F496075

General Info

Members Datasets Scaffolds Average Seq Length
1926 463 1926 65

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0276406|Ga0501032_0276406_240_470
Length 76
Sequence MRCKHQESEASVPKMKSHKTAQKRIGKTGSGKIIRVNAWRGHHLEIKSSRRTRRYAGKTIMKPVHAKQVRRMLPYL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
207 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
223 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
240 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
245 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
246 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
259 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
270 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
279 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
284 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
285 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
286 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
287 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
290 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
291 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
292 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
293 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
294 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
295 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
296 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
299 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
300 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
301 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
302 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
303 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
304 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
305 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
306 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
307 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
308 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
309 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
312 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
313 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
314 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
315 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
316 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
317 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
318 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
323 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
324 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
328 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
341 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
344 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
348 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
351 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
352 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
353 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
356 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
357 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
358 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
359 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
360 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
368 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
369 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
370 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
371 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
372 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
373 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
379 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
380 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
381 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
389 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
390 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
391 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
392 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
426 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
427 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
430 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
431 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
432 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
433 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
434 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
435 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
436 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
437 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
456 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
457 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
461 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 7.06
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10158050 3300003203 Unclassified 661
2 JGI25406J46586_10225724 3300003203 Bacteria 548
3 rootH2_10049188 3300003320 Bacteria 1988
4 rootH1_10212111 3300003323 Bacteria 3415
5 Ga0007409J51694_1046779 3300003575 Bacteria 544
6 Ga0058860_11391804 3300004801 Bacteria 509
7 Ga0058862_12329089 3300004803 Bacteria 1118
8 Ga0065707_10406542 3300005295 Bacteria 846
9 Ga0070658_11374872 3300005327 Unclassified 613
10 Ga0070676_10660594 3300005328 Bacteria 760
11 Ga0070676_11603893 3300005328 Bacteria 503
12 Ga0070683_100060933 3300005329 Bacteria 3507
13 Ga0070683_100527412 3300005329 Bacteria 1129
14 Ga0070683_100933873 3300005329 Bacteria 832
15 Ga0070683_101945196 3300005329 Bacteria 565
16 Ga0070683_102150265 3300005329 Unclassified 536
17 Ga0070690_100163173 3300005330 Bacteria 1528
18 Ga0070690_100232919 3300005330 Bacteria 1296
19 Ga0070670_100070756 3300005331 Bacteria 2995
20 Ga0070670_100651798 3300005331 Bacteria 945
21 Ga0070670_101293133 3300005331 Bacteria 668
22 Ga0070677_10942065 3300005333 Bacteria 501
23 Ga0068869_100133724 3300005334 Bacteria 1909
24 Ga0068869_100350801 3300005334 Unclassified 1203
25 Ga0068869_100688370 3300005334 Bacteria 871
26 Ga0068869_100946133 3300005334 Bacteria 748
27 Ga0070666_10220504 3300005335 Bacteria 1338
28 Ga0070680_100000095 3300005336 Bacteria 50255
29 Ga0070680_100536019 3300005336 Bacteria 1003
30 Ga0070680_101594389 3300005336 Unclassified 566
31 Ga0070680_101661108 3300005336 Bacteria 554
32 Ga0070680_101898201 3300005336 Unclassified 516
33 Ga0070682_100010726 3300005337 Bacteria 5210
34 Ga0070682_100075504 3300005337 Bacteria 2168
35 Ga0070682_100315921 3300005337 Bacteria 1152
36 Ga0070682_100974899 3300005337 Unclassified 702
37 Ga0070682_101483138 3300005337 Bacteria 583
38 Ga0068868_100363094 3300005338 Bacteria 1243
39 Ga0068868_100495245 3300005338 Bacteria 1069
40 Ga0068868_100984128 3300005338 Bacteria 771
41 Ga0068868_101446557 3300005338 Unclassified 642
42 Ga0068868_101574316 3300005338 Bacteria 617
43 Ga0068868_101891782 3300005338 Unclassified 565
44 Ga0068868_102097756 3300005338 Unclassified 537
45 Ga0070660_101253735 3300005339 Bacteria 629
46 Ga0070660_101919775 3300005339 Unclassified 505
47 Ga0070689_100026034 3300005340 Bacteria 4400
48 Ga0070689_100788858 3300005340 Unclassified 835
49 Ga0070689_102137888 3300005340 Bacteria 513
50 Ga0070691_10083073 3300005341 Unclassified 1571
51 Ga0070691_10435701 3300005341 Bacteria 746
52 Ga0070691_10523307 3300005341 Bacteria 689
53 Ga0070691_10666796 3300005341 Bacteria 621
54 Ga0070691_10945912 3300005341 Bacteria 534
55 Ga0070687_100001813 3300005343 Bacteria 7718
56 Ga0070687_100011227 3300005343 Bacteria 3911
57 Ga0070687_100047929 3300005343 Bacteria 2194
58 Ga0070687_100061402 3300005343 Bacteria 1987
59 Ga0070687_100351786 3300005343 Bacteria 951
60 Ga0070687_100393141 3300005343 Bacteria 907
61 Ga0070687_100524028 3300005343 Bacteria 802
62 Ga0070687_100971252 3300005343 Bacteria 614
63 Ga0070687_101088349 3300005343 Bacteria 584
64 Ga0070661_101090935 3300005344 Bacteria 665
65 Ga0070661_101673983 3300005344 Bacteria 539
66 Ga0070692_10009242 3300005345 Bacteria 4437
67 Ga0070692_10218823 3300005345 Bacteria 1124
68 Ga0070692_11018904 3300005345 Bacteria 580
69 Ga0070668_100215458 3300005347 Bacteria 1581
70 Ga0070668_100325059 3300005347 Bacteria 1296
71 Ga0070668_100938935 3300005347 Bacteria 775
72 Ga0070668_101783268 3300005347 Unclassified 566
73 Ga0070669_100184475 3300005353 Bacteria 1634
74 Ga0070669_100248459 3300005353 Bacteria 1416
75 Ga0070669_100506699 3300005353 Bacteria 1002
76 Ga0070675_100006157 3300005354 Bacteria 9197
77 Ga0070675_100789618 3300005354 Bacteria 868
78 Ga0070675_101074754 3300005354 Bacteria 740
79 Ga0070675_101324620 3300005354 Bacteria 664
80 Ga0070675_101720106 3300005354 Unclassified 579
81 Ga0070675_102240705 3300005354 Bacteria 503
82 Ga0070671_100640839 3300005355 Bacteria 920
83 Ga0070671_101889599 3300005355 Bacteria 531
84 Ga0070674_100011232 3300005356 Bacteria 5444
85 Ga0070674_100096243 3300005356 Bacteria 2148
86 Ga0070674_100250467 3300005356 Bacteria 1391
87 Ga0070674_101169915 3300005356 Bacteria 682
88 Ga0070674_101554835 3300005356 Bacteria 596
89 Ga0070674_101651303 3300005356 Unclassified 579
90 Ga0070673_102025336 3300005364 Unclassified 546
91 Ga0070673_102105999 3300005364 Unclassified 536
92 Ga0070673_102263665 3300005364 Bacteria 516
93 Ga0070673_102324017 3300005364 Bacteria 510
94 Ga0070688_100055644 3300005365 Bacteria 2482
95 Ga0070688_100085911 3300005365 Bacteria 2046
96 Ga0070688_100236006 3300005365 Bacteria 1296
97 Ga0070659_100024949 3300005366 Bacteria 4587
98 Ga0070659_100224928 3300005366 Bacteria 1550
99 Ga0070659_101102084 3300005366 Bacteria 700
100 Ga0070659_101219796 3300005366 Bacteria 666
101 Ga0070659_101325401 3300005366 Unclassified 639
102 Ga0070659_101354871 3300005366 Bacteria 632
103 Ga0070659_101567514 3300005366 Bacteria 588
104 Ga0070659_101803197 3300005366 Unclassified 548
105 Ga0070667_100501502 3300005367 Bacteria 1113
106 Ga0070667_101529388 3300005367 Bacteria 627
107 Ga0070667_101744707 3300005367 Unclassified 586
108 Ga0070703_10045702 3300005406 Unclassified 1382
109 Ga0070703_10134196 3300005406 Unclassified 913
110 Ga0070709_10508789 3300005434 Bacteria 916
111 Ga0070701_10035506 3300005438 Bacteria 2505
112 Ga0070701_10046039 3300005438 Bacteria 2241
113 Ga0070701_10769637 3300005438 Bacteria 654
114 Ga0070701_10984329 3300005438 Bacteria 587
115 Ga0070701_10984773 3300005438 Unclassified 587
116 Ga0070701_11223997 3300005438 Bacteria 534
117 Ga0070701_11298465 3300005438 Bacteria 520
118 Ga0070711_100685424 3300005439 Bacteria 862
119 Ga0070711_100933948 3300005439 Bacteria 742
120 Ga0070705_100029458 3300005440 Bacteria 3020
121 Ga0070705_100059307 3300005440 Bacteria 2266
122 Ga0070705_100317045 3300005440 Unclassified 1124
123 Ga0070705_100321171 3300005440 Bacteria 1118
124 Ga0070705_100506275 3300005440 Bacteria 918
125 Ga0070705_100557466 3300005440 Bacteria 880
126 Ga0070705_100673150 3300005440 Bacteria 809
127 Ga0070705_100739391 3300005440 Bacteria 777
128 Ga0070705_101534600 3300005440 Unclassified 559
129 Ga0070700_100012559 3300005441 Bacteria 4732
130 Ga0070700_100370632 3300005441 Bacteria 1068
131 Ga0070700_100643873 3300005441 Bacteria 836
132 Ga0070700_101604697 3300005441 Bacteria 556
133 Ga0070694_100052183 3300005444 Bacteria 2763
134 Ga0070694_100107772 3300005444 Bacteria 1981
135 Ga0070694_100121678 3300005444 Unclassified 1873
136 Ga0070694_100192350 3300005444 Bacteria 1516
137 Ga0070694_100357166 3300005444 Bacteria 1133
138 Ga0070694_100434880 3300005444 Bacteria 1033
139 Ga0070694_100753114 3300005444 Unclassified 796
140 Ga0070694_101406857 3300005444 Unclassified 589
141 Ga0070708_100002968 3300005445 Bacteria 13181
142 Ga0070708_100028644 3300005445 Bacteria 4795
143 Ga0070708_100034531 3300005445 Bacteria 4401
144 Ga0070708_100169854 3300005445 Unclassified 2035
145 Ga0070708_100220938 3300005445 Bacteria 1777
146 Ga0070708_100365847 3300005445 Bacteria 1359
147 Ga0070708_100424145 3300005445 Unclassified 1254
148 Ga0070663_100307641 3300005455 Bacteria 1270
149 Ga0070663_100716348 3300005455 Bacteria 852
150 Ga0070663_100739610 3300005455 Bacteria 839
151 Ga0070663_101801289 3300005455 Bacteria 549
152 Ga0070678_100072105 3300005456 Bacteria 2588
153 Ga0070678_100275883 3300005456 Bacteria 1420
154 Ga0070678_100354021 3300005456 Unclassified 1263
155 Ga0070678_100429365 3300005456 Bacteria 1153
156 Ga0070678_100450806 3300005456 Bacteria 1127
157 Ga0070678_101822740 3300005456 Bacteria 574
158 Ga0070678_101953077 3300005456 Unclassified 555
159 Ga0070662_100007462 3300005457 Bacteria 7090
160 Ga0070662_100161475 3300005457 Bacteria 1753
161 Ga0070662_100210059 3300005457 Bacteria 1548
162 Ga0070662_100603182 3300005457 Bacteria 924
163 Ga0070681_10769337 3300005458 Unclassified 880
164 Ga0070681_11007005 3300005458 Bacteria 753
165 Ga0070681_11124566 3300005458 Bacteria 706
166 Ga0068867_100110072 3300005459 Bacteria 2115
167 Ga0068867_100236469 3300005459 Bacteria 1479
168 Ga0068867_100697137 3300005459 Bacteria 896
169 Ga0068867_100840443 3300005459 Bacteria 822
170 Ga0070685_10006437 3300005466 Bacteria 5988
171 Ga0070685_10334965 3300005466 Bacteria 1030
172 Ga0070685_10905283 3300005466 Bacteria 657
173 Ga0070685_11318163 3300005466 Unclassified 552
174 Ga0070685_11388163 3300005466 Bacteria 539
175 Ga0070706_100000195 3300005467 Bacteria 75731
176 Ga0070706_100011489 3300005467 Bacteria 8231
177 Ga0070706_100014855 3300005467 Bacteria 7195
178 Ga0070706_100017337 3300005467 Bacteria 6645
179 Ga0070706_100023814 3300005467 Bacteria 5637
180 Ga0070706_100145885 3300005467 Bacteria 2210
181 Ga0070706_100154733 3300005467 Bacteria 2140
182 Ga0070706_100415791 3300005467 Unclassified 1252
183 Ga0070707_100000870 3300005468 Bacteria 29951
184 Ga0070707_100001138 3300005468 Bacteria 26187
185 Ga0070707_100048608 3300005468 Bacteria 4063
186 Ga0070707_100060810 3300005468 Bacteria 3623
187 Ga0070707_100074734 3300005468 Bacteria 3268
188 Ga0070707_100180572 3300005468 Bacteria 2057
189 Ga0070707_100316600 3300005468 Unclassified 1516
190 Ga0070707_100477067 3300005468 Bacteria 1209
191 Ga0070707_100578172 3300005468 Unclassified 1086
192 Ga0070707_100717630 3300005468 Bacteria 963
193 Ga0070707_101584834 3300005468 Bacteria 622
194 Ga0070698_100024476 3300005471 Bacteria 6300
195 Ga0070698_100094847 3300005471 Bacteria 2962
196 Ga0070698_100097029 3300005471 Bacteria 2923
197 Ga0070698_100121106 3300005471 Bacteria 2577
198 Ga0070698_100232309 3300005471 Bacteria 1778
199 Ga0070698_100369813 3300005471 Unclassified 1366
200 Ga0070698_100443455 3300005471 Unclassified 1233
201 Ga0070698_100606982 3300005471 Bacteria 1035
202 Ga0070698_100786159 3300005471 Bacteria 895
203 Ga0070699_100040202 3300005518 Bacteria 4049
204 Ga0070699_100047664 3300005518 Bacteria 3707
205 Ga0070699_100057351 3300005518 Bacteria 3373
206 Ga0070699_100135274 3300005518 Bacteria 2174
207 Ga0070699_100460673 3300005518 Bacteria 1153
208 Ga0070699_100509395 3300005518 Bacteria 1094
209 Ga0070699_100650891 3300005518 Bacteria 962
210 Ga0070699_100931741 3300005518 Bacteria 796
211 Ga0070679_100753646 3300005530 Bacteria 916
212 Ga0070679_101175716 3300005530 Bacteria 712
213 Ga0070679_101236471 3300005530 Bacteria 692
214 Ga0070684_100114740 3300005535 Bacteria 2418
215 Ga0070684_100390533 3300005535 Bacteria 1282
216 Ga0070684_100885993 3300005535 Unclassified 836
217 Ga0070684_101072632 3300005535 Unclassified 757
218 Ga0070684_101431883 3300005535 Bacteria 651
219 Ga0070697_100041648 3300005536 Bacteria 3718
220 Ga0070697_100133482 3300005536 Bacteria 2083
221 Ga0070697_100146534 3300005536 Bacteria 1988
222 Ga0070697_100174554 3300005536 Bacteria 1820
223 Ga0070697_100213514 3300005536 Bacteria 1643
224 Ga0068853_100650086 3300005539 Bacteria 1003
225 Ga0068853_101591967 3300005539 Bacteria 633
226 Ga0070672_100250414 3300005543 Bacteria 1492
227 Ga0070672_100311737 3300005543 Bacteria 1336
228 Ga0070672_100519311 3300005543 Bacteria 1032
229 Ga0070672_100663666 3300005543 Bacteria 911
230 Ga0070672_100844373 3300005543 Bacteria 807
231 Ga0070672_101572478 3300005543 Bacteria 590
232 Ga0070686_100015918 3300005544 Bacteria 4367
233 Ga0070686_100050867 3300005544 Bacteria 2635
234 Ga0070686_100141755 3300005544 Bacteria 1674
235 Ga0070686_100202276 3300005544 Unclassified 1424
236 Ga0070686_100219254 3300005544 Bacteria 1374
237 Ga0070686_100229192 3300005544 Bacteria 1347
238 Ga0070686_101042623 3300005544 Bacteria 673
239 Ga0070686_101706713 3300005544 Unclassified 535
240 Ga0070695_100031030 3300005545 Bacteria 3329
241 Ga0070695_100037326 3300005545 Bacteria 3061
242 Ga0070695_100240277 3300005545 Bacteria 1313
243 Ga0070695_100394967 3300005545 Bacteria 1047
244 Ga0070695_101569547 3300005545 Unclassified 549
245 Ga0070696_100054642 3300005546 Bacteria 2783
246 Ga0070696_100071625 3300005546 Bacteria 2439
247 Ga0070696_100098845 3300005546 Bacteria 2088
248 Ga0070696_100116093 3300005546 Bacteria 1933
249 Ga0070696_100173127 3300005546 Bacteria 1597
250 Ga0070696_100207703 3300005546 Bacteria 1464
251 Ga0070696_100326374 3300005546 Bacteria 1182
252 Ga0070696_100575100 3300005546 Bacteria 906
253 Ga0070696_100919940 3300005546 Bacteria 726
254 Ga0070693_100053190 3300005547 Bacteria 2324
255 Ga0070693_100119140 3300005547 Bacteria 1635
256 Ga0070693_100198808 3300005547 Unclassified 1300
257 Ga0070693_100418029 3300005547 Unclassified 934
258 Ga0070693_100685632 3300005547 Bacteria 749
259 Ga0070693_101164202 3300005547 Bacteria 591
260 Ga0070693_101422954 3300005547 Bacteria 540
261 Ga0070665_100248684 3300005548 Unclassified 1779
262 Ga0070665_100965088 3300005548 Bacteria 865
263 Ga0070704_100018624 3300005549 Bacteria 4445
264 Ga0070704_100060578 3300005549 Bacteria 2704
265 Ga0070704_100081561 3300005549 Bacteria 2383
266 Ga0070704_100110628 3300005549 Bacteria 2090
267 Ga0070704_100226822 3300005549 Unclassified 1522
268 Ga0070704_100583367 3300005549 Bacteria 981
269 Ga0070704_100768499 3300005549 Bacteria 859
270 Ga0070704_101779081 3300005549 Bacteria 570
271 Ga0068855_101218357 3300005563 Bacteria 782
272 Ga0068855_101254381 3300005563 Bacteria 769
273 Ga0070664_100081232 3300005564 Bacteria 2793
274 Ga0070664_100635116 3300005564 Bacteria 992
275 Ga0070664_101054864 3300005564 Bacteria 765
276 Ga0070664_102298054 3300005564 Unclassified 512
277 Ga0068857_100132766 3300005577 Bacteria 2246
278 Ga0068857_100141610 3300005577 Bacteria 2174
279 Ga0068857_100392754 3300005577 Bacteria 1290
280 Ga0068857_100666182 3300005577 Bacteria 987
281 Ga0068857_101915087 3300005577 Bacteria 581
282 Ga0068854_100129869 3300005578 Bacteria 1923
283 Ga0068854_100308635 3300005578 Bacteria 1282
284 Ga0068854_101029269 3300005578 Bacteria 730
285 Ga0068856_101818448 3300005614 Bacteria 621
286 Ga0070702_100248228 3300005615 Bacteria 1205
287 Ga0070702_100299373 3300005615 Bacteria 1112
288 Ga0070702_100800673 3300005615 Bacteria 729
289 Ga0070702_100982815 3300005615 Bacteria 667
290 Ga0070702_101097064 3300005615 Bacteria 636
291 Ga0070702_101389214 3300005615 Bacteria 574
292 Ga0068852_100086030 3300005616 Bacteria 2801
293 Ga0068852_100348209 3300005616 Bacteria 1446
294 Ga0068852_101506906 3300005616 Unclassified 695
295 Ga0068852_102301603 3300005616 Bacteria 560
296 Ga0068852_102747862 3300005616 Bacteria 511
297 Ga0068859_100009621 3300005617 Bacteria 9757
298 Ga0068859_100346372 3300005617 Bacteria 1580
299 Ga0068859_100568282 3300005617 Bacteria 1228
300 Ga0068859_100726571 3300005617 Bacteria 1083
301 Ga0068859_101983026 3300005617 Bacteria 643
302 Ga0068864_100022501 3300005618 Bacteria 5285
303 Ga0068864_100207015 3300005618 Bacteria 1805
304 Ga0068864_100226700 3300005618 Bacteria 1726
305 Ga0068864_100332932 3300005618 Bacteria 1429
306 Ga0068864_100400856 3300005618 Bacteria 1304
307 Ga0068864_101192382 3300005618 Bacteria 760
308 Ga0068864_101227117 3300005618 Bacteria 749
309 Ga0068864_101324411 3300005618 Bacteria 721
310 Ga0068866_11190183 3300005718 Bacteria 550
311 Ga0068861_100169981 3300005719 Bacteria 1806
312 Ga0068861_100265108 3300005719 Bacteria 1472
313 Ga0068861_100576959 3300005719 Bacteria 1029
314 Ga0068861_100685248 3300005719 Bacteria 951
315 Ga0068861_100884689 3300005719 Bacteria 845
316 Ga0068861_101084649 3300005719 Bacteria 769
317 Ga0068861_101623071 3300005719 Bacteria 638
318 Ga0068851_10145329 3300005834 Bacteria 1293
319 Ga0068851_10395857 3300005834 Bacteria 812
320 Ga0068870_10237873 3300005840 Bacteria 1123
321 Ga0068870_10259495 3300005840 Bacteria 1081
322 Ga0068870_11432349 3300005840 Bacteria 507
323 Ga0068870_11440575 3300005840 Unclassified 506
324 Ga0068863_100347565 3300005841 Bacteria 1444
325 Ga0068863_100584421 3300005841 Bacteria 1105
326 Ga0068863_101904125 3300005841 Unclassified 605
327 Ga0068858_100240275 3300005842 Unclassified 1718
328 Ga0068858_100260891 3300005842 Unclassified 1647
329 Ga0068858_100691953 3300005842 Bacteria 992
330 Ga0068858_101036260 3300005842 Bacteria 804
331 Ga0068858_102001664 3300005842 Bacteria 573
332 Ga0068860_100055282 3300005843 Bacteria 3773
333 Ga0068860_100199428 3300005843 Bacteria 1939
334 Ga0068860_100504039 3300005843 Unclassified 1209
335 Ga0068860_100973617 3300005843 Bacteria 866
336 Ga0068860_101032302 3300005843 Unclassified 841
337 Ga0068860_101422070 3300005843 Bacteria 715
338 Ga0068860_101825286 3300005843 Bacteria 630
339 Ga0068862_100093778 3300005844 Bacteria 2618
340 Ga0068862_101760204 3300005844 Bacteria 628
341 Ga0081538_10056043 3300005981 Bacteria 2313
342 Ga0081538_10111778 3300005981 Bacteria 1339
343 Ga0081539_10006122 3300005985 Bacteria 11725
344 Ga0081539_10012545 3300005985 Bacteria 6513
345 Ga0081539_10022773 3300005985 Bacteria 4129
346 Ga0081539_10110458 3300005985 Bacteria 1385
347 Ga0081539_10292465 3300005985 Bacteria 704
348 Ga0081539_10319548 3300005985 Bacteria 661
349 Ga0070717_10731951 3300006028 Bacteria 899
350 Ga0075365_10029504 3300006038 Bacteria 3507
351 Ga0075365_10375255 3300006038 Bacteria 1003
352 Ga0075364_10721293 3300006051 Bacteria 680
353 Ga0075432_10194372 3300006058 Bacteria 800
354 Ga0070716_100059368 3300006173 Unclassified 2205
355 Ga0070712_100200005 3300006175 Bacteria 1569
356 Ga0070712_101908205 3300006175 Bacteria 520
357 Ga0097621_100786400 3300006237 Bacteria 881
358 Ga0097621_101146956 3300006237 Bacteria 731
359 Ga0097621_101304309 3300006237 Bacteria 686
360 Ga0097621_101504029 3300006237 Bacteria 639
361 Ga0097621_102281406 3300006237 Bacteria 518
362 Ga0068871_100966053 3300006358 Bacteria 792
363 Ga0068871_101235057 3300006358 Bacteria 702
364 Ga0068871_101540761 3300006358 Bacteria 629
365 Ga0075428_100000397 3300006844 Bacteria 43115
366 Ga0075428_100171313 3300006844 Bacteria 2353
367 Ga0075428_100517374 3300006844 Bacteria 1276
368 Ga0075428_101247451 3300006844 Bacteria 783
369 Ga0075428_101914122 3300006844 Bacteria 616
370 Ga0075431_100021763 3300006847 Bacteria 6555
371 Ga0075431_100073432 3300006847 Bacteria 3529
372 Ga0075433_10010744 3300006852 Bacteria 7363
373 Ga0075433_10107763 3300006852 Bacteria 2471
374 Ga0075433_10325066 3300006852 Bacteria 1360
375 Ga0075433_10538506 3300006852 Bacteria 1027
376 Ga0075433_10570122 3300006852 Bacteria 994
377 Ga0075433_10577184 3300006852 Bacteria 988
378 Ga0075433_11157875 3300006852 Unclassified 672
379 Ga0075433_11942289 3300006852 Bacteria 504
380 Ga0075434_100157209 3300006871 Bacteria 2292
381 Ga0075434_100209260 3300006871 Bacteria 1971
382 Ga0075434_100470294 3300006871 Bacteria 1278
383 Ga0075434_100488087 3300006871 Unclassified 1253
384 Ga0075434_100578126 3300006871 Bacteria 1143
385 Ga0075434_101220481 3300006871 Unclassified 764
386 Ga0075434_102472985 3300006871 Unclassified 521
387 Ga0075429_100058468 3300006880 Bacteria 3357
388 Ga0075429_101127291 3300006880 Bacteria 685
389 Ga0068865_100023276 3300006881 Bacteria 4054
390 Ga0068865_100176618 3300006881 Bacteria 1642
391 Ga0068865_100281987 3300006881 Bacteria 1323
392 Ga0068865_100362014 3300006881 Bacteria 1178
393 Ga0068865_100438199 3300006881 Bacteria 1078
394 Ga0068865_101144510 3300006881 Bacteria 687
395 Ga0068865_101695377 3300006881 Unclassified 570
396 Ga0068865_101947031 3300006881 Bacteria 533
397 Ga0068865_102205397 3300006881 Bacteria 501
398 Ga0075436_100066218 3300006914 Bacteria 2496
399 Ga0075436_100122709 3300006914 Bacteria 1819
400 Ga0075436_100868075 3300006914 Bacteria 674
401 Ga0097620_100009621 3300006931 Bacteria 9757
402 Ga0097620_100346391 3300006931 Bacteria 1580
403 Ga0097620_100568356 3300006931 Bacteria 1228
404 Ga0097620_100726514 3300006931 Bacteria 1083
405 Ga0097620_101983256 3300006931 Bacteria 643
406 Ga0075435_100062841 3300007076 Bacteria 3014
407 Ga0075435_100259199 3300007076 Bacteria 1481
408 Ga0075435_100302533 3300007076 Bacteria 1368
409 Ga0075435_100462125 3300007076 Bacteria 1095
410 Ga0075435_100969955 3300007076 Bacteria 742
411 Ga0075435_101478903 3300007076 Unclassified 596
412 Ga0075435_102068989 3300007076 Bacteria 500
413 Ga0099795_10538693 3300007788 Unclassified 549
414 Ga0105251_10264370 3300009011 Unclassified 776
415 Ga0105251_10537967 3300009011 Unclassified 549
416 Ga0105250_10453031 3300009092 Bacteria 576
417 Ga0105250_10455063 3300009092 Bacteria 575
418 Ga0105240_11989338 3300009093 Bacteria 604
419 Ga0105240_12007841 3300009093 Bacteria 601
420 Ga0105240_12066705 3300009093 Bacteria 592
421 Ga0111539_10040950 3300009094 Bacteria 5573
422 Ga0111539_10120785 3300009094 Bacteria 3070
423 Ga0111539_10361448 3300009094 Bacteria 1690
424 Ga0111539_10420023 3300009094 Bacteria 1558
425 Ga0111539_10678260 3300009094 Bacteria 1200
426 Ga0111539_10742585 3300009094 Bacteria 1142
427 Ga0111539_11777190 3300009094 Bacteria 715
428 Ga0111539_12443815 3300009094 Bacteria 606
429 Ga0111539_12584290 3300009094 Bacteria 589
430 Ga0105245_10022581 3300009098 Bacteria 5524
431 Ga0105245_10055431 3300009098 Bacteria 3560
432 Ga0105245_10166301 3300009098 Bacteria 2097
433 Ga0105245_10240187 3300009098 Bacteria 1755
434 Ga0105245_10486988 3300009098 Bacteria 1247
435 Ga0105245_10756333 3300009098 Unclassified 1008
436 Ga0105245_11021157 3300009098 Unclassified 872
437 Ga0105245_11854937 3300009098 Unclassified 656
438 Ga0105245_11931021 3300009098 Bacteria 643
439 Ga0105245_12590377 3300009098 Bacteria 560
440 Ga0105247_10113681 3300009101 Bacteria 1745
441 Ga0105247_10499352 3300009101 Bacteria 886
442 Ga0105247_10867073 3300009101 Bacteria 694
443 Ga0114129_10007192 3300009147 Bacteria 15842
444 Ga0114129_10058678 3300009147 Bacteria 5383
445 Ga0114129_10088943 3300009147 Bacteria 4281
446 Ga0114129_10101890 3300009147 Bacteria 3971
447 Ga0114129_10124918 3300009147 Bacteria 3539
448 Ga0114129_10286536 3300009147 Bacteria 2199
449 Ga0114129_10444245 3300009147 Bacteria 1702
450 Ga0114129_10577184 3300009147 Bacteria 1459
451 Ga0114129_10894910 3300009147 Bacteria 1125
452 Ga0114129_11891507 3300009147 Bacteria 724
453 Ga0114129_12869026 3300009147 Bacteria 571
454 Ga0114129_13041074 3300009147 Bacteria 550
455 Ga0105243_10033849 3300009148 Bacteria 3952
456 Ga0105243_10039583 3300009148 Bacteria 3676
457 Ga0105243_10068753 3300009148 Bacteria 2855
458 Ga0105243_10738992 3300009148 Bacteria 963
459 Ga0105243_11084116 3300009148 Unclassified 808
460 Ga0105243_11106116 3300009148 Bacteria 801
461 Ga0105243_11249303 3300009148 Bacteria 758
462 Ga0105243_11575705 3300009148 Bacteria 683
463 Ga0105243_11814186 3300009148 Bacteria 641
464 Ga0105243_12388323 3300009148 Unclassified 567
465 Ga0105243_12830217 3300009148 Bacteria 526
466 Ga0105243_12932933 3300009148 Bacteria 517
467 Ga0105241_10552265 3300009174 Bacteria 1034
468 Ga0105241_11048717 3300009174 Bacteria 765
469 Ga0105241_11198789 3300009174 Bacteria 719
470 Ga0105241_11377533 3300009174 Bacteria 674
471 Ga0105241_12133908 3300009174 Bacteria 554
472 Ga0105241_12520885 3300009174 Bacteria 515
473 Ga0105242_10431658 3300009176 Bacteria 1237
474 Ga0105242_10553702 3300009176 Bacteria 1103
475 Ga0105242_10826330 3300009176 Bacteria 920
476 Ga0105242_10972924 3300009176 Bacteria 854
477 Ga0105242_11351432 3300009176 Bacteria 738
478 Ga0105242_11510042 3300009176 Unclassified 703
479 Ga0105242_12212508 3300009176 Unclassified 595
480 Ga0105242_12378723 3300009176 Bacteria 577
481 Ga0105248_10144125 3300009177 Bacteria 2688
482 Ga0105248_10358208 3300009177 Bacteria 1642
483 Ga0105248_10550834 3300009177 Bacteria 1301
484 Ga0105248_11056136 3300009177 Bacteria 918
485 Ga0105248_11843845 3300009177 Bacteria 686
486 Ga0105248_12267679 3300009177 Bacteria 618
487 Ga0105237_11338580 3300009545 Bacteria 722
488 Ga0105238_10089583 3300009551 Bacteria 3064
489 Ga0105238_10938574 3300009551 Bacteria 885
490 Ga0105238_12583765 3300009551 Bacteria 544
491 Ga0105249_10003478 3300009553 Bacteria 13643
492 Ga0105249_10052482 3300009553 Bacteria 3723
493 Ga0105249_10105754 3300009553 Bacteria 2654
494 Ga0105249_10176352 3300009553 Bacteria 2076
495 Ga0105249_10248924 3300009553 Bacteria 1761
496 Ga0105249_10544388 3300009553 Bacteria 1211
497 Ga0105249_11353425 3300009553 Bacteria 784
498 Ga0105249_12494763 3300009553 Bacteria 589
499 Ga0105249_12763328 3300009553 Bacteria 563
500 Ga0105249_13202488 3300009553 Bacteria 526
501 Ga0099796_10252194 3300010159 Bacteria 733
502 Ga0099796_10381614 3300010159 Unclassified 614
503 Ga0099796_10467943 3300010159 Unclassified 562
504 Ga0105239_10195187 3300010375 Bacteria 2267
505 Ga0105239_10412245 3300010375 Bacteria 1530
506 Ga0105239_10462254 3300010375 Bacteria 1440
507 Ga0105239_10499136 3300010375 Bacteria 1383
508 Ga0105239_10519454 3300010375 Bacteria 1355
509 Ga0105239_10531217 3300010375 Unclassified 1339
510 Ga0105239_11388793 3300010375 Bacteria 811
511 Ga0105239_12244722 3300010375 Unclassified 635
512 Ga0105239_12378932 3300010375 Bacteria 617
513 Ga0105239_12694940 3300010375 Bacteria 580
514 Ga0105239_13581535 3300010375 Bacteria 505
515 Ga0105246_10026512 3300011119 Bacteria 3788
516 Ga0105246_10089997 3300011119 Unclassified 2209
517 Ga0105246_10241499 3300011119 Bacteria 1428
518 Ga0105246_10276906 3300011119 Bacteria 1344
519 Ga0105246_10284697 3300011119 Bacteria 1328
520 Ga0105246_10462688 3300011119 Bacteria 1069
521 Ga0105246_10607149 3300011119 Bacteria 946
522 Ga0105246_10791948 3300011119 Bacteria 840
523 Ga0105246_11327188 3300011119 Archaea 668
524 Ga0105246_11430176 3300011119 Bacteria 646
525 Ga0105246_11922051 3300011119 Bacteria 569
526 Ga0157321_1033218 3300012487 Unclassified 536
527 Ga0157338_1059051 3300012515 Bacteria 571
528 Ga0157373_10950954 3300013100 Bacteria 639
529 Ga0157373_10978930 3300013100 Unclassified 630
530 Ga0157373_11000143 3300013100 Bacteria 624
531 Ga0157373_11118433 3300013100 Bacteria 591
532 Ga0157371_11396633 3300013102 Bacteria 544
533 Ga0157371_11617914 3300013102 Bacteria 507
534 Ga0157370_10641903 3300013104 Bacteria 971
535 Ga0157374_10503277 3300013296 Bacteria 1216
536 Ga0157374_10708927 3300013296 Bacteria 1020
537 Ga0157374_11020998 3300013296 Bacteria 846
538 Ga0157374_12563410 3300013296 Bacteria 537
539 Ga0157378_10109176 3300013297 Bacteria 2534
540 Ga0157378_10291575 3300013297 Bacteria 1576
541 Ga0157378_10518955 3300013297 Bacteria 1193
542 Ga0157378_10526198 3300013297 Bacteria 1185
543 Ga0157378_11365590 3300013297 Bacteria 751
544 Ga0157378_11691743 3300013297 Bacteria 680
545 Ga0163162_10021312 3300013306 Bacteria 6380
546 Ga0163162_10157585 3300013306 Bacteria 2391
547 Ga0163162_10562789 3300013306 Bacteria 1267
548 Ga0163162_10897342 3300013306 Bacteria 1000
549 Ga0163162_11426549 3300013306 Bacteria 788
550 Ga0163162_11628972 3300013306 Unclassified 736
551 Ga0163162_13048516 3300013306 Bacteria 538
552 Ga0157372_10733607 3300013307 Bacteria 1149
553 Ga0157372_11321913 3300013307 Bacteria 832
554 Ga0157372_11424452 3300013307 Unclassified 799
555 Ga0157372_11910946 3300013307 Bacteria 682
556 Ga0157372_12063404 3300013307 Bacteria 655
557 Ga0157375_10079370 3300013308 Bacteria 3317
558 Ga0157375_10355262 3300013308 Bacteria 1631
559 Ga0157375_10355615 3300013308 Bacteria 1631
560 Ga0157375_11096901 3300013308 Unclassified 932
561 Ga0157375_11174100 3300013308 Bacteria 900
562 Ga0157375_11383009 3300013308 Bacteria 829
563 Ga0157375_11622776 3300013308 Bacteria 765
564 Ga0157375_11886819 3300013308 Unclassified 709
565 Ga0163163_10023321 3300014325 Bacteria 5871
566 Ga0163163_10075976 3300014325 Bacteria 3353
567 Ga0163163_10136981 3300014325 Bacteria 2489
568 Ga0163163_10181577 3300014325 Bacteria 2151
569 Ga0163163_10248887 3300014325 Bacteria 1828
570 Ga0163163_10370508 3300014325 Bacteria 1489
571 Ga0163163_10560290 3300014325 Bacteria 1205
572 Ga0163163_11002684 3300014325 Bacteria 898
573 Ga0163163_11028113 3300014325 Unclassified 887
574 Ga0157380_10147459 3300014326 Bacteria 2029
575 Ga0157380_10279189 3300014326 Bacteria 1527
576 Ga0157380_10325797 3300014326 Bacteria 1426
577 Ga0157380_10457320 3300014326 Unclassified 1228
578 Ga0157380_10710577 3300014326 Bacteria 1011
579 Ga0157380_11000726 3300014326 Bacteria 869
580 Ga0157380_11710696 3300014326 Unclassified 687
581 Ga0157380_11769558 3300014326 Bacteria 677
582 Ga0182008_10095943 3300014497 Unclassified 1463
583 Ga0182008_10140984 3300014497 Bacteria 1206
584 Ga0182008_10441852 3300014497 Bacteria 706
585 Ga0157377_10006620 3300014745 Bacteria 5537
586 Ga0157377_10125273 3300014745 Bacteria 1562
587 Ga0157377_10185861 3300014745 Bacteria 1310
588 Ga0157377_10215288 3300014745 Bacteria 1227
589 Ga0157377_10333496 3300014745 Bacteria 1012
590 Ga0157377_10861238 3300014745 Bacteria 674
591 Ga0157377_10908222 3300014745 Unclassified 659
592 Ga0157379_10051909 3300014968 Bacteria 3661
593 Ga0157379_10363339 3300014968 Unclassified 1327
594 Ga0157379_10392223 3300014968 Bacteria 1275
595 Ga0157379_10407697 3300014968 Bacteria 1250
596 Ga0157379_10930379 3300014968 Bacteria 826
597 Ga0157379_11064750 3300014968 Bacteria 773
598 Ga0157379_11698222 3300014968 Bacteria 618
599 Ga0157376_10182110 3300014969 Bacteria 1921
600 Ga0157376_10188914 3300014969 Unclassified 1888
601 Ga0157376_10447010 3300014969 Bacteria 1260
602 Ga0157376_11348474 3300014969 Bacteria 744
603 Ga0157376_11363011 3300014969 Bacteria 740
604 Ga0157376_12823968 3300014969 Unclassified 525
605 Ga0157376_12944680 3300014969 Unclassified 515
606 Ga0182006_1203302 3300015261 Bacteria 656
607 Ga0163161_10081497 3300017792 Bacteria 2383
608 Ga0163161_10835260 3300017792 Unclassified 776
609 Ga0163161_11450552 3300017792 Bacteria 601
610 Ga0163161_11469842 3300017792 Bacteria 597
611 Ga0163161_11614070 3300017792 Bacteria 572
612 Ga0206356_10401185 3300020070 Unclassified 1120
613 Ga0206354_10450968 3300020081 Unclassified 518
614 Ga0206354_11126683 3300020081 Bacteria 578
615 Ga0213873_10228913 3300021358 Bacteria 584
616 Ga0207653_10021748 3300025885 Unclassified 2035
617 Ga0207653_10075630 3300025885 Unclassified 1157
618 Ga0207682_10089257 3300025893 Unclassified 1334
619 Ga0207642_10433718 3300025899 Bacteria 793
620 Ga0207710_10510974 3300025900 Unclassified 624
621 Ga0207710_10580795 3300025900 Bacteria 585
622 Ga0207688_10004003 3300025901 Bacteria 8026
623 Ga0207688_10123251 3300025901 Bacteria 1514
624 Ga0207688_10393919 3300025901 Bacteria 858
625 Ga0207688_10463122 3300025901 Bacteria 791
626 Ga0207688_10727720 3300025901 Bacteria 628
627 Ga0207680_10245408 3300025903 Bacteria 1235
628 Ga0207685_10296705 3300025905 Bacteria 798
629 Ga0207645_10155934 3300025907 Bacteria 1492
630 Ga0207645_10217270 3300025907 Bacteria 1259
631 Ga0207645_10222542 3300025907 Bacteria 1244
632 Ga0207645_11140701 3300025907 Bacteria 525
633 Ga0207643_10035888 3300025908 Bacteria 2781
634 Ga0207643_10565817 3300025908 Bacteria 730
635 Ga0207643_10938039 3300025908 Bacteria 560
636 Ga0207684_10005044 3300025910 Bacteria 12304
637 Ga0207684_10013660 3300025910 Bacteria 7016
638 Ga0207684_10022312 3300025910 Bacteria 5404
639 Ga0207684_10095895 3300025910 Bacteria 2531
640 Ga0207684_10120082 3300025910 Bacteria 2253
641 Ga0207684_10365248 3300025910 Bacteria 1242
642 Ga0207684_10789247 3300025910 Bacteria 803
643 Ga0207684_10826190 3300025910 Unclassified 782
644 Ga0207684_11071782 3300025910 Bacteria 672
645 Ga0207684_11336504 3300025910 Unclassified 589
646 Ga0207684_11725680 3300025910 Bacteria 504
647 Ga0207654_10288440 3300025911 Bacteria 1112
648 Ga0207654_10360121 3300025911 Bacteria 1003
649 Ga0207707_10263654 3300025912 Bacteria 1494
650 Ga0207707_10263720 3300025912 Unclassified 1494
651 Ga0207707_10686455 3300025912 Bacteria 861
652 Ga0207695_10909366 3300025913 Unclassified 760
653 Ga0207695_11407674 3300025913 Bacteria 578
654 Ga0207693_10368879 3300025915 Bacteria 1123
655 Ga0207693_10570511 3300025915 Bacteria 882
656 Ga0207663_10915934 3300025916 Bacteria 701
657 Ga0207660_10000001 3300025917 Bacteria 1034169
658 Ga0207660_10532652 3300025917 Bacteria 954
659 Ga0207660_10753296 3300025917 Unclassified 795
660 Ga0207662_10001552 3300025918 Bacteria 11215
661 Ga0207662_10008573 3300025918 Bacteria 5604
662 Ga0207662_10036691 3300025918 Bacteria 2866
663 Ga0207662_10139670 3300025918 Bacteria 1534
664 Ga0207662_10305790 3300025918 Bacteria 1058
665 Ga0207662_10702413 3300025918 Bacteria 709
666 Ga0207662_11187862 3300025918 Bacteria 542
667 Ga0207657_10473825 3300025919 Bacteria 982
668 Ga0207649_11375476 3300025920 Bacteria 558
669 Ga0207652_11157607 3300025921 Bacteria 675
670 Ga0207646_10001758 3300025922 Bacteria 26266
671 Ga0207646_10001760 3300025922 Bacteria 26247
672 Ga0207646_10013379 3300025922 Bacteria 7852
673 Ga0207646_10041390 3300025922 Bacteria 4142
674 Ga0207646_10051728 3300025922 Bacteria 3675
675 Ga0207646_10222479 3300025922 Bacteria 1705
676 Ga0207646_10369562 3300025922 Bacteria 1296
677 Ga0207646_10743188 3300025922 Bacteria 876
678 Ga0207646_10856579 3300025922 Bacteria 808
679 Ga0207646_11001051 3300025922 Bacteria 739
680 Ga0207681_10391405 3300025923 Bacteria 1121
681 Ga0207681_10531890 3300025923 Bacteria 966
682 Ga0207681_11411722 3300025923 Bacteria 584
683 Ga0207694_10137276 3300025924 Bacteria 1965
684 Ga0207694_11726349 3300025924 Bacteria 527
685 Ga0207650_10069442 3300025925 Bacteria 2647
686 Ga0207650_11659401 3300025925 Unclassified 542
687 Ga0207659_10035936 3300025926 Bacteria 3428
688 Ga0207659_10241837 3300025926 Bacteria 1460
689 Ga0207659_10483970 3300025926 Bacteria 1046
690 Ga0207687_10081074 3300025927 Bacteria 2344
691 Ga0207687_10772001 3300025927 Bacteria 819
692 Ga0207687_11192890 3300025927 Bacteria 654
693 Ga0207687_11701990 3300025927 Unclassified 541
694 Ga0207690_10029613 3300025932 Bacteria 3484
695 Ga0207690_10179735 3300025932 Bacteria 1592
696 Ga0207690_10368299 3300025932 Bacteria 1139
697 Ga0207690_10611939 3300025932 Bacteria 890
698 Ga0207690_10718989 3300025932 Bacteria 822
699 Ga0207690_10824156 3300025932 Unclassified 767
700 Ga0207690_10872555 3300025932 Bacteria 745
701 Ga0207690_11205692 3300025932 Bacteria 632
702 Ga0207690_11814073 3300025932 Bacteria 509
703 Ga0207706_10068175 3300025933 Bacteria 3131
704 Ga0207706_10216208 3300025933 Bacteria 1679
705 Ga0207706_10535042 3300025933 Bacteria 1010
706 Ga0207706_10664476 3300025933 Bacteria 892
707 Ga0207706_10831563 3300025933 Bacteria 783
708 Ga0207706_10874223 3300025933 Bacteria 760
709 Ga0207706_11590141 3300025933 Bacteria 530
710 Ga0207686_10687290 3300025934 Bacteria 812
711 Ga0207686_10876029 3300025934 Bacteria 723
712 Ga0207686_11200841 3300025934 Bacteria 621
713 Ga0207709_10066862 3300025935 Bacteria 2266
714 Ga0207709_10088123 3300025935 Bacteria 2020
715 Ga0207709_10216042 3300025935 Bacteria 1380
716 Ga0207709_10363492 3300025935 Bacteria 1096
717 Ga0207709_10463702 3300025935 Bacteria 982
718 Ga0207709_10641556 3300025935 Bacteria 845
719 Ga0207709_11064505 3300025935 Unclassified 663
720 Ga0207670_10052532 3300025936 Bacteria 2740
721 Ga0207670_11070278 3300025936 Unclassified 680
722 Ga0207669_10031250 3300025937 Bacteria 2972
723 Ga0207669_10071786 3300025937 Bacteria 2177
724 Ga0207669_10287420 3300025937 Bacteria 1243
725 Ga0207669_10473288 3300025937 Bacteria 997
726 Ga0207669_10610188 3300025937 Bacteria 888
727 Ga0207669_10956761 3300025937 Bacteria 718
728 Ga0207669_11107084 3300025937 Bacteria 669
729 Ga0207669_11347822 3300025937 Bacteria 607
730 Ga0207704_10374552 3300025938 Bacteria 1116
731 Ga0207704_10691244 3300025938 Bacteria 844
732 Ga0207704_10801267 3300025938 Unclassified 787
733 Ga0207704_10952831 3300025938 Bacteria 724
734 Ga0207704_11413423 3300025938 Bacteria 596
735 Ga0207704_11815955 3300025938 Bacteria 524
736 Ga0207665_10649547 3300025939 Unclassified 827
737 Ga0207665_10827712 3300025939 Bacteria 732
738 Ga0207665_11362947 3300025939 Unclassified 565
739 Ga0207691_10196907 3300025940 Bacteria 1755
740 Ga0207691_10310354 3300025940 Bacteria 1354
741 Ga0207691_10459822 3300025940 Bacteria 1083
742 Ga0207711_10207040 3300025941 Unclassified 1791
743 Ga0207711_10352663 3300025941 Bacteria 1362
744 Ga0207711_10352729 3300025941 Bacteria 1362
745 Ga0207711_10997610 3300025941 Bacteria 777
746 Ga0207689_10122400 3300025942 Bacteria 2139
747 Ga0207689_10124139 3300025942 Bacteria 2124
748 Ga0207689_10426960 3300025942 Unclassified 1106
749 Ga0207689_10624241 3300025942 Bacteria 907
750 Ga0207689_11012991 3300025942 Bacteria 700
751 Ga0207661_10355755 3300025944 Bacteria 1322
752 Ga0207661_10462930 3300025944 Bacteria 1156
753 Ga0207661_10648250 3300025944 Bacteria 970
754 Ga0207661_12081753 3300025944 Bacteria 514
755 Ga0207679_10057635 3300025945 Bacteria 2874
756 Ga0207679_10834023 3300025945 Unclassified 841
757 Ga0207679_11331521 3300025945 Bacteria 659
758 Ga0207679_11604787 3300025945 Bacteria 596
759 Ga0207667_11046175 3300025949 Unclassified 802
760 Ga0207667_11192094 3300025949 Bacteria 741
761 Ga0207667_11665490 3300025949 Bacteria 605
762 Ga0207667_12069306 3300025949 Unclassified 528
763 Ga0207651_10025909 3300025960 Bacteria 3653
764 Ga0207651_10195244 3300025960 Bacteria 1618
765 Ga0207651_10252120 3300025960 Bacteria 1445
766 Ga0207651_11105056 3300025960 Bacteria 711
767 Ga0207712_10029138 3300025961 Bacteria 3700
768 Ga0207712_10075853 3300025961 Bacteria 2432
769 Ga0207712_10083798 3300025961 Bacteria 2328
770 Ga0207712_10144219 3300025961 Bacteria 1831
771 Ga0207712_11484375 3300025961 Unclassified 607
772 Ga0207712_11655598 3300025961 Unclassified 574
773 Ga0207668_10358455 3300025972 Bacteria 1221
774 Ga0207668_10483680 3300025972 Bacteria 1062
775 Ga0207668_11632020 3300025972 Bacteria 582
776 Ga0207640_10268898 3300025981 Bacteria 1332
777 Ga0207640_10534183 3300025981 Bacteria 982
778 Ga0207640_10785747 3300025981 Bacteria 823
779 Ga0207640_11266966 3300025981 Bacteria 657
780 Ga0207640_11659007 3300025981 Unclassified 577
781 Ga0207658_10115084 3300025986 Bacteria 2134
782 Ga0207658_10610226 3300025986 Unclassified 981
783 Ga0207658_11133201 3300025986 Unclassified 715
784 Ga0207677_10059390 3300026023 Bacteria 2637
785 Ga0207677_10379402 3300026023 Bacteria 1193
786 Ga0207677_10460829 3300026023 Bacteria 1091
787 Ga0207677_10714338 3300026023 Bacteria 890
788 Ga0207677_11627143 3300026023 Unclassified 598
789 Ga0207703_10094664 3300026035 Bacteria 2519
790 Ga0207703_10486164 3300026035 Bacteria 1157
791 Ga0207703_10581378 3300026035 Unclassified 1058
792 Ga0207703_10788586 3300026035 Bacteria 907
793 Ga0207703_10889776 3300026035 Bacteria 852
794 Ga0207703_11911755 3300026035 Bacteria 570
795 Ga0207639_10067898 3300026041 Bacteria 2776
796 Ga0207639_11515093 3300026041 Bacteria 629
797 Ga0207678_10006046 3300026067 Bacteria 10765
798 Ga0207678_10339487 3300026067 Bacteria 1294
799 Ga0207678_10354806 3300026067 Bacteria 1265
800 Ga0207708_10002944 3300026075 Bacteria 12557
801 Ga0207708_10036978 3300026075 Bacteria 3718
802 Ga0207708_10078295 3300026075 Bacteria 2538
803 Ga0207708_10413580 3300026075 Bacteria 1117
804 Ga0207708_10779311 3300026075 Bacteria 822
805 Ga0207708_10908453 3300026075 Bacteria 762
806 Ga0207708_10927897 3300026075 Archaea 754
807 Ga0207708_11761080 3300026075 Bacteria 544
808 Ga0207702_11214143 3300026078 Bacteria 748
809 Ga0207648_10006847 3300026089 Bacteria 11295
810 Ga0207648_10390099 3300026089 Bacteria 1260
811 Ga0207648_10662571 3300026089 Bacteria 965
812 Ga0207648_11190843 3300026089 Bacteria 715
813 Ga0207648_11275149 3300026089 Bacteria 690
814 Ga0207648_11361083 3300026089 Bacteria 667
815 Ga0207648_11644983 3300026089 Bacteria 603
816 Ga0207648_11711298 3300026089 Bacteria 590
817 Ga0207648_11784957 3300026089 Unclassified 577
818 Ga0207648_12274474 3300026089 Unclassified 503
819 Ga0207676_10017526 3300026095 Bacteria 5192
820 Ga0207676_10197690 3300026095 Bacteria 1774
821 Ga0207676_10221058 3300026095 Bacteria 1687
822 Ga0207676_10256628 3300026095 Bacteria 1576
823 Ga0207676_11416650 3300026095 Bacteria 691
824 Ga0207676_11696900 3300026095 Bacteria 630
825 Ga0207676_11721930 3300026095 Bacteria 625
826 Ga0207676_11867985 3300026095 Bacteria 599
827 Ga0207674_10009674 3300026116 Bacteria 10988
828 Ga0207674_10257098 3300026116 Bacteria 1693
829 Ga0207674_10436527 3300026116 Bacteria 1265
830 Ga0207674_10465154 3300026116 Bacteria 1222
831 Ga0207675_100009163 3300026118 Bacteria 9284
832 Ga0207675_100051274 3300026118 Bacteria 3850
833 Ga0207675_100129179 3300026118 Bacteria 2395
834 Ga0207675_100192589 3300026118 Bacteria 1956
835 Ga0207675_100388211 3300026118 Bacteria 1374
836 Ga0207675_100564530 3300026118 Unclassified 1138
837 Ga0207675_100606164 3300026118 Bacteria 1098
838 Ga0207675_100705577 3300026118 Bacteria 1018
839 Ga0207675_100817088 3300026118 Bacteria 946
840 Ga0207675_100889820 3300026118 Unclassified 906
841 Ga0207675_101978889 3300026118 Bacteria 600
842 Ga0207675_102430705 3300026118 Bacteria 536
843 Ga0207675_102660541 3300026118 Bacteria 509
844 Ga0207683_10075494 3300026121 Bacteria 2983
845 Ga0207683_10091226 3300026121 Bacteria 2714
846 Ga0207683_10148904 3300026121 Bacteria 2112
847 Ga0207683_10216736 3300026121 Bacteria 1743
848 Ga0207683_10294037 3300026121 Bacteria 1485
849 Ga0207683_10473586 3300026121 Bacteria 1155
850 Ga0207683_10658574 3300026121 Bacteria 970
851 Ga0207683_11153033 3300026121 Unclassified 719
852 Ga0207698_10086922 3300026142 Bacteria 2544
853 Ga0207698_10263182 3300026142 Bacteria 1585
854 Ga0207698_11382250 3300026142 Bacteria 719
855 Ga0209984_1020535 3300027424 Bacteria 903
856 Ga0209999_1067588 3300027543 Bacteria 684
857 Ga0209974_10016701 3300027876 Bacteria 2436
858 Ga0207428_10026488 3300027907 Bacteria 4840
859 Ga0207428_10120009 3300027907 Unclassified 2017
860 Ga0207428_10330436 3300027907 Bacteria 1124
861 Ga0268266_10368340 3300028379 Bacteria 1353
862 Ga0268265_10459244 3300028380 Bacteria 1191
863 Ga0268265_10498828 3300028380 Bacteria 1147
864 Ga0268265_10965387 3300028380 Bacteria 840
865 Ga0268264_10128666 3300028381 Bacteria 2241
866 Ga0268264_10655434 3300028381 Unclassified 1039
867 Ga0268264_10728877 3300028381 Bacteria 986
868 Ga0268264_11301259 3300028381 Bacteria 737
869 Ga0268264_11678505 3300028381 Bacteria 646
870 Ga0268264_11830042 3300028381 Unclassified 617
871 Ga0265326_10042405 3300028558 Bacteria 1291
872 Ga0265319_1019649 3300028563 Bacteria 2517
873 Ga0265319_1029395 3300028563 Bacteria 1929
874 Ga0265319_1046228 3300028563 Bacteria 1452
875 Ga0265334_10040406 3300028573 Bacteria 1827
876 Ga0265334_10080353 3300028573 Bacteria 1201
877 Ga0265334_10294852 3300028573 Unclassified 555
878 Ga0265318_10014337 3300028577 Bacteria 3331
879 Ga0265318_10015236 3300028577 Bacteria 3203
880 Ga0265318_10057630 3300028577 Bacteria 1451
881 Ga0265318_10096317 3300028577 Bacteria 1089
882 Ga0265318_10198670 3300028577 Bacteria 733
883 Ga0265323_10125461 3300028653 Bacteria 834
884 Ga0265322_10129259 3300028654 Unclassified 720
885 Ga0265336_10030284 3300028666 Bacteria 1686
886 Ga0265336_10092162 3300028666 Bacteria 903
887 Ga0265336_10121837 3300028666 Bacteria 777
888 Ga0265338_10037167 3300028800 Bacteria 4642
889 Ga0265338_10055450 3300028800 Bacteria 3525
890 Ga0265338_10435140 3300028800 Bacteria 930
891 Ga0265324_10003872 3300029957 Bacteria 6978
892 Ga0265324_10175162 3300029957 Bacteria 728
893 Ga0265324_10296532 3300029957 Bacteria 550
894 Ga0265330_10022068 3300031235 Bacteria 2901
895 Ga0265332_10028840 3300031238 Bacteria 2428
896 Ga0265320_10038880 3300031240 Bacteria 2382
897 Ga0265320_10092587 3300031240 Bacteria 1399
898 Ga0265320_10202760 3300031240 Unclassified 885
899 Ga0265325_10033223 3300031241 Bacteria 2751
900 Ga0265325_10040458 3300031241 Bacteria 2448
901 Ga0265325_10116365 3300031241 Bacteria 1293
902 Ga0265325_10202544 3300031241 Bacteria 915
903 Ga0265329_10073575 3300031242 Unclassified 1081
904 Ga0265340_10055616 3300031247 Bacteria 1905
905 Ga0265340_10094848 3300031247 Bacteria 1391
906 Ga0265339_10090894 3300031249 Bacteria 1600
907 Ga0265339_10405587 3300031249 Bacteria 636
908 Ga0265339_10442277 3300031249 Bacteria 604
909 Ga0265331_10022450 3300031250 Bacteria 3219
910 Ga0265316_10135754 3300031344 Unclassified 1851
911 Ga0265316_10207773 3300031344 Bacteria 1449
912 Ga0265316_10278545 3300031344 Bacteria 1222
913 Ga0265316_11011191 3300031344 Bacteria 578
914 Ga0307408_100181505 3300031548 Bacteria 1688
915 Ga0307408_101280596 3300031548 Unclassified 686
916 Ga0265313_10291643 3300031595 Bacteria 657
917 Ga0316575_10308554 3300031665 Bacteria 670
918 Ga0316579_10036556 3300031691 Bacteria 2266
919 Ga0265314_10038570 3300031711 Bacteria 3449
920 Ga0265314_10189976 3300031711 Bacteria 1223
921 Ga0265342_10045743 3300031712 Bacteria 2633
922 Ga0265342_10154000 3300031712 Bacteria 1274
923 Ga0316576_10228745 3300031727 Bacteria 1398
924 Ga0307405_10292573 3300031731 Bacteria 1232
925 Ga0307405_10473090 3300031731 Bacteria 999
926 Ga0316577_10084905 3300031733 Bacteria 1771
927 Ga0307413_10138272 3300031824 Bacteria 1679
928 Ga0307413_10412872 3300031824 Bacteria 1061
929 Ga0307413_10620139 3300031824 Bacteria 888
930 Ga0307413_10856567 3300031824 Bacteria 768
931 Ga0307413_11002417 3300031824 Bacteria 716
932 Ga0307413_11730237 3300031824 Bacteria 558
933 Ga0307410_10176327 3300031852 Bacteria 1615
934 Ga0307410_10246946 3300031852 Bacteria 1386
935 Ga0307410_10624168 3300031852 Bacteria 901
936 Ga0307410_10946701 3300031852 Unclassified 740
937 Ga0307410_11296859 3300031852 Bacteria 637
938 Ga0307410_11966603 3300031852 Bacteria 521
939 Ga0307406_10099751 3300031901 Bacteria 1975
940 Ga0307406_10313698 3300031901 Bacteria 1210
941 Ga0307407_10070925 3300031903 Bacteria 2073
942 Ga0307407_10408694 3300031903 Bacteria 976
943 Ga0307407_10545436 3300031903 Bacteria 856
944 Ga0307407_10594033 3300031903 Bacteria 823
945 Ga0307407_11488511 3300031903 Bacteria 535
946 Ga0307412_10197343 3300031911 Bacteria 1526
947 Ga0307409_100070578 3300031995 Bacteria 2773
948 Ga0307409_100100508 3300031995 Bacteria 2398
949 Ga0307409_100120466 3300031995 Bacteria 2221
950 Ga0307409_100202470 3300031995 Bacteria 1777
951 Ga0307409_100203152 3300031995 Bacteria 1775
952 Ga0307409_100857714 3300031995 Bacteria 919
953 Ga0307409_100906556 3300031995 Unclassified 895
954 Ga0307409_101223614 3300031995 Bacteria 775
955 Ga0307409_101488461 3300031995 Bacteria 704
956 Ga0307409_102925021 3300031995 Bacteria 504
957 Ga0307416_100036600 3300032002 Bacteria 3766
958 Ga0307416_100114459 3300032002 Bacteria 2386
959 Ga0307416_100314122 3300032002 Bacteria 1565
960 Ga0307414_10544722 3300032004 Bacteria 1033
961 Ga0307414_11370110 3300032004 Bacteria 657
962 Ga0307411_10092344 3300032005 Bacteria 2117
963 Ga0307411_10497141 3300032005 Bacteria 1030
964 Ga0307411_10998312 3300032005 Bacteria 749
965 Ga0307411_11160548 3300032005 Bacteria 699
966 Ga0307415_100008451 3300032126 Bacteria 5707
967 Ga0307415_100094909 3300032126 Bacteria 2170
968 Ga0307415_100418159 3300032126 Unclassified 1149
969 Ga0307415_100741008 3300032126 Unclassified 891
970 Ga0307415_101038163 3300032126 Bacteria 764
971 Ga0307415_102109644 3300032126 Bacteria 550
972 Ga0316583_10017771 3300032133 Bacteria 2555
973 Ga0316593_10060785 3300032168 Bacteria 1291
974 Ga0373930_0112362 3300034816 Bacteria 657
975 Ga0373959_0134558 3300034820 Bacteria 614
976 Ga0373938_0136456 3300034957 Unclassified 644
977 Ga0373926_0260757 3300035083 Bacteria 673
978 Ga0373928_0075415 3300035084 Bacteria 842
979 Ga0373929_0171810 3300035085 Bacteria 593
980 Ga0373934_0443842 3300035086 Bacteria 544
981 Ga0373949_0223302 3300035090 Bacteria 574
982 Ga0373923_0418534 3300035111 Bacteria 647
983 Ga0373923_0588566 3300035111 Bacteria 547
984 Ga0373932_0055351 3300035112 Bacteria 1190
985 Ga0373936_0160661 3300035113 Bacteria 979
986 Ga0373936_0425556 3300035113 Bacteria 612
987 Ga0373939_0176648 3300035114 Bacteria 794
988 Ga0373939_0204343 3300035114 Bacteria 749
989 Ga0373939_0349023 3300035114 Bacteria 602
990 Ga0373941_0010108 3300035115 Bacteria 2398
991 Ga0373941_0132695 3300035115 Bacteria 899
992 Ga0373941_0339692 3300035115 Bacteria 608
993 Ga0373953_0246740 3300035117 Bacteria 776
994 Ga0373957_0536703 3300035120 Unclassified 511
995 Ga0373960_0038670 3300035121 Bacteria 1369
996 Ga0373960_0148990 3300035121 Bacteria 798
997 Ga0373943_0315581 3300035170 Bacteria 890
998 Ga0373943_0406739 3300035170 Bacteria 786
999 Ga0373943_0435170 3300035170 Unclassified 760
1000 Ga0373943_0812928 3300035170 Bacteria 557
1001 Ga0373946_0325646 3300035171 Unclassified 764
1002 Ga0373955_0497163 3300035172 Bacteria 745
1003 Ga0373942_0059390 3300035207 Bacteria 1093
1004 Ga0373961_0108427 3300035241 Bacteria 907
1005 Ga0373961_0135510 3300035241 Bacteria 828
1006 Ga0373961_0158103 3300035241 Bacteria 777
1007 Ga0373961_0423741 3300035241 Bacteria 514
1008 Ga0373962_0004538 3300035242 Bacteria 3359
1009 Ga0373962_0092957 3300035242 Bacteria 931
1010 Ga0373962_0229904 3300035242 Bacteria 637
1011 Ga0316574_0116624 3300035398 Bacteria 1713
1012 Ga0316574_0413048 3300035398 Bacteria 849
1013 Ga0373931_0037692 3300035691 Bacteria 2524
1014 Ga0373931_0081925 3300035691 Bacteria 1783
1015 Ga0373931_0174715 3300035691 Bacteria 1268
1016 Ga0373935_0457366 3300035692 Bacteria 923
1017 Ga0373933_0913335 3300035724 Bacteria 578
1018 Ga0373947_0377948 3300035725 Bacteria 953
1019 Ga0373947_0538692 3300035725 Bacteria 794
1020 Ga0373937_0098767 3300036401 Bacteria 2708
1021 Ga0373937_0575731 3300036401 Bacteria 1069
1022 Ga0373937_0636915 3300036401 Bacteria 1011
1023 Ga0373937_1047203 3300036401 Bacteria 765
1024 Ga0373937_1085018 3300036401 Bacteria 749
1025 Ga0373937_1655445 3300036401 Bacteria 587
1026 Ga0316582_0045721 3300036647 Bacteria 2757
1027 Ga0316582_0149506 3300036647 Bacteria 1578
1028 Ga0316584_0043994 3300036712 Bacteria 3330
1029 Ga0373925_0137102 3300037068 Bacteria 1913
1030 Ga0373925_0526089 3300037068 Bacteria 972
1031 Ga0395900_0819052 3300037418 Unclassified 858
1032 Ga0395905_0626916 3300037471 Unclassified 977
1033 Ga0316581_0015892 3300037588 Bacteria 2156
1034 Ga0395901_1940427 3300038443 Unclassified 536
1035 Ga0395901_1957754 3300038443 Bacteria 533
1036 Ga0242420_067071 3300038996 Bacteria 724
1037 Ga0436362_1182383 3300039453 Bacteria 722
1038 Ga0439438_042646 3300041405 Bacteria 1173
1039 Ga0439438_168651 3300041405 Unclassified 521
1040 Ga0439453_0051394 3300041408 Bacteria 834
1041 Ga0439453_0111316 3300041408 Bacteria 620
1042 Ga0439461_0016605 3300041410 Bacteria 1423
1043 Ga0439461_0037789 3300041410 Bacteria 1032
1044 Ga0439466_0193323 3300041411 Unclassified 619
1045 Ga0439466_0264025 3300041411 Unclassified 521
1046 Ga0439465_0019690 3300041413 Bacteria 2111
1047 Ga0439465_0151593 3300041413 Bacteria 828
1048 Ga0439465_0258839 3300041413 Bacteria 645
1049 Ga0439465_0364320 3300041413 Bacteria 547
1050 Ga0451787_248058 3300041441 Unclassified 1093
1051 Ga0451789_0456423 3300041443 Bacteria 674
1052 Ga0451789_0746665 3300041443 Bacteria 596
1053 Ga0451793_0530653 3300041452 Bacteria 539
1054 Ga0451800_0835134 3300041459 Bacteria 654
1055 Ga0451800_1473057 3300041459 Bacteria 1156
1056 Ga0451802_0119190 3300041460 Unclassified 520
1057 Ga0451802_0335512 3300041460 Bacteria 565
1058 Ga0451802_0378965 3300041460 Bacteria 1368
1059 Ga0451802_1055887 3300041460 Bacteria 1011
1060 Ga0451802_1696685 3300041460 Bacteria 1214
1061 Ga0451807_2364034 3300041486 Bacteria 839
1062 Ga0451807_2456411 3300041486 Bacteria 703
1063 Ga0451833_0420733 3300041491 Bacteria 606
1064 Ga0451833_0610792 3300041491 Bacteria 677
1065 Ga0451837_0420354 3300041494 Bacteria 948
1066 Ga0451837_1041428 3300041494 Bacteria 562
1067 Ga0451839_0804101 3300041496 Bacteria 1015
1068 Ga0451845_0707372 3300041501 Bacteria 622
1069 Ga0451847_0573800 3300041503 Unclassified 516
1070 Ga0451847_0941613 3300041503 Bacteria 521
1071 Ga0451847_0953196 3300041503 Unclassified 600
1072 Ga0451849_0077098 3300041505 Bacteria 533
1073 Ga0451849_0570943 3300041505 Bacteria 1190
1074 Ga0451849_1243198 3300041505 Bacteria 550
1075 Ga0451851_0324799 3300041507 Bacteria 637
1076 Ga0451843_1237422 3300041509 Unclassified 731
1077 Ga0451853_0244650 3300041512 Bacteria 573
1078 Ga0451853_1611157 3300041512 Bacteria 567
1079 Ga0451853_2943674 3300041512 Bacteria 567
1080 Ga0451853_3208146 3300041512 Bacteria 920
1081 Ga0451853_3271353 3300041512 Bacteria 1130
1082 Ga0439431_0114976 3300041997 Bacteria 747
1083 Ga0439433_0132512 3300041999 Bacteria 634
1084 Ga0439455_0042020 3300042012 Bacteria 1174
1085 Ga0439462_0061372 3300042015 Bacteria 1018
1086 Ga0439462_0139261 3300042015 Bacteria 679
1087 Ga0439462_0210804 3300042015 Unclassified 554
1088 Ga0450914_057630 3300042118 Bacteria 522
1089 Ga0450917_012715 3300042120 Bacteria 688
1090 Ga0450920_027840 3300042122 Bacteria 1106
1091 Ga0450920_044907 3300042122 Bacteria 883
1092 Ga0450920_052166 3300042122 Bacteria 821
1093 Ga0450923_073823 3300042125 Bacteria 759
1094 Ga0450923_084345 3300042125 Bacteria 718
1095 Ga0450923_125005 3300042125 Bacteria 609
1096 Ga0450900_033604 3300042136 Bacteria 752
1097 Ga0450906_018798 3300042145 Bacteria 1239
1098 Ga0450906_089470 3300042145 Bacteria 558
1099 Ga0450907_013045 3300042146 Bacteria 1384
1100 Ga0450910_002451 3300042147 Bacteria 2439
1101 Ga0450910_006296 3300042147 Bacteria 1635
1102 Ga0450910_038270 3300042147 Bacteria 770
1103 Ga0450910_077941 3300042147 Unclassified 576
1104 Ga0450910_079507 3300042147 Bacteria 572
1105 Ga0439446_0032741 3300042156 Bacteria 1509
1106 Ga0439446_0143931 3300042156 Bacteria 780
1107 Ga0439446_0170452 3300042156 Bacteria 724
1108 Ga0439458_0011761 3300042157 Bacteria 1960
1109 Ga0450909_021360 3300042185 Unclassified 967
1110 Ga0450909_039047 3300042185 Bacteria 729
1111 Ga0439434_0105973 3300042435 Bacteria 908
1112 Ga0439434_0175563 3300042435 Bacteria 716
1113 Ga0439435_0236970 3300042436 Bacteria 611
1114 Ga0439459_0046489 3300042438 Bacteria 940
1115 Ga0439460_0320562 3300042461 Unclassified 544
1116 Ga0450918_069211 3300042531 Bacteria 661
1117 Ga0450918_094216 3300042531 Bacteria 581
1118 Ga0450901_017917 3300042533 Bacteria 752
1119 Ga0451577_0079810 3300042876 Bacteria 2917
1120 Ga0451577_0231293 3300042876 Bacteria 1672
1121 Ga0451577_1382181 3300042876 Unclassified 625
1122 Ga0451577_1844449 3300042876 Unclassified 530
1123 Ga0453683_0049177 3300044673 Bacteria 2643
1124 Ga0453683_0203102 3300044673 Bacteria 1258
1125 Ga0453683_0434985 3300044673 Unclassified 848
1126 Ga0453684_0338068 3300044712 Bacteria 1701
1127 Ga0453684_0547544 3300044712 Bacteria 1275
1128 Ga0453684_0679069 3300044712 Bacteria 1121
1129 Ga0453684_0750197 3300044712 Unclassified 1057
1130 Ga0466971_0721369 3300044719 Unclassified 502
1131 Ga0466968_0610138 3300044735 Bacteria 551
1132 Ga0451576_0069769 3300045051 Bacteria 3658
1133 Ga0451576_0197485 3300045051 Bacteria 2102
1134 Ga0451576_0293149 3300045051 Bacteria 1701
1135 Ga0451576_1186172 3300045051 Bacteria 797
1136 Ga0466967_2605642 3300045976 Bacteria 500
1137 Ga0495592_0186750 3300046454 Bacteria 1407
1138 Ga0495592_0603975 3300046454 Bacteria 669
1139 Ga0495603_0030574 3300046455 Bacteria 3243
1140 Ga0495603_0119112 3300046455 Bacteria 1539
1141 Ga0495603_0290756 3300046455 Bacteria 939
1142 Ga0495603_0292405 3300046455 Bacteria 936
1143 Ga0495603_0516289 3300046455 Bacteria 684
1144 Ga0495590_0167223 3300046457 Bacteria 801
1145 Ga0495629_0658341 3300046459 Unclassified 697
1146 Ga0495629_0962103 3300046459 Bacteria 557
1147 Ga0495629_0987828 3300046459 Bacteria 548
1148 Ga0495641_0111810 3300046461 Bacteria 1219
1149 Ga0495641_0262010 3300046461 Bacteria 778
1150 Ga0495641_0263586 3300046461 Bacteria 775
1151 Ga0495641_0493018 3300046461 Bacteria 558
1152 Ga0495651_0062980 3300046462 Bacteria 2836
1153 Ga0495653_0040160 3300046463 Bacteria 3659
1154 Ga0495653_0667592 3300046463 Bacteria 634
1155 Ga0495653_0669777 3300046463 Bacteria 632
1156 Ga0495582_0359752 3300046473 Bacteria 838
1157 Ga0495582_0419128 3300046473 Unclassified 772
1158 Ga0495605_0215234 3300046474 Bacteria 832
1159 Ga0495605_0294234 3300046474 Bacteria 688
1160 Ga0495639_0723097 3300046475 Unclassified 515
1161 Ga0495662_0215970 3300046476 Unclassified 945
1162 Ga0495662_0580169 3300046476 Bacteria 549
1163 Ga0495664_0066755 3300046477 Bacteria 2146
1164 Ga0495664_0501762 3300046477 Bacteria 725
1165 Ga0495664_0705753 3300046477 Bacteria 596
1166 Ga0495584_0449276 3300046491 Bacteria 656
1167 Ga0495584_0472309 3300046491 Bacteria 638
1168 Ga0495594_0324024 3300046499 Bacteria 878
1169 Ga0495594_0400722 3300046499 Bacteria 781
1170 Ga0495596_0125815 3300046500 Bacteria 995
1171 Ga0495596_0353788 3300046500 Bacteria 572
1172 Ga0495607_0492437 3300046501 Bacteria 545
1173 Ga0495608_0099204 3300046511 Bacteria 1879
1174 Ga0495608_0131279 3300046511 Bacteria 1603
1175 Ga0495608_0555395 3300046511 Bacteria 692
1176 Ga0495618_0098636 3300046514 Bacteria 1869
1177 Ga0495618_0909629 3300046514 Bacteria 508
1178 Ga0495620_0290523 3300046515 Bacteria 622
1179 Ga0495628_0048688 3300046516 Bacteria 3359
1180 Ga0495628_0667714 3300046516 Unclassified 737
1181 Ga0495628_0759898 3300046516 Bacteria 681
1182 Ga0495628_1162274 3300046516 Bacteria 525
1183 Ga0495630_0360014 3300046517 Bacteria 1114
1184 Ga0495630_0512391 3300046517 Bacteria 920
1185 Ga0495631_0465044 3300046518 Unclassified 539
1186 Ga0495663_0173057 3300046525 Bacteria 745
1187 Ga0495666_0349772 3300046526 Bacteria 666
1188 Ga0495652_0053061 3300046529 Bacteria 3457
1189 Ga0495654_0368859 3300046530 Bacteria 575
1190 Ga0495640_0070085 3300046533 Bacteria 2357
1191 Ga0495640_0683417 3300046533 Unclassified 616
1192 Ga0495640_0864391 3300046533 Unclassified 537
1193 Ga0495640_0893798 3300046533 Bacteria 526
1194 Ga0495586_0681205 3300046535 Bacteria 594
1195 Ga0495587_0055796 3300046536 Unclassified 2326
1196 Ga0495587_0262489 3300046536 Bacteria 970
1197 Ga0495598_0470922 3300046537 Unclassified 500
1198 Ga0495609_0247398 3300046538 Bacteria 735
1199 Ga0495597_0203572 3300046542 Bacteria 792
1200 Ga0495645_0119067 3300046543 Bacteria 1861
1201 Ga0495645_0911431 3300046543 Unclassified 521
1202 Ga0495667_0308946 3300046559 Unclassified 1001
1203 Ga0495667_1022204 3300046559 Bacteria 503
1204 Ga0495656_0387180 3300046615 Bacteria 730
1205 Ga0495656_0570822 3300046615 Bacteria 604
1206 Ga0495668_0259047 3300046616 Unclassified 952
1207 Ga0495668_0417368 3300046616 Bacteria 738
1208 Ga0495634_0017206 3300046642 Bacteria 5163
1209 Ga0495634_0217765 3300046642 Bacteria 1180
1210 Ga0495634_0474403 3300046642 Bacteria 736
1211 Ga0495611_0463998 3300046648 Bacteria 577
1212 Ga0495635_0637063 3300046663 Bacteria 694
1213 Ga0495659_0260025 3300046664 Bacteria 725
1214 Ga0495659_0376287 3300046664 Unclassified 610
1215 Ga0495661_0553313 3300046665 Unclassified 544
1216 Ga0495588_0364756 3300046674 Unclassified 759
1217 Ga0495657_0663990 3300046675 Unclassified 600
1218 Ga0495599_0445257 3300046678 Bacteria 767
1219 Ga0495599_0824804 3300046678 Bacteria 529
1220 Ga0495647_0437333 3300046681 Bacteria 604
1221 Ga0495647_0531906 3300046681 Bacteria 549
1222 Ga0495647_0542705 3300046681 Unclassified 543
1223 Ga0495647_0588590 3300046681 Unclassified 522
1224 Ga0495647_0594270 3300046681 Unclassified 519
1225 Ga0495658_0452844 3300046683 Bacteria 820
1226 Ga0495658_0458574 3300046683 Unclassified 814
1227 Ga0495658_0532675 3300046683 Bacteria 752
1228 Ga0495613_0421812 3300046689 Bacteria 908
1229 Ga0495624_0360071 3300046690 Bacteria 875
1230 Ga0495624_0703660 3300046690 Bacteria 600
1231 Ga0495670_0421466 3300046691 Bacteria 722
1232 Ga0495660_0420805 3300046810 Bacteria 582
1233 Ga0495660_0458471 3300046810 Bacteria 550
1234 Ga0495581_0494202 3300047315 Bacteria 711
1235 Ga0495581_0513164 3300047315 Unclassified 697
1236 Ga0495581_0594070 3300047315 Unclassified 641
1237 Ga0495581_0914046 3300047315 Unclassified 501
1238 Ga0495604_0285617 3300047317 Bacteria 1113
1239 Ga0495604_0426775 3300047317 Bacteria 869
1240 Ga0495636_0212447 3300047318 Bacteria 886
1241 Ga0495674_0172296 3300047319 Bacteria 1805
1242 Ga0495674_0482626 3300047319 Bacteria 993
1243 Ga0495674_1439445 3300047319 Unclassified 512
1244 Ga0495676_0538696 3300047321 Bacteria 764
1245 Ga0495676_0606598 3300047321 Bacteria 712
1246 Ga0495676_0713905 3300047321 Unclassified 648
1247 Ga0495676_0847408 3300047321 Bacteria 587
1248 Ga0495676_0937873 3300047321 Bacteria 554
1249 Ga0495680_0046666 3300047322 Bacteria 3414
1250 Ga0495680_0583867 3300047322 Bacteria 749
1251 Ga0495681_0401662 3300047470 Bacteria 512
1252 Ga0495684_0240530 3300047471 Bacteria 1321
1253 Ga0495593_0411397 3300047673 Bacteria 676
1254 Ga0495593_0533175 3300047673 Bacteria 589
1255 Ga0495602_0422608 3300048088 Bacteria 946
1256 Ga0495602_0656994 3300048088 Bacteria 715
1257 Ga0495614_0433027 3300048089 Bacteria 621
1258 Ga0496100_0146212 3300048903 Unclassified 1681
1259 Ga0496100_0586681 3300048903 Bacteria 864
1260 Ga0496100_0921115 3300048903 Bacteria 687
1261 Ga0496101_0130757 3300048904 Unclassified 1906
1262 Ga0496101_0186961 3300048904 Bacteria 1597
1263 Ga0496101_0228531 3300048904 Bacteria 1446
1264 Ga0496101_0284624 3300048904 Bacteria 1293
1265 Ga0496102_0017986 3300048905 Bacteria 6202
1266 Ga0496102_0193975 3300048905 Bacteria 1914
1267 Ga0496102_0291685 3300048905 Unclassified 1538
1268 Ga0496102_0336701 3300048905 Bacteria 1421
1269 Ga0496102_0340513 3300048905 Bacteria 1412
1270 Ga0496102_0524730 3300048905 Bacteria 1107
1271 Ga0496102_1133565 3300048905 Bacteria 702
1272 Ga0496102_1140693 3300048905 Bacteria 699
1273 Ga0496102_1444448 3300048905 Unclassified 607
1274 Ga0496102_1666000 3300048905 Unclassified 556
1275 Ga0496102_1769930 3300048905 Bacteria 535
1276 Ga0496103_0142381 3300048906 Bacteria 1534
1277 Ga0496103_0161058 3300048906 Bacteria 1439
1278 Ga0496103_0175238 3300048906 Bacteria 1378
1279 Ga0496103_0919847 3300048906 Bacteria 547
1280 Ga0496104_0053279 3300048907 Bacteria 3822
1281 Ga0496104_0076056 3300048907 Bacteria 3197
1282 Ga0496104_0079942 3300048907 Bacteria 3116
1283 Ga0496104_0178630 3300048907 Bacteria 2033
1284 Ga0496104_0812923 3300048907 Bacteria 841
1285 Ga0496104_0911047 3300048907 Bacteria 784
1286 Ga0496105_0045777 3300048908 Bacteria 3610
1287 Ga0496105_0052409 3300048908 Bacteria 3370
1288 Ga0496105_0086127 3300048908 Bacteria 2596
1289 Ga0496105_0579460 3300048908 Bacteria 873
1290 Ga0496105_0759380 3300048908 Bacteria 740
1291 Ga0496105_1193926 3300048908 Bacteria 560
1292 Ga0496106_0188047 3300048909 Bacteria 1641
1293 Ga0496106_0471763 3300048909 Bacteria 1008
1294 Ga0496106_0476230 3300048909 Unclassified 1003
1295 Ga0496106_0484394 3300048909 Bacteria 994
1296 Ga0496106_0533606 3300048909 Bacteria 942
1297 Ga0496106_0598129 3300048909 Bacteria 883
1298 Ga0496106_0623045 3300048909 Bacteria 863
1299 Ga0496106_0680468 3300048909 Bacteria 821
1300 Ga0496106_0776468 3300048909 Unclassified 761
1301 Ga0496106_0882394 3300048909 Bacteria 707
1302 Ga0496106_0953055 3300048909 Bacteria 676
1303 Ga0496107_0044228 3300048910 Bacteria 3201
1304 Ga0496107_0147774 3300048910 Bacteria 1738
1305 Ga0496107_0379559 3300048910 Bacteria 1051
1306 Ga0496107_0488274 3300048910 Bacteria 914
1307 Ga0496107_0598880 3300048910 Bacteria 815
1308 Ga0496107_0724101 3300048910 Bacteria 731
1309 Ga0496107_0747583 3300048910 Bacteria 718
1310 Ga0496107_0748694 3300048910 Bacteria 717
1311 Ga0496107_0766164 3300048910 Bacteria 708
1312 Ga0496107_0848768 3300048910 Bacteria 667
1313 Ga0496107_0978639 3300048910 Bacteria 614
1314 Ga0496108_0053745 3300048911 Bacteria 3378
1315 Ga0496108_0077898 3300048911 Bacteria 2805
1316 Ga0496108_0145473 3300048911 Bacteria 2043
1317 Ga0496108_0204267 3300048911 Bacteria 1714
1318 Ga0496108_0383579 3300048911 Bacteria 1227
1319 Ga0496108_0700564 3300048911 Unclassified 878
1320 Ga0496108_0710217 3300048911 Bacteria 871
1321 Ga0496108_0912132 3300048911 Bacteria 754
1322 Ga0496108_1332697 3300048911 Unclassified 603
1323 Ga0496108_1522176 3300048911 Bacteria 556
1324 Ga0496109_0036412 3300048912 Bacteria 4441
1325 Ga0496109_0067582 3300048912 Bacteria 3274
1326 Ga0496109_0092505 3300048912 Bacteria 2797
1327 Ga0496109_0106356 3300048912 Bacteria 2606
1328 Ga0496109_0150769 3300048912 Bacteria 2177
1329 Ga0496109_0349189 3300048912 Bacteria 1397
1330 Ga0496109_0491888 3300048912 Bacteria 1158
1331 Ga0496109_0497195 3300048912 Bacteria 1151
1332 Ga0496109_0509047 3300048912 Bacteria 1136
1333 Ga0496109_0637449 3300048912 Bacteria 1002
1334 Ga0496109_0783587 3300048912 Bacteria 891
1335 Ga0496109_1073640 3300048912 Bacteria 742
1336 Ga0496109_1134654 3300048912 Bacteria 719
1337 Ga0496109_1251156 3300048912 Bacteria 678
1338 Ga0496110_0110373 3300048913 Bacteria 2471
1339 Ga0496110_0142717 3300048913 Bacteria 2165
1340 Ga0496110_0158680 3300048913 Bacteria 2050
1341 Ga0496110_0496896 3300048913 Bacteria 1111
1342 Ga0496110_0929006 3300048913 Unclassified 776
1343 Ga0496110_1363825 3300048913 Bacteria 618
1344 Ga0496111_0003938 3300048914 Bacteria 9315
1345 Ga0496111_0081751 3300048914 Bacteria 2358
1346 Ga0496111_0178677 3300048914 Bacteria 1577
1347 Ga0496111_0225613 3300048914 Bacteria 1392
1348 Ga0496111_0294888 3300048914 Bacteria 1202
1349 Ga0496111_0347256 3300048914 Bacteria 1098
1350 Ga0496111_0487310 3300048914 Bacteria 908
1351 Ga0496111_0714718 3300048914 Bacteria 728
1352 Ga0496111_0756485 3300048914 Bacteria 705
1353 Ga0496112_0000010 3300048915 Bacteria 245046
1354 Ga0496112_0186898 3300048915 Bacteria 2035
1355 Ga0496112_0244603 3300048915 Bacteria 1746
1356 Ga0496112_0312664 3300048915 Unclassified 1516
1357 Ga0496112_0323862 3300048915 Bacteria 1485
1358 Ga0496112_0424436 3300048915 Bacteria 1268
1359 Ga0496112_0458860 3300048915 Bacteria 1212
1360 Ga0496112_0560285 3300048915 Bacteria 1076
1361 Ga0496112_0675139 3300048915 Bacteria 962
1362 Ga0496112_1041018 3300048915 Bacteria 738
1363 Ga0496112_1065403 3300048915 Bacteria 727
1364 Ga0496112_1270843 3300048915 Bacteria 652
1365 Ga0496113_0033871 3300048916 Bacteria 3723
1366 Ga0496113_0105638 3300048916 Bacteria 2186
1367 Ga0496113_0596768 3300048916 Bacteria 884
1368 Ga0496113_0931779 3300048916 Bacteria 686
1369 Ga0496113_1529952 3300048916 Bacteria 514
1370 Ga0496114_0190416 3300048917 Bacteria 1795
1371 Ga0496114_0242424 3300048917 Bacteria 1585
1372 Ga0496114_0277341 3300048917 Bacteria 1478
1373 Ga0496114_0349592 3300048917 Bacteria 1307
1374 Ga0496114_0387392 3300048917 Bacteria 1238
1375 Ga0496114_0706051 3300048917 Bacteria 884
1376 Ga0496114_0748099 3300048917 Unclassified 855
1377 Ga0496114_0775514 3300048917 Bacteria 837
1378 Ga0496114_1021862 3300048917 Bacteria 710
1379 Ga0496114_1148695 3300048917 Bacteria 662
1380 Ga0496114_1677213 3300048917 Unclassified 524
1381 Ga0501317_051384 3300049533 Unclassified 656
1382 Ga0501317_068935 3300049533 Bacteria 594
1383 Ga0501317_077447 3300049533 Bacteria 570
1384 Ga0501031_0016564 3300049568 Bacteria 4788
1385 Ga0501031_0030027 3300049568 Bacteria 3546
1386 Ga0501031_0055651 3300049568 Bacteria 2577
1387 Ga0501031_0142851 3300049568 Bacteria 1564
1388 Ga0501031_0147971 3300049568 Bacteria 1534
1389 Ga0501031_0205315 3300049568 Bacteria 1285
1390 Ga0501031_0234572 3300049568 Bacteria 1193
1391 Ga0501031_0271783 3300049568 Bacteria 1100
1392 Ga0501031_0341908 3300049568 Bacteria 969
1393 Ga0501031_0354651 3300049568 Bacteria 949
1394 Ga0501031_0412535 3300049568 Bacteria 873
1395 Ga0501031_0497217 3300049568 Bacteria 787
1396 Ga0501031_0574112 3300049568 Unclassified 726
1397 Ga0501031_0591098 3300049568 Bacteria 714
1398 Ga0501032_0209669 3300049569 Bacteria 1270
1399 Ga0501032_0276406 3300049569 Bacteria 1088
1400 Ga0501032_0314056 3300049569 Bacteria 1012
1401 Ga0501032_0476361 3300049569 Unclassified 799
1402 Ga0501032_0570029 3300049569 Bacteria 721
1403 Ga0501032_0655575 3300049569 Bacteria 666
1404 Ga0501032_0679382 3300049569 Bacteria 653
1405 Ga0501033_0092865 3300049570 Bacteria 2207
1406 Ga0501033_0140817 3300049570 Bacteria 1744
1407 Ga0501033_0150024 3300049570 Bacteria 1682
1408 Ga0501033_0340844 3300049570 Bacteria 1051
1409 Ga0501033_0469882 3300049570 Bacteria 872
1410 Ga0501033_0825688 3300049570 Bacteria 626
1411 Ga0501033_0899211 3300049570 Unclassified 595
1412 Ga0501034_0767111 3300049571 Bacteria 859
1413 Ga0501034_1374343 3300049571 Bacteria 582
1414 Ga0501036_0008584 3300049572 Bacteria 8382
1415 Ga0501036_0051949 3300049572 Bacteria 3471
1416 Ga0501036_0052252 3300049572 Bacteria 3461
1417 Ga0501036_0111980 3300049572 Bacteria 2306
1418 Ga0501036_0149980 3300049572 Bacteria 1967
1419 Ga0501036_0177691 3300049572 Bacteria 1792
1420 Ga0501036_0232353 3300049572 Bacteria 1547
1421 Ga0501036_0519461 3300049572 Bacteria 990
1422 Ga0501036_1053253 3300049572 Bacteria 665
1423 Ga0501036_1286208 3300049572 Bacteria 595
1424 Ga0501036_1401163 3300049572 Bacteria 567
1425 Ga0501036_1460124 3300049572 Bacteria 554
1426 Ga0501036_1654059 3300049572 Bacteria 516
1427 Ga0501036_1672329 3300049572 Unclassified 513
1428 Ga0501037_0189197 3300049573 Bacteria 1458
1429 Ga0501037_0282874 3300049573 Bacteria 1155
1430 Ga0501037_0291525 3300049573 Bacteria 1135
1431 Ga0501037_0309959 3300049573 Bacteria 1094
1432 Ga0501037_0430918 3300049573 Bacteria 902
1433 Ga0501037_0483829 3300049573 Bacteria 841
1434 Ga0501037_0615230 3300049573 Bacteria 728
1435 Ga0501038_0023373 3300049574 Bacteria 5527
1436 Ga0501038_0071494 3300049574 Bacteria 2943
1437 Ga0501038_0074438 3300049574 Bacteria 2873
1438 Ga0501038_0196163 3300049574 Bacteria 1623
1439 Ga0501038_0255986 3300049574 Bacteria 1385
1440 Ga0501038_0394554 3300049574 Bacteria 1071
1441 Ga0501038_0552652 3300049574 Bacteria 875
1442 Ga0501038_1176500 3300049574 Bacteria 557
1443 Ga0501038_1187728 3300049574 Bacteria 554
1444 Ga0501039_0040831 3300049575 Bacteria 3581
1445 Ga0501039_0070888 3300049575 Bacteria 2707
1446 Ga0501039_0152410 3300049575 Bacteria 1816
1447 Ga0501039_0162928 3300049575 Bacteria 1753
1448 Ga0501039_0206929 3300049575 Bacteria 1543
1449 Ga0501039_0265718 3300049575 Bacteria 1348
1450 Ga0501039_0270485 3300049575 Bacteria 1336
1451 Ga0501039_0396766 3300049575 Bacteria 1083
1452 Ga0501039_0668206 3300049575 Bacteria 813
1453 Ga0501039_0758798 3300049575 Bacteria 757
1454 Ga0501039_0787521 3300049575 Bacteria 742
1455 Ga0501039_0825865 3300049575 Bacteria 723
1456 Ga0501040_0002643 3300049576 Bacteria 11559
1457 Ga0501040_0002938 3300049576 Bacteria 11020
1458 Ga0501040_0032435 3300049576 Bacteria 3534
1459 Ga0501040_0077593 3300049576 Bacteria 2298
1460 Ga0501040_0077890 3300049576 Bacteria 2293
1461 Ga0501040_0145141 3300049576 Bacteria 1673
1462 Ga0501040_0188176 3300049576 Bacteria 1464
1463 Ga0501040_0216763 3300049576 Bacteria 1361
1464 Ga0501040_0443104 3300049576 Bacteria 934
1465 Ga0501040_0563549 3300049576 Bacteria 822
1466 Ga0501040_0889093 3300049576 Unclassified 645
1467 Ga0501040_0907739 3300049576 Bacteria 638
1468 Ga0501040_0973222 3300049576 Bacteria 615
1469 Ga0501040_1222106 3300049576 Unclassified 545
1470 Ga0501041_0033148 3300049577 Bacteria 3124
1471 Ga0501041_0034167 3300049577 Bacteria 3078
1472 Ga0501041_0101980 3300049577 Unclassified 1777
1473 Ga0501041_0140905 3300049577 Bacteria 1503
1474 Ga0501041_0165917 3300049577 Unclassified 1381
1475 Ga0501041_0191586 3300049577 Bacteria 1281
1476 Ga0501041_0203933 3300049577 Bacteria 1240
1477 Ga0501041_0278426 3300049577 Bacteria 1053
1478 Ga0501041_0303775 3300049577 Unclassified 1005
1479 Ga0501041_0309045 3300049577 Bacteria 996
1480 Ga0501041_0499984 3300049577 Bacteria 773
1481 Ga0501041_0564008 3300049577 Bacteria 726
1482 Ga0501041_0840590 3300049577 Unclassified 589
1483 Ga0501042_0000721 3300049578 Bacteria 17946
1484 Ga0501042_0016877 3300049578 Bacteria 5023
1485 Ga0501042_0049838 3300049578 Bacteria 2988
1486 Ga0501042_0108921 3300049578 Bacteria 1994
1487 Ga0501042_0174553 3300049578 Bacteria 1550
1488 Ga0501042_0313602 3300049578 Bacteria 1133
1489 Ga0501042_0320816 3300049578 Bacteria 1119
1490 Ga0501042_0414960 3300049578 Bacteria 975
1491 Ga0501042_0552614 3300049578 Unclassified 837
1492 Ga0501042_0617009 3300049578 Bacteria 788
1493 Ga0501042_0659122 3300049578 Bacteria 761
1494 Ga0501042_0728426 3300049578 Bacteria 721
1495 Ga0501042_0789393 3300049578 Unclassified 691
1496 Ga0501042_0815357 3300049578 Unclassified 679
1497 Ga0501042_1014234 3300049578 Viruses 605
1498 Ga0501042_1099324 3300049578 Unclassified 580
1499 Ga0501043_0191183 3300049579 Bacteria 1592
1500 Ga0501043_0293603 3300049579 Bacteria 1244
1501 Ga0501043_0363336 3300049579 Bacteria 1098
1502 Ga0501043_0364023 3300049579 Bacteria 1097
1503 Ga0501043_0374868 3300049579 Bacteria 1078
1504 Ga0501043_0628448 3300049579 Bacteria 791
1505 Ga0501043_1076892 3300049579 Bacteria 569
1506 Ga0501046_0049354 3300049580 Bacteria 3329
1507 Ga0501046_0076501 3300049580 Bacteria 2593
1508 Ga0501046_0138464 3300049580 Bacteria 1843
1509 Ga0501046_0245878 3300049580 Bacteria 1318
1510 Ga0501046_0250932 3300049580 Bacteria 1302
1511 Ga0501046_0261226 3300049580 Bacteria 1272
1512 Ga0501046_0556061 3300049580 Unclassified 818
1513 Ga0501046_0572502 3300049580 Bacteria 803
1514 Ga0501046_0582015 3300049580 Bacteria 796
1515 Ga0501046_0785694 3300049580 Bacteria 668
1516 Ga0501046_0816961 3300049580 Bacteria 653
1517 Ga0501046_0848904 3300049580 Unclassified 638
1518 Ga0501046_1101243 3300049580 Bacteria 549
1519 Ga0501046_1248722 3300049580 Unclassified 509
1520 Ga0501047_1036497 3300049581 Bacteria 634
1521 Ga0501048_0003897 3300049582 Bacteria 11348
1522 Ga0501048_0007913 3300049582 Bacteria 8049
1523 Ga0501048_0053010 3300049582 Bacteria 2886
1524 Ga0501048_0062120 3300049582 Bacteria 2644
1525 Ga0501048_0085877 3300049582 Bacteria 2219
1526 Ga0501048_0177340 3300049582 Bacteria 1510
1527 Ga0501048_0208110 3300049582 Bacteria 1387
1528 Ga0501048_0257844 3300049582 Bacteria 1239
1529 Ga0501048_0424817 3300049582 Unclassified 951
1530 Ga0501048_0493861 3300049582 Bacteria 877
1531 Ga0501048_0654607 3300049582 Bacteria 754
1532 Ga0501048_0656449 3300049582 Bacteria 753
1533 Ga0501067_0002376 3300049583 Bacteria 10423
1534 Ga0501067_0015889 3300049583 Bacteria 4163
1535 Ga0501067_0018518 3300049583 Bacteria 3857
1536 Ga0501067_0040939 3300049583 Bacteria 2573
1537 Ga0501067_0042359 3300049583 Bacteria 2528
1538 Ga0501067_0057163 3300049583 Bacteria 2161
1539 Ga0501067_0321722 3300049583 Bacteria 861
1540 Ga0501067_0604248 3300049583 Bacteria 615
1541 Ga0501067_0618754 3300049583 Bacteria 607
1542 Ga0501067_0735936 3300049583 Bacteria 555
1543 Ga0501067_0887177 3300049583 Unclassified 503
1544 Ga0501068_0044773 3300049584 Bacteria 2665
1545 Ga0501068_0100258 3300049584 Bacteria 1794
1546 Ga0501068_0105140 3300049584 Bacteria 1752
1547 Ga0501068_0150568 3300049584 Bacteria 1462
1548 Ga0501068_0158788 3300049584 Bacteria 1425
1549 Ga0501068_0186950 3300049584 Bacteria 1311
1550 Ga0501068_0256123 3300049584 Bacteria 1116
1551 Ga0501068_0323281 3300049584 Bacteria 989
1552 Ga0501068_0548821 3300049584 Bacteria 751
1553 Ga0501068_0552440 3300049584 Unclassified 749
1554 Ga0501068_0591741 3300049584 Bacteria 722
1555 Ga0501068_0664022 3300049584 Bacteria 681
1556 Ga0501068_0690951 3300049584 Bacteria 667
1557 Ga0501068_0760934 3300049584 Bacteria 634
1558 Ga0501068_0897607 3300049584 Bacteria 583
1559 Ga0501068_0946175 3300049584 Unclassified 567
1560 Ga0501068_1054087 3300049584 Unclassified 537
1561 Ga0501068_1178114 3300049584 Unclassified 507
1562 Ga0501069_0015225 3300049585 Bacteria 4121
1563 Ga0501069_0023610 3300049585 Bacteria 3354
1564 Ga0501069_0051657 3300049585 Bacteria 2288
1565 Ga0501069_0057124 3300049585 Bacteria 2175
1566 Ga0501069_0103032 3300049585 Bacteria 1621
1567 Ga0501069_0176301 3300049585 Bacteria 1235
1568 Ga0501069_0228030 3300049585 Bacteria 1084
1569 Ga0501069_0267535 3300049585 Bacteria 999
1570 Ga0501069_0287695 3300049585 Bacteria 962
1571 Ga0501069_0334928 3300049585 Bacteria 891
1572 Ga0501069_0377333 3300049585 Bacteria 837
1573 Ga0501069_0507973 3300049585 Bacteria 719
1574 Ga0501069_0516246 3300049585 Bacteria 713
1575 Ga0501069_0637205 3300049585 Unclassified 641
1576 Ga0501069_0782120 3300049585 Unclassified 578
1577 Ga0501069_0891741 3300049585 Unclassified 541
1578 Ga0501070_0094653 3300049586 Bacteria 2472
1579 Ga0501070_0119176 3300049586 Bacteria 2181
1580 Ga0501070_0197073 3300049586 Bacteria 1654
1581 Ga0501070_0239964 3300049586 Bacteria 1484
1582 Ga0501070_0295221 3300049586 Bacteria 1321
1583 Ga0501070_0313319 3300049586 Bacteria 1277
1584 Ga0501070_0330290 3300049586 Bacteria 1239
1585 Ga0501070_0534940 3300049586 Bacteria 939
1586 Ga0501070_0774430 3300049586 Unclassified 755
1587 Ga0501071_0025969 3300049587 Bacteria 4107
1588 Ga0501071_0032156 3300049587 Bacteria 3724
1589 Ga0501071_0061570 3300049587 Bacteria 2718
1590 Ga0501071_0071528 3300049587 Bacteria 2529
1591 Ga0501071_0074246 3300049587 Bacteria 2482
1592 Ga0501071_0084124 3300049587 Bacteria 2331
1593 Ga0501071_0096538 3300049587 Bacteria 2175
1594 Ga0501071_0097601 3300049587 Bacteria 2163
1595 Ga0501071_0110728 3300049587 Bacteria 2029
1596 Ga0501071_0135986 3300049587 Bacteria 1829
1597 Ga0501071_0178641 3300049587 Bacteria 1590
1598 Ga0501071_0234260 3300049587 Bacteria 1384
1599 Ga0501071_0273972 3300049587 Bacteria 1276
1600 Ga0501071_0315385 3300049587 Bacteria 1187
1601 Ga0501071_0325275 3300049587 Bacteria 1168
1602 Ga0501071_0385909 3300049587 Unclassified 1068
1603 Ga0501071_0760151 3300049587 Bacteria 747
1604 Ga0501071_0792823 3300049587 Bacteria 730
1605 Ga0501071_0816222 3300049587 Bacteria 719
1606 Ga0501071_0911728 3300049587 Unclassified 678
1607 Ga0501071_0997521 3300049587 Bacteria 647
1608 Ga0501071_1144003 3300049587 Bacteria 601
1609 Ga0501071_1439705 3300049587 Bacteria 532
1610 Ga0501072_0000437 3300049588 Bacteria 29805
1611 Ga0501072_0005183 3300049588 Bacteria 9914
1612 Ga0501072_0011886 3300049588 Bacteria 6650
1613 Ga0501072_0109974 3300049588 Bacteria 2193
1614 Ga0501072_0119150 3300049588 Unclassified 2103
1615 Ga0501072_0158653 3300049588 Bacteria 1804
1616 Ga0501072_0238987 3300049588 Unclassified 1447
1617 Ga0501072_0241072 3300049588 Bacteria 1440
1618 Ga0501072_0278639 3300049588 Unclassified 1330
1619 Ga0501072_0311022 3300049588 Bacteria 1252
1620 Ga0501072_0409638 3300049588 Bacteria 1075
1621 Ga0501072_0417147 3300049588 Unclassified 1064
1622 Ga0501072_0560569 3300049588 Bacteria 902
1623 Ga0501072_0608706 3300049588 Bacteria 861
1624 Ga0501072_0693460 3300049588 Bacteria 800
1625 Ga0501072_0721507 3300049588 Bacteria 783
1626 Ga0501072_0743819 3300049588 Bacteria 769
1627 Ga0501072_1300996 3300049588 Unclassified 563
1628 Ga0501072_1353949 3300049588 Unclassified 551
1629 Ga0501073_0039206 3300049589 Bacteria 3357
1630 Ga0501073_0225324 3300049589 Bacteria 1295
1631 Ga0501073_0565986 3300049589 Unclassified 785
1632 Ga0501073_0594809 3300049589 Bacteria 764
1633 Ga0501074_0001061 3300049590 Bacteria 17939
1634 Ga0501074_0037946 3300049590 Bacteria 3492
1635 Ga0501074_0074564 3300049590 Bacteria 2436
1636 Ga0501074_0076197 3300049590 Bacteria 2408
1637 Ga0501074_0206286 3300049590 Bacteria 1400
1638 Ga0501074_0286728 3300049590 Bacteria 1170
1639 Ga0501074_0414330 3300049590 Bacteria 955
1640 Ga0501074_0552389 3300049590 Bacteria 815
1641 Ga0501074_1206184 3300049590 Unclassified 531
1642 Ga0501074_1255500 3300049590 Bacteria 519
1643 Ga0501075_0003857 3300049591 Bacteria 10096
1644 Ga0501075_0011422 3300049591 Bacteria 6285
1645 Ga0501075_0014585 3300049591 Bacteria 5632
1646 Ga0501075_0053228 3300049591 Bacteria 3044
1647 Ga0501075_0084133 3300049591 Bacteria 2409
1648 Ga0501075_0088098 3300049591 Bacteria 2353
1649 Ga0501075_0091790 3300049591 Bacteria 2304
1650 Ga0501075_0127758 3300049591 Bacteria 1935
1651 Ga0501075_0130339 3300049591 Bacteria 1916
1652 Ga0501075_0136394 3300049591 Bacteria 1869
1653 Ga0501075_0202847 3300049591 Bacteria 1512
1654 Ga0501075_0286777 3300049591 Bacteria 1254
1655 Ga0501075_0335138 3300049591 Bacteria 1153
1656 Ga0501075_0388563 3300049591 Bacteria 1064
1657 Ga0501075_0415699 3300049591 Bacteria 1025
1658 Ga0501075_0425702 3300049591 Bacteria 1012
1659 Ga0501075_0478295 3300049591 Bacteria 950
1660 Ga0501075_0493142 3300049591 Unclassified 934
1661 Ga0501075_0691606 3300049591 Bacteria 777
1662 Ga0501075_0989658 3300049591 Bacteria 639
1663 Ga0501075_1026386 3300049591 Bacteria 626
1664 Ga0501075_1098487 3300049591 Unclassified 604
1665 Ga0501075_1536708 3300049591 Bacteria 504
1666 Ga0501076_0001398 3300049592 Bacteria 16173
1667 Ga0501076_0003862 3300049592 Bacteria 10551
1668 Ga0501076_0028008 3300049592 Bacteria 4371
1669 Ga0501076_0043843 3300049592 Bacteria 3527
1670 Ga0501076_0091904 3300049592 Bacteria 2441
1671 Ga0501076_0097393 3300049592 Bacteria 2369
1672 Ga0501076_0117706 3300049592 Bacteria 2150
1673 Ga0501076_0187239 3300049592 Bacteria 1688
1674 Ga0501076_0190739 3300049592 Bacteria 1672
1675 Ga0501076_0213819 3300049592 Bacteria 1576
1676 Ga0501076_0238627 3300049592 Bacteria 1487
1677 Ga0501076_0254664 3300049592 Bacteria 1437
1678 Ga0501076_0391969 3300049592 Bacteria 1142
1679 Ga0501076_0436814 3300049592 Bacteria 1077
1680 Ga0501076_0549611 3300049592 Bacteria 952
1681 Ga0501076_0559682 3300049592 Bacteria 943
1682 Ga0501076_0580531 3300049592 Unclassified 924
1683 Ga0501076_0622270 3300049592 Bacteria 891
1684 Ga0501076_0723537 3300049592 Bacteria 821
1685 Ga0501076_0850520 3300049592 Bacteria 752
1686 Ga0501076_0982302 3300049592 Bacteria 696
1687 Ga0501076_1032744 3300049592 Bacteria 677
1688 Ga0501076_1294096 3300049592 Bacteria 600
1689 Ga0501077_0024287 3300049593 Bacteria 3849
1690 Ga0501077_0027866 3300049593 Bacteria 3588
1691 Ga0501077_0066762 3300049593 Bacteria 2281
1692 Ga0501077_0072804 3300049593 Bacteria 2177
1693 Ga0501077_0084839 3300049593 Bacteria 2007
1694 Ga0501077_0191444 3300049593 Bacteria 1299
1695 Ga0501077_0191667 3300049593 Bacteria 1299
1696 Ga0501077_0357930 3300049593 Bacteria 932
1697 Ga0501077_0464244 3300049593 Bacteria 811
1698 Ga0501077_0496923 3300049593 Bacteria 782
1699 Ga0501077_0524315 3300049593 Unclassified 760
1700 Ga0501077_0629249 3300049593 Bacteria 689
1701 Ga0501198_105907 3300049649 Unclassified 576
1702 Ga0501223_087443 3300049663 Unclassified 630
1703 Ga0501243_040415 3300049675 Unclassified 818
1704 Ga0501260_014220 3300049689 Unclassified 824
1705 Ga0501079_0022984 3300049741 Bacteria 4788
1706 Ga0501079_0036063 3300049741 Bacteria 3808
1707 Ga0501079_0042623 3300049741 Bacteria 3504
1708 Ga0501079_0060914 3300049741 Bacteria 2911
1709 Ga0501079_0083643 3300049741 Bacteria 2469
1710 Ga0501079_0090958 3300049741 Bacteria 2364
1711 Ga0501079_0092851 3300049741 Bacteria 2338
1712 Ga0501079_0117259 3300049741 Bacteria 2070
1713 Ga0501079_0122040 3300049741 Bacteria 2026
1714 Ga0501079_0129453 3300049741 Bacteria 1964
1715 Ga0501079_0131447 3300049741 Bacteria 1948
1716 Ga0501079_0176593 3300049741 Unclassified 1666
1717 Ga0501079_0316570 3300049741 Bacteria 1221
1718 Ga0501079_0506000 3300049741 Bacteria 950
1719 Ga0501079_0549171 3300049741 Bacteria 908
1720 Ga0501079_0828897 3300049741 Bacteria 728
1721 Ga0501079_0856395 3300049741 Bacteria 716
1722 Ga0501079_0870511 3300049741 Bacteria 709
1723 Ga0501079_1053826 3300049741 Unclassified 641
1724 Ga0501079_1287664 3300049741 Bacteria 576
1725 Ga0501079_1499782 3300049741 Bacteria 530
1726 Ga0501079_1672896 3300049741 Bacteria 500
1727 Ga0501080_0082955 3300049742 Bacteria 2978
1728 Ga0501080_0118354 3300049742 Bacteria 2456
1729 Ga0501080_0137408 3300049742 Bacteria 2261
1730 Ga0501080_0141743 3300049742 Bacteria 2222
1731 Ga0501080_0204951 3300049742 Bacteria 1809
1732 Ga0501080_0215385 3300049742 Bacteria 1759
1733 Ga0501080_0263185 3300049742 Bacteria 1571
1734 Ga0501080_0303612 3300049742 Bacteria 1447
1735 Ga0501080_0366277 3300049742 Bacteria 1300
1736 Ga0501080_0370828 3300049742 Bacteria 1291
1737 Ga0501080_0454338 3300049742 Unclassified 1148
1738 Ga0501080_0509000 3300049742 Unclassified 1075
1739 Ga0501080_0718199 3300049742 Bacteria 880
1740 Ga0501080_0725600 3300049742 Bacteria 875
1741 Ga0501080_0846668 3300049742 Bacteria 800
1742 Ga0501080_1185827 3300049742 Bacteria 657
1743 Ga0501080_1210492 3300049742 Bacteria 649
1744 Ga0501080_1876977 3300049742 Bacteria 502
1745 Ga0501081_0016457 3300049743 Bacteria 4888
1746 Ga0501081_0142391 3300049743 Bacteria 1719
1747 Ga0501081_0155041 3300049743 Bacteria 1647
1748 Ga0501081_0170681 3300049743 Bacteria 1570
1749 Ga0501081_0249528 3300049743 Bacteria 1295
1750 Ga0501081_0297096 3300049743 Bacteria 1184
1751 Ga0501081_0667224 3300049743 Unclassified 780
1752 Ga0501081_0686359 3300049743 Bacteria 768
1753 Ga0501081_0763920 3300049743 Unclassified 727
1754 Ga0501081_0895763 3300049743 Unclassified 669
1755 Ga0501081_0920674 3300049743 Unclassified 659
1756 Ga0501081_1157529 3300049743 Bacteria 586
1757 Ga0501081_1272335 3300049743 Bacteria 558
1758 Ga0501083_0053070 3300049744 Bacteria 2722
1759 Ga0501083_0078076 3300049744 Bacteria 2196
1760 Ga0501083_0118752 3300049744 Bacteria 1735
1761 Ga0501083_0154686 3300049744 Bacteria 1501
1762 Ga0501083_0205794 3300049744 Bacteria 1283
1763 Ga0501083_0279347 3300049744 Bacteria 1086
1764 Ga0501083_0295243 3300049744 Bacteria 1054
1765 Ga0501083_0477061 3300049744 Bacteria 812
1766 Ga0501083_0842426 3300049744 Bacteria 597
1767 Ga0501083_0933222 3300049744 Bacteria 565
1768 Ga0501035_0045835 3300049822 Bacteria 3933
1769 Ga0501035_0112687 3300049822 Bacteria 2383
1770 Ga0501035_0171526 3300049822 Bacteria 1874
1771 Ga0501035_0406484 3300049822 Bacteria 1132
1772 Ga0501035_0734785 3300049822 Bacteria 793
1773 Ga0501035_0782708 3300049822 Bacteria 763
1774 Ga0501035_0918484 3300049822 Bacteria 692
1775 Ga0501035_1155185 3300049822 Unclassified 602
1776 Ga0501044_0464827 3300049823 Bacteria 1170
1777 Ga0501044_0721776 3300049823 Bacteria 881
1778 Ga0501044_1091117 3300049823 Bacteria 668
1779 Ga0501044_1389846 3300049823 Bacteria 568
1780 Ga0501045_0011292 3300049824 Bacteria 6269
1781 Ga0501045_0032348 3300049824 Bacteria 3790
1782 Ga0501045_0070606 3300049824 Bacteria 2569
1783 Ga0501045_0093138 3300049824 Bacteria 2228
1784 Ga0501045_0130841 3300049824 Bacteria 1865
1785 Ga0501045_0150694 3300049824 Unclassified 1730
1786 Ga0501045_0269582 3300049824 Bacteria 1267
1787 Ga0501045_0287594 3300049824 Bacteria 1223
1788 Ga0501045_0308448 3300049824 Bacteria 1178
1789 Ga0501045_0350042 3300049824 Bacteria 1100
1790 Ga0501045_0353609 3300049824 Bacteria 1093
1791 Ga0501045_0432891 3300049824 Unclassified 978
1792 Ga0501045_0435086 3300049824 Bacteria 975
1793 Ga0501045_0437909 3300049824 Bacteria 972
1794 Ga0501045_0545902 3300049824 Bacteria 860
1795 Ga0501045_1183592 3300049824 Bacteria 558
1796 Ga0501045_1237859 3300049824 Unclassified 544
1797 Ga0501045_1340410 3300049824 Bacteria 520
1798 Ga0501045_1398607 3300049824 Unclassified 508
1799 nmdc:mga00v17_756233_c1 3300050491 Unclassified 621
1800 nmdc:mga0yw44_162717_c1 3300050492 Bacteria 1462
1801 nmdc:mga0yw44_203319_c1 3300050492 Bacteria 1308
1802 nmdc:mga05p37_137942_c1 3300050507 Bacteria 2989
1803 nmdc:mga05p37_1696832_c1 3300050507 Bacteria 616
1804 nmdc:mga05p37_206361_c1 3300050507 Bacteria 2377
1805 nmdc:mga05p37_218566_c1 3300050507 Bacteria 2301
1806 nmdc:mga05p37_427873_c1 3300050507 Bacteria 1539
1807 nmdc:mga05p37_809123_c1 3300050507 Bacteria 1024
1808 nmdc:mga09592_32328_c1 3300050508 Bacteria 4362
1809 nmdc:mga09592_693781_c1 3300050508 Bacteria 867
1810 nmdc:mga06r32_255982_c1 3300050510 Bacteria 1738
1811 nmdc:mga06r32_26536_c1 3300050510 Bacteria 5402
1812 nmdc:mga08y16_1473091_c1 3300050511 Bacteria 642
1813 nmdc:mga08y16_369004_c1 3300050511 Bacteria 1473
1814 nmdc:mga08y16_45737_c1 3300050511 Bacteria 4585
1815 nmdc:mga08y16_671683_c1 3300050511 Bacteria 1038
1816 nmdc:mga08y16_684122_c1 3300050511 Bacteria 1027
1817 nmdc:mga08y16_7967_c1 3300050511 Bacteria 11085
1818 nmdc:mga0n895_1368455_c1 3300050512 Bacteria 677
1819 nmdc:mga0n895_145610_c1 3300050512 Bacteria 2398
1820 nmdc:mga0n895_322131_c1 3300050512 Unclassified 1566
1821 nmdc:mga0n895_435191_c1 3300050512 Bacteria 1325
1822 nmdc:mga0n895_45163_c1 3300050512 Bacteria 4298
1823 nmdc:mga0n895_481304_c1 3300050512 Bacteria 1252
1824 nmdc:mga0n895_61337_c1 3300050512 Bacteria 3712
1825 nmdc:mga0rr50_132060_c1 3300050513 Bacteria 2000
1826 nmdc:mga0rr50_152448_c1 3300050513 Bacteria 1869
1827 nmdc:mga0rr50_1741363_c1 3300050513 Bacteria 525
1828 nmdc:mga0rr50_223816_c1 3300050513 Bacteria 1554
1829 nmdc:mga0rr50_588014_c1 3300050513 Bacteria 949
1830 nmdc:mga0rr50_824311_c1 3300050513 Bacteria 791
1831 nmdc:mga08x19_1157621_c1 3300050514 Bacteria 548
1832 nmdc:mga08x19_59687_c1 3300050514 Bacteria 2469
1833 nmdc:mga08x19_856324_c1 3300050514 Bacteria 646
1834 nmdc:mga0a205_17661_c1 3300050515 Bacteria 6696
1835 nmdc:mga0a205_183263_c1 3300050515 Bacteria 1987
1836 nmdc:mga0a205_32474_c1 3300050515 Bacteria 5005
1837 nmdc:mga0a205_45211_c1 3300050515 Bacteria 4245
1838 nmdc:mga0a205_615392_c1 3300050515 Bacteria 939
1839 Ga0495601_0013066 3300053077 Bacteria 4990
1840 Ga0495601_0310488 3300053077 Bacteria 1027
1841 Ga0495612_0009618 3300053078 Bacteria 3915
1842 Ga0495612_0215187 3300053078 Unclassified 850
1843 Ga0495612_0251063 3300053078 Bacteria 787
1844 Ga0495655_0240715 3300053083 Bacteria 605
1845 Ga0495655_0304379 3300053083 Unclassified 548
1846 Ga0495655_0328219 3300053083 Bacteria 531
1847 Ga0495595_0006326 3300053084 Bacteria 4822
1848 Ga0495595_0125960 3300053084 Bacteria 1250
1849 Ga0495595_0363802 3300053084 Bacteria 731
1850 Ga0495595_0518344 3300053084 Unclassified 608
1851 Ga0495595_0572719 3300053084 Bacteria 577
1852 Ga0495595_0729402 3300053084 Bacteria 508
1853 Ga0495619_0009224 3300053085 Bacteria 6235
1854 Ga0495619_0040503 3300053085 Bacteria 3046
1855 Ga0495619_0105251 3300053085 Bacteria 1924
1856 Ga0495619_0615790 3300053085 Bacteria 742
1857 Ga0500628_065249 3300053129 Bacteria 899
1858 Ga0501084_0002352 3300054114 Bacteria 15204
1859 Ga0501084_0008414 3300054114 Bacteria 8524
1860 Ga0501084_0029226 3300054114 Bacteria 4611
1861 Ga0501084_0058153 3300054114 Bacteria 3235
1862 Ga0501084_0067722 3300054114 Bacteria 2988
1863 Ga0501084_0073590 3300054114 Bacteria 2861
1864 Ga0501084_0085950 3300054114 Bacteria 2641
1865 Ga0501084_0144920 3300054114 Bacteria 2000
1866 Ga0501084_0147250 3300054114 Bacteria 1984
1867 Ga0501084_0177193 3300054114 Bacteria 1799
1868 Ga0501084_0434011 3300054114 Bacteria 1110
1869 Ga0501084_0612321 3300054114 Bacteria 920
1870 Ga0501084_0671815 3300054114 Bacteria 874
1871 Ga0501084_0701771 3300054114 Bacteria 853
1872 Ga0501084_1042788 3300054114 Bacteria 687
1873 Ga0501084_1063353 3300054114 Bacteria 680
1874 Ga0501084_1211216 3300054114 Bacteria 633
1875 Ga0501084_1384351 3300054114 Bacteria 589
1876 Ga0501084_1448730 3300054114 Bacteria 575
1877 Ga0501084_1467572 3300054114 Bacteria 571
1878 Ga0501084_1495449 3300054114 Bacteria 565
1879 Ga0501084_1606196 3300054114 Unclassified 544
1880 Ga0590071_009569 3300059421 Bacteria 2275
1881 Ga0590074_007118 3300059423 Bacteria 1858
1882 Ga0590075_004206 3300059424 Bacteria 3408
1883 Ga0590075_011136 3300059424 Bacteria 2171
1884 Ga0590075_014674 3300059424 Bacteria 1917
1885 Ga0590077_002835 3300059426 Bacteria 3647
1886 Ga0590077_075987 3300059426 Bacteria 770
1887 Ga0590077_134248 3300059426 Bacteria 588
1888 Ga0587085_075719 3300059506 Bacteria 667
1889 Ga0501082_0013626 3300060353 Bacteria 6988
1890 Ga0501082_0038308 3300060353 Bacteria 4135
1891 Ga0501082_0053143 3300060353 Bacteria 3492
1892 Ga0501082_0064598 3300060353 Bacteria 3152
1893 Ga0501082_0095723 3300060353 Bacteria 2566
1894 Ga0501082_0122597 3300060353 Bacteria 2254
1895 Ga0501082_0278413 3300060353 Bacteria 1456
1896 Ga0501082_0288877 3300060353 Bacteria 1428
1897 Ga0501082_0400675 3300060353 Bacteria 1198
1898 Ga0501082_0418578 3300060353 Bacteria 1170
1899 Ga0501082_0469968 3300060353 Bacteria 1099
1900 Ga0501082_0681820 3300060353 Unclassified 899
1901 Ga0501082_0685527 3300060353 Bacteria 897
1902 Ga0501082_0699327 3300060353 Bacteria 887
1903 Ga0501082_0894705 3300060353 Bacteria 776
1904 Ga0501082_1047825 3300060353 Bacteria 713
1905 Ga0501082_1225731 3300060353 Unclassified 656
1906 Ga0501082_1417345 3300060353 Bacteria 607
1907 Ga0501082_1651616 3300060353 Bacteria 559
1908 Ga0530510_0016975 3300061734 Bacteria 5155
1909 Ga0530510_0023755 3300061734 Bacteria 4370
1910 Ga0530510_0032351 3300061734 Bacteria 3763
1911 Ga0530510_0057289 3300061734 Bacteria 2815
1912 Ga0530510_0060175 3300061734 Bacteria 2748
1913 Ga0530510_0075843 3300061734 Bacteria 2442
1914 Ga0530510_0103570 3300061734 Bacteria 2081
1915 Ga0530510_0121939 3300061734 Bacteria 1914
1916 Ga0530510_0301100 3300061734 Bacteria 1200
1917 Ga0530510_0304230 3300061734 Bacteria 1193
1918 Ga0530510_0317819 3300061734 Bacteria 1167
1919 Ga0530510_0404861 3300061734 Unclassified 1029
1920 Ga0530510_0412580 3300061734 Unclassified 1019
1921 Ga0530510_0422319 3300061734 Bacteria 1006
1922 Ga0530510_0478230 3300061734 Unclassified 943
1923 Ga0530510_0557885 3300061734 Bacteria 870
1924 Ga0530510_0605703 3300061734 Bacteria 833
1925 Ga0530510_0873038 3300061734 Bacteria 687
1926 Ga0530510_1064477 3300061734 Bacteria 619

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004803 Ga0058862_12329089 Ga0058862_123290892 62
2 3300005327 Ga0070658_11374872 Ga0070658_113748722 62
3 3300005331 Ga0070670_101293133 Ga0070670_1012931331 62
4 3300005340 Ga0070689_100788858 Ga0070689_1007888582 62
5 3300005366 Ga0070659_101325401 Ga0070659_1013254012 62
6 3300005366 Ga0070659_101803197 Ga0070659_1018031972 62
7 3300005438 Ga0070701_10046039 Ga0070701_100460393 62
8 3300005441 Ga0070700_101604697 Ga0070700_1016046972 62
9 3300005456 Ga0070678_101953077 Ga0070678_1019530772 62
10 3300005471 Ga0070698_100024476 Ga0070698_1000244764 62
11 3300005518 Ga0070699_100509395 Ga0070699_1005093952 62
12 3300005543 Ga0070672_100519311 Ga0070672_1005193112 62
13 3300005564 Ga0070664_100635116 Ga0070664_1006351162 62
14 3300005616 Ga0068852_100348209 Ga0068852_1003482092 62
15 3300005618 Ga0068864_100400856 Ga0068864_1004008562 62
16 3300005618 Ga0068864_101192382 Ga0068864_1011923822 62
17 3300005841 Ga0068863_101904125 Ga0068863_1019041251 62
18 3300005842 Ga0068858_101036260 Ga0068858_1010362602 62
19 3300006237 Ga0097621_101146956 Ga0097621_1011469562 62
20 3300006237 Ga0097621_102281406 Ga0097621_1022814062 62
21 3300006358 Ga0068871_100966053 Ga0068871_1009660532 62
22 3300006844 Ga0075428_100000397 Ga0075428_10000039723 62
23 3300006871 Ga0075434_101220481 Ga0075434_1012204812 62
24 3300006881 Ga0068865_100362014 Ga0068865_1003620142 62
25 3300006881 Ga0068865_100438199 Ga0068865_1004381992 62
26 3300009094 Ga0111539_10361448 Ga0111539_103614482 62
27 3300009094 Ga0111539_10678260 Ga0111539_106782602 62
28 3300009094 Ga0111539_11777190 Ga0111539_117771902 62
29 3300009098 Ga0105245_10486988 Ga0105245_104869882 62
30 3300009098 Ga0105245_11931021 Ga0105245_119310212 62
31 3300009098 Ga0105245_12590377 Ga0105245_125903772 62
32 3300009101 Ga0105247_10499352 Ga0105247_104993522 62
33 3300009147 Ga0114129_10007192 Ga0114129_100071929 62
34 3300009147 Ga0114129_10058678 Ga0114129_100586784 62
35 3300009147 Ga0114129_10286536 Ga0114129_102865363 62
36 3300009147 Ga0114129_12869026 Ga0114129_128690261 62
37 3300009148 Ga0105243_11084116 Ga0105243_110841162 62
38 3300009148 Ga0105243_11575705 Ga0105243_115757052 62
39 3300009174 Ga0105241_11377533 Ga0105241_113775332 62
40 3300009176 Ga0105242_11351432 Ga0105242_113514321 62
41 3300009176 Ga0105242_12212508 Ga0105242_122125082 62
42 3300009177 Ga0105248_11843845 Ga0105248_118438452 62
43 3300009177 Ga0105248_12267679 Ga0105248_122676792 62
44 3300009553 Ga0105249_10544388 Ga0105249_105443882 62
45 3300010159 Ga0099796_10381614 Ga0099796_103816142 62
46 3300010159 Ga0099796_10467943 Ga0099796_104679432 62
47 3300010375 Ga0105239_10499136 Ga0105239_104991362 62
48 3300010375 Ga0105239_10531217 Ga0105239_105312172 62
49 3300011119 Ga0105246_10241499 Ga0105246_102414992 62
50 3300011119 Ga0105246_10791948 Ga0105246_107919482 62
51 3300012515 Ga0157338_1059051 Ga0157338_10590511 62
52 3300013104 Ga0157370_10641903 Ga0157370_106419032 62
53 3300013296 Ga0157374_10708927 Ga0157374_107089272 62
54 3300013306 Ga0163162_10562789 Ga0163162_105627892 62
55 3300013306 Ga0163162_10897342 Ga0163162_108973422 62
56 3300013307 Ga0157372_12063404 Ga0157372_120634042 62
57 3300013308 Ga0157375_10079370 Ga0157375_100793703 62
58 3300013308 Ga0157375_10355615 Ga0157375_103556152 62
59 3300013308 Ga0157375_11174100 Ga0157375_111741001 62
60 3300014325 Ga0163163_10181577 Ga0163163_101815773 62
61 3300014325 Ga0163163_10248887 Ga0163163_102488872 62
62 3300014325 Ga0163163_11002684 Ga0163163_110026842 62
63 3300014326 Ga0157380_10279189 Ga0157380_102791893 62
64 3300014326 Ga0157380_10710577 Ga0157380_107105772 62
65 3300014745 Ga0157377_10215288 Ga0157377_102152882 62
66 3300014745 Ga0157377_10861238 Ga0157377_108612382 62
67 3300014968 Ga0157379_10363339 Ga0157379_103633393 62
68 3300014968 Ga0157379_10407697 Ga0157379_104076972 62
69 3300014968 Ga0157379_11698222 Ga0157379_116982222 62
70 3300014969 Ga0157376_10182110 Ga0157376_101821103 62
71 3300014969 Ga0157376_11363011 Ga0157376_113630112 62
72 3300014969 Ga0157376_12823968 Ga0157376_128239682 62
73 3300017792 Ga0163161_11450552 Ga0163161_114505522 62
74 3300020081 Ga0206354_11126683 Ga0206354_111266832 62
75 3300025900 Ga0207710_10580795 Ga0207710_105807952 62
76 3300025907 Ga0207645_10155934 Ga0207645_101559342 62
77 3300025910 Ga0207684_11336504 Ga0207684_113365042 62
78 3300025919 Ga0207657_10473825 Ga0207657_104738252 62
79 3300025926 Ga0207659_10483970 Ga0207659_104839703 62
80 3300025932 Ga0207690_10718989 Ga0207690_107189892 62
81 3300025934 Ga0207686_11200841 Ga0207686_112008412 62
82 3300025936 Ga0207670_11070278 Ga0207670_110702782 62
83 3300025937 Ga0207669_10287420 Ga0207669_102874202 62
84 3300025937 Ga0207669_10956761 Ga0207669_109567611 62
85 3300025938 Ga0207704_10691244 Ga0207704_106912442 62
86 3300025939 Ga0207665_11362947 Ga0207665_113629472 62
87 3300025940 Ga0207691_10196907 Ga0207691_101969072 62
88 3300025944 Ga0207661_12081753 Ga0207661_120817532 62
89 3300025972 Ga0207668_10483680 Ga0207668_104836802 62
90 3300026023 Ga0207677_11627143 Ga0207677_116271432 62
91 3300026035 Ga0207703_10581378 Ga0207703_105813782 62
92 3300026041 Ga0207639_11515093 Ga0207639_115150932 62
93 3300026089 Ga0207648_11190843 Ga0207648_111908432 62
94 3300026095 Ga0207676_10221058 Ga0207676_102210583 62
95 3300026116 Ga0207674_10436527 Ga0207674_104365273 62
96 3300026118 Ga0207675_100889820 Ga0207675_1008898201 62
97 3300026121 Ga0207683_11153033 Ga0207683_111530332 62
98 3300026142 Ga0207698_10263182 Ga0207698_102631823 62
99 3300028563 Ga0265319_1019649 Ga0265319_10196494 62
100 3300028573 Ga0265334_10040406 Ga0265334_100404062 62
101 3300028577 Ga0265318_10057630 Ga0265318_100576302 62
102 3300028666 Ga0265336_10030284 Ga0265336_100302843 62
103 3300028800 Ga0265338_10037167 Ga0265338_100371673 62
104 3300029957 Ga0265324_10003872 Ga0265324_100038728 62
105 3300031235 Ga0265330_10022068 Ga0265330_100220683 62
106 3300031238 Ga0265332_10028840 Ga0265332_100288403 62
107 3300031241 Ga0265325_10040458 Ga0265325_100404584 62
108 3300031242 Ga0265329_10073575 Ga0265329_100735752 62
109 3300031247 Ga0265340_10055616 Ga0265340_100556163 62
110 3300031249 Ga0265339_10090894 Ga0265339_100908943 62
111 3300031250 Ga0265331_10022450 Ga0265331_100224503 62
112 3300031344 Ga0265316_10135754 Ga0265316_101357542 62
113 3300031344 Ga0265316_10207773 Ga0265316_102077733 62
114 3300031595 Ga0265313_10291643 Ga0265313_102916431 62
115 3300031711 Ga0265314_10038570 Ga0265314_100385703 62
116 3300031712 Ga0265342_10045743 Ga0265342_100457432 62
117 3300032133 Ga0316583_10017771 Ga0316583_100177713 62
118 3300035086 Ga0373934_0443842 Ga0373934_0443842_275_463 62
119 3300035117 Ga0373953_0246740 Ga0373953_0246740_378_566 62
120 3300035120 Ga0373957_0536703 Ga0373957_0536703_30_218 62
121 3300035170 Ga0373943_0812928 Ga0373943_0812928_333_521 62
122 3300035242 Ga0373962_0229904 Ga0373962_0229904_79_270 62
123 3300035398 Ga0316574_0116624 Ga0316574_0116624_862_1050 62
124 3300035398 Ga0316574_0413048 Ga0316574_0413048_461_649 62
125 3300035724 Ga0373933_0913335 Ga0373933_0913335_239_427 62
126 3300036401 Ga0373937_0636915 Ga0373937_0636915_90_278 62
127 3300036401 Ga0373937_1655445 Ga0373937_1655445_333_521 62
128 3300036647 Ga0316582_0045721 Ga0316582_0045721_137_334 62
129 3300036647 Ga0316582_0149506 Ga0316582_0149506_1275_1463 62
130 3300036712 Ga0316584_0043994 Ga0316584_0043994_1237_1431 62
131 3300037068 Ga0373925_0526089 Ga0373925_0526089_755_943 62
132 3300037588 Ga0316581_0015892 Ga0316581_0015892_1016_1213 62
133 3300041405 Ga0439438_042646 Ga0439438_042646_220_408 62
134 3300041405 Ga0439438_168651 Ga0439438_168651_199_399 62
135 3300041408 Ga0439453_0111316 Ga0439453_0111316_73_261 62
136 3300041410 Ga0439461_0016605 Ga0439461_0016605_728_916 62
137 3300041410 Ga0439461_0037789 Ga0439461_0037789_359_556 62
138 3300041411 Ga0439466_0193323 Ga0439466_0193323_284_472 62
139 3300041413 Ga0439465_0364320 Ga0439465_0364320_126_314 62
140 3300041441 Ga0451787_248058 Ga0451787_248058_696_884 62
141 3300041459 Ga0451800_1473057 Ga0451800_1473057_702_890 62
142 3300041460 Ga0451802_1055887 Ga0451802_1055887_239_427 62
143 3300041460 Ga0451802_1696685 Ga0451802_1696685_885_1073 62
144 3300041486 Ga0451807_2456411 Ga0451807_2456411_262_450 62
145 3300041491 Ga0451833_0420733 Ga0451833_0420733_145_333 62
146 3300041491 Ga0451833_0610792 Ga0451833_0610792_184_372 62
147 3300041494 Ga0451837_0420354 Ga0451837_0420354_96_284 62
148 3300041494 Ga0451837_1041428 Ga0451837_1041428_185_373 62
149 3300041496 Ga0451839_0804101 Ga0451839_0804101_384_572 62
150 3300041501 Ga0451845_0707372 Ga0451845_0707372_186_374 62
151 3300041503 Ga0451847_0941613 Ga0451847_0941613_53_241 62
152 3300041505 Ga0451849_0077098 Ga0451849_0077098_69_257 62
153 3300041505 Ga0451849_0570943 Ga0451849_0570943_541_729 62
154 3300041509 Ga0451843_1237422 Ga0451843_1237422_305_493 62
155 3300041512 Ga0451853_2943674 Ga0451853_2943674_42_230 62
156 3300041512 Ga0451853_3271353 Ga0451853_3271353_159_347 62
157 3300042015 Ga0439462_0061372 Ga0439462_0061372_567_764 62
158 3300042015 Ga0439462_0210804 Ga0439462_0210804_156_356 62
159 3300042125 Ga0450923_084345 Ga0450923_084345_466_654 62
160 3300042136 Ga0450900_033604 Ga0450900_033604_38_226 62
161 3300042147 Ga0450910_006296 Ga0450910_006296_263_451 62
162 3300042156 Ga0439446_0032741 Ga0439446_0032741_1104_1292 62
163 3300042185 Ga0450909_021360 Ga0450909_021360_645_833 62
164 3300042435 Ga0439434_0175563 Ga0439434_0175563_96_284 62
165 3300042461 Ga0439460_0320562 Ga0439460_0320562_186_374 62
166 3300042531 Ga0450918_094216 Ga0450918_094216_165_353 62
167 3300042876 Ga0451577_1382181 Ga0451577_1382181_64_252 62
168 3300042876 Ga0451577_1844449 Ga0451577_1844449_297_485 62
169 3300044712 Ga0453684_0547544 Ga0453684_0547544_563_751 62
170 3300044712 Ga0453684_0750197 Ga0453684_0750197_129_317 62
171 3300046454 Ga0495592_0603975 Ga0495592_0603975_11_199 62
172 3300046455 Ga0495603_0030574 Ga0495603_0030574_2120_2308 62
173 3300046455 Ga0495603_0290756 Ga0495603_0290756_135_323 62
174 3300046457 Ga0495590_0167223 Ga0495590_0167223_567_755 62
175 3300046459 Ga0495629_0987828 Ga0495629_0987828_206_394 62
176 3300046461 Ga0495641_0263586 Ga0495641_0263586_549_737 62
177 3300046461 Ga0495641_0493018 Ga0495641_0493018_238_426 62
178 3300046462 Ga0495651_0062980 Ga0495651_0062980_2377_2565 62
179 3300046463 Ga0495653_0667592 Ga0495653_0667592_26_214 62
180 3300046473 Ga0495582_0359752 Ga0495582_0359752_219_407 62
181 3300046474 Ga0495605_0215234 Ga0495605_0215234_586_774 62
182 3300046475 Ga0495639_0723097 Ga0495639_0723097_231_419 62
183 3300046476 Ga0495662_0580169 Ga0495662_0580169_171_359 62
184 3300046477 Ga0495664_0501762 Ga0495664_0501762_182_370 62
185 3300046477 Ga0495664_0705753 Ga0495664_0705753_286_474 62
186 3300046491 Ga0495584_0472309 Ga0495584_0472309_138_326 62
187 3300046499 Ga0495594_0400722 Ga0495594_0400722_555_743 62
188 3300046500 Ga0495596_0125815 Ga0495596_0125815_243_431 62
189 3300046501 Ga0495607_0492437 Ga0495607_0492437_138_326 62
190 3300046511 Ga0495608_0099204 Ga0495608_0099204_121_309 62
191 3300046511 Ga0495608_0131279 Ga0495608_0131279_200_388 62
192 3300046516 Ga0495628_0759898 Ga0495628_0759898_122_310 62
193 3300046517 Ga0495630_0512391 Ga0495630_0512391_440_628 62
194 3300046518 Ga0495631_0465044 Ga0495631_0465044_98_286 62
195 3300046525 Ga0495663_0173057 Ga0495663_0173057_207_395 62
196 3300046533 Ga0495640_0683417 Ga0495640_0683417_134_322 62
197 3300046533 Ga0495640_0864391 Ga0495640_0864391_299_487 62
198 3300046535 Ga0495586_0681205 Ga0495586_0681205_80_268 62
199 3300046536 Ga0495587_0262489 Ga0495587_0262489_306_494 62
200 3300046537 Ga0495598_0470922 Ga0495598_0470922_207_395 62
201 3300046538 Ga0495609_0247398 Ga0495609_0247398_453_641 62
202 3300046542 Ga0495597_0203572 Ga0495597_0203572_431_619 62
203 3300046543 Ga0495645_0911431 Ga0495645_0911431_231_419 62
204 3300046559 Ga0495667_0308946 Ga0495667_0308946_206_394 62
205 3300046615 Ga0495656_0387180 Ga0495656_0387180_314_502 62
206 3300046615 Ga0495656_0570822 Ga0495656_0570822_283_471 62
207 3300046664 Ga0495659_0376287 Ga0495659_0376287_64_252 62
208 3300046675 Ga0495657_0663990 Ga0495657_0663990_293_481 62
209 3300046678 Ga0495599_0824804 Ga0495599_0824804_26_214 62
210 3300046681 Ga0495647_0437333 Ga0495647_0437333_392_580 62
211 3300046681 Ga0495647_0531906 Ga0495647_0531906_331_519 62
212 3300046681 Ga0495647_0588590 Ga0495647_0588590_58_246 62
213 3300046689 Ga0495613_0421812 Ga0495613_0421812_172_360 62
214 3300046690 Ga0495624_0703660 Ga0495624_0703660_115_303 62
215 3300046691 Ga0495670_0421466 Ga0495670_0421466_232_420 62
216 3300046810 Ga0495660_0420805 Ga0495660_0420805_60_248 62
217 3300047315 Ga0495581_0494202 Ga0495581_0494202_408_596 62
218 3300047317 Ga0495604_0285617 Ga0495604_0285617_513_701 62
219 3300047319 Ga0495674_0482626 Ga0495674_0482626_299_487 62
220 3300047319 Ga0495674_1439445 Ga0495674_1439445_218_406 62
221 3300047321 Ga0495676_0606598 Ga0495676_0606598_361_549 62
222 3300047321 Ga0495676_0847408 Ga0495676_0847408_385_573 62
223 3300047321 Ga0495676_0937873 Ga0495676_0937873_166_354 62
224 3300047470 Ga0495681_0401662 Ga0495681_0401662_38_226 62
225 3300047673 Ga0495593_0411397 Ga0495593_0411397_80_268 62
226 3300048088 Ga0495602_0422608 Ga0495602_0422608_75_263 62
227 3300048088 Ga0495602_0656994 Ga0495602_0656994_164_352 62
228 3300048089 Ga0495614_0433027 Ga0495614_0433027_354_542 62
229 3300048903 Ga0496100_0586681 Ga0496100_0586681_524_712 62
230 3300048904 Ga0496101_0186961 Ga0496101_0186961_913_1101 62
231 3300048905 Ga0496102_0336701 Ga0496102_0336701_467_655 62
232 3300048905 Ga0496102_1140693 Ga0496102_1140693_428_616 62
233 3300048905 Ga0496102_1666000 Ga0496102_1666000_191_379 62
234 3300048906 Ga0496103_0919847 Ga0496103_0919847_255_443 62
235 3300048907 Ga0496104_0053279 Ga0496104_0053279_1725_1913 62
236 3300048907 Ga0496104_0079942 Ga0496104_0079942_1619_1807 62
237 3300048907 Ga0496104_0178630 Ga0496104_0178630_1624_1812 62
238 3300048908 Ga0496105_0045777 Ga0496105_0045777_1638_1826 62
239 3300048909 Ga0496106_0471763 Ga0496106_0471763_222_410 62
240 3300048910 Ga0496107_0147774 Ga0496107_0147774_773_961 62
241 3300048911 Ga0496108_0077898 Ga0496108_0077898_908_1096 62
242 3300048912 Ga0496109_0150769 Ga0496109_0150769_1791_1979 62
243 3300048912 Ga0496109_0491888 Ga0496109_0491888_391_579 62
244 3300048912 Ga0496109_0509047 Ga0496109_0509047_495_683 62
245 3300048913 Ga0496110_0158680 Ga0496110_0158680_613_801 62
246 3300048914 Ga0496111_0178677 Ga0496111_0178677_1129_1317 62
247 3300048914 Ga0496111_0225613 Ga0496111_0225613_983_1171 62
248 3300048914 Ga0496111_0756485 Ga0496111_0756485_345_533 62
249 3300048915 Ga0496112_0560285 Ga0496112_0560285_168_356 62
250 3300048917 Ga0496114_0190416 Ga0496114_0190416_1200_1388 62
251 3300048917 Ga0496114_0242424 Ga0496114_0242424_165_353 62
252 3300048917 Ga0496114_0277341 Ga0496114_0277341_547_735 62
253 3300048917 Ga0496114_0387392 Ga0496114_0387392_683_871 62
254 3300048917 Ga0496114_0748099 Ga0496114_0748099_422_610 62
255 3300049533 Ga0501317_077447 Ga0501317_077447_152_340 62
256 3300049568 Ga0501031_0016564 Ga0501031_0016564_731_928 62
257 3300049568 Ga0501031_0030027 Ga0501031_0030027_17_205 62
258 3300049568 Ga0501031_0205315 Ga0501031_0205315_722_919 62
259 3300049568 Ga0501031_0341908 Ga0501031_0341908_518_706 62
260 3300049568 Ga0501031_0574112 Ga0501031_0574112_112_309 62
261 3300049568 Ga0501031_0591098 Ga0501031_0591098_250_447 62
262 3300049569 Ga0501032_0314056 Ga0501032_0314056_302_490 62
263 3300049569 Ga0501032_0476361 Ga0501032_0476361_483_680 62
264 3300049569 Ga0501032_0570029 Ga0501032_0570029_165_362 62
265 3300049570 Ga0501033_0092865 Ga0501033_0092865_1527_1715 62
266 3300049570 Ga0501033_0340844 Ga0501033_0340844_641_829 62
267 3300049570 Ga0501033_0899211 Ga0501033_0899211_33_221 62
268 3300049571 Ga0501034_1374343 Ga0501034_1374343_234_431 62
269 3300049572 Ga0501036_0052252 Ga0501036_0052252_459_647 62
270 3300049572 Ga0501036_0519461 Ga0501036_0519461_391_579 62
271 3300049572 Ga0501036_1053253 Ga0501036_1053253_427_615 62
272 3300049572 Ga0501036_1401163 Ga0501036_1401163_15_212 62
273 3300049572 Ga0501036_1460124 Ga0501036_1460124_310_507 62
274 3300049572 Ga0501036_1654059 Ga0501036_1654059_46_234 62
275 3300049572 Ga0501036_1672329 Ga0501036_1672329_76_273 62
276 3300049573 Ga0501037_0309959 Ga0501037_0309959_139_327 62
277 3300049573 Ga0501037_0430918 Ga0501037_0430918_575_772 62
278 3300049574 Ga0501038_0255986 Ga0501038_0255986_592_780 62
279 3300049574 Ga0501038_0552652 Ga0501038_0552652_73_270 62
280 3300049574 Ga0501038_1187728 Ga0501038_1187728_285_482 62
281 3300049575 Ga0501039_0152410 Ga0501039_0152410_448_645 62
282 3300049575 Ga0501039_0668206 Ga0501039_0668206_116_304 62
283 3300049575 Ga0501039_0787521 Ga0501039_0787521_231_428 62
284 3300049576 Ga0501040_0077890 Ga0501040_0077890_880_1068 62
285 3300049576 Ga0501040_0145141 Ga0501040_0145141_1169_1357 62
286 3300049576 Ga0501040_0216763 Ga0501040_0216763_663_860 62
287 3300049576 Ga0501040_0563549 Ga0501040_0563549_145_333 62
288 3300049576 Ga0501040_0889093 Ga0501040_0889093_109_297 62
289 3300049576 Ga0501040_0907739 Ga0501040_0907739_130_327 62
290 3300049577 Ga0501041_0101980 Ga0501041_0101980_1378_1566 62
291 3300049577 Ga0501041_0191586 Ga0501041_0191586_671_859 62
292 3300049577 Ga0501041_0278426 Ga0501041_0278426_273_461 62
293 3300049577 Ga0501041_0564008 Ga0501041_0564008_505_702 62
294 3300049577 Ga0501041_0840590 Ga0501041_0840590_167_355 62
295 3300049578 Ga0501042_0108921 Ga0501042_0108921_699_887 62
296 3300049578 Ga0501042_0320816 Ga0501042_0320816_458_655 62
297 3300049578 Ga0501042_0659122 Ga0501042_0659122_250_438 62
298 3300049578 Ga0501042_0728426 Ga0501042_0728426_228_416 62
299 3300049578 Ga0501042_1014234 Ga0501042_1014234_253_441 62
300 3300049578 Ga0501042_1099324 Ga0501042_1099324_313_501 62
301 3300049579 Ga0501043_0628448 Ga0501043_0628448_337_525 62
302 3300049580 Ga0501046_0582015 Ga0501046_0582015_50_247 62
303 3300049580 Ga0501046_0785694 Ga0501046_0785694_346_534 62
304 3300049580 Ga0501046_0816961 Ga0501046_0816961_305_493 62
305 3300049580 Ga0501046_1101243 Ga0501046_1101243_204_401 62
306 3300049581 Ga0501047_1036497 Ga0501047_1036497_198_386 62
307 3300049582 Ga0501048_0208110 Ga0501048_0208110_1101_1289 62
308 3300049582 Ga0501048_0424817 Ga0501048_0424817_541_741 62
309 3300049582 Ga0501048_0493861 Ga0501048_0493861_484_681 62
310 3300049582 Ga0501048_0654607 Ga0501048_0654607_47_235 62
311 3300049583 Ga0501067_0018518 Ga0501067_0018518_3436_3624 62
312 3300049583 Ga0501067_0321722 Ga0501067_0321722_167_355 62
313 3300049584 Ga0501068_0186950 Ga0501068_0186950_747_935 62
314 3300049584 Ga0501068_0323281 Ga0501068_0323281_410_598 62
315 3300049584 Ga0501068_0548821 Ga0501068_0548821_534_722 62
316 3300049584 Ga0501068_0552440 Ga0501068_0552440_446_643 62
317 3300049584 Ga0501068_0690951 Ga0501068_0690951_467_655 62
318 3300049584 Ga0501068_0897607 Ga0501068_0897607_251_439 62
319 3300049585 Ga0501069_0103032 Ga0501069_0103032_464_652 62
320 3300049585 Ga0501069_0377333 Ga0501069_0377333_435_623 62
321 3300049585 Ga0501069_0516246 Ga0501069_0516246_53_250 62
322 3300049586 Ga0501070_0295221 Ga0501070_0295221_389_586 62
323 3300049586 Ga0501070_0774430 Ga0501070_0774430_352_540 62
324 3300049587 Ga0501071_0032156 Ga0501071_0032156_2242_2430 62
325 3300049587 Ga0501071_0096538 Ga0501071_0096538_1737_1925 62
326 3300049587 Ga0501071_0110728 Ga0501071_0110728_1662_1859 62
327 3300049587 Ga0501071_0135986 Ga0501071_0135986_329_517 62
328 3300049587 Ga0501071_0178641 Ga0501071_0178641_436_633 62
329 3300049587 Ga0501071_0234260 Ga0501071_0234260_374_562 62
330 3300049587 Ga0501071_0325275 Ga0501071_0325275_456_653 62
331 3300049587 Ga0501071_0816222 Ga0501071_0816222_373_561 62
332 3300049588 Ga0501072_0011886 Ga0501072_0011886_972_1160 62
333 3300049588 Ga0501072_0278639 Ga0501072_0278639_498_686 62
334 3300049588 Ga0501072_0409638 Ga0501072_0409638_863_1060 62
335 3300049588 Ga0501072_0560569 Ga0501072_0560569_421_609 62
336 3300049588 Ga0501072_0693460 Ga0501072_0693460_228_425 62
337 3300049588 Ga0501072_1300996 Ga0501072_1300996_288_485 62
338 3300049588 Ga0501072_1353949 Ga0501072_1353949_125_313 62
339 3300049589 Ga0501073_0039206 Ga0501073_0039206_1314_1502 62
340 3300049590 Ga0501074_0037946 Ga0501074_0037946_963_1151 62
341 3300049590 Ga0501074_0074564 Ga0501074_0074564_481_669 62
342 3300049590 Ga0501074_0552389 Ga0501074_0552389_470_667 62
343 3300049591 Ga0501075_0011422 Ga0501075_0011422_2652_2849 62
344 3300049591 Ga0501075_0088098 Ga0501075_0088098_510_698 62
345 3300049591 Ga0501075_0091790 Ga0501075_0091790_1002_1190 62
346 3300049591 Ga0501075_0286777 Ga0501075_0286777_566_763 62
347 3300049591 Ga0501075_0478295 Ga0501075_0478295_404_601 62
348 3300049591 Ga0501075_0989658 Ga0501075_0989658_92_280 62
349 3300049591 Ga0501075_1536708 Ga0501075_1536708_268_465 62
350 3300049592 Ga0501076_0043843 Ga0501076_0043843_903_1091 62
351 3300049592 Ga0501076_0190739 Ga0501076_0190739_1117_1305 62
352 3300049592 Ga0501076_0213819 Ga0501076_0213819_1107_1295 62
353 3300049592 Ga0501076_0254664 Ga0501076_0254664_915_1112 62
354 3300049592 Ga0501076_0391969 Ga0501076_0391969_719_907 62
355 3300049592 Ga0501076_0549611 Ga0501076_0549611_688_876 62
356 3300049592 Ga0501076_0850520 Ga0501076_0850520_480_668 62
357 3300049592 Ga0501076_0982302 Ga0501076_0982302_46_234 62
358 3300049592 Ga0501076_1294096 Ga0501076_1294096_296_493 62
359 3300049593 Ga0501077_0066762 Ga0501077_0066762_1246_1434 62
360 3300049593 Ga0501077_0084839 Ga0501077_0084839_1207_1395 62
361 3300049593 Ga0501077_0524315 Ga0501077_0524315_166_354 62
362 3300049593 Ga0501077_0629249 Ga0501077_0629249_236_433 62
363 3300049741 Ga0501079_0090958 Ga0501079_0090958_1532_1720 62
364 3300049741 Ga0501079_0117259 Ga0501079_0117259_1695_1883 62
365 3300049741 Ga0501079_0122040 Ga0501079_0122040_1078_1266 62
366 3300049741 Ga0501079_0129453 Ga0501079_0129453_212_409 62
367 3300049741 Ga0501079_0506000 Ga0501079_0506000_370_558 62
368 3300049741 Ga0501079_0856395 Ga0501079_0856395_88_285 62
369 3300049741 Ga0501079_1287664 Ga0501079_1287664_143_331 62
370 3300049742 Ga0501080_0263185 Ga0501080_0263185_201_398 62
371 3300049742 Ga0501080_0303612 Ga0501080_0303612_1025_1222 62
372 3300049742 Ga0501080_0454338 Ga0501080_0454338_791_988 62
373 3300049742 Ga0501080_0718199 Ga0501080_0718199_283_471 62
374 3300049742 Ga0501080_0846668 Ga0501080_0846668_479_667 62
375 3300049744 Ga0501083_0053070 Ga0501083_0053070_1497_1685 62
376 3300049744 Ga0501083_0205794 Ga0501083_0205794_410_598 62
377 3300049744 Ga0501083_0933222 Ga0501083_0933222_348_545 62
378 3300049822 Ga0501035_0782708 Ga0501035_0782708_347_544 62
379 3300049822 Ga0501035_0918484 Ga0501035_0918484_478_666 62
380 3300049823 Ga0501044_1389846 Ga0501044_1389846_212_400 62
381 3300049824 Ga0501045_0269582 Ga0501045_0269582_111_308 62
382 3300049824 Ga0501045_0437909 Ga0501045_0437909_68_256 62
383 3300049824 Ga0501045_1398607 Ga0501045_1398607_21_218 62
384 3300050492 nmdc:mga0yw44_203319_c1 nmdc:mga0yw44_203319_c1_619_807 62
385 3300050507 nmdc:mga05p37_218566_c1 nmdc:mga05p37_218566_c1_661_849 62
386 3300050508 nmdc:mga09592_32328_c1 nmdc:mga09592_32328_c1_1280_1468 62
387 3300050510 nmdc:mga06r32_26536_c1 nmdc:mga06r32_26536_c1_83_271 62
388 3300050511 nmdc:mga08y16_684122_c1 nmdc:mga08y16_684122_c1_420_608 62
389 3300050512 nmdc:mga0n895_145610_c1 nmdc:mga0n895_145610_c1_1521_1709 62
390 3300050512 nmdc:mga0n895_435191_c1 nmdc:mga0n895_435191_c1_575_766 62
391 3300050513 nmdc:mga0rr50_824311_c1 nmdc:mga0rr50_824311_c1_242_430 62
392 3300053078 Ga0495612_0251063 Ga0495612_0251063_435_623 62
393 3300053083 Ga0495655_0240715 Ga0495655_0240715_106_294 62
394 3300053084 Ga0495595_0363802 Ga0495595_0363802_446_634 62
395 3300053084 Ga0495595_0518344 Ga0495595_0518344_375_563 62
396 3300053084 Ga0495595_0572719 Ga0495595_0572719_218_406 62
397 3300053084 Ga0495595_0729402 Ga0495595_0729402_28_216 62
398 3300053085 Ga0495619_0615790 Ga0495619_0615790_236_424 62
399 3300053129 Ga0500628_065249 Ga0500628_065249_476_664 62
400 3300054114 Ga0501084_0029226 Ga0501084_0029226_4216_4413 62
401 3300054114 Ga0501084_0144920 Ga0501084_0144920_472_660 62
402 3300054114 Ga0501084_0147250 Ga0501084_0147250_1421_1618 62
403 3300054114 Ga0501084_0177193 Ga0501084_0177193_1319_1507 62
404 3300054114 Ga0501084_0612321 Ga0501084_0612321_325_513 62
405 3300054114 Ga0501084_0671815 Ga0501084_0671815_631_828 62
406 3300054114 Ga0501084_1063353 Ga0501084_1063353_77_265 62
407 3300054114 Ga0501084_1211216 Ga0501084_1211216_388_576 62
408 3300054114 Ga0501084_1467572 Ga0501084_1467572_46_234 62
409 3300054114 Ga0501084_1495449 Ga0501084_1495449_289_477 62
410 3300054114 Ga0501084_1606196 Ga0501084_1606196_311_499 62
411 3300060353 Ga0501082_0122597 Ga0501082_0122597_737_925 62
412 3300060353 Ga0501082_0418578 Ga0501082_0418578_940_1128 62
413 3300060353 Ga0501082_0469968 Ga0501082_0469968_116_313 62
414 3300060353 Ga0501082_1047825 Ga0501082_1047825_313_510 62
415 3300060353 Ga0501082_1651616 Ga0501082_1651616_307_495 62
416 3300061734 Ga0530510_0121939 Ga0530510_0121939_1177_1365 62
417 3300061734 Ga0530510_0301100 Ga0530510_0301100_379_576 62
418 3300061734 Ga0530510_0304230 Ga0530510_0304230_523_711 62
419 3300061734 Ga0530510_0873038 Ga0530510_0873038_457_645 62
420 3300003203 JGI25406J46586_10158050 JGI25406J46586_101580501 65
421 3300003203 JGI25406J46586_10225724 JGI25406J46586_102257242 65
422 3300003320 rootH2_10049188 rootH2_100491883 65
423 3300003323 rootH1_10212111 rootH1_102121114 65
424 3300003575 Ga0007409J51694_1046779 Ga0007409J51694_10467791 65
425 3300004801 Ga0058860_11391804 Ga0058860_113918042 65
426 3300005295 Ga0065707_10406542 Ga0065707_104065422 65
427 3300005328 Ga0070676_10660594 Ga0070676_106605941 65
428 3300005328 Ga0070676_11603893 Ga0070676_116038932 65
429 3300005329 Ga0070683_100060933 Ga0070683_1000609334 65
430 3300005329 Ga0070683_100527412 Ga0070683_1005274122 65
431 3300005329 Ga0070683_100933873 Ga0070683_1009338732 65
432 3300005329 Ga0070683_101945196 Ga0070683_1019451962 65
433 3300005329 Ga0070683_102150265 Ga0070683_1021502652 65
434 3300005330 Ga0070690_100163173 Ga0070690_1001631733 65
435 3300005330 Ga0070690_100232919 Ga0070690_1002329191 65
436 3300005331 Ga0070670_100070756 Ga0070670_1000707563 65
437 3300005331 Ga0070670_100651798 Ga0070670_1006517981 65
438 3300005333 Ga0070677_10942065 Ga0070677_109420651 65
439 3300005334 Ga0068869_100133724 Ga0068869_1001337242 65
440 3300005334 Ga0068869_100350801 Ga0068869_1003508011 65
441 3300005334 Ga0068869_100688370 Ga0068869_1006883701 65
442 3300005334 Ga0068869_100946133 Ga0068869_1009461332 65
443 3300005335 Ga0070666_10220504 Ga0070666_102205043 65
444 3300005336 Ga0070680_100000095 Ga0070680_1000000954 65
445 3300005336 Ga0070680_100536019 Ga0070680_1005360192 65
446 3300005336 Ga0070680_101594389 Ga0070680_1015943891 65
447 3300005336 Ga0070680_101661108 Ga0070680_1016611081 65
448 3300005336 Ga0070680_101898201 Ga0070680_1018982012 65
449 3300005337 Ga0070682_100010726 Ga0070682_1000107263 65
450 3300005337 Ga0070682_100075504 Ga0070682_1000755043 65
451 3300005337 Ga0070682_100315921 Ga0070682_1003159211 65
452 3300005337 Ga0070682_100974899 Ga0070682_1009748992 65
453 3300005337 Ga0070682_101483138 Ga0070682_1014831382 65
454 3300005338 Ga0068868_100363094 Ga0068868_1003630942 65
455 3300005338 Ga0068868_100495245 Ga0068868_1004952453 65
456 3300005338 Ga0068868_100984128 Ga0068868_1009841282 65
457 3300005338 Ga0068868_101446557 Ga0068868_1014465571 65
458 3300005338 Ga0068868_101574316 Ga0068868_1015743162 65
459 3300005338 Ga0068868_101891782 Ga0068868_1018917822 65
460 3300005338 Ga0068868_102097756 Ga0068868_1020977561 65
461 3300005339 Ga0070660_101253735 Ga0070660_1012537351 65
462 3300005339 Ga0070660_101919775 Ga0070660_1019197752 65
463 3300005340 Ga0070689_100026034 Ga0070689_1000260342 65
464 3300005340 Ga0070689_102137888 Ga0070689_1021378881 65
465 3300005341 Ga0070691_10083073 Ga0070691_100830733 65
466 3300005341 Ga0070691_10435701 Ga0070691_104357012 65
467 3300005341 Ga0070691_10523307 Ga0070691_105233071 65
468 3300005341 Ga0070691_10666796 Ga0070691_106667962 65
469 3300005341 Ga0070691_10945912 Ga0070691_109459122 65
470 3300005343 Ga0070687_100001813 Ga0070687_1000018137 65
471 3300005343 Ga0070687_100011227 Ga0070687_1000112274 65
472 3300005343 Ga0070687_100047929 Ga0070687_1000479291 65
473 3300005343 Ga0070687_100061402 Ga0070687_1000614021 65
474 3300005343 Ga0070687_100351786 Ga0070687_1003517862 65
475 3300005343 Ga0070687_100393141 Ga0070687_1003931412 65
476 3300005343 Ga0070687_100524028 Ga0070687_1005240282 65
477 3300005343 Ga0070687_100971252 Ga0070687_1009712521 65
478 3300005343 Ga0070687_101088349 Ga0070687_1010883492 65
479 3300005344 Ga0070661_101090935 Ga0070661_1010909352 65
480 3300005344 Ga0070661_101673983 Ga0070661_1016739832 65
481 3300005345 Ga0070692_10009242 Ga0070692_100092424 65
482 3300005345 Ga0070692_10218823 Ga0070692_102188232 65
483 3300005345 Ga0070692_11018904 Ga0070692_110189042 65
484 3300005347 Ga0070668_100215458 Ga0070668_1002154582 65
485 3300005347 Ga0070668_100325059 Ga0070668_1003250591 65
486 3300005347 Ga0070668_100938935 Ga0070668_1009389352 65
487 3300005347 Ga0070668_101783268 Ga0070668_1017832682 65
488 3300005353 Ga0070669_100184475 Ga0070669_1001844752 65
489 3300005353 Ga0070669_100248459 Ga0070669_1002484593 65
490 3300005353 Ga0070669_100506699 Ga0070669_1005066992 65
491 3300005354 Ga0070675_100006157 Ga0070675_1000061574 65
492 3300005354 Ga0070675_100789618 Ga0070675_1007896182 65
493 3300005354 Ga0070675_101074754 Ga0070675_1010747542 65
494 3300005354 Ga0070675_101324620 Ga0070675_1013246202 65
495 3300005354 Ga0070675_101720106 Ga0070675_1017201062 65
496 3300005354 Ga0070675_102240705 Ga0070675_1022407052 65
497 3300005355 Ga0070671_100640839 Ga0070671_1006408392 65
498 3300005355 Ga0070671_101889599 Ga0070671_1018895992 65
499 3300005356 Ga0070674_100011232 Ga0070674_1000112322 65
500 3300005356 Ga0070674_100096243 Ga0070674_1000962432 65
501 3300005356 Ga0070674_100250467 Ga0070674_1002504672 65
502 3300005356 Ga0070674_101169915 Ga0070674_1011699152 65
503 3300005356 Ga0070674_101554835 Ga0070674_1015548352 65
504 3300005356 Ga0070674_101651303 Ga0070674_1016513031 65
505 3300005364 Ga0070673_102025336 Ga0070673_1020253362 65
506 3300005364 Ga0070673_102105999 Ga0070673_1021059991 65
507 3300005364 Ga0070673_102263665 Ga0070673_1022636652 65
508 3300005364 Ga0070673_102324017 Ga0070673_1023240172 65
509 3300005365 Ga0070688_100055644 Ga0070688_1000556442 65
510 3300005365 Ga0070688_100085911 Ga0070688_1000859112 65
511 3300005365 Ga0070688_100236006 Ga0070688_1002360063 65
512 3300005366 Ga0070659_100024949 Ga0070659_1000249494 65
513 3300005366 Ga0070659_100224928 Ga0070659_1002249282 65
514 3300005366 Ga0070659_101102084 Ga0070659_1011020842 65
515 3300005366 Ga0070659_101219796 Ga0070659_1012197961 65
516 3300005366 Ga0070659_101354871 Ga0070659_1013548712 65
517 3300005366 Ga0070659_101567514 Ga0070659_1015675142 65
518 3300005367 Ga0070667_100501502 Ga0070667_1005015021 65
519 3300005367 Ga0070667_101529388 Ga0070667_1015293882 65
520 3300005367 Ga0070667_101744707 Ga0070667_1017447072 65
521 3300005406 Ga0070703_10045702 Ga0070703_100457022 65
522 3300005406 Ga0070703_10134196 Ga0070703_101341962 65
523 3300005434 Ga0070709_10508789 Ga0070709_105087892 65
524 3300005438 Ga0070701_10035506 Ga0070701_100355064 65
525 3300005438 Ga0070701_10769637 Ga0070701_107696372 65
526 3300005438 Ga0070701_10984329 Ga0070701_109843292 65
527 3300005438 Ga0070701_10984773 Ga0070701_109847731 65
528 3300005438 Ga0070701_11223997 Ga0070701_112239972 65
529 3300005438 Ga0070701_11298465 Ga0070701_112984651 65
530 3300005439 Ga0070711_100685424 Ga0070711_1006854242 65
531 3300005439 Ga0070711_100933948 Ga0070711_1009339482 65
532 3300005440 Ga0070705_100029458 Ga0070705_1000294582 65
533 3300005440 Ga0070705_100059307 Ga0070705_1000593074 65
534 3300005440 Ga0070705_100317045 Ga0070705_1003170451 65
535 3300005440 Ga0070705_100321171 Ga0070705_1003211711 65
536 3300005440 Ga0070705_100506275 Ga0070705_1005062751 65
537 3300005440 Ga0070705_100557466 Ga0070705_1005574662 65
538 3300005440 Ga0070705_100673150 Ga0070705_1006731501 65
539 3300005440 Ga0070705_100739391 Ga0070705_1007393912 65
540 3300005440 Ga0070705_101534600 Ga0070705_1015346001 65
541 3300005441 Ga0070700_100012559 Ga0070700_1000125594 65
542 3300005441 Ga0070700_100370632 Ga0070700_1003706323 65
543 3300005441 Ga0070700_100643873 Ga0070700_1006438732 65
544 3300005444 Ga0070694_100052183 Ga0070694_1000521833 65
545 3300005444 Ga0070694_100107772 Ga0070694_1001077723 65
546 3300005444 Ga0070694_100121678 Ga0070694_1001216783 65
547 3300005444 Ga0070694_100192350 Ga0070694_1001923502 65
548 3300005444 Ga0070694_100357166 Ga0070694_1003571662 65
549 3300005444 Ga0070694_100434880 Ga0070694_1004348802 65
550 3300005444 Ga0070694_100753114 Ga0070694_1007531142 65
551 3300005444 Ga0070694_101406857 Ga0070694_1014068572 65
552 3300005445 Ga0070708_100002968 Ga0070708_1000029687 65
553 3300005445 Ga0070708_100028644 Ga0070708_1000286442 65
554 3300005445 Ga0070708_100034531 Ga0070708_1000345314 65
555 3300005445 Ga0070708_100169854 Ga0070708_1001698544 65
556 3300005445 Ga0070708_100220938 Ga0070708_1002209383 65
557 3300005445 Ga0070708_100365847 Ga0070708_1003658472 65
558 3300005445 Ga0070708_100424145 Ga0070708_1004241452 65
559 3300005455 Ga0070663_100307641 Ga0070663_1003076412 65
560 3300005455 Ga0070663_100716348 Ga0070663_1007163482 65
561 3300005455 Ga0070663_100739610 Ga0070663_1007396101 65
562 3300005455 Ga0070663_101801289 Ga0070663_1018012891 65
563 3300005456 Ga0070678_100072105 Ga0070678_1000721052 65
564 3300005456 Ga0070678_100275883 Ga0070678_1002758831 65
565 3300005456 Ga0070678_100354021 Ga0070678_1003540213 65
566 3300005456 Ga0070678_100429365 Ga0070678_1004293651 65
567 3300005456 Ga0070678_100450806 Ga0070678_1004508062 65
568 3300005456 Ga0070678_101822740 Ga0070678_1018227401 65
569 3300005457 Ga0070662_100007462 Ga0070662_1000074622 65
570 3300005457 Ga0070662_100161475 Ga0070662_1001614753 65
571 3300005457 Ga0070662_100210059 Ga0070662_1002100593 65
572 3300005457 Ga0070662_100603182 Ga0070662_1006031821 65
573 3300005458 Ga0070681_10769337 Ga0070681_107693372 65
574 3300005458 Ga0070681_11007005 Ga0070681_110070051 65
575 3300005458 Ga0070681_11124566 Ga0070681_111245662 65
576 3300005459 Ga0068867_100110072 Ga0068867_1001100724 65
577 3300005459 Ga0068867_100236469 Ga0068867_1002364691 65
578 3300005459 Ga0068867_100697137 Ga0068867_1006971372 65
579 3300005459 Ga0068867_100840443 Ga0068867_1008404432 65
580 3300005466 Ga0070685_10006437 Ga0070685_100064372 65
581 3300005466 Ga0070685_10334965 Ga0070685_103349652 65
582 3300005466 Ga0070685_10905283 Ga0070685_109052832 65
583 3300005466 Ga0070685_11318163 Ga0070685_113181632 65
584 3300005466 Ga0070685_11388163 Ga0070685_113881631 65
585 3300005467 Ga0070706_100000195 Ga0070706_10000019564 65
586 3300005467 Ga0070706_100011489 Ga0070706_1000114891 65
587 3300005467 Ga0070706_100014855 Ga0070706_1000148553 65
588 3300005467 Ga0070706_100017337 Ga0070706_1000173374 65
589 3300005467 Ga0070706_100023814 Ga0070706_1000238143 65
590 3300005467 Ga0070706_100145885 Ga0070706_1001458852 65
591 3300005467 Ga0070706_100154733 Ga0070706_1001547332 65
592 3300005467 Ga0070706_100415791 Ga0070706_1004157913 65
593 3300005468 Ga0070707_100000870 Ga0070707_10000087010 65
594 3300005468 Ga0070707_100001138 Ga0070707_1000011386 65
595 3300005468 Ga0070707_100048608 Ga0070707_1000486082 65
596 3300005468 Ga0070707_100060810 Ga0070707_1000608102 65
597 3300005468 Ga0070707_100074734 Ga0070707_1000747341 65
598 3300005468 Ga0070707_100180572 Ga0070707_1001805723 65
599 3300005468 Ga0070707_100316600 Ga0070707_1003166003 65
600 3300005468 Ga0070707_100477067 Ga0070707_1004770673 65
601 3300005468 Ga0070707_100578172 Ga0070707_1005781722 65
602 3300005468 Ga0070707_100717630 Ga0070707_1007176302 65
603 3300005468 Ga0070707_101584834 Ga0070707_1015848342 65
604 3300005471 Ga0070698_100094847 Ga0070698_1000948473 65
605 3300005471 Ga0070698_100097029 Ga0070698_1000970293 65
606 3300005471 Ga0070698_100121106 Ga0070698_1001211063 65
607 3300005471 Ga0070698_100232309 Ga0070698_1002323092 65
608 3300005471 Ga0070698_100369813 Ga0070698_1003698131 65
609 3300005471 Ga0070698_100443455 Ga0070698_1004434552 65
610 3300005471 Ga0070698_100606982 Ga0070698_1006069822 65
611 3300005471 Ga0070698_100786159 Ga0070698_1007861591 65
612 3300005518 Ga0070699_100040202 Ga0070699_1000402023 65
613 3300005518 Ga0070699_100047664 Ga0070699_1000476643 65
614 3300005518 Ga0070699_100057351 Ga0070699_1000573513 65
615 3300005518 Ga0070699_100135274 Ga0070699_1001352743 65
616 3300005518 Ga0070699_100460673 Ga0070699_1004606731 65
617 3300005518 Ga0070699_100650891 Ga0070699_1006508912 65
618 3300005518 Ga0070699_100931741 Ga0070699_1009317412 65
619 3300005530 Ga0070679_100753646 Ga0070679_1007536462 65
620 3300005530 Ga0070679_101175716 Ga0070679_1011757162 65
621 3300005530 Ga0070679_101236471 Ga0070679_1012364712 65
622 3300005535 Ga0070684_100114740 Ga0070684_1001147403 65
623 3300005535 Ga0070684_100390533 Ga0070684_1003905333 65
624 3300005535 Ga0070684_100885993 Ga0070684_1008859932 65
625 3300005535 Ga0070684_101072632 Ga0070684_1010726322 65
626 3300005535 Ga0070684_101431883 Ga0070684_1014318832 65
627 3300005536 Ga0070697_100041648 Ga0070697_1000416481 65
628 3300005536 Ga0070697_100133482 Ga0070697_1001334822 65
629 3300005536 Ga0070697_100146534 Ga0070697_1001465342 65
630 3300005536 Ga0070697_100174554 Ga0070697_1001745541 65
631 3300005536 Ga0070697_100213514 Ga0070697_1002135143 65
632 3300005539 Ga0068853_100650086 Ga0068853_1006500863 65
633 3300005539 Ga0068853_101591967 Ga0068853_1015919671 65
634 3300005543 Ga0070672_100250414 Ga0070672_1002504142 65
635 3300005543 Ga0070672_100311737 Ga0070672_1003117373 65
636 3300005543 Ga0070672_100663666 Ga0070672_1006636661 65
637 3300005543 Ga0070672_100844373 Ga0070672_1008443732 65
638 3300005543 Ga0070672_101572478 Ga0070672_1015724781 65
639 3300005544 Ga0070686_100015918 Ga0070686_1000159184 65
640 3300005544 Ga0070686_100050867 Ga0070686_1000508673 65
641 3300005544 Ga0070686_100141755 Ga0070686_1001417553 65
642 3300005544 Ga0070686_100202276 Ga0070686_1002022762 65
643 3300005544 Ga0070686_100219254 Ga0070686_1002192543 65
644 3300005544 Ga0070686_100229192 Ga0070686_1002291922 65
645 3300005544 Ga0070686_101042623 Ga0070686_1010426232 65
646 3300005544 Ga0070686_101706713 Ga0070686_1017067131 65
647 3300005545 Ga0070695_100031030 Ga0070695_1000310303 65
648 3300005545 Ga0070695_100037326 Ga0070695_1000373264 65
649 3300005545 Ga0070695_100240277 Ga0070695_1002402773 65
650 3300005545 Ga0070695_100394967 Ga0070695_1003949673 65
651 3300005545 Ga0070695_101569547 Ga0070695_1015695472 65
652 3300005546 Ga0070696_100054642 Ga0070696_1000546423 65
653 3300005546 Ga0070696_100071625 Ga0070696_1000716253 65
654 3300005546 Ga0070696_100098845 Ga0070696_1000988452 65
655 3300005546 Ga0070696_100116093 Ga0070696_1001160933 65
656 3300005546 Ga0070696_100173127 Ga0070696_1001731273 65
657 3300005546 Ga0070696_100207703 Ga0070696_1002077032 65
658 3300005546 Ga0070696_100326374 Ga0070696_1003263742 65
659 3300005546 Ga0070696_100575100 Ga0070696_1005751001 65
660 3300005546 Ga0070696_100919940 Ga0070696_1009199402 65
661 3300005547 Ga0070693_100053190 Ga0070693_1000531903 65
662 3300005547 Ga0070693_100119140 Ga0070693_1001191403 65
663 3300005547 Ga0070693_100198808 Ga0070693_1001988082 65
664 3300005547 Ga0070693_100418029 Ga0070693_1004180291 65
665 3300005547 Ga0070693_100685632 Ga0070693_1006856322 65
666 3300005547 Ga0070693_101164202 Ga0070693_1011642022 65
667 3300005547 Ga0070693_101422954 Ga0070693_1014229542 65
668 3300005548 Ga0070665_100248684 Ga0070665_1002486842 65
669 3300005548 Ga0070665_100965088 Ga0070665_1009650882 65
670 3300005549 Ga0070704_100018624 Ga0070704_1000186245 65
671 3300005549 Ga0070704_100060578 Ga0070704_1000605784 65
672 3300005549 Ga0070704_100081561 Ga0070704_1000815613 65
673 3300005549 Ga0070704_100110628 Ga0070704_1001106282 65
674 3300005549 Ga0070704_100226822 Ga0070704_1002268223 65
675 3300005549 Ga0070704_100583367 Ga0070704_1005833672 65
676 3300005549 Ga0070704_100768499 Ga0070704_1007684992 65
677 3300005549 Ga0070704_101779081 Ga0070704_1017790812 65
678 3300005563 Ga0068855_101218357 Ga0068855_1012183572 65
679 3300005563 Ga0068855_101254381 Ga0068855_1012543811 65
680 3300005564 Ga0070664_100081232 Ga0070664_1000812323 65
681 3300005564 Ga0070664_101054864 Ga0070664_1010548642 65
682 3300005564 Ga0070664_102298054 Ga0070664_1022980542 65
683 3300005577 Ga0068857_100132766 Ga0068857_1001327663 65
684 3300005577 Ga0068857_100141610 Ga0068857_1001416104 65
685 3300005577 Ga0068857_100392754 Ga0068857_1003927542 65
686 3300005577 Ga0068857_100666182 Ga0068857_1006661821 65
687 3300005577 Ga0068857_101915087 Ga0068857_1019150872 65
688 3300005578 Ga0068854_100129869 Ga0068854_1001298693 65
689 3300005578 Ga0068854_100308635 Ga0068854_1003086352 65
690 3300005578 Ga0068854_101029269 Ga0068854_1010292692 65
691 3300005614 Ga0068856_101818448 Ga0068856_1018184481 65
692 3300005615 Ga0070702_100248228 Ga0070702_1002482282 65
693 3300005615 Ga0070702_100299373 Ga0070702_1002993733 65
694 3300005615 Ga0070702_100800673 Ga0070702_1008006732 65
695 3300005615 Ga0070702_100982815 Ga0070702_1009828152 65
696 3300005615 Ga0070702_101097064 Ga0070702_1010970642 65
697 3300005615 Ga0070702_101389214 Ga0070702_1013892142 65
698 3300005616 Ga0068852_100086030 Ga0068852_1000860303 65
699 3300005616 Ga0068852_101506906 Ga0068852_1015069062 65
700 3300005616 Ga0068852_102301603 Ga0068852_1023016031 65
701 3300005616 Ga0068852_102747862 Ga0068852_1027478622 65
702 3300005617 Ga0068859_100009621 Ga0068859_1000096213 65
703 3300005617 Ga0068859_100346372 Ga0068859_1003463722 65
704 3300005617 Ga0068859_100568282 Ga0068859_1005682821 65
705 3300005617 Ga0068859_100726571 Ga0068859_1007265712 65
706 3300005617 Ga0068859_101983026 Ga0068859_1019830262 65
707 3300005618 Ga0068864_100022501 Ga0068864_1000225012 65
708 3300005618 Ga0068864_100207015 Ga0068864_1002070152 65
709 3300005618 Ga0068864_100226700 Ga0068864_1002267003 65
710 3300005618 Ga0068864_100332932 Ga0068864_1003329323 65
711 3300005618 Ga0068864_101227117 Ga0068864_1012271172 65
712 3300005618 Ga0068864_101324411 Ga0068864_1013244112 65
713 3300005718 Ga0068866_11190183 Ga0068866_111901831 65
714 3300005719 Ga0068861_100169981 Ga0068861_1001699813 65
715 3300005719 Ga0068861_100265108 Ga0068861_1002651082 65
716 3300005719 Ga0068861_100576959 Ga0068861_1005769592 65
717 3300005719 Ga0068861_100685248 Ga0068861_1006852482 65
718 3300005719 Ga0068861_100884689 Ga0068861_1008846892 65
719 3300005719 Ga0068861_101084649 Ga0068861_1010846492 65
720 3300005719 Ga0068861_101623071 Ga0068861_1016230712 65
721 3300005834 Ga0068851_10145329 Ga0068851_101453293 65
722 3300005834 Ga0068851_10395857 Ga0068851_103958572 65
723 3300005840 Ga0068870_10237873 Ga0068870_102378733 65
724 3300005840 Ga0068870_10259495 Ga0068870_102594952 65
725 3300005840 Ga0068870_11432349 Ga0068870_114323492 65
726 3300005840 Ga0068870_11440575 Ga0068870_114405752 65
727 3300005841 Ga0068863_100347565 Ga0068863_1003475651 65
728 3300005841 Ga0068863_100584421 Ga0068863_1005844212 65
729 3300005842 Ga0068858_100240275 Ga0068858_1002402752 65
730 3300005842 Ga0068858_100260891 Ga0068858_1002608912 65
731 3300005842 Ga0068858_100691953 Ga0068858_1006919532 65
732 3300005842 Ga0068858_102001664 Ga0068858_1020016642 65
733 3300005843 Ga0068860_100055282 Ga0068860_1000552821 65
734 3300005843 Ga0068860_100199428 Ga0068860_1001994283 65
735 3300005843 Ga0068860_100504039 Ga0068860_1005040392 65
736 3300005843 Ga0068860_100973617 Ga0068860_1009736171 65
737 3300005843 Ga0068860_101032302 Ga0068860_1010323022 65
738 3300005843 Ga0068860_101422070 Ga0068860_1014220702 65
739 3300005843 Ga0068860_101825286 Ga0068860_1018252862 65
740 3300005844 Ga0068862_100093778 Ga0068862_1000937784 65
741 3300005844 Ga0068862_101760204 Ga0068862_1017602042 65
742 3300005981 Ga0081538_10056043 Ga0081538_100560432 65
743 3300005981 Ga0081538_10111778 Ga0081538_101117781 65
744 3300005985 Ga0081539_10006122 Ga0081539_1000612212 65
745 3300005985 Ga0081539_10012545 Ga0081539_100125454 65
746 3300005985 Ga0081539_10022773 Ga0081539_100227734 65
747 3300005985 Ga0081539_10110458 Ga0081539_101104583 65
748 3300005985 Ga0081539_10292465 Ga0081539_102924652 65
749 3300005985 Ga0081539_10319548 Ga0081539_103195482 65
750 3300006028 Ga0070717_10731951 Ga0070717_107319512 65
751 3300006038 Ga0075365_10029504 Ga0075365_100295044 65
752 3300006038 Ga0075365_10375255 Ga0075365_103752552 65
753 3300006051 Ga0075364_10721293 Ga0075364_107212932 65
754 3300006058 Ga0075432_10194372 Ga0075432_101943721 65
755 3300006173 Ga0070716_100059368 Ga0070716_1000593684 65
756 3300006175 Ga0070712_100200005 Ga0070712_1002000053 65
757 3300006175 Ga0070712_101908205 Ga0070712_1019082052 65
758 3300006237 Ga0097621_100786400 Ga0097621_1007864001 65
759 3300006237 Ga0097621_101304309 Ga0097621_1013043092 65
760 3300006237 Ga0097621_101504029 Ga0097621_1015040292 65
761 3300006358 Ga0068871_101235057 Ga0068871_1012350571 65
762 3300006358 Ga0068871_101540761 Ga0068871_1015407611 65
763 3300006844 Ga0075428_100171313 Ga0075428_1001713132 65
764 3300006844 Ga0075428_100517374 Ga0075428_1005173742 65
765 3300006844 Ga0075428_101247451 Ga0075428_1012474512 65
766 3300006844 Ga0075428_101914122 Ga0075428_1019141222 65
767 3300006847 Ga0075431_100021763 Ga0075431_1000217634 65
768 3300006847 Ga0075431_100073432 Ga0075431_1000734323 65
769 3300006852 Ga0075433_10010744 Ga0075433_100107444 65
770 3300006852 Ga0075433_10107763 Ga0075433_101077632 65
771 3300006852 Ga0075433_10325066 Ga0075433_103250662 65
772 3300006852 Ga0075433_10538506 Ga0075433_105385062 65
773 3300006852 Ga0075433_10570122 Ga0075433_105701222 65
774 3300006852 Ga0075433_10577184 Ga0075433_105771842 65
775 3300006852 Ga0075433_11157875 Ga0075433_111578752 65
776 3300006852 Ga0075433_11942289 Ga0075433_119422892 65
777 3300006871 Ga0075434_100157209 Ga0075434_1001572093 65
778 3300006871 Ga0075434_100209260 Ga0075434_1002092603 65
779 3300006871 Ga0075434_100470294 Ga0075434_1004702943 65
780 3300006871 Ga0075434_100488087 Ga0075434_1004880872 65
781 3300006871 Ga0075434_100578126 Ga0075434_1005781262 65
782 3300006871 Ga0075434_102472985 Ga0075434_1024729852 65
783 3300006880 Ga0075429_100058468 Ga0075429_1000584683 65
784 3300006880 Ga0075429_101127291 Ga0075429_1011272912 65
785 3300006881 Ga0068865_100023276 Ga0068865_1000232764 65
786 3300006881 Ga0068865_100176618 Ga0068865_1001766183 65
787 3300006881 Ga0068865_100281987 Ga0068865_1002819873 65
788 3300006881 Ga0068865_101144510 Ga0068865_1011445102 65
789 3300006881 Ga0068865_101695377 Ga0068865_1016953772 65
790 3300006881 Ga0068865_101947031 Ga0068865_1019470311 65
791 3300006881 Ga0068865_102205397 Ga0068865_1022053971 65
792 3300006914 Ga0075436_100066218 Ga0075436_1000662183 65
793 3300006914 Ga0075436_100122709 Ga0075436_1001227093 65
794 3300006914 Ga0075436_100868075 Ga0075436_1008680752 65
795 3300006931 Ga0097620_100009621 Ga0097620_1000096213 65
796 3300006931 Ga0097620_100346391 Ga0097620_1003463912 65
797 3300006931 Ga0097620_100568356 Ga0097620_1005683562 65
798 3300006931 Ga0097620_100726514 Ga0097620_1007265142 65
799 3300006931 Ga0097620_101983256 Ga0097620_1019832562 65
800 3300007076 Ga0075435_100062841 Ga0075435_1000628414 65
801 3300007076 Ga0075435_100259199 Ga0075435_1002591993 65
802 3300007076 Ga0075435_100302533 Ga0075435_1003025332 65
803 3300007076 Ga0075435_100462125 Ga0075435_1004621252 65
804 3300007076 Ga0075435_100969955 Ga0075435_1009699551 65
805 3300007076 Ga0075435_101478903 Ga0075435_1014789032 65
806 3300007076 Ga0075435_102068989 Ga0075435_1020689892 65
807 3300007788 Ga0099795_10538693 Ga0099795_105386932 65
808 3300009011 Ga0105251_10264370 Ga0105251_102643702 65
809 3300009011 Ga0105251_10537967 Ga0105251_105379671 65
810 3300009092 Ga0105250_10453031 Ga0105250_104530312 65
811 3300009092 Ga0105250_10455063 Ga0105250_104550632 65
812 3300009093 Ga0105240_11989338 Ga0105240_119893382 65
813 3300009093 Ga0105240_12007841 Ga0105240_120078412 65
814 3300009093 Ga0105240_12066705 Ga0105240_120667051 65
815 3300009094 Ga0111539_10040950 Ga0111539_100409504 65
816 3300009094 Ga0111539_10120785 Ga0111539_101207853 65
817 3300009094 Ga0111539_10420023 Ga0111539_104200232 65
818 3300009094 Ga0111539_10742585 Ga0111539_107425852 65
819 3300009094 Ga0111539_12443815 Ga0111539_124438152 65
820 3300009094 Ga0111539_12584290 Ga0111539_125842902 65
821 3300009098 Ga0105245_10022581 Ga0105245_100225814 65
822 3300009098 Ga0105245_10055431 Ga0105245_100554313 65
823 3300009098 Ga0105245_10166301 Ga0105245_101663012 65
824 3300009098 Ga0105245_10240187 Ga0105245_102401872 65
825 3300009098 Ga0105245_10756333 Ga0105245_107563332 65
826 3300009098 Ga0105245_11021157 Ga0105245_110211572 65
827 3300009098 Ga0105245_11854937 Ga0105245_118549372 65
828 3300009101 Ga0105247_10113681 Ga0105247_101136812 65
829 3300009101 Ga0105247_10867073 Ga0105247_108670731 65
830 3300009147 Ga0114129_10088943 Ga0114129_100889434 65
831 3300009147 Ga0114129_10101890 Ga0114129_101018904 65
832 3300009147 Ga0114129_10124918 Ga0114129_101249182 65
833 3300009147 Ga0114129_10444245 Ga0114129_104442452 65
834 3300009147 Ga0114129_10577184 Ga0114129_105771843 65
835 3300009147 Ga0114129_10894910 Ga0114129_108949102 65
836 3300009147 Ga0114129_11891507 Ga0114129_118915072 65
837 3300009147 Ga0114129_13041074 Ga0114129_130410742 65
838 3300009148 Ga0105243_10033849 Ga0105243_100338494 65
839 3300009148 Ga0105243_10039583 Ga0105243_100395832 65
840 3300009148 Ga0105243_10068753 Ga0105243_100687532 65
841 3300009148 Ga0105243_10738992 Ga0105243_107389921 65
842 3300009148 Ga0105243_11106116 Ga0105243_111061162 65
843 3300009148 Ga0105243_11249303 Ga0105243_112493032 65
844 3300009148 Ga0105243_11814186 Ga0105243_118141862 65
845 3300009148 Ga0105243_12388323 Ga0105243_123883232 65
846 3300009148 Ga0105243_12830217 Ga0105243_128302171 65
847 3300009148 Ga0105243_12932933 Ga0105243_129329331 65
848 3300009174 Ga0105241_10552265 Ga0105241_105522652 65
849 3300009174 Ga0105241_11048717 Ga0105241_110487172 65
850 3300009174 Ga0105241_11198789 Ga0105241_111987891 65
851 3300009174 Ga0105241_12133908 Ga0105241_121339082 65
852 3300009174 Ga0105241_12520885 Ga0105241_125208851 65
853 3300009176 Ga0105242_10431658 Ga0105242_104316581 65
854 3300009176 Ga0105242_10553702 Ga0105242_105537022 65
855 3300009176 Ga0105242_10826330 Ga0105242_108263301 65
856 3300009176 Ga0105242_10972924 Ga0105242_109729242 65
857 3300009176 Ga0105242_11510042 Ga0105242_115100422 65
858 3300009176 Ga0105242_12378723 Ga0105242_123787232 65
859 3300009177 Ga0105248_10144125 Ga0105248_101441253 65
860 3300009177 Ga0105248_10358208 Ga0105248_103582083 65
861 3300009177 Ga0105248_10550834 Ga0105248_105508342 65
862 3300009177 Ga0105248_11056136 Ga0105248_110561363 65
863 3300009545 Ga0105237_11338580 Ga0105237_113385802 65
864 3300009551 Ga0105238_10089583 Ga0105238_100895833 65
865 3300009551 Ga0105238_10938574 Ga0105238_109385741 65
866 3300009551 Ga0105238_12583765 Ga0105238_125837651 65
867 3300009553 Ga0105249_10003478 Ga0105249_1000347812 65
868 3300009553 Ga0105249_10052482 Ga0105249_100524824 65
869 3300009553 Ga0105249_10105754 Ga0105249_101057543 65
870 3300009553 Ga0105249_10176352 Ga0105249_101763523 65
871 3300009553 Ga0105249_10248924 Ga0105249_102489243 65
872 3300009553 Ga0105249_11353425 Ga0105249_113534251 65
873 3300009553 Ga0105249_12494763 Ga0105249_124947631 65
874 3300009553 Ga0105249_12763328 Ga0105249_127633282 65
875 3300009553 Ga0105249_13202488 Ga0105249_132024882 65
876 3300010159 Ga0099796_10252194 Ga0099796_102521942 65
877 3300010375 Ga0105239_10195187 Ga0105239_101951873 65
878 3300010375 Ga0105239_10412245 Ga0105239_104122453 65
879 3300010375 Ga0105239_10462254 Ga0105239_104622543 65
880 3300010375 Ga0105239_10519454 Ga0105239_105194542 65
881 3300010375 Ga0105239_11388793 Ga0105239_113887931 65
882 3300010375 Ga0105239_12244722 Ga0105239_122447222 65
883 3300010375 Ga0105239_12378932 Ga0105239_123789322 65
884 3300010375 Ga0105239_12694940 Ga0105239_126949402 65
885 3300010375 Ga0105239_13581535 Ga0105239_135815351 65
886 3300011119 Ga0105246_10026512 Ga0105246_100265123 65
887 3300011119 Ga0105246_10089997 Ga0105246_100899971 65
888 3300011119 Ga0105246_10276906 Ga0105246_102769062 65
889 3300011119 Ga0105246_10284697 Ga0105246_102846973 65
890 3300011119 Ga0105246_10462688 Ga0105246_104626882 65
891 3300011119 Ga0105246_10607149 Ga0105246_106071493 65
892 3300011119 Ga0105246_11327188 Ga0105246_113271882 65
893 3300011119 Ga0105246_11430176 Ga0105246_114301762 65
894 3300011119 Ga0105246_11922051 Ga0105246_119220511 65
895 3300012487 Ga0157321_1033218 Ga0157321_10332182 65
896 3300013100 Ga0157373_10950954 Ga0157373_109509542 65
897 3300013100 Ga0157373_10978930 Ga0157373_109789302 65
898 3300013100 Ga0157373_11000143 Ga0157373_110001432 65
899 3300013100 Ga0157373_11118433 Ga0157373_111184331 65
900 3300013102 Ga0157371_11396633 Ga0157371_113966332 65
901 3300013102 Ga0157371_11617914 Ga0157371_116179142 65
902 3300013296 Ga0157374_10503277 Ga0157374_105032772 65
903 3300013296 Ga0157374_11020998 Ga0157374_110209981 65
904 3300013296 Ga0157374_12563410 Ga0157374_125634102 65
905 3300013297 Ga0157378_10109176 Ga0157378_101091763 65
906 3300013297 Ga0157378_10291575 Ga0157378_102915752 65
907 3300013297 Ga0157378_10518955 Ga0157378_105189552 65
908 3300013297 Ga0157378_10526198 Ga0157378_105261982 65
909 3300013297 Ga0157378_11365590 Ga0157378_113655901 65
910 3300013297 Ga0157378_11691743 Ga0157378_116917432 65
911 3300013306 Ga0163162_10021312 Ga0163162_100213123 65
912 3300013306 Ga0163162_10157585 Ga0163162_101575853 65
913 3300013306 Ga0163162_11426549 Ga0163162_114265492 65
914 3300013306 Ga0163162_11628972 Ga0163162_116289722 65
915 3300013306 Ga0163162_13048516 Ga0163162_130485163 65
916 3300013307 Ga0157372_10733607 Ga0157372_107336073 65
917 3300013307 Ga0157372_11321913 Ga0157372_113219132 65
918 3300013307 Ga0157372_11424452 Ga0157372_114244522 65
919 3300013307 Ga0157372_11910946 Ga0157372_119109462 65
920 3300013308 Ga0157375_10355262 Ga0157375_103552623 65
921 3300013308 Ga0157375_11096901 Ga0157375_110969012 65
922 3300013308 Ga0157375_11383009 Ga0157375_113830092 65
923 3300013308 Ga0157375_11622776 Ga0157375_116227762 65
924 3300013308 Ga0157375_11886819 Ga0157375_118868191 65
925 3300014325 Ga0163163_10023321 Ga0163163_100233214 65
926 3300014325 Ga0163163_10075976 Ga0163163_100759763 65
927 3300014325 Ga0163163_10136981 Ga0163163_101369812 65
928 3300014325 Ga0163163_10370508 Ga0163163_103705081 65
929 3300014325 Ga0163163_10560290 Ga0163163_105602903 65
930 3300014325 Ga0163163_11028113 Ga0163163_110281132 65
931 3300014326 Ga0157380_10147459 Ga0157380_101474593 65
932 3300014326 Ga0157380_10325797 Ga0157380_103257972 65
933 3300014326 Ga0157380_10457320 Ga0157380_104573202 65
934 3300014326 Ga0157380_11000726 Ga0157380_110007262 65
935 3300014326 Ga0157380_11710696 Ga0157380_117106961 65
936 3300014326 Ga0157380_11769558 Ga0157380_117695582 65
937 3300014497 Ga0182008_10095943 Ga0182008_100959432 65
938 3300014497 Ga0182008_10140984 Ga0182008_101409842 65
939 3300014497 Ga0182008_10441852 Ga0182008_104418521 65
940 3300014745 Ga0157377_10006620 Ga0157377_100066202 65
941 3300014745 Ga0157377_10125273 Ga0157377_101252732 65
942 3300014745 Ga0157377_10185861 Ga0157377_101858612 65
943 3300014745 Ga0157377_10333496 Ga0157377_103334962 65
944 3300014745 Ga0157377_10908222 Ga0157377_109082221 65
945 3300014968 Ga0157379_10051909 Ga0157379_100519093 65
946 3300014968 Ga0157379_10392223 Ga0157379_103922232 65
947 3300014968 Ga0157379_10930379 Ga0157379_109303791 65
948 3300014968 Ga0157379_11064750 Ga0157379_110647502 65
949 3300014969 Ga0157376_10188914 Ga0157376_101889143 65
950 3300014969 Ga0157376_10447010 Ga0157376_104470102 65
951 3300014969 Ga0157376_11348474 Ga0157376_113484742 65
952 3300014969 Ga0157376_12944680 Ga0157376_129446802 65
953 3300015261 Ga0182006_1203302 Ga0182006_12033021 65
954 3300017792 Ga0163161_10081497 Ga0163161_100814972 65
955 3300017792 Ga0163161_10835260 Ga0163161_108352602 65
956 3300017792 Ga0163161_11469842 Ga0163161_114698422 65
957 3300017792 Ga0163161_11614070 Ga0163161_116140701 65
958 3300020070 Ga0206356_10401185 Ga0206356_104011852 65
959 3300020081 Ga0206354_10450968 Ga0206354_104509682 65
960 3300021358 Ga0213873_10228913 Ga0213873_102289131 65
961 3300025885 Ga0207653_10021748 Ga0207653_100217483 65
962 3300025885 Ga0207653_10075630 Ga0207653_100756302 65
963 3300025893 Ga0207682_10089257 Ga0207682_100892572 65
964 3300025899 Ga0207642_10433718 Ga0207642_104337181 65
965 3300025900 Ga0207710_10510974 Ga0207710_105109742 65
966 3300025901 Ga0207688_10004003 Ga0207688_100040035 65
967 3300025901 Ga0207688_10123251 Ga0207688_101232512 65
968 3300025901 Ga0207688_10393919 Ga0207688_103939193 65
969 3300025901 Ga0207688_10463122 Ga0207688_104631222 65
970 3300025901 Ga0207688_10727720 Ga0207688_107277201 65
971 3300025903 Ga0207680_10245408 Ga0207680_102454081 65
972 3300025905 Ga0207685_10296705 Ga0207685_102967053 65
973 3300025907 Ga0207645_10217270 Ga0207645_102172703 65
974 3300025907 Ga0207645_10222542 Ga0207645_102225422 65
975 3300025907 Ga0207645_11140701 Ga0207645_111407011 65
976 3300025908 Ga0207643_10035888 Ga0207643_100358882 65
977 3300025908 Ga0207643_10565817 Ga0207643_105658172 65
978 3300025908 Ga0207643_10938039 Ga0207643_109380392 65
979 3300025910 Ga0207684_10005044 Ga0207684_100050449 65
980 3300025910 Ga0207684_10013660 Ga0207684_100136602 65
981 3300025910 Ga0207684_10022312 Ga0207684_100223126 65
982 3300025910 Ga0207684_10095895 Ga0207684_100958953 65
983 3300025910 Ga0207684_10120082 Ga0207684_101200822 65
984 3300025910 Ga0207684_10365248 Ga0207684_103652482 65
985 3300025910 Ga0207684_10789247 Ga0207684_107892472 65
986 3300025910 Ga0207684_10826190 Ga0207684_108261902 65
987 3300025910 Ga0207684_11071782 Ga0207684_110717822 65
988 3300025910 Ga0207684_11725680 Ga0207684_117256801 65
989 3300025911 Ga0207654_10288440 Ga0207654_102884402 65
990 3300025911 Ga0207654_10360121 Ga0207654_103601212 65
991 3300025912 Ga0207707_10263654 Ga0207707_102636542 65
992 3300025912 Ga0207707_10263720 Ga0207707_102637201 65
993 3300025912 Ga0207707_10686455 Ga0207707_106864552 65
994 3300025913 Ga0207695_10909366 Ga0207695_109093661 65
995 3300025913 Ga0207695_11407674 Ga0207695_114076742 65
996 3300025915 Ga0207693_10368879 Ga0207693_103688793 65
997 3300025915 Ga0207693_10570511 Ga0207693_105705112 65
998 3300025916 Ga0207663_10915934 Ga0207663_109159341 65
999 3300025917 Ga0207660_10000001 Ga0207660_10000001251 65
1000 3300025917 Ga0207660_10532652 Ga0207660_105326522 65
1001 3300025917 Ga0207660_10753296 Ga0207660_107532962 65
1002 3300025918 Ga0207662_10001552 Ga0207662_100015527 65
1003 3300025918 Ga0207662_10008573 Ga0207662_100085735 65
1004 3300025918 Ga0207662_10036691 Ga0207662_100366913 65
1005 3300025918 Ga0207662_10139670 Ga0207662_101396702 65
1006 3300025918 Ga0207662_10305790 Ga0207662_103057901 65
1007 3300025918 Ga0207662_10702413 Ga0207662_107024132 65
1008 3300025918 Ga0207662_11187862 Ga0207662_111878622 65
1009 3300025920 Ga0207649_11375476 Ga0207649_113754762 65
1010 3300025921 Ga0207652_11157607 Ga0207652_111576072 65
1011 3300025922 Ga0207646_10001758 Ga0207646_1000175818 65
1012 3300025922 Ga0207646_10001760 Ga0207646_100017605 65
1013 3300025922 Ga0207646_10013379 Ga0207646_100133794 65
1014 3300025922 Ga0207646_10041390 Ga0207646_100413904 65
1015 3300025922 Ga0207646_10051728 Ga0207646_100517284 65
1016 3300025922 Ga0207646_10222479 Ga0207646_102224793 65
1017 3300025922 Ga0207646_10369562 Ga0207646_103695621 65
1018 3300025922 Ga0207646_10743188 Ga0207646_107431882 65
1019 3300025922 Ga0207646_10856579 Ga0207646_108565793 65
1020 3300025922 Ga0207646_11001051 Ga0207646_110010512 65
1021 3300025923 Ga0207681_10391405 Ga0207681_103914052 65
1022 3300025923 Ga0207681_10531890 Ga0207681_105318903 65
1023 3300025923 Ga0207681_11411722 Ga0207681_114117222 65
1024 3300025924 Ga0207694_10137276 Ga0207694_101372763 65
1025 3300025924 Ga0207694_11726349 Ga0207694_117263491 65
1026 3300025925 Ga0207650_10069442 Ga0207650_100694423 65
1027 3300025925 Ga0207650_11659401 Ga0207650_116594012 65
1028 3300025926 Ga0207659_10035936 Ga0207659_100359364 65
1029 3300025926 Ga0207659_10241837 Ga0207659_102418372 65
1030 3300025927 Ga0207687_10081074 Ga0207687_100810743 65
1031 3300025927 Ga0207687_10772001 Ga0207687_107720012 65
1032 3300025927 Ga0207687_11192890 Ga0207687_111928902 65
1033 3300025927 Ga0207687_11701990 Ga0207687_117019902 65
1034 3300025932 Ga0207690_10029613 Ga0207690_100296132 65
1035 3300025932 Ga0207690_10179735 Ga0207690_101797351 65
1036 3300025932 Ga0207690_10368299 Ga0207690_103682991 65
1037 3300025932 Ga0207690_10611939 Ga0207690_106119391 65
1038 3300025932 Ga0207690_10824156 Ga0207690_108241561 65
1039 3300025932 Ga0207690_10872555 Ga0207690_108725552 65
1040 3300025932 Ga0207690_11205692 Ga0207690_112056922 65
1041 3300025932 Ga0207690_11814073 Ga0207690_118140732 65
1042 3300025933 Ga0207706_10068175 Ga0207706_100681753 65
1043 3300025933 Ga0207706_10216208 Ga0207706_102162083 65
1044 3300025933 Ga0207706_10535042 Ga0207706_105350422 65
1045 3300025933 Ga0207706_10664476 Ga0207706_106644762 65
1046 3300025933 Ga0207706_10831563 Ga0207706_108315631 65
1047 3300025933 Ga0207706_10874223 Ga0207706_108742232 65
1048 3300025933 Ga0207706_11590141 Ga0207706_115901412 65
1049 3300025934 Ga0207686_10687290 Ga0207686_106872902 65
1050 3300025934 Ga0207686_10876029 Ga0207686_108760292 65
1051 3300025935 Ga0207709_10066862 Ga0207709_100668623 65
1052 3300025935 Ga0207709_10088123 Ga0207709_100881233 65
1053 3300025935 Ga0207709_10216042 Ga0207709_102160422 65
1054 3300025935 Ga0207709_10363492 Ga0207709_103634923 65
1055 3300025935 Ga0207709_10463702 Ga0207709_104637022 65
1056 3300025935 Ga0207709_10641556 Ga0207709_106415562 65
1057 3300025935 Ga0207709_11064505 Ga0207709_110645052 65
1058 3300025936 Ga0207670_10052532 Ga0207670_100525322 65
1059 3300025937 Ga0207669_10031250 Ga0207669_100312502 65
1060 3300025937 Ga0207669_10071786 Ga0207669_100717863 65
1061 3300025937 Ga0207669_10473288 Ga0207669_104732881 65
1062 3300025937 Ga0207669_10610188 Ga0207669_106101883 65
1063 3300025937 Ga0207669_11107084 Ga0207669_111070842 65
1064 3300025937 Ga0207669_11347822 Ga0207669_113478222 65
1065 3300025938 Ga0207704_10374552 Ga0207704_103745522 65
1066 3300025938 Ga0207704_10801267 Ga0207704_108012672 65
1067 3300025938 Ga0207704_10952831 Ga0207704_109528312 65
1068 3300025938 Ga0207704_11413423 Ga0207704_114134232 65
1069 3300025938 Ga0207704_11815955 Ga0207704_118159552 65
1070 3300025939 Ga0207665_10649547 Ga0207665_106495472 65
1071 3300025939 Ga0207665_10827712 Ga0207665_108277122 65
1072 3300025940 Ga0207691_10310354 Ga0207691_103103543 65
1073 3300025940 Ga0207691_10459822 Ga0207691_104598223 65
1074 3300025941 Ga0207711_10207040 Ga0207711_102070403 65
1075 3300025941 Ga0207711_10352663 Ga0207711_103526632 65
1076 3300025941 Ga0207711_10352729 Ga0207711_103527291 65
1077 3300025941 Ga0207711_10997610 Ga0207711_109976102 65
1078 3300025942 Ga0207689_10122400 Ga0207689_101224002 65
1079 3300025942 Ga0207689_10124139 Ga0207689_101241393 65
1080 3300025942 Ga0207689_10426960 Ga0207689_104269602 65
1081 3300025942 Ga0207689_10624241 Ga0207689_106242413 65
1082 3300025942 Ga0207689_11012991 Ga0207689_110129912 65
1083 3300025944 Ga0207661_10355755 Ga0207661_103557552 65
1084 3300025944 Ga0207661_10462930 Ga0207661_104629302 65
1085 3300025944 Ga0207661_10648250 Ga0207661_106482501 65
1086 3300025945 Ga0207679_10057635 Ga0207679_100576353 65
1087 3300025945 Ga0207679_10834023 Ga0207679_108340232 65
1088 3300025945 Ga0207679_11331521 Ga0207679_113315211 65
1089 3300025945 Ga0207679_11604787 Ga0207679_116047872 65
1090 3300025949 Ga0207667_11046175 Ga0207667_110461752 65
1091 3300025949 Ga0207667_11192094 Ga0207667_111920942 65
1092 3300025949 Ga0207667_11665490 Ga0207667_116654902 65
1093 3300025949 Ga0207667_12069306 Ga0207667_120693061 65
1094 3300025960 Ga0207651_10025909 Ga0207651_100259092 65
1095 3300025960 Ga0207651_10195244 Ga0207651_101952442 65
1096 3300025960 Ga0207651_10252120 Ga0207651_102521202 65
1097 3300025960 Ga0207651_11105056 Ga0207651_111050562 65
1098 3300025961 Ga0207712_10029138 Ga0207712_100291383 65
1099 3300025961 Ga0207712_10075853 Ga0207712_100758533 65
1100 3300025961 Ga0207712_10083798 Ga0207712_100837983 65
1101 3300025961 Ga0207712_10144219 Ga0207712_101442193 65
1102 3300025961 Ga0207712_11484375 Ga0207712_114843752 65
1103 3300025961 Ga0207712_11655598 Ga0207712_116555981 65
1104 3300025972 Ga0207668_10358455 Ga0207668_103584552 65
1105 3300025972 Ga0207668_11632020 Ga0207668_116320201 65
1106 3300025981 Ga0207640_10268898 Ga0207640_102688982 65
1107 3300025981 Ga0207640_10534183 Ga0207640_105341831 65
1108 3300025981 Ga0207640_10785747 Ga0207640_107857472 65
1109 3300025981 Ga0207640_11266966 Ga0207640_112669661 65
1110 3300025981 Ga0207640_11659007 Ga0207640_116590072 65
1111 3300025986 Ga0207658_10115084 Ga0207658_101150843 65
1112 3300025986 Ga0207658_10610226 Ga0207658_106102262 65
1113 3300025986 Ga0207658_11133201 Ga0207658_111332012 65
1114 3300026023 Ga0207677_10059390 Ga0207677_100593904 65
1115 3300026023 Ga0207677_10379402 Ga0207677_103794022 65
1116 3300026023 Ga0207677_10460829 Ga0207677_104608292 65
1117 3300026023 Ga0207677_10714338 Ga0207677_107143383 65
1118 3300026035 Ga0207703_10094664 Ga0207703_100946643 65
1119 3300026035 Ga0207703_10486164 Ga0207703_104861642 65
1120 3300026035 Ga0207703_10788586 Ga0207703_107885862 65
1121 3300026035 Ga0207703_10889776 Ga0207703_108897762 65
1122 3300026035 Ga0207703_11911755 Ga0207703_119117552 65
1123 3300026041 Ga0207639_10067898 Ga0207639_100678983 65
1124 3300026067 Ga0207678_10006046 Ga0207678_100060467 65
1125 3300026067 Ga0207678_10339487 Ga0207678_103394872 65
1126 3300026067 Ga0207678_10354806 Ga0207678_103548063 65
1127 3300026075 Ga0207708_10002944 Ga0207708_100029443 65
1128 3300026075 Ga0207708_10036978 Ga0207708_100369783 65
1129 3300026075 Ga0207708_10078295 Ga0207708_100782953 65
1130 3300026075 Ga0207708_10413580 Ga0207708_104135802 65
1131 3300026075 Ga0207708_10779311 Ga0207708_107793112 65
1132 3300026075 Ga0207708_10908453 Ga0207708_109084531 65
1133 3300026075 Ga0207708_10927897 Ga0207708_109278972 65
1134 3300026075 Ga0207708_11761080 Ga0207708_117610802 65
1135 3300026078 Ga0207702_11214143 Ga0207702_112141432 65
1136 3300026089 Ga0207648_10006847 Ga0207648_100068474 65
1137 3300026089 Ga0207648_10390099 Ga0207648_103900993 65
1138 3300026089 Ga0207648_10662571 Ga0207648_106625712 65
1139 3300026089 Ga0207648_11275149 Ga0207648_112751492 65
1140 3300026089 Ga0207648_11361083 Ga0207648_113610832 65
1141 3300026089 Ga0207648_11644983 Ga0207648_116449832 65
1142 3300026089 Ga0207648_11711298 Ga0207648_117112982 65
1143 3300026089 Ga0207648_11784957 Ga0207648_117849572 65
1144 3300026089 Ga0207648_12274474 Ga0207648_122744741 65
1145 3300026095 Ga0207676_10017526 Ga0207676_100175264 65
1146 3300026095 Ga0207676_10197690 Ga0207676_101976902 65
1147 3300026095 Ga0207676_10256628 Ga0207676_102566282 65
1148 3300026095 Ga0207676_11416650 Ga0207676_114166502 65
1149 3300026095 Ga0207676_11696900 Ga0207676_116969002 65
1150 3300026095 Ga0207676_11721930 Ga0207676_117219302 65
1151 3300026095 Ga0207676_11867985 Ga0207676_118679852 65
1152 3300026116 Ga0207674_10009674 Ga0207674_100096748 65
1153 3300026116 Ga0207674_10257098 Ga0207674_102570982 65
1154 3300026116 Ga0207674_10465154 Ga0207674_104651542 65
1155 3300026118 Ga0207675_100009163 Ga0207675_1000091637 65
1156 3300026118 Ga0207675_100051274 Ga0207675_1000512744 65
1157 3300026118 Ga0207675_100129179 Ga0207675_1001291793 65
1158 3300026118 Ga0207675_100192589 Ga0207675_1001925892 65
1159 3300026118 Ga0207675_100388211 Ga0207675_1003882112 65
1160 3300026118 Ga0207675_100564530 Ga0207675_1005645302 65
1161 3300026118 Ga0207675_100606164 Ga0207675_1006061642 65
1162 3300026118 Ga0207675_100705577 Ga0207675_1007055772 65
1163 3300026118 Ga0207675_100817088 Ga0207675_1008170882 65
1164 3300026118 Ga0207675_101978889 Ga0207675_1019788891 65
1165 3300026118 Ga0207675_102430705 Ga0207675_1024307052 65
1166 3300026118 Ga0207675_102660541 Ga0207675_1026605411 65
1167 3300026121 Ga0207683_10075494 Ga0207683_100754942 65
1168 3300026121 Ga0207683_10091226 Ga0207683_100912265 65
1169 3300026121 Ga0207683_10148904 Ga0207683_101489042 65
1170 3300026121 Ga0207683_10216736 Ga0207683_102167362 65
1171 3300026121 Ga0207683_10294037 Ga0207683_102940373 65
1172 3300026121 Ga0207683_10473586 Ga0207683_104735863 65
1173 3300026121 Ga0207683_10658574 Ga0207683_106585742 65
1174 3300026142 Ga0207698_10086922 Ga0207698_100869222 65
1175 3300026142 Ga0207698_11382250 Ga0207698_113822501 65
1176 3300027424 Ga0209984_1020535 Ga0209984_10205352 65
1177 3300027543 Ga0209999_1067588 Ga0209999_10675882 65
1178 3300027876 Ga0209974_10016701 Ga0209974_100167013 65
1179 3300027907 Ga0207428_10026488 Ga0207428_100264884 65
1180 3300027907 Ga0207428_10120009 Ga0207428_101200093 65
1181 3300027907 Ga0207428_10330436 Ga0207428_103304362 65
1182 3300028379 Ga0268266_10368340 Ga0268266_103683402 65
1183 3300028380 Ga0268265_10459244 Ga0268265_104592443 65
1184 3300028380 Ga0268265_10498828 Ga0268265_104988282 65
1185 3300028380 Ga0268265_10965387 Ga0268265_109653871 65
1186 3300028381 Ga0268264_10128666 Ga0268264_101286661 65
1187 3300028381 Ga0268264_10655434 Ga0268264_106554342 65
1188 3300028381 Ga0268264_10728877 Ga0268264_107288773 65
1189 3300028381 Ga0268264_11301259 Ga0268264_113012592 65
1190 3300028381 Ga0268264_11678505 Ga0268264_116785051 65
1191 3300028381 Ga0268264_11830042 Ga0268264_118300422 65
1192 3300028558 Ga0265326_10042405 Ga0265326_100424053 65
1193 3300028563 Ga0265319_1029395 Ga0265319_10293953 65
1194 3300028563 Ga0265319_1046228 Ga0265319_10462283 65
1195 3300028573 Ga0265334_10080353 Ga0265334_100803533 65
1196 3300028573 Ga0265334_10294852 Ga0265334_102948521 65
1197 3300028577 Ga0265318_10014337 Ga0265318_100143374 65
1198 3300028577 Ga0265318_10015236 Ga0265318_100152364 65
1199 3300028577 Ga0265318_10096317 Ga0265318_100963173 65
1200 3300028577 Ga0265318_10198670 Ga0265318_101986701 65
1201 3300028653 Ga0265323_10125461 Ga0265323_101254612 65
1202 3300028654 Ga0265322_10129259 Ga0265322_101292592 65
1203 3300028666 Ga0265336_10092162 Ga0265336_100921621 65
1204 3300028666 Ga0265336_10121837 Ga0265336_101218372 65
1205 3300028800 Ga0265338_10055450 Ga0265338_100554503 65
1206 3300028800 Ga0265338_10435140 Ga0265338_104351402 65
1207 3300029957 Ga0265324_10175162 Ga0265324_101751622 65
1208 3300029957 Ga0265324_10296532 Ga0265324_102965322 65
1209 3300031240 Ga0265320_10038880 Ga0265320_100388802 65
1210 3300031240 Ga0265320_10092587 Ga0265320_100925871 65
1211 3300031240 Ga0265320_10202760 Ga0265320_102027602 65
1212 3300031241 Ga0265325_10033223 Ga0265325_100332233 65
1213 3300031241 Ga0265325_10116365 Ga0265325_101163652 65
1214 3300031241 Ga0265325_10202544 Ga0265325_102025442 65
1215 3300031247 Ga0265340_10094848 Ga0265340_100948483 65
1216 3300031249 Ga0265339_10405587 Ga0265339_104055872 65
1217 3300031249 Ga0265339_10442277 Ga0265339_104422772 65
1218 3300031344 Ga0265316_10278545 Ga0265316_102785453 65
1219 3300031344 Ga0265316_11011191 Ga0265316_110111911 65
1220 3300031548 Ga0307408_100181505 Ga0307408_1001815053 65
1221 3300031548 Ga0307408_101280596 Ga0307408_1012805962 65
1222 3300031665 Ga0316575_10308554 Ga0316575_103085542 65
1223 3300031691 Ga0316579_10036556 Ga0316579_100365562 65
1224 3300031711 Ga0265314_10189976 Ga0265314_101899763 65
1225 3300031712 Ga0265342_10154000 Ga0265342_101540002 65
1226 3300031727 Ga0316576_10228745 Ga0316576_102287452 65
1227 3300031731 Ga0307405_10292573 Ga0307405_102925732 65
1228 3300031731 Ga0307405_10473090 Ga0307405_104730903 65
1229 3300031733 Ga0316577_10084905 Ga0316577_100849053 65
1230 3300031824 Ga0307413_10138272 Ga0307413_101382722 65
1231 3300031824 Ga0307413_10412872 Ga0307413_104128722 65
1232 3300031824 Ga0307413_10620139 Ga0307413_106201391 65
1233 3300031824 Ga0307413_10856567 Ga0307413_108565672 65
1234 3300031824 Ga0307413_11002417 Ga0307413_110024172 65
1235 3300031824 Ga0307413_11730237 Ga0307413_117302371 65
1236 3300031852 Ga0307410_10176327 Ga0307410_101763273 65
1237 3300031852 Ga0307410_10246946 Ga0307410_102469463 65
1238 3300031852 Ga0307410_10624168 Ga0307410_106241682 65
1239 3300031852 Ga0307410_10946701 Ga0307410_109467012 65
1240 3300031852 Ga0307410_11296859 Ga0307410_112968591 65
1241 3300031852 Ga0307410_11966603 Ga0307410_119666031 65
1242 3300031901 Ga0307406_10099751 Ga0307406_100997513 65
1243 3300031901 Ga0307406_10313698 Ga0307406_103136983 65
1244 3300031903 Ga0307407_10070925 Ga0307407_100709252 65
1245 3300031903 Ga0307407_10408694 Ga0307407_104086942 65
1246 3300031903 Ga0307407_10545436 Ga0307407_105454362 65
1247 3300031903 Ga0307407_10594033 Ga0307407_105940332 65
1248 3300031903 Ga0307407_11488511 Ga0307407_114885112 65
1249 3300031911 Ga0307412_10197343 Ga0307412_101973431 65
1250 3300031995 Ga0307409_100070578 Ga0307409_1000705783 65
1251 3300031995 Ga0307409_100100508 Ga0307409_1001005084 65
1252 3300031995 Ga0307409_100120466 Ga0307409_1001204663 65
1253 3300031995 Ga0307409_100202470 Ga0307409_1002024703 65
1254 3300031995 Ga0307409_100203152 Ga0307409_1002031523 65
1255 3300031995 Ga0307409_100857714 Ga0307409_1008577141 65
1256 3300031995 Ga0307409_100906556 Ga0307409_1009065562 65
1257 3300031995 Ga0307409_101223614 Ga0307409_1012236142 65
1258 3300031995 Ga0307409_101488461 Ga0307409_1014884612 65
1259 3300031995 Ga0307409_102925021 Ga0307409_1029250211 65
1260 3300032002 Ga0307416_100036600 Ga0307416_1000366005 65
1261 3300032002 Ga0307416_100114459 Ga0307416_1001144594 65
1262 3300032002 Ga0307416_100314122 Ga0307416_1003141223 65
1263 3300032004 Ga0307414_10544722 Ga0307414_105447222 65
1264 3300032004 Ga0307414_11370110 Ga0307414_113701102 65
1265 3300032005 Ga0307411_10092344 Ga0307411_100923442 65
1266 3300032005 Ga0307411_10497141 Ga0307411_104971413 65
1267 3300032005 Ga0307411_10998312 Ga0307411_109983122 65
1268 3300032005 Ga0307411_11160548 Ga0307411_111605482 65
1269 3300032126 Ga0307415_100008451 Ga0307415_1000084515 65
1270 3300032126 Ga0307415_100094909 Ga0307415_1000949093 65
1271 3300032126 Ga0307415_100418159 Ga0307415_1004181593 65
1272 3300032126 Ga0307415_100741008 Ga0307415_1007410082 65
1273 3300032126 Ga0307415_101038163 Ga0307415_1010381632 65
1274 3300032126 Ga0307415_102109644 Ga0307415_1021096442 65
1275 3300032168 Ga0316593_10060785 Ga0316593_100607852 65
1276 3300034816 Ga0373930_0112362 Ga0373930_0112362_11_208 65
1277 3300034820 Ga0373959_0134558 Ga0373959_0134558_271_468 65
1278 3300034957 Ga0373938_0136456 Ga0373938_0136456_204_401 65
1279 3300035083 Ga0373926_0260757 Ga0373926_0260757_341_538 65
1280 3300035084 Ga0373928_0075415 Ga0373928_0075415_259_456 65
1281 3300035085 Ga0373929_0171810 Ga0373929_0171810_195_392 65
1282 3300035090 Ga0373949_0223302 Ga0373949_0223302_176_373 65
1283 3300035111 Ga0373923_0418534 Ga0373923_0418534_156_353 65
1284 3300035111 Ga0373923_0588566 Ga0373923_0588566_57_254 65
1285 3300035112 Ga0373932_0055351 Ga0373932_0055351_138_335 65
1286 3300035113 Ga0373936_0160661 Ga0373936_0160661_84_281 65
1287 3300035113 Ga0373936_0425556 Ga0373936_0425556_162_359 65
1288 3300035114 Ga0373939_0176648 Ga0373939_0176648_13_210 65
1289 3300035114 Ga0373939_0204343 Ga0373939_0204343_307_504 65
1290 3300035114 Ga0373939_0349023 Ga0373939_0349023_245_442 65
1291 3300035115 Ga0373941_0010108 Ga0373941_0010108_2025_2222 65
1292 3300035115 Ga0373941_0132695 Ga0373941_0132695_497_694 65
1293 3300035115 Ga0373941_0339692 Ga0373941_0339692_317_514 65
1294 3300035121 Ga0373960_0038670 Ga0373960_0038670_652_849 65
1295 3300035121 Ga0373960_0148990 Ga0373960_0148990_362_559 65
1296 3300035170 Ga0373943_0315581 Ga0373943_0315581_156_353 65
1297 3300035170 Ga0373943_0406739 Ga0373943_0406739_162_359 65
1298 3300035170 Ga0373943_0435170 Ga0373943_0435170_466_663 65
1299 3300035171 Ga0373946_0325646 Ga0373946_0325646_89_286 65
1300 3300035172 Ga0373955_0497163 Ga0373955_0497163_276_473 65
1301 3300035207 Ga0373942_0059390 Ga0373942_0059390_699_896 65
1302 3300035241 Ga0373961_0108427 Ga0373961_0108427_348_545 65
1303 3300035241 Ga0373961_0135510 Ga0373961_0135510_268_465 65
1304 3300035241 Ga0373961_0158103 Ga0373961_0158103_400_597 65
1305 3300035241 Ga0373961_0423741 Ga0373961_0423741_136_333 65
1306 3300035242 Ga0373962_0004538 Ga0373962_0004538_2093_2290 65
1307 3300035242 Ga0373962_0092957 Ga0373962_0092957_617_814 65
1308 3300035691 Ga0373931_0037692 Ga0373931_0037692_329_526 65
1309 3300035691 Ga0373931_0081925 Ga0373931_0081925_406_603 65
1310 3300035691 Ga0373931_0174715 Ga0373931_0174715_200_397 65
1311 3300035692 Ga0373935_0457366 Ga0373935_0457366_544_741 65
1312 3300035725 Ga0373947_0377948 Ga0373947_0377948_288_485 65
1313 3300035725 Ga0373947_0538692 Ga0373947_0538692_203_400 65
1314 3300036401 Ga0373937_0098767 Ga0373937_0098767_1625_1822 65
1315 3300036401 Ga0373937_0575731 Ga0373937_0575731_365_562 65
1316 3300036401 Ga0373937_1047203 Ga0373937_1047203_293_490 65
1317 3300036401 Ga0373937_1085018 Ga0373937_1085018_385_582 65
1318 3300037068 Ga0373925_0137102 Ga0373925_0137102_907_1104 65
1319 3300037418 Ga0395900_0819052 Ga0395900_0819052_93_293 65
1320 3300037471 Ga0395905_0626916 Ga0395905_0626916_211_408 65
1321 3300038443 Ga0395901_1940427 Ga0395901_1940427_71_268 65
1322 3300038443 Ga0395901_1957754 Ga0395901_1957754_60_257 65
1323 3300038996 Ga0242420_067071 Ga0242420_067071_460_657 65
1324 3300039453 Ga0436362_1182383 Ga0436362_1182383_212_421 65
1325 3300041408 Ga0439453_0051394 Ga0439453_0051394_529_726 65
1326 3300041411 Ga0439466_0264025 Ga0439466_0264025_12_209 65
1327 3300041413 Ga0439465_0019690 Ga0439465_0019690_1427_1624 65
1328 3300041413 Ga0439465_0151593 Ga0439465_0151593_617_814 65
1329 3300041413 Ga0439465_0258839 Ga0439465_0258839_207_404 65
1330 3300041443 Ga0451789_0456423 Ga0451789_0456423_90_287 65
1331 3300041443 Ga0451789_0746665 Ga0451789_0746665_185_382 65
1332 3300041452 Ga0451793_0530653 Ga0451793_0530653_138_335 65
1333 3300041459 Ga0451800_0835134 Ga0451800_0835134_246_443 65
1334 3300041460 Ga0451802_0119190 Ga0451802_0119190_139_336 65
1335 3300041460 Ga0451802_0335512 Ga0451802_0335512_265_462 65
1336 3300041460 Ga0451802_0378965 Ga0451802_0378965_969_1166 65
1337 3300041486 Ga0451807_2364034 Ga0451807_2364034_66_263 65
1338 3300041503 Ga0451847_0573800 Ga0451847_0573800_166_363 65
1339 3300041503 Ga0451847_0953196 Ga0451847_0953196_111_308 65
1340 3300041505 Ga0451849_1243198 Ga0451849_1243198_186_383 65
1341 3300041507 Ga0451851_0324799 Ga0451851_0324799_421_618 65
1342 3300041512 Ga0451853_0244650 Ga0451853_0244650_333_530 65
1343 3300041512 Ga0451853_1611157 Ga0451853_1611157_120_317 65
1344 3300041512 Ga0451853_3208146 Ga0451853_3208146_595_792 65
1345 3300041997 Ga0439431_0114976 Ga0439431_0114976_492_689 65
1346 3300041999 Ga0439433_0132512 Ga0439433_0132512_16_213 65
1347 3300042012 Ga0439455_0042020 Ga0439455_0042020_622_819 65
1348 3300042015 Ga0439462_0139261 Ga0439462_0139261_456_665 65
1349 3300042118 Ga0450914_057630 Ga0450914_057630_293_490 65
1350 3300042120 Ga0450917_012715 Ga0450917_012715_308_505 65
1351 3300042122 Ga0450920_027840 Ga0450920_027840_576_773 65
1352 3300042122 Ga0450920_044907 Ga0450920_044907_577_786 65
1353 3300042122 Ga0450920_052166 Ga0450920_052166_613_810 65
1354 3300042125 Ga0450923_073823 Ga0450923_073823_458_655 65
1355 3300042125 Ga0450923_125005 Ga0450923_125005_402_599 65
1356 3300042145 Ga0450906_018798 Ga0450906_018798_385_582 65
1357 3300042145 Ga0450906_089470 Ga0450906_089470_275_484 65
1358 3300042146 Ga0450907_013045 Ga0450907_013045_943_1152 65
1359 3300042147 Ga0450910_002451 Ga0450910_002451_1751_1948 65
1360 3300042147 Ga0450910_038270 Ga0450910_038270_213_410 65
1361 3300042147 Ga0450910_077941 Ga0450910_077941_286_495 65
1362 3300042147 Ga0450910_079507 Ga0450910_079507_283_480 65
1363 3300042156 Ga0439446_0143931 Ga0439446_0143931_395_601 65
1364 3300042156 Ga0439446_0170452 Ga0439446_0170452_151_348 65
1365 3300042157 Ga0439458_0011761 Ga0439458_0011761_605_802 65
1366 3300042185 Ga0450909_039047 Ga0450909_039047_199_396 65
1367 3300042435 Ga0439434_0105973 Ga0439434_0105973_100_306 65
1368 3300042436 Ga0439435_0236970 Ga0439435_0236970_375_572 65
1369 3300042438 Ga0439459_0046489 Ga0439459_0046489_22_219 65
1370 3300042531 Ga0450918_069211 Ga0450918_069211_135_344 65
1371 3300042533 Ga0450901_017917 Ga0450901_017917_479_676 65
1372 3300042876 Ga0451577_0079810 Ga0451577_0079810_1742_1939 65
1373 3300042876 Ga0451577_0231293 Ga0451577_0231293_1078_1275 65
1374 3300044673 Ga0453683_0049177 Ga0453683_0049177_1507_1704 65
1375 3300044673 Ga0453683_0203102 Ga0453683_0203102_418_615 65
1376 3300044673 Ga0453683_0434985 Ga0453683_0434985_500_697 65
1377 3300044712 Ga0453684_0338068 Ga0453684_0338068_976_1173 65
1378 3300044712 Ga0453684_0679069 Ga0453684_0679069_787_984 65
1379 3300044719 Ga0466971_0721369 Ga0466971_0721369_258_455 65
1380 3300044735 Ga0466968_0610138 Ga0466968_0610138_267_473 65
1381 3300045051 Ga0451576_0069769 Ga0451576_0069769_2694_2891 65
1382 3300045051 Ga0451576_0197485 Ga0451576_0197485_1737_1934 65
1383 3300045051 Ga0451576_0293149 Ga0451576_0293149_127_324 65
1384 3300045051 Ga0451576_1186172 Ga0451576_1186172_388_585 65
1385 3300045976 Ga0466967_2605642 Ga0466967_2605642_188_385 65
1386 3300046454 Ga0495592_0186750 Ga0495592_0186750_866_1063 65
1387 3300046455 Ga0495603_0119112 Ga0495603_0119112_460_657 65
1388 3300046455 Ga0495603_0292405 Ga0495603_0292405_89_286 65
1389 3300046455 Ga0495603_0516289 Ga0495603_0516289_138_335 65
1390 3300046459 Ga0495629_0658341 Ga0495629_0658341_102_299 65
1391 3300046459 Ga0495629_0962103 Ga0495629_0962103_340_537 65
1392 3300046461 Ga0495641_0111810 Ga0495641_0111810_18_215 65
1393 3300046461 Ga0495641_0262010 Ga0495641_0262010_137_334 65
1394 3300046463 Ga0495653_0040160 Ga0495653_0040160_928_1125 65
1395 3300046463 Ga0495653_0669777 Ga0495653_0669777_116_313 65
1396 3300046473 Ga0495582_0419128 Ga0495582_0419128_191_388 65
1397 3300046474 Ga0495605_0294234 Ga0495605_0294234_89_286 65
1398 3300046476 Ga0495662_0215970 Ga0495662_0215970_13_210 65
1399 3300046477 Ga0495664_0066755 Ga0495664_0066755_90_287 65
1400 3300046491 Ga0495584_0449276 Ga0495584_0449276_396_593 65
1401 3300046499 Ga0495594_0324024 Ga0495594_0324024_355_552 65
1402 3300046500 Ga0495596_0353788 Ga0495596_0353788_340_537 65
1403 3300046511 Ga0495608_0555395 Ga0495608_0555395_202_399 65
1404 3300046514 Ga0495618_0098636 Ga0495618_0098636_1244_1441 65
1405 3300046514 Ga0495618_0909629 Ga0495618_0909629_278_475 65
1406 3300046515 Ga0495620_0290523 Ga0495620_0290523_28_225 65
1407 3300046516 Ga0495628_0048688 Ga0495628_0048688_2769_2966 65
1408 3300046516 Ga0495628_0667714 Ga0495628_0667714_402_599 65
1409 3300046516 Ga0495628_1162274 Ga0495628_1162274_314_511 65
1410 3300046517 Ga0495630_0360014 Ga0495630_0360014_513_710 65
1411 3300046526 Ga0495666_0349772 Ga0495666_0349772_256_453 65
1412 3300046529 Ga0495652_0053061 Ga0495652_0053061_2111_2308 65
1413 3300046530 Ga0495654_0368859 Ga0495654_0368859_222_419 65
1414 3300046533 Ga0495640_0070085 Ga0495640_0070085_602_799 65
1415 3300046533 Ga0495640_0893798 Ga0495640_0893798_240_437 65
1416 3300046536 Ga0495587_0055796 Ga0495587_0055796_41_238 65
1417 3300046543 Ga0495645_0119067 Ga0495645_0119067_943_1140 65
1418 3300046559 Ga0495667_1022204 Ga0495667_1022204_72_269 65
1419 3300046616 Ga0495668_0259047 Ga0495668_0259047_148_345 65
1420 3300046616 Ga0495668_0417368 Ga0495668_0417368_479_676 65
1421 3300046642 Ga0495634_0017206 Ga0495634_0017206_202_399 65
1422 3300046642 Ga0495634_0217765 Ga0495634_0217765_684_881 65
1423 3300046642 Ga0495634_0474403 Ga0495634_0474403_109_306 65
1424 3300046648 Ga0495611_0463998 Ga0495611_0463998_283_480 65
1425 3300046663 Ga0495635_0637063 Ga0495635_0637063_44_241 65
1426 3300046664 Ga0495659_0260025 Ga0495659_0260025_207_404 65
1427 3300046665 Ga0495661_0553313 Ga0495661_0553313_295_492 65
1428 3300046674 Ga0495588_0364756 Ga0495588_0364756_411_608 65
1429 3300046678 Ga0495599_0445257 Ga0495599_0445257_525_722 65
1430 3300046681 Ga0495647_0542705 Ga0495647_0542705_224_421 65
1431 3300046681 Ga0495647_0594270 Ga0495647_0594270_217_414 65
1432 3300046683 Ga0495658_0452844 Ga0495658_0452844_413_610 65
1433 3300046683 Ga0495658_0458574 Ga0495658_0458574_525_722 65
1434 3300046683 Ga0495658_0532675 Ga0495658_0532675_436_633 65
1435 3300046690 Ga0495624_0360071 Ga0495624_0360071_362_559 65
1436 3300046810 Ga0495660_0458471 Ga0495660_0458471_318_515 65
1437 3300047315 Ga0495581_0513164 Ga0495581_0513164_449_646 65
1438 3300047315 Ga0495581_0594070 Ga0495581_0594070_309_506 65
1439 3300047315 Ga0495581_0914046 Ga0495581_0914046_70_267 65
1440 3300047317 Ga0495604_0426775 Ga0495604_0426775_567_764 65
1441 3300047318 Ga0495636_0212447 Ga0495636_0212447_508_705 65
1442 3300047319 Ga0495674_0172296 Ga0495674_0172296_391_588 65
1443 3300047321 Ga0495676_0538696 Ga0495676_0538696_475_672 65
1444 3300047321 Ga0495676_0713905 Ga0495676_0713905_78_275 65
1445 3300047322 Ga0495680_0046666 Ga0495680_0046666_776_973 65
1446 3300047322 Ga0495680_0583867 Ga0495680_0583867_312_509 65
1447 3300047471 Ga0495684_0240530 Ga0495684_0240530_572_769 65
1448 3300047673 Ga0495593_0533175 Ga0495593_0533175_265_462 65
1449 3300048903 Ga0496100_0146212 Ga0496100_0146212_93_290 65
1450 3300048903 Ga0496100_0921115 Ga0496100_0921115_420_617 65
1451 3300048904 Ga0496101_0130757 Ga0496101_0130757_944_1141 65
1452 3300048904 Ga0496101_0228531 Ga0496101_0228531_1173_1379 65
1453 3300048904 Ga0496101_0284624 Ga0496101_0284624_567_764 65
1454 3300048905 Ga0496102_0017986 Ga0496102_0017986_3460_3657 65
1455 3300048905 Ga0496102_0193975 Ga0496102_0193975_1304_1501 65
1456 3300048905 Ga0496102_0291685 Ga0496102_0291685_1093_1290 65
1457 3300048905 Ga0496102_0340513 Ga0496102_0340513_612_809 65
1458 3300048905 Ga0496102_0524730 Ga0496102_0524730_316_513 65
1459 3300048905 Ga0496102_1133565 Ga0496102_1133565_389_586 65
1460 3300048905 Ga0496102_1444448 Ga0496102_1444448_149_346 65
1461 3300048905 Ga0496102_1769930 Ga0496102_1769930_217_414 65
1462 3300048906 Ga0496103_0142381 Ga0496103_0142381_1127_1324 65
1463 3300048906 Ga0496103_0161058 Ga0496103_0161058_224_421 65
1464 3300048906 Ga0496103_0175238 Ga0496103_0175238_832_1029 65
1465 3300048907 Ga0496104_0076056 Ga0496104_0076056_2511_2708 65
1466 3300048907 Ga0496104_0812923 Ga0496104_0812923_391_588 65
1467 3300048907 Ga0496104_0911047 Ga0496104_0911047_498_695 65
1468 3300048908 Ga0496105_0052409 Ga0496105_0052409_1581_1778 65
1469 3300048908 Ga0496105_0086127 Ga0496105_0086127_1977_2174 65
1470 3300048908 Ga0496105_0579460 Ga0496105_0579460_514_711 65
1471 3300048908 Ga0496105_0759380 Ga0496105_0759380_123_320 65
1472 3300048908 Ga0496105_1193926 Ga0496105_1193926_49_246 65
1473 3300048909 Ga0496106_0188047 Ga0496106_0188047_1133_1330 65
1474 3300048909 Ga0496106_0476230 Ga0496106_0476230_241_438 65
1475 3300048909 Ga0496106_0484394 Ga0496106_0484394_489_686 65
1476 3300048909 Ga0496106_0533606 Ga0496106_0533606_25_222 65
1477 3300048909 Ga0496106_0598129 Ga0496106_0598129_598_795 65
1478 3300048909 Ga0496106_0623045 Ga0496106_0623045_593_790 65
1479 3300048909 Ga0496106_0680468 Ga0496106_0680468_317_514 65
1480 3300048909 Ga0496106_0776468 Ga0496106_0776468_114_311 65
1481 3300048909 Ga0496106_0882394 Ga0496106_0882394_214_411 65
1482 3300048909 Ga0496106_0953055 Ga0496106_0953055_216_413 65
1483 3300048910 Ga0496107_0044228 Ga0496107_0044228_1408_1605 65
1484 3300048910 Ga0496107_0379559 Ga0496107_0379559_122_319 65
1485 3300048910 Ga0496107_0488274 Ga0496107_0488274_427_624 65
1486 3300048910 Ga0496107_0598880 Ga0496107_0598880_79_276 65
1487 3300048910 Ga0496107_0724101 Ga0496107_0724101_298_495 65
1488 3300048910 Ga0496107_0747583 Ga0496107_0747583_371_568 65
1489 3300048910 Ga0496107_0748694 Ga0496107_0748694_181_378 65
1490 3300048910 Ga0496107_0766164 Ga0496107_0766164_459_656 65
1491 3300048910 Ga0496107_0848768 Ga0496107_0848768_347_544 65
1492 3300048910 Ga0496107_0978639 Ga0496107_0978639_107_304 65
1493 3300048911 Ga0496108_0053745 Ga0496108_0053745_2873_3070 65
1494 3300048911 Ga0496108_0145473 Ga0496108_0145473_1574_1771 65
1495 3300048911 Ga0496108_0204267 Ga0496108_0204267_655_852 65
1496 3300048911 Ga0496108_0383579 Ga0496108_0383579_449_646 65
1497 3300048911 Ga0496108_0700564 Ga0496108_0700564_531_728 65
1498 3300048911 Ga0496108_0710217 Ga0496108_0710217_569_766 65
1499 3300048911 Ga0496108_0912132 Ga0496108_0912132_95_292 65
1500 3300048911 Ga0496108_1332697 Ga0496108_1332697_287_493 65
1501 3300048911 Ga0496108_1522176 Ga0496108_1522176_101_298 65
1502 3300048912 Ga0496109_0036412 Ga0496109_0036412_2112_2309 65
1503 3300048912 Ga0496109_0067582 Ga0496109_0067582_333_530 65
1504 3300048912 Ga0496109_0092505 Ga0496109_0092505_1521_1718 65
1505 3300048912 Ga0496109_0106356 Ga0496109_0106356_1470_1667 65
1506 3300048912 Ga0496109_0349189 Ga0496109_0349189_695_892 65
1507 3300048912 Ga0496109_0497195 Ga0496109_0497195_263_460 65
1508 3300048912 Ga0496109_0637449 Ga0496109_0637449_386_583 65
1509 3300048912 Ga0496109_0783587 Ga0496109_0783587_462_659 65
1510 3300048912 Ga0496109_1073640 Ga0496109_1073640_463_669 65
1511 3300048912 Ga0496109_1134654 Ga0496109_1134654_466_663 65
1512 3300048912 Ga0496109_1251156 Ga0496109_1251156_369_566 65
1513 3300048913 Ga0496110_0110373 Ga0496110_0110373_1855_2052 65
1514 3300048913 Ga0496110_0142717 Ga0496110_0142717_962_1159 65
1515 3300048913 Ga0496110_0496896 Ga0496110_0496896_888_1094 65
1516 3300048913 Ga0496110_0929006 Ga0496110_0929006_277_474 65
1517 3300048913 Ga0496110_1363825 Ga0496110_1363825_297_494 65
1518 3300048914 Ga0496111_0003938 Ga0496111_0003938_8433_8630 65
1519 3300048914 Ga0496111_0081751 Ga0496111_0081751_492_689 65
1520 3300048914 Ga0496111_0294888 Ga0496111_0294888_962_1159 65
1521 3300048914 Ga0496111_0347256 Ga0496111_0347256_428_625 65
1522 3300048914 Ga0496111_0487310 Ga0496111_0487310_660_857 65
1523 3300048914 Ga0496111_0714718 Ga0496111_0714718_97_294 65
1524 3300048915 Ga0496112_0000010 Ga0496112_0000010_7322_7519 65
1525 3300048915 Ga0496112_0186898 Ga0496112_0186898_1687_1884 65
1526 3300048915 Ga0496112_0244603 Ga0496112_0244603_515_712 65
1527 3300048915 Ga0496112_0312664 Ga0496112_0312664_923_1120 65
1528 3300048915 Ga0496112_0323862 Ga0496112_0323862_784_981 65
1529 3300048915 Ga0496112_0424436 Ga0496112_0424436_358_555 65
1530 3300048915 Ga0496112_0458860 Ga0496112_0458860_766_963 65
1531 3300048915 Ga0496112_0675139 Ga0496112_0675139_88_285 65
1532 3300048915 Ga0496112_1041018 Ga0496112_1041018_80_277 65
1533 3300048915 Ga0496112_1065403 Ga0496112_1065403_193_390 65
1534 3300048915 Ga0496112_1270843 Ga0496112_1270843_137_334 65
1535 3300048916 Ga0496113_0033871 Ga0496113_0033871_1716_1913 65
1536 3300048916 Ga0496113_0105638 Ga0496113_0105638_98_295 65
1537 3300048916 Ga0496113_0596768 Ga0496113_0596768_289_486 65
1538 3300048916 Ga0496113_0931779 Ga0496113_0931779_421_618 65
1539 3300048916 Ga0496113_1529952 Ga0496113_1529952_166_363 65
1540 3300048917 Ga0496114_0349592 Ga0496114_0349592_464_661 65
1541 3300048917 Ga0496114_0706051 Ga0496114_0706051_492_689 65
1542 3300048917 Ga0496114_0775514 Ga0496114_0775514_279_476 65
1543 3300048917 Ga0496114_1021862 Ga0496114_1021862_300_497 65
1544 3300048917 Ga0496114_1148695 Ga0496114_1148695_371_577 65
1545 3300048917 Ga0496114_1677213 Ga0496114_1677213_90_287 65
1546 3300049533 Ga0501317_051384 Ga0501317_051384_384_581 65
1547 3300049533 Ga0501317_068935 Ga0501317_068935_21_230 65
1548 3300049568 Ga0501031_0055651 Ga0501031_0055651_1753_1962 65
1549 3300049568 Ga0501031_0142851 Ga0501031_0142851_415_612 65
1550 3300049568 Ga0501031_0147971 Ga0501031_0147971_923_1120 65
1551 3300049568 Ga0501031_0234572 Ga0501031_0234572_399_596 65
1552 3300049568 Ga0501031_0271783 Ga0501031_0271783_291_488 65
1553 3300049568 Ga0501031_0354651 Ga0501031_0354651_517_714 65
1554 3300049568 Ga0501031_0412535 Ga0501031_0412535_584_781 65
1555 3300049568 Ga0501031_0497217 Ga0501031_0497217_498_695 65
1556 3300049569 Ga0501032_0209669 Ga0501032_0209669_405_602 65
1557 3300049569 Ga0501032_0276406 Ga0501032_0276406_240_470 65
1558 3300049569 Ga0501032_0655575 Ga0501032_0655575_10_207 65
1559 3300049569 Ga0501032_0679382 Ga0501032_0679382_153_350 65
1560 3300049570 Ga0501033_0140817 Ga0501033_0140817_375_572 65
1561 3300049570 Ga0501033_0150024 Ga0501033_0150024_947_1144 65
1562 3300049570 Ga0501033_0469882 Ga0501033_0469882_441_650 65
1563 3300049570 Ga0501033_0825688 Ga0501033_0825688_92_289 65
1564 3300049571 Ga0501034_0767111 Ga0501034_0767111_156_353 65
1565 3300049572 Ga0501036_0008584 Ga0501036_0008584_1212_1409 65
1566 3300049572 Ga0501036_0051949 Ga0501036_0051949_2196_2393 65
1567 3300049572 Ga0501036_0111980 Ga0501036_0111980_155_352 65
1568 3300049572 Ga0501036_0149980 Ga0501036_0149980_1064_1261 65
1569 3300049572 Ga0501036_0177691 Ga0501036_0177691_1358_1567 65
1570 3300049572 Ga0501036_0232353 Ga0501036_0232353_1012_1209 65
1571 3300049572 Ga0501036_1286208 Ga0501036_1286208_28_225 65
1572 3300049573 Ga0501037_0189197 Ga0501037_0189197_782_979 65
1573 3300049573 Ga0501037_0282874 Ga0501037_0282874_39_236 65
1574 3300049573 Ga0501037_0291525 Ga0501037_0291525_41_271 65
1575 3300049573 Ga0501037_0483829 Ga0501037_0483829_171_368 65
1576 3300049573 Ga0501037_0615230 Ga0501037_0615230_352_549 65
1577 3300049574 Ga0501038_0023373 Ga0501038_0023373_2789_2998 65
1578 3300049574 Ga0501038_0071494 Ga0501038_0071494_881_1078 65
1579 3300049574 Ga0501038_0074438 Ga0501038_0074438_306_503 65
1580 3300049574 Ga0501038_0196163 Ga0501038_0196163_429_626 65
1581 3300049574 Ga0501038_0394554 Ga0501038_0394554_247_477 65
1582 3300049574 Ga0501038_1176500 Ga0501038_1176500_106_303 65
1583 3300049575 Ga0501039_0040831 Ga0501039_0040831_257_454 65
1584 3300049575 Ga0501039_0070888 Ga0501039_0070888_1558_1767 65
1585 3300049575 Ga0501039_0162928 Ga0501039_0162928_1104_1301 65
1586 3300049575 Ga0501039_0206929 Ga0501039_0206929_1227_1424 65
1587 3300049575 Ga0501039_0265718 Ga0501039_0265718_701_898 65
1588 3300049575 Ga0501039_0270485 Ga0501039_0270485_600_797 65
1589 3300049575 Ga0501039_0396766 Ga0501039_0396766_801_998 65
1590 3300049575 Ga0501039_0758798 Ga0501039_0758798_517_747 65
1591 3300049575 Ga0501039_0825865 Ga0501039_0825865_197_403 65
1592 3300049576 Ga0501040_0002643 Ga0501040_0002643_8523_8720 65
1593 3300049576 Ga0501040_0002938 Ga0501040_0002938_2956_3165 65
1594 3300049576 Ga0501040_0032435 Ga0501040_0032435_1952_2149 65
1595 3300049576 Ga0501040_0077593 Ga0501040_0077593_210_407 65
1596 3300049576 Ga0501040_0188176 Ga0501040_0188176_553_750 65
1597 3300049576 Ga0501040_0443104 Ga0501040_0443104_533_730 65
1598 3300049576 Ga0501040_0973222 Ga0501040_0973222_109_306 65
1599 3300049576 Ga0501040_1222106 Ga0501040_1222106_77_274 65
1600 3300049577 Ga0501041_0033148 Ga0501041_0033148_904_1101 65
1601 3300049577 Ga0501041_0034167 Ga0501041_0034167_1742_1951 65
1602 3300049577 Ga0501041_0140905 Ga0501041_0140905_431_628 65
1603 3300049577 Ga0501041_0165917 Ga0501041_0165917_446_643 65
1604 3300049577 Ga0501041_0203933 Ga0501041_0203933_405_602 65
1605 3300049577 Ga0501041_0303775 Ga0501041_0303775_708_905 65
1606 3300049577 Ga0501041_0309045 Ga0501041_0309045_624_821 65
1607 3300049577 Ga0501041_0499984 Ga0501041_0499984_462_659 65
1608 3300049578 Ga0501042_0000721 Ga0501042_0000721_1684_1881 65
1609 3300049578 Ga0501042_0016877 Ga0501042_0016877_4481_4690 65
1610 3300049578 Ga0501042_0049838 Ga0501042_0049838_2247_2444 65
1611 3300049578 Ga0501042_0174553 Ga0501042_0174553_1106_1303 65
1612 3300049578 Ga0501042_0313602 Ga0501042_0313602_15_212 65
1613 3300049578 Ga0501042_0414960 Ga0501042_0414960_430_627 65
1614 3300049578 Ga0501042_0552614 Ga0501042_0552614_332_529 65
1615 3300049578 Ga0501042_0617009 Ga0501042_0617009_438_635 65
1616 3300049578 Ga0501042_0789393 Ga0501042_0789393_262_459 65
1617 3300049578 Ga0501042_0815357 Ga0501042_0815357_426_623 65
1618 3300049579 Ga0501043_0191183 Ga0501043_0191183_1018_1227 65
1619 3300049579 Ga0501043_0293603 Ga0501043_0293603_848_1045 65
1620 3300049579 Ga0501043_0363336 Ga0501043_0363336_102_299 65
1621 3300049579 Ga0501043_0364023 Ga0501043_0364023_273_470 65
1622 3300049579 Ga0501043_0374868 Ga0501043_0374868_316_513 65
1623 3300049579 Ga0501043_1076892 Ga0501043_1076892_59_256 65
1624 3300049580 Ga0501046_0049354 Ga0501046_0049354_488_697 65
1625 3300049580 Ga0501046_0076501 Ga0501046_0076501_522_719 65
1626 3300049580 Ga0501046_0138464 Ga0501046_0138464_1459_1656 65
1627 3300049580 Ga0501046_0245878 Ga0501046_0245878_928_1125 65
1628 3300049580 Ga0501046_0250932 Ga0501046_0250932_903_1100 65
1629 3300049580 Ga0501046_0261226 Ga0501046_0261226_476_673 65
1630 3300049580 Ga0501046_0556061 Ga0501046_0556061_199_396 65
1631 3300049580 Ga0501046_0572502 Ga0501046_0572502_248_445 65
1632 3300049580 Ga0501046_0848904 Ga0501046_0848904_75_272 65
1633 3300049580 Ga0501046_1248722 Ga0501046_1248722_122_319 65
1634 3300049582 Ga0501048_0003897 Ga0501048_0003897_171_368 65
1635 3300049582 Ga0501048_0007913 Ga0501048_0007913_3078_3287 65
1636 3300049582 Ga0501048_0053010 Ga0501048_0053010_2301_2498 65
1637 3300049582 Ga0501048_0062120 Ga0501048_0062120_1290_1487 65
1638 3300049582 Ga0501048_0085877 Ga0501048_0085877_1240_1437 65
1639 3300049582 Ga0501048_0177340 Ga0501048_0177340_852_1049 65
1640 3300049582 Ga0501048_0257844 Ga0501048_0257844_72_269 65
1641 3300049582 Ga0501048_0656449 Ga0501048_0656449_390_587 65
1642 3300049583 Ga0501067_0002376 Ga0501067_0002376_2891_3088 65
1643 3300049583 Ga0501067_0015889 Ga0501067_0015889_1494_1691 65
1644 3300049583 Ga0501067_0040939 Ga0501067_0040939_2358_2555 65
1645 3300049583 Ga0501067_0042359 Ga0501067_0042359_1634_1831 65
1646 3300049583 Ga0501067_0057163 Ga0501067_0057163_761_958 65
1647 3300049583 Ga0501067_0604248 Ga0501067_0604248_253_450 65
1648 3300049583 Ga0501067_0618754 Ga0501067_0618754_268_465 65
1649 3300049583 Ga0501067_0735936 Ga0501067_0735936_283_492 65
1650 3300049583 Ga0501067_0887177 Ga0501067_0887177_183_380 65
1651 3300049584 Ga0501068_0044773 Ga0501068_0044773_735_932 65
1652 3300049584 Ga0501068_0100258 Ga0501068_0100258_751_948 65
1653 3300049584 Ga0501068_0105140 Ga0501068_0105140_1086_1283 65
1654 3300049584 Ga0501068_0150568 Ga0501068_0150568_252_449 65
1655 3300049584 Ga0501068_0158788 Ga0501068_0158788_813_1010 65
1656 3300049584 Ga0501068_0256123 Ga0501068_0256123_740_937 65
1657 3300049584 Ga0501068_0591741 Ga0501068_0591741_335_532 65
1658 3300049584 Ga0501068_0664022 Ga0501068_0664022_75_272 65
1659 3300049584 Ga0501068_0760934 Ga0501068_0760934_105_302 65
1660 3300049584 Ga0501068_0946175 Ga0501068_0946175_295_492 65
1661 3300049584 Ga0501068_1054087 Ga0501068_1054087_286_483 65
1662 3300049584 Ga0501068_1178114 Ga0501068_1178114_193_390 65
1663 3300049585 Ga0501069_0015225 Ga0501069_0015225_3324_3521 65
1664 3300049585 Ga0501069_0023610 Ga0501069_0023610_2650_2847 65
1665 3300049585 Ga0501069_0051657 Ga0501069_0051657_1188_1397 65
1666 3300049585 Ga0501069_0057124 Ga0501069_0057124_588_785 65
1667 3300049585 Ga0501069_0176301 Ga0501069_0176301_705_902 65
1668 3300049585 Ga0501069_0228030 Ga0501069_0228030_230_427 65
1669 3300049585 Ga0501069_0267535 Ga0501069_0267535_647_844 65
1670 3300049585 Ga0501069_0287695 Ga0501069_0287695_312_509 65
1671 3300049585 Ga0501069_0334928 Ga0501069_0334928_569_778 65
1672 3300049585 Ga0501069_0507973 Ga0501069_0507973_423_620 65
1673 3300049585 Ga0501069_0637205 Ga0501069_0637205_11_208 65
1674 3300049585 Ga0501069_0782120 Ga0501069_0782120_58_255 65
1675 3300049585 Ga0501069_0891741 Ga0501069_0891741_263_460 65
1676 3300049586 Ga0501070_0094653 Ga0501070_0094653_1771_1968 65
1677 3300049586 Ga0501070_0119176 Ga0501070_0119176_1492_1689 65
1678 3300049586 Ga0501070_0197073 Ga0501070_0197073_809_1006 65
1679 3300049586 Ga0501070_0239964 Ga0501070_0239964_166_363 65
1680 3300049586 Ga0501070_0313319 Ga0501070_0313319_228_425 65
1681 3300049586 Ga0501070_0330290 Ga0501070_0330290_991_1188 65
1682 3300049586 Ga0501070_0534940 Ga0501070_0534940_506_703 65
1683 3300049587 Ga0501071_0025969 Ga0501071_0025969_819_1016 65
1684 3300049587 Ga0501071_0061570 Ga0501071_0061570_1741_1950 65
1685 3300049587 Ga0501071_0071528 Ga0501071_0071528_760_957 65
1686 3300049587 Ga0501071_0074246 Ga0501071_0074246_457_654 65
1687 3300049587 Ga0501071_0084124 Ga0501071_0084124_932_1129 65
1688 3300049587 Ga0501071_0097601 Ga0501071_0097601_730_927 65
1689 3300049587 Ga0501071_0273972 Ga0501071_0273972_321_518 65
1690 3300049587 Ga0501071_0315385 Ga0501071_0315385_785_982 65
1691 3300049587 Ga0501071_0385909 Ga0501071_0385909_790_987 65
1692 3300049587 Ga0501071_0760151 Ga0501071_0760151_55_264 65
1693 3300049587 Ga0501071_0792823 Ga0501071_0792823_95_292 65
1694 3300049587 Ga0501071_0911728 Ga0501071_0911728_14_211 65
1695 3300049587 Ga0501071_0997521 Ga0501071_0997521_250_447 65
1696 3300049587 Ga0501071_1144003 Ga0501071_1144003_52_249 65
1697 3300049587 Ga0501071_1439705 Ga0501071_1439705_317_514 65
1698 3300049588 Ga0501072_0000437 Ga0501072_0000437_4203_4400 65
1699 3300049588 Ga0501072_0005183 Ga0501072_0005183_4468_4677 65
1700 3300049588 Ga0501072_0109974 Ga0501072_0109974_701_898 65
1701 3300049588 Ga0501072_0119150 Ga0501072_0119150_1750_1947 65
1702 3300049588 Ga0501072_0158653 Ga0501072_0158653_401_598 65
1703 3300049588 Ga0501072_0238987 Ga0501072_0238987_199_396 65
1704 3300049588 Ga0501072_0241072 Ga0501072_0241072_252_449 65
1705 3300049588 Ga0501072_0311022 Ga0501072_0311022_598_795 65
1706 3300049588 Ga0501072_0417147 Ga0501072_0417147_629_826 65
1707 3300049588 Ga0501072_0608706 Ga0501072_0608706_427_633 65
1708 3300049588 Ga0501072_0721507 Ga0501072_0721507_513_710 65
1709 3300049588 Ga0501072_0743819 Ga0501072_0743819_517_747 65
1710 3300049589 Ga0501073_0225324 Ga0501073_0225324_782_979 65
1711 3300049589 Ga0501073_0565986 Ga0501073_0565986_425_622 65
1712 3300049589 Ga0501073_0594809 Ga0501073_0594809_515_712 65
1713 3300049590 Ga0501074_0001061 Ga0501074_0001061_430_627 65
1714 3300049590 Ga0501074_0076197 Ga0501074_0076197_2162_2359 65
1715 3300049590 Ga0501074_0206286 Ga0501074_0206286_1045_1242 65
1716 3300049590 Ga0501074_0286728 Ga0501074_0286728_941_1138 65
1717 3300049590 Ga0501074_0414330 Ga0501074_0414330_562_771 65
1718 3300049590 Ga0501074_1206184 Ga0501074_1206184_72_278 65
1719 3300049590 Ga0501074_1255500 Ga0501074_1255500_31_228 65
1720 3300049591 Ga0501075_0003857 Ga0501075_0003857_7986_8183 65
1721 3300049591 Ga0501075_0014585 Ga0501075_0014585_1313_1522 65
1722 3300049591 Ga0501075_0053228 Ga0501075_0053228_1207_1404 65
1723 3300049591 Ga0501075_0084133 Ga0501075_0084133_1222_1419 65
1724 3300049591 Ga0501075_0127758 Ga0501075_0127758_1197_1394 65
1725 3300049591 Ga0501075_0130339 Ga0501075_0130339_711_908 65
1726 3300049591 Ga0501075_0136394 Ga0501075_0136394_1439_1636 65
1727 3300049591 Ga0501075_0202847 Ga0501075_0202847_771_968 65
1728 3300049591 Ga0501075_0335138 Ga0501075_0335138_300_497 65
1729 3300049591 Ga0501075_0388563 Ga0501075_0388563_225_431 65
1730 3300049591 Ga0501075_0415699 Ga0501075_0415699_156_353 65
1731 3300049591 Ga0501075_0425702 Ga0501075_0425702_603_800 65
1732 3300049591 Ga0501075_0493142 Ga0501075_0493142_462_659 65
1733 3300049591 Ga0501075_0691606 Ga0501075_0691606_274_471 65
1734 3300049591 Ga0501075_1026386 Ga0501075_1026386_48_245 65
1735 3300049591 Ga0501075_1098487 Ga0501075_1098487_162_371 65
1736 3300049592 Ga0501076_0001398 Ga0501076_0001398_15774_15971 65
1737 3300049592 Ga0501076_0003862 Ga0501076_0003862_4122_4331 65
1738 3300049592 Ga0501076_0028008 Ga0501076_0028008_727_924 65
1739 3300049592 Ga0501076_0091904 Ga0501076_0091904_291_488 65
1740 3300049592 Ga0501076_0097393 Ga0501076_0097393_520_717 65
1741 3300049592 Ga0501076_0117706 Ga0501076_0117706_684_881 65
1742 3300049592 Ga0501076_0187239 Ga0501076_0187239_640_837 65
1743 3300049592 Ga0501076_0238627 Ga0501076_0238627_580_777 65
1744 3300049592 Ga0501076_0436814 Ga0501076_0436814_798_995 65
1745 3300049592 Ga0501076_0559682 Ga0501076_0559682_165_362 65
1746 3300049592 Ga0501076_0580531 Ga0501076_0580531_250_447 65
1747 3300049592 Ga0501076_0622270 Ga0501076_0622270_20_217 65
1748 3300049592 Ga0501076_0723537 Ga0501076_0723537_299_496 65
1749 3300049592 Ga0501076_1032744 Ga0501076_1032744_204_401 65
1750 3300049593 Ga0501077_0024287 Ga0501077_0024287_1193_1390 65
1751 3300049593 Ga0501077_0027866 Ga0501077_0027866_538_735 65
1752 3300049593 Ga0501077_0072804 Ga0501077_0072804_1964_2161 65
1753 3300049593 Ga0501077_0191444 Ga0501077_0191444_578_775 65
1754 3300049593 Ga0501077_0191667 Ga0501077_0191667_368_565 65
1755 3300049593 Ga0501077_0357930 Ga0501077_0357930_491_688 65
1756 3300049593 Ga0501077_0464244 Ga0501077_0464244_371_568 65
1757 3300049593 Ga0501077_0496923 Ga0501077_0496923_442_639 65
1758 3300049649 Ga0501198_105907 Ga0501198_105907_38_235 65
1759 3300049663 Ga0501223_087443 Ga0501223_087443_334_531 65
1760 3300049675 Ga0501243_040415 Ga0501243_040415_463_660 65
1761 3300049689 Ga0501260_014220 Ga0501260_014220_137_334 65
1762 3300049741 Ga0501079_0022984 Ga0501079_0022984_3260_3457 65
1763 3300049741 Ga0501079_0036063 Ga0501079_0036063_203_400 65
1764 3300049741 Ga0501079_0042623 Ga0501079_0042623_764_961 65
1765 3300049741 Ga0501079_0060914 Ga0501079_0060914_2438_2635 65
1766 3300049741 Ga0501079_0083643 Ga0501079_0083643_973_1170 65
1767 3300049741 Ga0501079_0092851 Ga0501079_0092851_642_851 65
1768 3300049741 Ga0501079_0131447 Ga0501079_0131447_286_483 65
1769 3300049741 Ga0501079_0176593 Ga0501079_0176593_1127_1324 65
1770 3300049741 Ga0501079_0316570 Ga0501079_0316570_928_1125 65
1771 3300049741 Ga0501079_0549171 Ga0501079_0549171_296_493 65
1772 3300049741 Ga0501079_0828897 Ga0501079_0828897_95_292 65
1773 3300049741 Ga0501079_0870511 Ga0501079_0870511_120_317 65
1774 3300049741 Ga0501079_1053826 Ga0501079_1053826_225_434 65
1775 3300049741 Ga0501079_1499782 Ga0501079_1499782_183_389 65
1776 3300049741 Ga0501079_1672896 Ga0501079_1672896_206_403 65
1777 3300049742 Ga0501080_0082955 Ga0501080_0082955_2160_2357 65
1778 3300049742 Ga0501080_0118354 Ga0501080_0118354_186_383 65
1779 3300049742 Ga0501080_0137408 Ga0501080_0137408_1062_1259 65
1780 3300049742 Ga0501080_0141743 Ga0501080_0141743_1288_1485 65
1781 3300049742 Ga0501080_0204951 Ga0501080_0204951_450_647 65
1782 3300049742 Ga0501080_0215385 Ga0501080_0215385_551_760 65
1783 3300049742 Ga0501080_0366277 Ga0501080_0366277_1036_1233 65
1784 3300049742 Ga0501080_0370828 Ga0501080_0370828_825_1022 65
1785 3300049742 Ga0501080_0509000 Ga0501080_0509000_636_833 65
1786 3300049742 Ga0501080_0725600 Ga0501080_0725600_365_562 65
1787 3300049742 Ga0501080_1185827 Ga0501080_1185827_431_628 65
1788 3300049742 Ga0501080_1210492 Ga0501080_1210492_130_327 65
1789 3300049742 Ga0501080_1876977 Ga0501080_1876977_223_420 65
1790 3300049743 Ga0501081_0016457 Ga0501081_0016457_1142_1339 65
1791 3300049743 Ga0501081_0142391 Ga0501081_0142391_478_675 65
1792 3300049743 Ga0501081_0155041 Ga0501081_0155041_1168_1365 65
1793 3300049743 Ga0501081_0170681 Ga0501081_0170681_267_464 65
1794 3300049743 Ga0501081_0249528 Ga0501081_0249528_749_946 65
1795 3300049743 Ga0501081_0297096 Ga0501081_0297096_156_365 65
1796 3300049743 Ga0501081_0667224 Ga0501081_0667224_40_237 65
1797 3300049743 Ga0501081_0686359 Ga0501081_0686359_100_297 65
1798 3300049743 Ga0501081_0763920 Ga0501081_0763920_407_604 65
1799 3300049743 Ga0501081_0895763 Ga0501081_0895763_248_454 65
1800 3300049743 Ga0501081_0920674 Ga0501081_0920674_288_485 65
1801 3300049743 Ga0501081_1157529 Ga0501081_1157529_358_555 65
1802 3300049743 Ga0501081_1272335 Ga0501081_1272335_28_225 65
1803 3300049744 Ga0501083_0078076 Ga0501083_0078076_208_405 65
1804 3300049744 Ga0501083_0118752 Ga0501083_0118752_1090_1287 65
1805 3300049744 Ga0501083_0154686 Ga0501083_0154686_552_749 65
1806 3300049744 Ga0501083_0279347 Ga0501083_0279347_529_726 65
1807 3300049744 Ga0501083_0295243 Ga0501083_0295243_417_626 65
1808 3300049744 Ga0501083_0477061 Ga0501083_0477061_217_414 65
1809 3300049744 Ga0501083_0842426 Ga0501083_0842426_259_456 65
1810 3300049822 Ga0501035_0045835 Ga0501035_0045835_3595_3792 65
1811 3300049822 Ga0501035_0112687 Ga0501035_0112687_282_491 65
1812 3300049822 Ga0501035_0171526 Ga0501035_0171526_886_1083 65
1813 3300049822 Ga0501035_0406484 Ga0501035_0406484_53_250 65
1814 3300049822 Ga0501035_0734785 Ga0501035_0734785_355_552 65
1815 3300049822 Ga0501035_1155185 Ga0501035_1155185_339_536 65
1816 3300049823 Ga0501044_0464827 Ga0501044_0464827_877_1074 65
1817 3300049823 Ga0501044_0721776 Ga0501044_0721776_343_540 65
1818 3300049823 Ga0501044_1091117 Ga0501044_1091117_375_572 65
1819 3300049824 Ga0501045_0011292 Ga0501045_0011292_2781_2990 65
1820 3300049824 Ga0501045_0032348 Ga0501045_0032348_2679_2876 65
1821 3300049824 Ga0501045_0070606 Ga0501045_0070606_604_801 65
1822 3300049824 Ga0501045_0093138 Ga0501045_0093138_1221_1418 65
1823 3300049824 Ga0501045_0130841 Ga0501045_0130841_759_956 65
1824 3300049824 Ga0501045_0150694 Ga0501045_0150694_1110_1307 65
1825 3300049824 Ga0501045_0287594 Ga0501045_0287594_954_1151 65
1826 3300049824 Ga0501045_0308448 Ga0501045_0308448_548_745 65
1827 3300049824 Ga0501045_0350042 Ga0501045_0350042_756_953 65
1828 3300049824 Ga0501045_0353609 Ga0501045_0353609_498_695 65
1829 3300049824 Ga0501045_0432891 Ga0501045_0432891_180_377 65
1830 3300049824 Ga0501045_0435086 Ga0501045_0435086_115_345 65
1831 3300049824 Ga0501045_0545902 Ga0501045_0545902_75_272 65
1832 3300049824 Ga0501045_1183592 Ga0501045_1183592_317_514 65
1833 3300049824 Ga0501045_1237859 Ga0501045_1237859_30_239 65
1834 3300049824 Ga0501045_1340410 Ga0501045_1340410_278_475 65
1835 3300050491 nmdc:mga00v17_756233_c1 nmdc:mga00v17_756233_c1_241_438 65
1836 3300050492 nmdc:mga0yw44_162717_c1 nmdc:mga0yw44_162717_c1_420_617 65
1837 3300050507 nmdc:mga05p37_137942_c1 nmdc:mga05p37_137942_c1_921_1118 65
1838 3300050507 nmdc:mga05p37_1696832_c1 nmdc:mga05p37_1696832_c1_44_241 65
1839 3300050507 nmdc:mga05p37_206361_c1 nmdc:mga05p37_206361_c1_2052_2249 65
1840 3300050507 nmdc:mga05p37_427873_c1 nmdc:mga05p37_427873_c1_1034_1231 65
1841 3300050507 nmdc:mga05p37_809123_c1 nmdc:mga05p37_809123_c1_348_545 65
1842 3300050508 nmdc:mga09592_693781_c1 nmdc:mga09592_693781_c1_601_798 65
1843 3300050510 nmdc:mga06r32_255982_c1 nmdc:mga06r32_255982_c1_1005_1202 65
1844 3300050511 nmdc:mga08y16_1473091_c1 nmdc:mga08y16_1473091_c1_37_234 65
1845 3300050511 nmdc:mga08y16_369004_c1 nmdc:mga08y16_369004_c1_1053_1250 65
1846 3300050511 nmdc:mga08y16_45737_c1 nmdc:mga08y16_45737_c1_2172_2381 65
1847 3300050511 nmdc:mga08y16_671683_c1 nmdc:mga08y16_671683_c1_649_846 65
1848 3300050511 nmdc:mga08y16_7967_c1 nmdc:mga08y16_7967_c1_1492_1689 65
1849 3300050512 nmdc:mga0n895_1368455_c1 nmdc:mga0n895_1368455_c1_409_606 65
1850 3300050512 nmdc:mga0n895_322131_c1 nmdc:mga0n895_322131_c1_783_980 65
1851 3300050512 nmdc:mga0n895_45163_c1 nmdc:mga0n895_45163_c1_120_317 65
1852 3300050512 nmdc:mga0n895_481304_c1 nmdc:mga0n895_481304_c1_172_369 65
1853 3300050512 nmdc:mga0n895_61337_c1 nmdc:mga0n895_61337_c1_1087_1284 65
1854 3300050513 nmdc:mga0rr50_132060_c1 nmdc:mga0rr50_132060_c1_1179_1376 65
1855 3300050513 nmdc:mga0rr50_152448_c1 nmdc:mga0rr50_152448_c1_1071_1268 65
1856 3300050513 nmdc:mga0rr50_1741363_c1 nmdc:mga0rr50_1741363_c1_29_226 65
1857 3300050513 nmdc:mga0rr50_223816_c1 nmdc:mga0rr50_223816_c1_479_676 65
1858 3300050513 nmdc:mga0rr50_588014_c1 nmdc:mga0rr50_588014_c1_519_716 65
1859 3300050514 nmdc:mga08x19_1157621_c1 nmdc:mga08x19_1157621_c1_174_371 65
1860 3300050514 nmdc:mga08x19_59687_c1 nmdc:mga08x19_59687_c1_2193_2390 65
1861 3300050514 nmdc:mga08x19_856324_c1 nmdc:mga08x19_856324_c1_267_464 65
1862 3300050515 nmdc:mga0a205_17661_c1 nmdc:mga0a205_17661_c1_1390_1587 65
1863 3300050515 nmdc:mga0a205_183263_c1 nmdc:mga0a205_183263_c1_702_899 65
1864 3300050515 nmdc:mga0a205_32474_c1 nmdc:mga0a205_32474_c1_1779_1976 65
1865 3300050515 nmdc:mga0a205_45211_c1 nmdc:mga0a205_45211_c1_3024_3221 65
1866 3300050515 nmdc:mga0a205_615392_c1 nmdc:mga0a205_615392_c1_531_728 65
1867 3300053077 Ga0495601_0013066 Ga0495601_0013066_2333_2530 65
1868 3300053077 Ga0495601_0310488 Ga0495601_0310488_677_874 65
1869 3300053078 Ga0495612_0009618 Ga0495612_0009618_1579_1776 65
1870 3300053078 Ga0495612_0215187 Ga0495612_0215187_587_784 65
1871 3300053083 Ga0495655_0304379 Ga0495655_0304379_280_477 65
1872 3300053083 Ga0495655_0328219 Ga0495655_0328219_241_438 65
1873 3300053084 Ga0495595_0006326 Ga0495595_0006326_3770_3967 65
1874 3300053084 Ga0495595_0125960 Ga0495595_0125960_278_475 65
1875 3300053085 Ga0495619_0009224 Ga0495619_0009224_830_1027 65
1876 3300053085 Ga0495619_0040503 Ga0495619_0040503_1683_1880 65
1877 3300053085 Ga0495619_0105251 Ga0495619_0105251_1305_1502 65
1878 3300054114 Ga0501084_0002352 Ga0501084_0002352_278_475 65
1879 3300054114 Ga0501084_0008414 Ga0501084_0008414_3710_3919 65
1880 3300054114 Ga0501084_0058153 Ga0501084_0058153_548_745 65
1881 3300054114 Ga0501084_0067722 Ga0501084_0067722_906_1103 65
1882 3300054114 Ga0501084_0073590 Ga0501084_0073590_1185_1382 65
1883 3300054114 Ga0501084_0085950 Ga0501084_0085950_1866_2063 65
1884 3300054114 Ga0501084_0434011 Ga0501084_0434011_636_833 65
1885 3300054114 Ga0501084_0701771 Ga0501084_0701771_530_736 65
1886 3300054114 Ga0501084_1042788 Ga0501084_1042788_433_630 65
1887 3300054114 Ga0501084_1384351 Ga0501084_1384351_329_526 65
1888 3300054114 Ga0501084_1448730 Ga0501084_1448730_71_268 65
1889 3300059421 Ga0590071_009569 Ga0590071_009569_833_1039 65
1890 3300059423 Ga0590074_007118 Ga0590074_007118_748_954 65
1891 3300059424 Ga0590075_004206 Ga0590075_004206_713_919 65
1892 3300059424 Ga0590075_011136 Ga0590075_011136_928_1137 65
1893 3300059424 Ga0590075_014674 Ga0590075_014674_1315_1512 65
1894 3300059426 Ga0590077_002835 Ga0590077_002835_1670_1876 65
1895 3300059426 Ga0590077_075987 Ga0590077_075987_263_460 65
1896 3300059426 Ga0590077_134248 Ga0590077_134248_117_326 65
1897 3300059506 Ga0587085_075719 Ga0587085_075719_261_458 65
1898 3300060353 Ga0501082_0013626 Ga0501082_0013626_3100_3309 65
1899 3300060353 Ga0501082_0038308 Ga0501082_0038308_801_998 65
1900 3300060353 Ga0501082_0053143 Ga0501082_0053143_1644_1841 65
1901 3300060353 Ga0501082_0064598 Ga0501082_0064598_501_698 65
1902 3300060353 Ga0501082_0095723 Ga0501082_0095723_1378_1575 65
1903 3300060353 Ga0501082_0278413 Ga0501082_0278413_1006_1203 65
1904 3300060353 Ga0501082_0288877 Ga0501082_0288877_276_473 65
1905 3300060353 Ga0501082_0400675 Ga0501082_0400675_574_771 65
1906 3300060353 Ga0501082_0681820 Ga0501082_0681820_63_260 65
1907 3300060353 Ga0501082_0685527 Ga0501082_0685527_217_414 65
1908 3300060353 Ga0501082_0699327 Ga0501082_0699327_244_441 65
1909 3300060353 Ga0501082_0894705 Ga0501082_0894705_462_659 65
1910 3300060353 Ga0501082_1225731 Ga0501082_1225731_321_518 65
1911 3300060353 Ga0501082_1417345 Ga0501082_1417345_124_321 65
1912 3300061734 Ga0530510_0016975 Ga0530510_0016975_2891_3088 65
1913 3300061734 Ga0530510_0023755 Ga0530510_0023755_4040_4237 65
1914 3300061734 Ga0530510_0032351 Ga0530510_0032351_2927_3124 65
1915 3300061734 Ga0530510_0057289 Ga0530510_0057289_1492_1689 65
1916 3300061734 Ga0530510_0060175 Ga0530510_0060175_1453_1650 65
1917 3300061734 Ga0530510_0075843 Ga0530510_0075843_1191_1388 65
1918 3300061734 Ga0530510_0103570 Ga0530510_0103570_1309_1506 65
1919 3300061734 Ga0530510_0317819 Ga0530510_0317819_191_388 65
1920 3300061734 Ga0530510_0404861 Ga0530510_0404861_594_791 65
1921 3300061734 Ga0530510_0412580 Ga0530510_0412580_364_573 65
1922 3300061734 Ga0530510_0422319 Ga0530510_0422319_708_905 65
1923 3300061734 Ga0530510_0478230 Ga0530510_0478230_448_645 65
1924 3300061734 Ga0530510_0557885 Ga0530510_0557885_443_640 65
1925 3300061734 Ga0530510_0605703 Ga0530510_0605703_520_717 65
1926 3300061734 Ga0530510_1064477 Ga0530510_1064477_292_489 65

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01632

Ribosomal_L35p

Ribosomal protein L35

13

73

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ee1-assembly1.cif.gz_A solution structures of the chromo domain of human chromodomain helicase-dna-binding protein 4 0.7238 13 29
5mmi-assembly1.cif.gz_4 structure of the large subunit of the chloroplast ribosome 0.7087 1 65
5mlc-assembly1.cif.gz_5 cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.707 2 65
5mmi-assembly1.cif.gz_4 structure of the large subunit of the chloroplast ribosome 0.6992 1 65
7xam-assembly1.cif.gz_e mycobacterium smegmatis 50s ribosomal subunit from stationary phase of growth 0.6931 2 63
ID Description Score Start End Superfamily
2ee1A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7238 13 29 2.40.50.40
af_P0CG94_54_278_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6913 14 29 2.130.10.10
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6849 3 65 4.10.410.60
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6755 3 65 4.10.410.60
3fjpA02 Mainly Beta;Roll;SH3 type barrels.; 0.5919 13 50 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A536N769-F1-model_v4 Large ribosomal subunit protein bL35 0.7329 1 65 GO:0003735
GO:0006412
GO:0022625
AF-A0A1G3Q4F0-F1-model_v4 Large ribosomal subunit protein bL35 0.7229 1 65 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F9BB80-F1-model_v4 Large ribosomal subunit protein bL35 0.7216 1 65 GO:0003735
GO:0006412
GO:0022625
AF-A0A7U6JF46-F1-model_v4 Large ribosomal subunit protein bL35 0.7185 1 65 GO:0003735
GO:0006412
GO:0015934
AF-A0A1D1Y3J4-F1-model_v4 50S ribosomal protein L35 0.7179 2 65 GO:0003735
GO:0006412
GO:0015934

Feature Viewer

pLDDT pTM Quality
86.19 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map