661 Ga0501217_084378 Ga0501217_084378_60_587 175
1857 3300049663 Ga0501223_003806 Ga0501223_003806_763_1290 175
1858 3300049669 Ga0501235_025754 Ga0501235_025754_291_818 175
1859 3300049672 Ga0501239_046041 Ga0501239_046041_38_565 175
1860 3300049674 Ga0501242_028665 Ga0501242_028665_117_644 175
1861 3300049683 Ga0501253_014398 Ga0501253_014398_644_1171 175
1862 3300049688 Ga0501259_033855 Ga0501259_033855_163_690 175
1863 3300049688 Ga0501259_066471 Ga0501259_066471_216_743 175
1864 3300049690 Ga0501261_012252 Ga0501261_012252_476_1003 175
1865 3300049704 Ga0501221_086240 Ga0501221_086240_86_613 175
1866 3300049705 Ga0501225_0023498 Ga0501225_0023498_971_1498 175
1867 3300049741 Ga0501079_0004772 Ga0501079_0004772_1055_1582 175
1868 3300049741 Ga0501079_0012910 Ga0501079_0012910_3308_3835 175
1869 3300049741 Ga0501079_0064512 Ga0501079_0064512_1479_2012 175
1870 3300049741 Ga0501079_0177596 Ga0501079_0177596_862_1389 175
1871 3300049742 Ga0501080_0001373 Ga0501080_0001373_8406_8933 175
1872 3300049742 Ga0501080_0004228 Ga0501080_0004228_1014_1541 175
1873 3300049742 Ga0501080_0018049 Ga0501080_0018049_5757_6290 175
1874 3300049742 Ga0501080_0026073 Ga0501080_0026073_307_834 175
1875 3300049742 Ga0501080_0041576 Ga0501080_0041576_2891_3418 175
1876 3300049742 Ga0501080_0047460 Ga0501080_0047460_2875_3408 175
1877 3300049742 Ga0501080_0100770 Ga0501080_0100770_1934_2461 175
1878 3300049742 Ga0501080_0109324 Ga0501080_0109324_1991_2518 175
1879 3300049742 Ga0501080_0159566 Ga0501080_0159566_1007_1534 175
1880 3300049742 Ga0501080_0590651 Ga0501080_0590651_96_629 175
1881 3300049742 Ga0501080_0798337 Ga0501080_0798337_44_571 175
1882 3300049743 Ga0501081_0097937 Ga0501081_0097937_1211_1744 175
1883 3300049743 Ga0501081_0145138 Ga0501081_0145138_659_1192 175
1884 3300049743 Ga0501081_0387202 Ga0501081_0387202_280_813 175
1885 3300049743 Ga0501081_0664046 Ga0501081_0664046_86_613 175
1886 3300049743 Ga0501081_0928491 Ga0501081_0928491_61_594 175
1887 3300049744 Ga0501083_0004501 Ga0501083_0004501_3680_4207 175
1888 3300049744 Ga0501083_0021498 Ga0501083_0021498_887_1414 175
1889 3300049744 Ga0501083_0091220 Ga0501083_0091220_1468_2001 175
1890 3300049744 Ga0501083_0200719 Ga0501083_0200719_363_896 175
1891 3300049744 Ga0501083_0266013 Ga0501083_0266013_567_1094 175
1892 3300049744 Ga0501083_0291073 Ga0501083_0291073_439_966 175
1893 3300049763 Ga0501266_010008 Ga0501266_010008_151_678 175
1894 3300049765 Ga0501268_001085 Ga0501268_001085_464_991 175
1895 3300049767 Ga0501270_004217 Ga0501270_004217_510_1037 175
1896 3300049822 Ga0501035_0000666 Ga0501035_0000666_25426_25953 175
1897 3300049822 Ga0501035_0023174 Ga0501035_0023174_3242_3769 175
1898 3300049822 Ga0501035_0240284 Ga0501035_0240284_362_895 175
1899 3300049822 Ga0501035_0315951 Ga0501035_0315951_131_658 175
1900 3300049822 Ga0501035_0689638 Ga0501035_0689638_170_703 175
1901 3300049823 Ga0501044_0004802 Ga0501044_0004802_6975_7502 175
1902 3300049823 Ga0501044_0020968 Ga0501044_0020968_219_752 175
1903 3300049823 Ga0501044_0028230 Ga0501044_0028230_3384_3911 175
1904 3300049823 Ga0501044_0052796 Ga0501044_0052796_2817_3350 175
1905 3300049823 Ga0501044_0097351 Ga0501044_0097351_1310_1837 175
1906 3300049823 Ga0501044_0115022 Ga0501044_0115022_874_1401 175
1907 3300049823 Ga0501044_0174050 Ga0501044_0174050_470_1012 175
1908 3300049823 Ga0501044_0344411 Ga0501044_0344411_760_1287 175
1909 3300049824 Ga0501045_0091755 Ga0501045_0091755_1400_1933 175
1910 3300049824 Ga0501045_0127077 Ga0501045_0127077_104_637 175
1911 3300049824 Ga0501045_0337496 Ga0501045_0337496_441_968 175
1912 3300049851 Ga0501212_031705 Ga0501212_031705_40_567 175
1913 3300050489 nmdc:mga03683_332218_c1 nmdc:mga03683_332218_c1_33_566 175
1914 3300050491 nmdc:mga00v17_2568_c1 nmdc:mga00v17_2568_c1_5926_6453 175
1915 3300050491 nmdc:mga00v17_267434_c1 nmdc:mga00v17_267434_c1_539_1066 175
1916 3300050491 nmdc:mga00v17_5329_c1 nmdc:mga00v17_5329_c1_3710_4243 175
1917 3300050491 nmdc:mga00v17_5359_c1 nmdc:mga00v17_5359_c1_5535_6062 175
1918 3300050491 nmdc:mga00v17_81641_c1 nmdc:mga00v17_81641_c1_664_1191 175
1919 3300050492 nmdc:mga0yw44_629040_c1 nmdc:mga0yw44_629040_c1_86_619 175
1920 3300050493 nmdc:mga0k408_1928_c1 nmdc:mga0k408_1928_c1_2353_2886 175
1921 3300050493 nmdc:mga0k408_433156_c1 nmdc:mga0k408_433156_c1_82_609 175
1922 3300050494 nmdc:mga06z11_8708_c1 nmdc:mga06z11_8708_c1_3054_3587 175
1923 3300050494 nmdc:mga06z11_99456_c1 nmdc:mga06z11_99456_c1_659_1192 175
1924 3300050495 nmdc:mga04h51_159777_c1 nmdc:mga04h51_159777_c1_147_674 175
1925 3300050495 nmdc:mga04h51_87027_c1 nmdc:mga04h51_87027_c1_507_1040 175
1926 3300050510 nmdc:mga06r32_525665_c1 nmdc:mga06r32_525665_c1_77_604 175
1927 3300050510 nmdc:mga06r32_90056_c1 nmdc:mga06r32_90056_c1_1817_2350 175
1928 3300050511 nmdc:mga08y16_208685_c1 nmdc:mga08y16_208685_c1_734_1261 175
1929 3300050511 nmdc:mga08y16_397291_c1 nmdc:mga08y16_397291_c1_111_638 175
1930 3300050511 nmdc:mga08y16_485070_c1 nmdc:mga08y16_485070_c1_61_588 175
1931 3300050512 nmdc:mga0n895_1429225_c1 nmdc:mga0n895_1429225_c1_95_622 175
1932 3300050516 nmdc:mga0sz30_1133_c1 nmdc:mga0sz30_1133_c1_5119_5652 175
1933 3300053079 Ga0500610_0000159 Ga0500610_0000159_7322_7849 175
1934 3300053083 Ga0495655_0027539 Ga0495655_0027539_18_545 175
1935 3300053084 Ga0495595_0047137 Ga0495595_0047137_956_1489 175
1936 3300053085 Ga0495619_0001164 Ga0495619_0001164_8486_9019 175
1937 3300053087 Ga0500643_000120 Ga0500643_000120_35331_35858 175
1938 3300053087 Ga0500643_001959 Ga0500643_001959_4860_5387 175
1939 3300053092 Ga0500583_0130815 Ga0500583_0130815_289_816 175
1940 3300053093 Ga0500651_0003432 Ga0500651_0003432_4379_4906 175
1941 3300053096 Ga0500641_0008546 Ga0500641_0008546_1681_2214 175
1942 3300053103 Ga0500555_001019 Ga0500555_001019_8464_8991 175
1943 3300053120 Ga0500597_002753 Ga0500597_002753_3226_3753 175
1944 3300053123 Ga0500614_027889 Ga0500614_027889_793_1332 175
1945 3300053123 Ga0500614_146339 Ga0500614_146339_100_627 175
1946 3300053129 Ga0500628_019518 Ga0500628_019518_435_962 175
1947 3300053160 Ga0500633_0006586 Ga0500633_0006586_2036_2563 175
1948 3300053161 Ga0500634_0035981 Ga0500634_0035981_390_917 175
1949 3300053178 Ga0500637_0392942 Ga0500637_0392942_101_628 175
1950 3300053734 Ga0500565_000972 Ga0500565_000972_1027_1554 175
1951 3300054114 Ga0501084_0022568 Ga0501084_0022568_3649_4176 175
1952 3300054114 Ga0501084_0104394 Ga0501084_0104394_350_883 175
1953 3300054114 Ga0501084_0110341 Ga0501084_0110341_1632_2159 175
1954 3300054114 Ga0501084_0140781 Ga0501084_0140781_528_1061 175
1955 3300054114 Ga0501084_0185358 Ga0501084_0185358_773_1300 175
1956 3300054114 Ga0501084_0255215 Ga0501084_0255215_844_1377 175
1957 3300054114 Ga0501084_0548787 Ga0501084_0548787_128_655 175
1958 3300059508 Ga0587088_018017 Ga0587088_018017_418_945 175
1959 3300059642 Ga0587069_012743 Ga0587069_012743_570_1121 175
1960 3300059655 Ga0587114_031834 Ga0587114_031834_31_582 175
1961 3300060353 Ga0501082_0000351 Ga0501082_0000351_1390_1917 175
1962 3300060353 Ga0501082_0035796 Ga0501082_0035796_2655_3182 175
1963 3300060353 Ga0501082_0075942 Ga0501082_0075942_396_929 175
1964 3300060353 Ga0501082_0203241 Ga0501082_0203241_302_853 175
1965 3300060353 Ga0501082_0537132 Ga0501082_0537132_18_545 175
1966 3300061734 Ga0530510_0023701 Ga0530510_0023701_2153_2686 175
1967 3300061734 Ga0530510_0024355 Ga0530510_0024355_2028_2561 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

104

179

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7u-assembly1.cif.gz_K e. faecalis 70s ribosome with p-trna, state iv 0.9517 2 173
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.9487 64 165
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9453 2 173
5mmi-assembly1.cif.gz_G structure of the large subunit of the chloroplast ribosome 0.9449 2 173
5x8t-assembly1.cif.gz_G structure of the 50s large subunit of chloroplast ribosome from spinach 0.9438 3 171
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.981 81 171 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9762 81 173 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9707 84 175 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9586 81 166 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9502 81 171 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A1F5E3A2-F1-model_v4 50S ribosomal protein L6 0.9906 64 173 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-Q7Y029-F1-model_v4 Ribosomal protein CtrL6e, 5'-partial 0.9905 69 174 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A453I2C9-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.99 64 174 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2J1D431-F1-model_v4 deleted 0.9887 71 166
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9886 79 159 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
90.4 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map