F495872

General Info

Members Datasets Scaffolds Average Seq Length
1843 535 3686 100

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0606487|Ga0496112_0606487_308_607
Length 99
Sequence VSRSVKKGPFVEDSLKKKIETLNSRNEKKVVKTWSRPSVILPIMVGHTIAVHDGRRHVPVFITENMVGHRLGEFAATRTFKGHGRGAAAETATTVKAGA

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
120 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
121 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
122 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
123 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
124 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
238 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
244 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
256 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
257 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
258 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
262 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
263 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
264 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
265 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
266 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
273 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
274 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
275 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
290 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
291 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
298 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
307 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
310 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
311 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
312 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
313 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
314 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
315 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
316 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
317 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
318 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
319 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
320 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
321 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
322 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
323 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
324 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
325 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
326 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
327 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
328 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
333 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
334 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
335 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
336 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
337 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
338 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
339 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
345 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
348 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
351 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
352 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
357 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
398 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
407 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
408 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
409 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
410 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
411 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
412 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
413 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
422 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
423 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
424 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
456 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
457 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
458 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
459 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
460 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
461 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
462 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
463 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
464 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
465 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
466 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
467 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
468 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
469 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
470 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
471 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
472 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
473 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
474 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
475 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
476 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
477 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
478 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
479 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
480 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
481 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
482 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
483 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
486 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
487 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
488 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
489 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
490 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
491 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
492 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
493 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
494 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
495 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
496 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
497 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
498 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
499 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
500 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
501 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
505 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
506 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
507 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
508 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
509 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
510 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
511 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
512 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
513 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
514 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
517 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
518 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
521 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
522 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
523 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
524 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 1.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.15
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0606487 3300048915 Bacteria 1026
2 JGI26145J50221_1006158 3300003371 Bacteria 1002
3 Ga0058863_10086968 3300004799 Bacteria 3231
4 Ga0058861_11789312 3300004800 Bacteria 647
5 Ga0058862_12643353 3300004803 Bacteria 986
6 Ga0065712_10074846 3300005290 Bacteria 3994
7 Ga0065712_10439994 3300005290 Bacteria 695
8 Ga0065712_10815210 3300005290 Bacteria 505
9 Ga0065715_10057212 3300005293 Bacteria 946
10 Ga0065715_10116004 3300005293 Bacteria 2395
11 Ga0065715_10299813 3300005293 Bacteria 1044
12 Ga0065715_10811487 3300005293 Bacteria 606
13 Ga0065707_10432448 3300005295 Bacteria 819
14 Ga0065707_10717645 3300005295 Bacteria 608
15 Ga0070658_10171352 3300005327 Bacteria 1823
16 Ga0070658_10561985 3300005327 Bacteria 987
17 Ga0070658_11648416 3300005327 Bacteria 555
18 Ga0070658_11812599 3300005327 Bacteria 528
19 Ga0070676_10010363 3300005328 Bacteria 5055
20 Ga0070676_10089561 3300005328 Bacteria 1882
21 Ga0070676_10624397 3300005328 Bacteria 779
22 Ga0070683_100003340 3300005329 Bacteria 12981
23 Ga0070683_100058071 3300005329 Bacteria 3595
24 Ga0070683_100071412 3300005329 Bacteria 3239
25 Ga0070683_100366719 3300005329 Bacteria 1372
26 Ga0070683_100862286 3300005329 Bacteria 868
27 Ga0070683_100935969 3300005329 Bacteria 831
28 Ga0070683_101036957 3300005329 Bacteria 788
29 Ga0070683_101164768 3300005329 Bacteria 741
30 Ga0070683_101170690 3300005329 Bacteria 739
31 Ga0070690_100021133 3300005330 Bacteria 3971
32 Ga0070690_100086374 3300005330 Bacteria 2059
33 Ga0070690_100216988 3300005330 Bacteria 1338
34 Ga0070670_100240332 3300005331 Bacteria 1577
35 Ga0070670_100322579 3300005331 Bacteria 1353
36 Ga0070670_100727273 3300005331 Bacteria 893
37 Ga0070670_100806131 3300005331 Bacteria 848
38 Ga0070677_10078225 3300005333 Bacteria 1409
39 Ga0070677_10528114 3300005333 Bacteria 644
40 Ga0068869_100874259 3300005334 Bacteria 776
41 Ga0068869_100892987 3300005334 Bacteria 769
42 Ga0068869_100907740 3300005334 Bacteria 763
43 Ga0068869_100984090 3300005334 Bacteria 734
44 Ga0068869_100984138 3300005334 Bacteria 734
45 Ga0070666_10093653 3300005335 Bacteria 2065
46 Ga0070666_10215569 3300005335 Bacteria 1353
47 Ga0070666_10327378 3300005335 Bacteria 1094
48 Ga0070666_10847074 3300005335 Bacteria 674
49 Ga0070680_100003421 3300005336 Bacteria 11843
50 Ga0070680_100011604 3300005336 Bacteria 6824
51 Ga0070680_100048050 3300005336 Bacteria 3477
52 Ga0070680_100103171 3300005336 Bacteria 2369
53 Ga0070680_100119665 3300005336 Bacteria 2197
54 Ga0070680_100156870 3300005336 Bacteria 1912
55 Ga0070680_100163795 3300005336 Bacteria 1869
56 Ga0070680_100321809 3300005336 Bacteria 1313
57 Ga0070680_100369443 3300005336 Bacteria 1220
58 Ga0070680_100464968 3300005336 Bacteria 1081
59 Ga0070680_100466058 3300005336 Bacteria 1079
60 Ga0070680_101315673 3300005336 Bacteria 625
61 Ga0070682_100029919 3300005337 Bacteria 3282
62 Ga0070682_100060558 3300005337 Bacteria 2394
63 Ga0070682_100203345 3300005337 Bacteria 1398
64 Ga0070682_100307437 3300005337 Bacteria 1166
65 Ga0070682_100309796 3300005337 Bacteria 1162
66 Ga0070682_101120793 3300005337 Bacteria 660
67 Ga0068868_100013085 3300005338 Bacteria 6075
68 Ga0068868_100141727 3300005338 Bacteria 1973
69 Ga0068868_100320488 3300005338 Bacteria 1320
70 Ga0068868_100783022 3300005338 Bacteria 859
71 Ga0068868_101742480 3300005338 Bacteria 588
72 Ga0070660_100100995 3300005339 Bacteria 2285
73 Ga0070660_100250698 3300005339 Bacteria 1444
74 Ga0070660_100293209 3300005339 Bacteria 1332
75 Ga0070660_101042557 3300005339 Bacteria 691
76 Ga0070660_101050711 3300005339 Bacteria 689
77 Ga0070660_101184695 3300005339 Bacteria 647
78 Ga0070689_100012783 3300005340 Bacteria 6060
79 Ga0070689_100031628 3300005340 Bacteria 4023
80 Ga0070689_100038522 3300005340 Bacteria 3658
81 Ga0070689_100118383 3300005340 Bacteria 2113
82 Ga0070689_101465145 3300005340 Bacteria 618
83 Ga0070691_10028966 3300005341 Bacteria 2590
84 Ga0070691_10186317 3300005341 Bacteria 1083
85 Ga0070691_10272178 3300005341 Bacteria 916
86 Ga0070687_100018908 3300005343 Bacteria 3196
87 Ga0070687_100038862 3300005343 Bacteria 2388
88 Ga0070687_100623865 3300005343 Bacteria 744
89 Ga0070661_100028453 3300005344 Bacteria 4031
90 Ga0070661_100029610 3300005344 Bacteria 3952
91 Ga0070661_100034455 3300005344 Bacteria 3671
92 Ga0070661_100323146 3300005344 Bacteria 1205
93 Ga0070661_100383300 3300005344 Bacteria 1109
94 Ga0070661_100459024 3300005344 Bacteria 1014
95 Ga0070661_100512303 3300005344 Bacteria 961
96 Ga0070661_101477934 3300005344 Bacteria 573
97 Ga0070661_101593807 3300005344 Bacteria 552
98 Ga0070661_101786665 3300005344 Bacteria 522
99 Ga0070692_10085682 3300005345 Bacteria 1704
100 Ga0070692_10152386 3300005345 Bacteria 1318
101 Ga0070692_10236677 3300005345 Bacteria 1086
102 Ga0070692_10595750 3300005345 Bacteria 730
103 Ga0070692_11148700 3300005345 Bacteria 551
104 Ga0070668_100254925 3300005347 Bacteria 1457
105 Ga0070668_100802060 3300005347 Bacteria 836
106 Ga0070668_101483884 3300005347 Bacteria 620
107 Ga0070669_100025980 3300005353 Bacteria 4211
108 Ga0070669_100182704 3300005353 Bacteria 1641
109 Ga0070669_100218637 3300005353 Bacteria 1506
110 Ga0070669_100571542 3300005353 Bacteria 944
111 Ga0070675_100303016 3300005354 Bacteria 1408
112 Ga0070675_100374469 3300005354 Bacteria 1266
113 Ga0070675_101472671 3300005354 Bacteria 628
114 Ga0070675_101610651 3300005354 Bacteria 599
115 Ga0070675_101702594 3300005354 Bacteria 582
116 Ga0070671_100079081 3300005355 Bacteria 2748
117 Ga0070671_100159410 3300005355 Bacteria 1907
118 Ga0070671_100181105 3300005355 Bacteria 1784
119 Ga0070671_101392007 3300005355 Bacteria 620
120 Ga0070671_101835633 3300005355 Bacteria 539
121 Ga0070674_100075414 3300005356 Bacteria 2395
122 Ga0070674_101764079 3300005356 Bacteria 561
123 Ga0070674_101938091 3300005356 Bacteria 536
124 Ga0070673_100003685 3300005364 Bacteria 9600
125 Ga0070673_100024226 3300005364 Bacteria 4447
126 Ga0070673_100153788 3300005364 Bacteria 1950
127 Ga0070673_100499084 3300005364 Bacteria 1100
128 Ga0070673_102163037 3300005364 Bacteria 529
129 Ga0070688_100024866 3300005365 Bacteria 3539
130 Ga0070688_100028355 3300005365 Bacteria 3341
131 Ga0070688_100394857 3300005365 Bacteria 1022
132 Ga0070659_100058242 3300005366 Bacteria 3048
133 Ga0070659_100108977 3300005366 Bacteria 2234
134 Ga0070659_100116694 3300005366 Bacteria 2158
135 Ga0070659_100245326 3300005366 Bacteria 1483
136 Ga0070659_100601719 3300005366 Bacteria 945
137 Ga0070659_100915992 3300005366 Bacteria 767
138 Ga0070659_101134747 3300005366 Bacteria 690
139 Ga0070659_101444930 3300005366 Bacteria 612
140 Ga0070667_100043630 3300005367 Bacteria 3764
141 Ga0070667_100093065 3300005367 Bacteria 2595
142 Ga0070667_100611410 3300005367 Bacteria 1005
143 Ga0070703_10122590 3300005406 Bacteria 945
144 Ga0070709_10006385 3300005434 Bacteria 6421
145 Ga0070709_10036785 3300005434 Bacteria 2985
146 Ga0070709_10171398 3300005434 Bacteria 1517
147 Ga0070714_100000411 3300005435 Bacteria 31485
148 Ga0070714_100139880 3300005435 Bacteria 2171
149 Ga0070714_100462329 3300005435 Bacteria 1206
150 Ga0070714_100710189 3300005435 Bacteria 970
151 Ga0070713_100065550 3300005436 Bacteria 3051
152 Ga0070713_100583856 3300005436 Bacteria 1060
153 Ga0070713_101027119 3300005436 Bacteria 796
154 Ga0070713_101642690 3300005436 Bacteria 624
155 Ga0070710_10128761 3300005437 Bacteria 1541
156 Ga0070701_10062320 3300005438 Bacteria 1969
157 Ga0070701_10624172 3300005438 Bacteria 716
158 Ga0070711_100034546 3300005439 Bacteria 3373
159 Ga0070711_100079312 3300005439 Bacteria 2335
160 Ga0070705_100020535 3300005440 Bacteria 3499
161 Ga0070705_100090555 3300005440 Bacteria 1904
162 Ga0070705_100169323 3300005440 Bacteria 1469
163 Ga0070705_101704231 3300005440 Bacteria 533
164 Ga0070700_100195386 3300005441 Bacteria 1417
165 Ga0070700_101012060 3300005441 Bacteria 684
166 Ga0070694_100555824 3300005444 Bacteria 919
167 Ga0070694_100825210 3300005444 Bacteria 761
168 Ga0070694_100977120 3300005444 Bacteria 702
169 Ga0070694_101097517 3300005444 Bacteria 664
170 Ga0070708_100001661 3300005445 Bacteria 17067
171 Ga0070708_100003800 3300005445 Bacteria 11845
172 Ga0070708_100018839 3300005445 Bacteria 5782
173 Ga0070708_100020893 3300005445 Bacteria 5528
174 Ga0070708_100055604 3300005445 Bacteria 3519
175 Ga0070708_100335677 3300005445 Bacteria 1424
176 Ga0070708_100338186 3300005445 Bacteria 1418
177 Ga0070708_100366252 3300005445 Bacteria 1358
178 Ga0070708_101042104 3300005445 Bacteria 767
179 Ga0070708_101463714 3300005445 Bacteria 637
180 Ga0070663_100005346 3300005455 Bacteria 7621
181 Ga0070663_100094822 3300005455 Bacteria 2217
182 Ga0070663_100798646 3300005455 Bacteria 809
183 Ga0070663_101530009 3300005455 Bacteria 593
184 Ga0070678_100053888 3300005456 Bacteria 2927
185 Ga0070678_100352274 3300005456 Bacteria 1266
186 Ga0070662_100054587 3300005457 Bacteria 2896
187 Ga0070662_100198764 3300005457 Bacteria 1589
188 Ga0070662_100251955 3300005457 Bacteria 1420
189 Ga0070662_100452728 3300005457 Bacteria 1065
190 Ga0070662_100704165 3300005457 Bacteria 855
191 Ga0070681_10035181 3300005458 Bacteria 5031
192 Ga0070681_10044619 3300005458 Bacteria 4438
193 Ga0070681_10053922 3300005458 Bacteria 4006
194 Ga0070681_10078280 3300005458 Bacteria 3263
195 Ga0070681_10116033 3300005458 Bacteria 2615
196 Ga0070681_10160574 3300005458 Bacteria 2171
197 Ga0070681_10171280 3300005458 Bacteria 2093
198 Ga0070681_10225090 3300005458 Bacteria 1790
199 Ga0070681_10227553 3300005458 Bacteria 1779
200 Ga0070681_10415728 3300005458 Bacteria 1256
201 Ga0070681_10477193 3300005458 Bacteria 1160
202 Ga0070681_10498751 3300005458 Bacteria 1130
203 Ga0070681_10758644 3300005458 Bacteria 887
204 Ga0070681_11130055 3300005458 Bacteria 705
205 Ga0070681_11251139 3300005458 Bacteria 664
206 Ga0068867_100093589 3300005459 Bacteria 2284
207 Ga0068867_100262442 3300005459 Bacteria 1409
208 Ga0068867_100786095 3300005459 Bacteria 847
209 Ga0068867_101256728 3300005459 Bacteria 682
210 Ga0068867_101331788 3300005459 Bacteria 664
211 Ga0070685_10028108 3300005466 Bacteria 3114
212 Ga0070685_10117314 3300005466 Bacteria 1648
213 Ga0070685_10262680 3300005466 Bacteria 1149
214 Ga0070706_100006592 3300005467 Bacteria 10949
215 Ga0070706_100115208 3300005467 Bacteria 2503
216 Ga0070706_100171538 3300005467 Bacteria 2026
217 Ga0070706_100188726 3300005467 Bacteria 1926
218 Ga0070706_100354241 3300005467 Bacteria 1368
219 Ga0070706_100502739 3300005467 Bacteria 1128
220 Ga0070707_100016356 3300005468 Bacteria 6962
221 Ga0070707_100019047 3300005468 Bacteria 6463
222 Ga0070707_100198999 3300005468 Bacteria 1953
223 Ga0070707_100439225 3300005468 Bacteria 1265
224 Ga0070707_100939600 3300005468 Bacteria 829
225 Ga0070707_100948615 3300005468 Bacteria 825
226 Ga0070707_100995176 3300005468 Bacteria 804
227 Ga0070698_100001954 3300005471 Bacteria 22884
228 Ga0070698_100024253 3300005471 Bacteria 6330
229 Ga0070698_100030896 3300005471 Bacteria 5554
230 Ga0070698_100052230 3300005471 Bacteria 4160
231 Ga0070698_100466389 3300005471 Bacteria 1199
232 Ga0070698_102150056 3300005471 Bacteria 512
233 Ga0070699_100003912 3300005518 Bacteria 13158
234 Ga0070699_100071160 3300005518 Bacteria 3025
235 Ga0070699_100096501 3300005518 Bacteria 2589
236 Ga0070699_100243299 3300005518 Bacteria 1607
237 Ga0070699_100244307 3300005518 Bacteria 1603
238 Ga0070699_100314429 3300005518 Bacteria 1406
239 Ga0070699_100484652 3300005518 Bacteria 1122
240 Ga0070699_100864240 3300005518 Bacteria 828
241 Ga0070699_100922820 3300005518 Bacteria 800
242 Ga0070699_101175842 3300005518 Bacteria 704
243 Ga0070699_101184395 3300005518 Bacteria 701
244 Ga0070699_101192268 3300005518 Bacteria 698
245 Ga0070699_101674234 3300005518 Bacteria 583
246 Ga0070679_100014655 3300005530 Bacteria 7534
247 Ga0070679_100019482 3300005530 Bacteria 6597
248 Ga0070679_100045568 3300005530 Bacteria 4370
249 Ga0070679_100052627 3300005530 Bacteria 4054
250 Ga0070679_100091847 3300005530 Bacteria 3023
251 Ga0070679_100165137 3300005530 Bacteria 2187
252 Ga0070679_100243051 3300005530 Bacteria 1757
253 Ga0070679_100249770 3300005530 Bacteria 1730
254 Ga0070679_100321944 3300005530 Bacteria 1495
255 Ga0070679_100443075 3300005530 Bacteria 1243
256 Ga0070679_100609953 3300005530 Bacteria 1034
257 Ga0070684_100005718 3300005535 Bacteria 9552
258 Ga0070684_100041533 3300005535 Bacteria 3965
259 Ga0070684_100152966 3300005535 Bacteria 2091
260 Ga0070684_100172651 3300005535 Bacteria 1964
261 Ga0070684_100298128 3300005535 Bacteria 1479
262 Ga0070684_100349691 3300005535 Bacteria 1359
263 Ga0070684_100585927 3300005535 Bacteria 1036
264 Ga0070684_100611370 3300005535 Bacteria 1014
265 Ga0070684_100976783 3300005535 Bacteria 794
266 Ga0070684_101063874 3300005535 Bacteria 760
267 Ga0070697_100034669 3300005536 Bacteria 4070
268 Ga0070697_100159646 3300005536 Bacteria 1904
269 Ga0070697_100173667 3300005536 Bacteria 1825
270 Ga0070697_100255073 3300005536 Bacteria 1500
271 Ga0070697_100308839 3300005536 Bacteria 1360
272 Ga0070697_100352424 3300005536 Bacteria 1271
273 Ga0070697_101146138 3300005536 Bacteria 692
274 Ga0068853_100040762 3300005539 Bacteria 3963
275 Ga0068853_100176850 3300005539 Bacteria 1933
276 Ga0068853_100203663 3300005539 Bacteria 1801
277 Ga0068853_100246394 3300005539 Bacteria 1639
278 Ga0068853_100355905 3300005539 Bacteria 1363
279 Ga0068853_101652526 3300005539 Bacteria 621
280 Ga0070672_100038933 3300005543 Bacteria 3637
281 Ga0070672_100061495 3300005543 Bacteria 2960
282 Ga0070672_100079274 3300005543 Bacteria 2628
283 Ga0070672_100308147 3300005543 Bacteria 1343
284 Ga0070672_100322927 3300005543 Bacteria 1312
285 Ga0070672_102016100 3300005543 Bacteria 520
286 Ga0070686_100247099 3300005544 Bacteria 1301
287 Ga0070686_100365031 3300005544 Bacteria 1089
288 Ga0070686_100481563 3300005544 Bacteria 960
289 Ga0070695_100006011 3300005545 Bacteria 7165
290 Ga0070695_100006164 3300005545 Bacteria 7087
291 Ga0070695_100081722 3300005545 Bacteria 2139
292 Ga0070695_100210430 3300005545 Bacteria 1395
293 Ga0070695_100294995 3300005545 Bacteria 1196
294 Ga0070695_101000870 3300005545 Bacteria 680
295 Ga0070696_100014069 3300005546 Bacteria 5371
296 Ga0070696_100064301 3300005546 Bacteria 2570
297 Ga0070696_100199231 3300005546 Bacteria 1494
298 Ga0070696_100287300 3300005546 Bacteria 1255
299 Ga0070696_100345231 3300005546 Bacteria 1151
300 Ga0070696_100640509 3300005546 Bacteria 861
301 Ga0070696_100698752 3300005546 Bacteria 826
302 Ga0070696_101931493 3300005546 Bacteria 512
303 Ga0070693_100000799 3300005547 Bacteria 13905
304 Ga0070693_100133923 3300005547 Bacteria 1552
305 Ga0070693_100610723 3300005547 Bacteria 788
306 Ga0070693_100700302 3300005547 Bacteria 741
307 Ga0070693_100877039 3300005547 Bacteria 671
308 Ga0070665_100124547 3300005548 Bacteria 2579
309 Ga0070665_101359628 3300005548 Bacteria 720
310 Ga0070665_102322188 3300005548 Unclassified 539
311 Ga0070704_100129452 3300005549 Bacteria 1953
312 Ga0070704_100324442 3300005549 Bacteria 1291
313 Ga0070704_100337516 3300005549 Bacteria 1268
314 Ga0070704_100347075 3300005549 Bacteria 1252
315 Ga0070704_100529683 3300005549 Bacteria 1027
316 Ga0068855_100033387 3300005563 Bacteria 6141
317 Ga0068855_100389264 3300005563 Bacteria 1529
318 Ga0068855_100533266 3300005563 Bacteria 1272
319 Ga0068855_100817487 3300005563 Bacteria 989
320 Ga0068855_101726342 3300005563 Bacteria 638
321 Ga0068855_101906615 3300005563 Bacteria 602
322 Ga0070664_100008033 3300005564 Bacteria 8527
323 Ga0070664_100229505 3300005564 Bacteria 1664
324 Ga0070664_100276901 3300005564 Bacteria 1512
325 Ga0070664_100312256 3300005564 Bacteria 1423
326 Ga0070664_100385803 3300005564 Bacteria 1279
327 Ga0070664_100616820 3300005564 Bacteria 1007
328 Ga0070664_100678751 3300005564 Bacteria 959
329 Ga0070664_100738379 3300005564 Bacteria 918
330 Ga0070664_102173296 3300005564 Bacteria 527
331 Ga0068857_100009735 3300005577 Bacteria 8348
332 Ga0068857_100024265 3300005577 Bacteria 5337
333 Ga0068857_100205597 3300005577 Bacteria 1796
334 Ga0068857_100306504 3300005577 Bacteria 1464
335 Ga0068854_100008727 3300005578 Bacteria 6524
336 Ga0068854_100013720 3300005578 Bacteria 5325
337 Ga0068854_100069785 3300005578 Bacteria 2567
338 Ga0068854_100168844 3300005578 Bacteria 1701
339 Ga0068854_100999751 3300005578 Bacteria 740
340 Ga0068854_101564314 3300005578 Bacteria 600
341 Ga0068856_100073182 3300005614 Bacteria 3393
342 Ga0068856_100776822 3300005614 Bacteria 978
343 Ga0068856_100902275 3300005614 Bacteria 903
344 Ga0070702_100251803 3300005615 Bacteria 1198
345 Ga0070702_100499928 3300005615 Bacteria 893
346 Ga0070702_100565489 3300005615 Bacteria 847
347 Ga0070702_101245784 3300005615 Bacteria 602
348 Ga0070702_101297416 3300005615 Bacteria 591
349 Ga0068852_100026550 3300005616 Bacteria 4709
350 Ga0068852_100029132 3300005616 Bacteria 4530
351 Ga0068852_100241182 3300005616 Bacteria 1727
352 Ga0068852_100495111 3300005616 Bacteria 1216
353 Ga0068852_100622674 3300005616 Bacteria 1085
354 Ga0068852_101294854 3300005616 Bacteria 750
355 Ga0068852_102534548 3300005616 Bacteria 533
356 Ga0068859_100039441 3300005617 Bacteria 4737
357 Ga0068859_100216391 3300005617 Bacteria 2003
358 Ga0068859_100351569 3300005617 Bacteria 1569
359 Ga0068859_100624071 3300005617 Bacteria 1170
360 Ga0068859_100725038 3300005617 Unclassified 1084
361 Ga0068864_100207043 3300005618 Bacteria 1805
362 Ga0068864_100277387 3300005618 Bacteria 1563
363 Ga0068864_100736050 3300005618 Bacteria 965
364 Ga0068866_10025649 3300005718 Bacteria 2773
365 Ga0068866_10131416 3300005718 Bacteria 1424
366 Ga0068866_10854617 3300005718 Bacteria 637
367 Ga0068866_11036562 3300005718 Bacteria 585
368 Ga0068861_100234025 3300005719 Bacteria 1559
369 Ga0068861_100912461 3300005719 Bacteria 833
370 Ga0068851_10620593 3300005834 Bacteria 659
371 Ga0068870_10011998 3300005840 Bacteria 4034
372 Ga0068870_10270076 3300005840 Bacteria 1062
373 Ga0068870_10446384 3300005840 Bacteria 852
374 Ga0068863_100037716 3300005841 Bacteria 4599
375 Ga0068863_100119013 3300005841 Bacteria 2517
376 Ga0068863_100223270 3300005841 Bacteria 1816
377 Ga0068863_100276028 3300005841 Bacteria 1627
378 Ga0068863_100284520 3300005841 Bacteria 1602
379 Ga0068863_100525038 3300005841 Bacteria 1167
380 Ga0068863_101634340 3300005841 Bacteria 654
381 Ga0068863_102623373 3300005841 Bacteria 513
382 Ga0068858_100393383 3300005842 Bacteria 1331
383 Ga0068858_100400542 3300005842 Bacteria 1319
384 Ga0068858_101117216 3300005842 Bacteria 774
385 Ga0068858_101182529 3300005842 Bacteria 751
386 Ga0068860_100530559 3300005843 Bacteria 1178
387 Ga0068860_100708526 3300005843 Bacteria 1017
388 Ga0068862_100513910 3300005844 Bacteria 1139
389 Ga0068862_100624739 3300005844 Bacteria 1037
390 Ga0068862_101218995 3300005844 Bacteria 751
391 Ga0081455_10243169 3300005937 Bacteria 1321
392 Ga0081455_10245504 3300005937 Bacteria 1313
393 Ga0081538_10078237 3300005981 Bacteria 1776
394 Ga0081539_10023333 3300005985 Bacteria 4055
395 Ga0081539_10215463 3300005985 Bacteria 877
396 Ga0075432_10303059 3300006058 Bacteria 664
397 Ga0070715_10091235 3300006163 Bacteria 1402
398 Ga0070715_10614808 3300006163 Bacteria 639
399 Ga0070715_10781552 3300006163 Bacteria 578
400 Ga0070716_100014957 3300006173 Bacteria 3982
401 Ga0070716_100120125 3300006173 Bacteria 1644
402 Ga0070716_100185223 3300006173 Bacteria 1371
403 Ga0070712_100150856 3300006175 Bacteria 1784
404 Ga0070712_100602962 3300006175 Bacteria 930
405 Ga0070712_101180134 3300006175 Bacteria 666
406 Ga0097621_100072407 3300006237 Bacteria 2850
407 Ga0097621_100114591 3300006237 Bacteria 2281
408 Ga0097621_101288906 3300006237 Bacteria 690
409 Ga0068871_100188895 3300006358 Bacteria 1774
410 Ga0068871_100349234 3300006358 Bacteria 1308
411 Ga0068871_100524840 3300006358 Bacteria 1070
412 Ga0068871_100790188 3300006358 Unclassified 874
413 Ga0075428_100483856 3300006844 Bacteria 1325
414 Ga0075428_101106268 3300006844 Bacteria 837
415 Ga0075428_102713510 3300006844 Bacteria 505
416 Ga0075430_100388623 3300006846 Bacteria 1151
417 Ga0075430_101203605 3300006846 Bacteria 624
418 Ga0075431_100066106 3300006847 Bacteria 3732
419 Ga0075431_100132267 3300006847 Bacteria 2573
420 Ga0075431_100445223 3300006847 Bacteria 1292
421 Ga0075431_100446411 3300006847 Bacteria 1290
422 Ga0075431_100679135 3300006847 Bacteria 1009
423 Ga0075433_10014445 3300006852 Bacteria 6452
424 Ga0075433_10017586 3300006852 Bacteria 5928
425 Ga0075433_10048621 3300006852 Bacteria 3689
426 Ga0075433_10082656 3300006852 Bacteria 2832
427 Ga0075433_10453291 3300006852 Bacteria 1131
428 Ga0075433_10475033 3300006852 Bacteria 1101
429 Ga0075434_100039856 3300006871 Bacteria 4652
430 Ga0075434_100056118 3300006871 Bacteria 3914
431 Ga0075434_100293178 3300006871 Bacteria 1647
432 Ga0075434_100411482 3300006871 Bacteria 1373
433 Ga0075434_100623359 3300006871 Bacteria 1097
434 Ga0075434_100881444 3300006871 Bacteria 910
435 Ga0075429_100019213 3300006880 Bacteria 5920
436 Ga0075429_100181478 3300006880 Bacteria 1844
437 Ga0075429_100278121 3300006880 Bacteria 1466
438 Ga0075429_101064640 3300006880 Bacteria 707
439 Ga0068865_100094461 3300006881 Bacteria 2176
440 Ga0068865_100136783 3300006881 Bacteria 1842
441 Ga0068865_100273628 3300006881 Bacteria 1342
442 Ga0068865_100787660 3300006881 Bacteria 819
443 Ga0068865_100999212 3300006881 Bacteria 732
444 Ga0075436_100000105 3300006914 Bacteria 50007
445 Ga0075436_100011027 3300006914 Bacteria 6202
446 Ga0075436_100034048 3300006914 Bacteria 3511
447 Ga0075436_100145157 3300006914 Bacteria 1668
448 Ga0075436_100293565 3300006914 Bacteria 1164
449 Ga0075436_100506269 3300006914 Bacteria 884
450 Ga0097620_100039441 3300006931 Bacteria 4737
451 Ga0097620_100216397 3300006931 Bacteria 2003
452 Ga0097620_100351562 3300006931 Bacteria 1569
453 Ga0097620_100624048 3300006931 Bacteria 1170
454 Ga0097620_100725107 3300006931 Unclassified 1084
455 Ga0075435_100039577 3300007076 Bacteria 3762
456 Ga0075435_100093480 3300007076 Bacteria 2485
457 Ga0075435_100458431 3300007076 Bacteria 1100
458 Ga0075435_101173550 3300007076 Bacteria 672
459 Ga0075435_101207494 3300007076 Bacteria 662
460 Ga0075435_101501941 3300007076 Bacteria 591
461 Ga0099794_10232222 3300007265 Bacteria 949
462 Ga0099794_10235798 3300007265 Bacteria 942
463 Ga0099794_10805773 3300007265 Bacteria 502
464 Ga0099795_10031621 3300007788 Bacteria 1824
465 Ga0105240_10101231 3300009093 Bacteria 3505
466 Ga0105240_10106067 3300009093 Bacteria 3409
467 Ga0105240_10377512 3300009093 Bacteria 1601
468 Ga0105240_11405854 3300009093 Bacteria 733
469 Ga0105240_12715848 3300009093 Bacteria 510
470 Ga0111539_10250172 3300009094 Bacteria 2064
471 Ga0111539_10296278 3300009094 Bacteria 1882
472 Ga0111539_10875500 3300009094 Bacteria 1045
473 Ga0111539_12150536 3300009094 Bacteria 647
474 Ga0105245_10094704 3300009098 Bacteria 2753
475 Ga0105245_10155732 3300009098 Bacteria 2164
476 Ga0105245_10219981 3300009098 Bacteria 1832
477 Ga0105245_10429375 3300009098 Bacteria 1326
478 Ga0105245_10470338 3300009098 Bacteria 1269
479 Ga0105245_10564960 3300009098 Bacteria 1161
480 Ga0105245_11336780 3300009098 Bacteria 766
481 Ga0105245_11604509 3300009098 Bacteria 702
482 Ga0105247_10723337 3300009101 Bacteria 752
483 Ga0114129_10032671 3300009147 Bacteria 7353
484 Ga0114129_10074165 3300009147 Bacteria 4740
485 Ga0114129_10442964 3300009147 Bacteria 1705
486 Ga0114129_10603869 3300009147 Bacteria 1421
487 Ga0114129_10768010 3300009147 Bacteria 1232
488 Ga0114129_10794816 3300009147 Bacteria 1207
489 Ga0114129_10971514 3300009147 Bacteria 1071
490 Ga0105243_10345671 3300009148 Bacteria 1364
491 Ga0105243_10657686 3300009148 Bacteria 1016
492 Ga0105243_10911407 3300009148 Bacteria 875
493 Ga0105243_12099905 3300009148 Bacteria 601
494 Ga0105243_12447293 3300009148 Bacteria 561
495 Ga0105241_10146778 3300009174 Bacteria 1925
496 Ga0105241_10357475 3300009174 Bacteria 1270
497 Ga0105242_10149144 3300009176 Bacteria 2038
498 Ga0105242_11282820 3300009176 Bacteria 755
499 Ga0105248_10122714 3300009177 Bacteria 2931
500 Ga0105248_10322129 3300009177 Bacteria 1741
501 Ga0105248_10673931 3300009177 Bacteria 1167
502 Ga0105248_11222903 3300009177 Bacteria 849
503 Ga0105248_11563113 3300009177 Bacteria 747
504 Ga0105248_12130074 3300009177 Bacteria 638
505 Ga0105248_12276975 3300009177 Bacteria 617
506 Ga0105237_10688214 3300009545 Bacteria 1029
507 Ga0105237_11180422 3300009545 Bacteria 772
508 Ga0105238_10074647 3300009551 Bacteria 3383
509 Ga0105238_10911998 3300009551 Bacteria 897
510 Ga0105238_11817297 3300009551 Bacteria 641
511 Ga0105249_10747690 3300009553 Bacteria 1040
512 Ga0105249_10974948 3300009553 Bacteria 916
513 Ga0105239_10977094 3300010375 Bacteria 973
514 Ga0105239_11728858 3300010375 Bacteria 724
515 Ga0105239_13235952 3300010375 Bacteria 530
516 Ga0105246_10135906 3300011119 Bacteria 1843
517 Ga0157318_1028166 3300012482 Bacteria 541
518 Ga0157341_1042080 3300012494 Bacteria 532
519 Ga0157323_1004571 3300012495 Bacteria 891
520 Ga0157339_1028615 3300012505 Bacteria 639
521 Ga0157342_1020734 3300012507 Bacteria 762
522 Ga0157316_1015673 3300012510 Bacteria 770
523 Ga0157373_10075094 3300013100 Bacteria 2385
524 Ga0157373_10107506 3300013100 Bacteria 1961
525 Ga0157373_10134672 3300013100 Bacteria 1737
526 Ga0157373_10261289 3300013100 Bacteria 1225
527 Ga0157371_10502250 3300013102 Bacteria 896
528 Ga0157371_11376732 3300013102 Bacteria 547
529 Ga0157370_10006391 3300013104 Bacteria 13004
530 Ga0157370_10051328 3300013104 Bacteria 3939
531 Ga0157370_10284510 3300013104 Bacteria 1527
532 Ga0157370_10885631 3300013104 Bacteria 810
533 Ga0157370_11354269 3300013104 Bacteria 641
534 Ga0157370_11584828 3300013104 Bacteria 588
535 Ga0157369_10129033 3300013105 Bacteria 2680
536 Ga0157369_10360263 3300013105 Bacteria 1510
537 Ga0157369_10966313 3300013105 Bacteria 873
538 Ga0157369_11050120 3300013105 Bacteria 833
539 Ga0157369_12520277 3300013105 Bacteria 521
540 Ga0157374_10841745 3300013296 Bacteria 934
541 Ga0157374_10938383 3300013296 Bacteria 884
542 Ga0157374_11612879 3300013296 Bacteria 673
543 Ga0157374_11672773 3300013296 Bacteria 661
544 Ga0157378_10107312 3300013297 Bacteria 2555
545 Ga0157378_10168578 3300013297 Bacteria 2052
546 Ga0157378_10392433 3300013297 Bacteria 1365
547 Ga0157378_10924224 3300013297 Bacteria 904
548 Ga0157378_11111228 3300013297 Bacteria 828
549 Ga0157378_11206617 3300013297 Bacteria 796
550 Ga0157378_11286448 3300013297 Bacteria 772
551 Ga0157378_11793893 3300013297 Bacteria 662
552 Ga0157378_12350404 3300013297 Bacteria 585
553 Ga0157378_12778686 3300013297 Bacteria 542
554 Ga0163162_10771069 3300013306 Bacteria 1080
555 Ga0163162_10942245 3300013306 Bacteria 975
556 Ga0163162_11353130 3300013306 Bacteria 810
557 Ga0163162_12210203 3300013306 Bacteria 632
558 Ga0163162_12562676 3300013306 Bacteria 587
559 Ga0157372_10353040 3300013307 Bacteria 1713
560 Ga0157372_10360783 3300013307 Bacteria 1693
561 Ga0157372_10398247 3300013307 Bacteria 1604
562 Ga0157372_10437193 3300013307 Bacteria 1525
563 Ga0157372_10438515 3300013307 Bacteria 1522
564 Ga0157372_10707076 3300013307 Bacteria 1173
565 Ga0157372_11176516 3300013307 Bacteria 886
566 Ga0157372_11335691 3300013307 Bacteria 827
567 Ga0157372_11876377 3300013307 Bacteria 689
568 Ga0157372_12916985 3300013307 Bacteria 547
569 Ga0157372_13205857 3300013307 Bacteria 522
570 Ga0157375_10470699 3300013308 Unclassified 1422
571 Ga0157375_10773256 3300013308 Bacteria 1110
572 Ga0157375_12065547 3300013308 Bacteria 678
573 Ga0163163_10308590 3300014325 Bacteria 1635
574 Ga0163163_10308637 3300014325 Bacteria 1635
575 Ga0163163_10395870 3300014325 Bacteria 1439
576 Ga0163163_10833141 3300014325 Bacteria 986
577 Ga0163163_11090999 3300014325 Bacteria 861
578 Ga0157380_11276920 3300014326 Bacteria 781
579 Ga0157380_13177473 3300014326 Bacteria 524
580 Ga0182008_10006718 3300014497 Bacteria 6404
581 Ga0157377_10220127 3300014745 Bacteria 1215
582 Ga0157379_10648203 3300014968 Bacteria 989
583 Ga0157379_11019995 3300014968 Bacteria 789
584 Ga0157379_11275611 3300014968 Bacteria 709
585 Ga0157379_11425219 3300014968 Bacteria 672
586 Ga0157379_12463332 3300014968 Bacteria 520
587 Ga0157376_10346309 3300014969 Bacteria 1421
588 Ga0157376_10688632 3300014969 Bacteria 1026
589 Ga0157376_10976839 3300014969 Bacteria 868
590 Ga0157376_12139206 3300014969 Bacteria 598
591 Ga0157376_13037862 3300014969 Bacteria 508
592 Ga0182007_10245076 3300015262 Bacteria 641
593 Ga0163161_10184027 3300017792 Bacteria 1603
594 Ga0163161_10551308 3300017792 Unclassified 945
595 Ga0163161_12037071 3300017792 Bacteria 510
596 Ga0206356_11621450 3300020070 Bacteria 820
597 Ga0206349_1309757 3300020075 Bacteria 563
598 Ga0213876_10010709 3300021384 Bacteria 4913
599 Ga0213876_10244513 3300021384 Bacteria 953
600 Ga0213876_10253805 3300021384 Bacteria 935
601 Ga0207666_1023196 3300025271 Bacteria 922
602 Ga0207697_10011385 3300025315 Bacteria 3763
603 Ga0207656_10283209 3300025321 Bacteria 818
604 Ga0207682_10016764 3300025893 Bacteria 2859
605 Ga0207692_10077555 3300025898 Bacteria 1768
606 Ga0207642_10008208 3300025899 Bacteria 3569
607 Ga0207642_10469862 3300025899 Bacteria 765
608 Ga0207642_10568459 3300025899 Bacteria 702
609 Ga0207642_10642395 3300025899 Bacteria 664
610 Ga0207688_10027380 3300025901 Bacteria 3136
611 Ga0207688_10684318 3300025901 Bacteria 648
612 Ga0207680_10025729 3300025903 Bacteria 3250
613 Ga0207680_10125424 3300025903 Bacteria 1685
614 Ga0207680_10351990 3300025903 Bacteria 1035
615 Ga0207685_10030303 3300025905 Bacteria 1924
616 Ga0207699_10001230 3300025906 Bacteria 12159
617 Ga0207699_10044660 3300025906 Bacteria 2580
618 Ga0207699_10127954 3300025906 Bacteria 1652
619 Ga0207699_10560054 3300025906 Bacteria 830
620 Ga0207645_10018114 3300025907 Bacteria 4642
621 Ga0207645_10185904 3300025907 Bacteria 1364
622 Ga0207645_10193216 3300025907 Bacteria 1338
623 Ga0207643_10003364 3300025908 Bacteria 8615
624 Ga0207643_10281215 3300025908 Bacteria 1032
625 Ga0207705_10027229 3300025909 Bacteria 4075
626 Ga0207705_10029211 3300025909 Bacteria 3930
627 Ga0207705_10031424 3300025909 Bacteria 3790
628 Ga0207705_10278431 3300025909 Bacteria 1280
629 Ga0207705_10461503 3300025909 Bacteria 985
630 Ga0207705_10694084 3300025909 Bacteria 791
631 Ga0207684_10022976 3300025910 Bacteria 5326
632 Ga0207684_10199408 3300025910 Bacteria 1726
633 Ga0207684_10321730 3300025910 Bacteria 1333
634 Ga0207684_10460484 3300025910 Bacteria 1091
635 Ga0207684_10466072 3300025910 Bacteria 1084
636 Ga0207684_11038716 3300025910 Bacteria 684
637 Ga0207654_10028743 3300025911 Bacteria 3034
638 Ga0207707_10004257 3300025912 Bacteria 12664
639 Ga0207707_10020853 3300025912 Bacteria 5725
640 Ga0207707_10041250 3300025912 Bacteria 4031
641 Ga0207707_10068861 3300025912 Bacteria 3084
642 Ga0207707_10075446 3300025912 Bacteria 2942
643 Ga0207707_10097923 3300025912 Bacteria 2564
644 Ga0207707_10627301 3300025912 Bacteria 908
645 Ga0207707_10784898 3300025912 Bacteria 794
646 Ga0207707_10861232 3300025912 Bacteria 751
647 Ga0207707_11104162 3300025912 Bacteria 646
648 Ga0207695_10004617 3300025913 Bacteria 18682
649 Ga0207695_10013424 3300025913 Bacteria 9771
650 Ga0207695_10070341 3300025913 Bacteria 3578
651 Ga0207695_10226195 3300025913 Bacteria 1777
652 Ga0207671_10127670 3300025914 Bacteria 1950
653 Ga0207671_11569578 3300025914 Bacteria 507
654 Ga0207693_10130240 3300025915 Bacteria 1977
655 Ga0207693_10177031 3300025915 Bacteria 1678
656 Ga0207693_10182171 3300025915 Bacteria 1653
657 Ga0207693_10361372 3300025915 Bacteria 1136
658 Ga0207693_10440034 3300025915 Bacteria 1019
659 Ga0207693_10488937 3300025915 Bacteria 961
660 Ga0207663_10008487 3300025916 Bacteria 5375
661 Ga0207663_10073763 3300025916 Bacteria 2210
662 Ga0207663_10511946 3300025916 Bacteria 934
663 Ga0207663_10892089 3300025916 Bacteria 711
664 Ga0207660_10004139 3300025917 Bacteria 9438
665 Ga0207660_10032435 3300025917 Bacteria 3605
666 Ga0207660_10044376 3300025917 Bacteria 3128
667 Ga0207660_10046045 3300025917 Bacteria 3077
668 Ga0207660_10088243 3300025917 Bacteria 2293
669 Ga0207660_10097907 3300025917 Bacteria 2187
670 Ga0207660_10168557 3300025917 Bacteria 1694
671 Ga0207660_10478573 3300025917 Bacteria 1009
672 Ga0207660_10681750 3300025917 Bacteria 838
673 Ga0207660_11266911 3300025917 Bacteria 599
674 Ga0207662_10007104 3300025918 Bacteria 6083
675 Ga0207662_10037541 3300025918 Bacteria 2835
676 Ga0207662_10185746 3300025918 Bacteria 1339
677 Ga0207662_10247582 3300025918 Bacteria 1169
678 Ga0207662_10304538 3300025918 Bacteria 1060
679 Ga0207662_10722687 3300025918 Bacteria 699
680 Ga0207657_10001138 3300025919 Bacteria 28229
681 Ga0207657_10047239 3300025919 Bacteria 3765
682 Ga0207657_10133641 3300025919 Bacteria 2032
683 Ga0207657_10281579 3300025919 Bacteria 1320
684 Ga0207657_10553571 3300025919 Bacteria 899
685 Ga0207649_10025188 3300025920 Bacteria 3466
686 Ga0207649_10032190 3300025920 Bacteria 3124
687 Ga0207649_10058649 3300025920 Bacteria 2411
688 Ga0207649_10118913 3300025920 Bacteria 1778
689 Ga0207649_10167119 3300025920 Bacteria 1529
690 Ga0207649_10178625 3300025920 Bacteria 1484
691 Ga0207649_10525517 3300025920 Bacteria 903
692 Ga0207649_10526993 3300025920 Bacteria 901
693 Ga0207649_11091551 3300025920 Bacteria 629
694 Ga0207652_10011077 3300025921 Bacteria 7269
695 Ga0207652_10012004 3300025921 Bacteria 6992
696 Ga0207652_10042922 3300025921 Bacteria 3850
697 Ga0207652_10065009 3300025921 Bacteria 3157
698 Ga0207652_10093206 3300025921 Bacteria 2650
699 Ga0207652_10180913 3300025921 Bacteria 1895
700 Ga0207652_10261717 3300025921 Bacteria 1560
701 Ga0207652_10261985 3300025921 Bacteria 1559
702 Ga0207652_10324641 3300025921 Bacteria 1390
703 Ga0207652_10444285 3300025921 Bacteria 1169
704 Ga0207652_10539114 3300025921 Bacteria 1049
705 Ga0207652_10917515 3300025921 Bacteria 773
706 Ga0207652_10968089 3300025921 Bacteria 749
707 Ga0207646_10019243 3300025922 Bacteria 6348
708 Ga0207646_10035672 3300025922 Bacteria 4491
709 Ga0207646_10103586 3300025922 Bacteria 2552
710 Ga0207646_10409012 3300025922 Bacteria 1225
711 Ga0207646_10473825 3300025922 Bacteria 1129
712 Ga0207646_10536794 3300025922 Bacteria 1052
713 Ga0207646_11799240 3300025922 Bacteria 524
714 Ga0207681_10068781 3300025923 Bacteria 2461
715 Ga0207681_10085457 3300025923 Bacteria 2239
716 Ga0207681_10205225 3300025923 Bacteria 1515
717 Ga0207681_10544386 3300025923 Bacteria 955
718 Ga0207681_10545758 3300025923 Bacteria 953
719 Ga0207694_10026946 3300025924 Bacteria 4377
720 Ga0207694_10248765 3300025924 Bacteria 1454
721 Ga0207694_10275749 3300025924 Bacteria 1380
722 Ga0207694_10843780 3300025924 Bacteria 774
723 Ga0207650_10010393 3300025925 Bacteria 6382
724 Ga0207650_10249865 3300025925 Bacteria 1435
725 Ga0207650_11374444 3300025925 Bacteria 601
726 Ga0207659_10022346 3300025926 Bacteria 4211
727 Ga0207659_10208752 3300025926 Bacteria 1564
728 Ga0207659_10218655 3300025926 Bacteria 1530
729 Ga0207659_10497834 3300025926 Bacteria 1031
730 Ga0207659_11195230 3300025926 Bacteria 654
731 Ga0207659_11694803 3300025926 Bacteria 538
732 Ga0207687_10075869 3300025927 Bacteria 2414
733 Ga0207687_10136950 3300025927 Bacteria 1853
734 Ga0207687_10400629 3300025927 Bacteria 1129
735 Ga0207687_11183420 3300025927 Bacteria 657
736 Ga0207687_11722786 3300025927 Bacteria 537
737 Ga0207700_10087723 3300025928 Bacteria 2447
738 Ga0207700_10483316 3300025928 Bacteria 1094
739 Ga0207664_10000099 3300025929 Bacteria 80206
740 Ga0207664_10012437 3300025929 Bacteria 6084
741 Ga0207664_10420601 3300025929 Bacteria 1190
742 Ga0207664_11970421 3300025929 Bacteria 507
743 Ga0207644_10227703 3300025931 Bacteria 1480
744 Ga0207644_10490086 3300025931 Bacteria 1013
745 Ga0207644_10860658 3300025931 Bacteria 759
746 Ga0207644_11627165 3300025931 Bacteria 541
747 Ga0207690_10070701 3300025932 Bacteria 2405
748 Ga0207690_10076401 3300025932 Bacteria 2325
749 Ga0207690_10207916 3300025932 Bacteria 1490
750 Ga0207706_10075992 3300025933 Bacteria 2955
751 Ga0207706_10150224 3300025933 Bacteria 2049
752 Ga0207706_10535245 3300025933 Bacteria 1009
753 Ga0207706_10556469 3300025933 Bacteria 987
754 Ga0207706_11007915 3300025933 Bacteria 699
755 Ga0207706_11353459 3300025933 Bacteria 586
756 Ga0207686_10060773 3300025934 Bacteria 2393
757 Ga0207686_11131820 3300025934 Bacteria 639
758 Ga0207686_11331536 3300025934 Bacteria 590
759 Ga0207709_10081832 3300025935 Bacteria 2083
760 Ga0207709_11327797 3300025935 Bacteria 595
761 Ga0207670_10004353 3300025936 Bacteria 7611
762 Ga0207670_10018648 3300025936 Bacteria 4224
763 Ga0207670_10107499 3300025936 Bacteria 2003
764 Ga0207670_10301182 3300025936 Bacteria 1255
765 Ga0207670_11139326 3300025936 Bacteria 659
766 Ga0207670_11928134 3300025936 Bacteria 502
767 Ga0207669_10346609 3300025937 Bacteria 1146
768 Ga0207669_10350187 3300025937 Bacteria 1141
769 Ga0207669_11052314 3300025937 Bacteria 685
770 Ga0207704_10040337 3300025938 Bacteria 2727
771 Ga0207704_11302836 3300025938 Bacteria 621
772 Ga0207704_11365406 3300025938 Bacteria 607
773 Ga0207665_10021871 3300025939 Bacteria 4206
774 Ga0207665_10024947 3300025939 Bacteria 3943
775 Ga0207665_10097926 3300025939 Bacteria 2043
776 Ga0207665_10197621 3300025939 Bacteria 1464
777 Ga0207665_11293580 3300025939 Bacteria 581
778 Ga0207691_10032808 3300025940 Bacteria 4839
779 Ga0207691_10046795 3300025940 Bacteria 3973
780 Ga0207691_10153386 3300025940 Bacteria 2025
781 Ga0207691_10322355 3300025940 Bacteria 1325
782 Ga0207711_10183645 3300025941 Bacteria 1903
783 Ga0207711_11200148 3300025941 Bacteria 700
784 Ga0207711_11895670 3300025941 Bacteria 539
785 Ga0207711_12060576 3300025941 Bacteria 513
786 Ga0207689_10019641 3300025942 Bacteria 5694
787 Ga0207689_10053633 3300025942 Bacteria 3322
788 Ga0207689_10123876 3300025942 Bacteria 2126
789 Ga0207661_10001907 3300025944 Bacteria 14301
790 Ga0207661_10004866 3300025944 Bacteria 9413
791 Ga0207661_10047859 3300025944 Bacteria 3396
792 Ga0207661_10179812 3300025944 Bacteria 1847
793 Ga0207661_11788099 3300025944 Bacteria 560
794 Ga0207679_10002650 3300025945 Bacteria 11044
795 Ga0207679_10192419 3300025945 Bacteria 1697
796 Ga0207679_10218788 3300025945 Bacteria 1601
797 Ga0207679_10314992 3300025945 Bacteria 1353
798 Ga0207679_10316793 3300025945 Bacteria 1349
799 Ga0207679_10741175 3300025945 Bacteria 893
800 Ga0207679_10752364 3300025945 Bacteria 886
801 Ga0207679_10822952 3300025945 Bacteria 847
802 Ga0207679_10872568 3300025945 Bacteria 822
803 Ga0207679_11249370 3300025945 Bacteria 682
804 Ga0207679_11269312 3300025945 Bacteria 676
805 Ga0207679_12086469 3300025945 Bacteria 515
806 Ga0207679_12138210 3300025945 Bacteria 508
807 Ga0207667_10034763 3300025949 Bacteria 5409
808 Ga0207667_10658021 3300025949 Bacteria 1053
809 Ga0207667_11478457 3300025949 Bacteria 651
810 Ga0207667_12081101 3300025949 Bacteria 526
811 Ga0207651_10021908 3300025960 Bacteria 3893
812 Ga0207651_10036217 3300025960 Bacteria 3219
813 Ga0207651_10071067 3300025960 Bacteria 2465
814 Ga0207651_10128156 3300025960 Bacteria 1937
815 Ga0207651_10173474 3300025960 Bacteria 1703
816 Ga0207712_10675161 3300025961 Bacteria 900
817 Ga0207668_10281849 3300025972 Bacteria 1363
818 Ga0207668_10808508 3300025972 Bacteria 830
819 Ga0207640_10001854 3300025981 Bacteria 11325
820 Ga0207640_10129033 3300025981 Bacteria 1825
821 Ga0207640_10238690 3300025981 Bacteria 1403
822 Ga0207640_10280376 3300025981 Bacteria 1309
823 Ga0207640_10583783 3300025981 Bacteria 944
824 Ga0207640_10719024 3300025981 Bacteria 858
825 Ga0207658_11026684 3300025986 Bacteria 752
826 Ga0207658_12005943 3300025986 Bacteria 527
827 Ga0207677_10012623 3300026023 Bacteria 4866
828 Ga0207677_10058774 3300026023 Bacteria 2649
829 Ga0207677_10092972 3300026023 Bacteria 2197
830 Ga0207677_10216912 3300026023 Bacteria 1532
831 Ga0207677_10287200 3300026023 Bacteria 1353
832 Ga0207677_10416302 3300026023 Bacteria 1143
833 Ga0207703_11017431 3300026035 Bacteria 795
834 Ga0207703_12206895 3300026035 Bacteria 526
835 Ga0207639_10002689 3300026041 Bacteria 11930
836 Ga0207639_10051893 3300026041 Bacteria 3122
837 Ga0207639_10204557 3300026041 Bacteria 1695
838 Ga0207639_10217878 3300026041 Bacteria 1647
839 Ga0207639_10798015 3300026041 Bacteria 880
840 Ga0207639_11176347 3300026041 Bacteria 720
841 Ga0207639_11760032 3300026041 Bacteria 580
842 Ga0207678_10012023 3300026067 Bacteria 7601
843 Ga0207678_10076305 3300026067 Bacteria 2871
844 Ga0207678_11960182 3300026067 Bacteria 510
845 Ga0207708_10112088 3300026075 Bacteria 2118
846 Ga0207708_10156616 3300026075 Bacteria 1796
847 Ga0207708_10614938 3300026075 Bacteria 922
848 Ga0207708_10795262 3300026075 Bacteria 814
849 Ga0207708_11220680 3300026075 Bacteria 658
850 Ga0207708_12019120 3300026075 Bacteria 505
851 Ga0207702_10036288 3300026078 Bacteria 4123
852 Ga0207702_10086091 3300026078 Bacteria 2740
853 Ga0207702_10249947 3300026078 Bacteria 1665
854 Ga0207702_10868485 3300026078 Bacteria 893
855 Ga0207702_11628407 3300026078 Bacteria 639
856 Ga0207641_10070450 3300026088 Bacteria 3004
857 Ga0207641_10281147 3300026088 Bacteria 1565
858 Ga0207641_10464731 3300026088 Bacteria 1224
859 Ga0207641_10611440 3300026088 Bacteria 1068
860 Ga0207641_11270260 3300026088 Bacteria 736
861 Ga0207648_10048391 3300026089 Bacteria 3722
862 Ga0207648_10097740 3300026089 Bacteria 2569
863 Ga0207648_10203821 3300026089 Bacteria 1755
864 Ga0207648_10306254 3300026089 Bacteria 1426
865 Ga0207648_10654520 3300026089 Bacteria 971
866 Ga0207676_10180609 3300026095 Bacteria 1847
867 Ga0207676_10297097 3300026095 Bacteria 1473
868 Ga0207676_11001064 3300026095 Bacteria 823
869 Ga0207676_11162364 3300026095 Bacteria 764
870 Ga0207676_11353882 3300026095 Bacteria 707
871 Ga0207674_10048180 3300026116 Bacteria 4363
872 Ga0207674_10082972 3300026116 Bacteria 3205
873 Ga0207674_10100870 3300026116 Bacteria 2868
874 Ga0207674_10101100 3300026116 Bacteria 2864
875 Ga0207674_10168287 3300026116 Bacteria 2145
876 Ga0207674_10268372 3300026116 Bacteria 1654
877 Ga0207674_11749475 3300026116 Bacteria 589
878 Ga0207675_100316888 3300026118 Bacteria 1522
879 Ga0207683_10028596 3300026121 Bacteria 4822
880 Ga0207683_10035142 3300026121 Bacteria 4359
881 Ga0207683_10127379 3300026121 Bacteria 2289
882 Ga0207683_10618670 3300026121 Bacteria 1003
883 Ga0207698_10038152 3300026142 Bacteria 3547
884 Ga0207698_10046102 3300026142 Bacteria 3289
885 Ga0207698_10601353 3300026142 Bacteria 1084
886 Ga0207698_11574528 3300026142 Bacteria 672
887 Ga0207698_11688725 3300026142 Bacteria 649
888 Ga0207698_12636717 3300026142 Bacteria 512
889 Ga0209973_1018244 3300027252 Bacteria 908
890 Ga0209973_1021955 3300027252 Bacteria 854
891 Ga0209967_1084390 3300027364 Bacteria 500
892 Ga0209984_1013486 3300027424 Bacteria 1073
893 Ga0209984_1054251 3300027424 Bacteria 589
894 Ga0209995_1003150 3300027471 Bacteria 2621
895 Ga0209995_1009325 3300027471 Bacteria 1586
896 Ga0209968_1003096 3300027526 Bacteria 2493
897 Ga0209999_1002599 3300027543 Bacteria 3194
898 Ga0209999_1091843 3300027543 Bacteria 589
899 Ga0209999_1124806 3300027543 Bacteria 505
900 Ga0209982_1017982 3300027552 Bacteria 1080
901 Ga0209970_1024737 3300027614 Bacteria 1027
902 Ga0209970_1052785 3300027614 Bacteria 737
903 Ga0210002_1043222 3300027617 Bacteria 768
904 Ga0210002_1082987 3300027617 Bacteria 572
905 Ga0209983_1000810 3300027665 Bacteria 6831
906 Ga0209983_1018496 3300027665 Bacteria 1447
907 Ga0209983_1019830 3300027665 Bacteria 1399
908 Ga0209971_1020116 3300027682 Bacteria 1586
909 Ga0209966_1000982 3300027695 Bacteria 5325
910 Ga0209966_1108664 3300027695 Bacteria 631
911 Ga0209998_10003458 3300027717 Bacteria 3451
912 Ga0209998_10080529 3300027717 Bacteria 789
913 Ga0209974_10007380 3300027876 Bacteria 3789
914 Ga0209974_10007508 3300027876 Bacteria 3752
915 Ga0207428_10011903 3300027907 Bacteria 7658
916 Ga0207428_10193964 3300027907 Bacteria 1530
917 Ga0207428_10276111 3300027907 Bacteria 1248
918 Ga0207428_10401508 3300027907 Bacteria 1003
919 Ga0268266_10142482 3300028379 Bacteria 2152
920 Ga0268266_10237157 3300028379 Bacteria 1682
921 Ga0268265_10067252 3300028380 Bacteria 2773
922 Ga0268265_10415410 3300028380 Bacteria 1248
923 Ga0268265_10574631 3300028380 Bacteria 1073
924 Ga0268265_10859804 3300028380 Bacteria 888
925 Ga0268265_11001979 3300028380 Bacteria 825
926 Ga0268264_10221374 3300028381 Bacteria 1742
927 Ga0268264_10630454 3300028381 Bacteria 1059
928 Ga0265323_10056890 3300028653 Bacteria 1370
929 Ga0265338_10051633 3300028800 Bacteria 3699
930 Ga0316182_1255157 3300030745 Bacteria 836
931 Ga0265320_10064432 3300031240 Unclassified 1741
932 Ga0265327_10087014 3300031251 Bacteria 1531
933 Ga0265316_10934161 3300031344 Bacteria 605
934 Ga0307408_100016817 3300031548 Bacteria 4889
935 Ga0307408_100019763 3300031548 Bacteria 4537
936 Ga0307408_100046769 3300031548 Bacteria 3096
937 Ga0307408_100052712 3300031548 Bacteria 2935
938 Ga0307408_100062503 3300031548 Bacteria 2721
939 Ga0307408_100099262 3300031548 Bacteria 2215
940 Ga0307408_100153960 3300031548 Bacteria 1818
941 Ga0307408_100223526 3300031548 Bacteria 1538
942 Ga0307408_100406940 3300031548 Bacteria 1170
943 Ga0307408_100424859 3300031548 Bacteria 1147
944 Ga0307408_100713907 3300031548 Bacteria 902
945 Ga0307408_100864679 3300031548 Bacteria 825
946 Ga0307408_101332649 3300031548 Bacteria 674
947 Ga0265313_10145536 3300031595 Bacteria 1016
948 Ga0316575_10039695 3300031665 Bacteria 1859
949 Ga0316575_10385885 3300031665 Bacteria 599
950 Ga0316579_10001157 3300031691 Bacteria 9386
951 Ga0265314_10001956 3300031711 Bacteria 21935
952 Ga0265342_10633398 3300031712 Bacteria 538
953 Ga0316576_10004863 3300031727 Bacteria 8124
954 Ga0316576_10044118 3300031727 Bacteria 3220
955 Ga0316578_10001113 3300031728 Bacteria 10503
956 Ga0307405_10003326 3300031731 Bacteria 7362
957 Ga0307405_10004504 3300031731 Bacteria 6595
958 Ga0307405_10081500 3300031731 Bacteria 2115
959 Ga0307405_10083760 3300031731 Bacteria 2091
960 Ga0307405_10100967 3300031731 Bacteria 1935
961 Ga0307405_10107686 3300031731 Bacteria 1882
962 Ga0307405_10116149 3300031731 Bacteria 1822
963 Ga0307405_10152371 3300031731 Bacteria 1627
964 Ga0307405_10250335 3300031731 Bacteria 1318
965 Ga0307405_11012285 3300031731 Bacteria 709
966 Ga0307405_11208907 3300031731 Bacteria 654
967 Ga0307405_11333273 3300031731 Bacteria 625
968 Ga0316577_10008737 3300031733 Bacteria 5430
969 Ga0316577_10076737 3300031733 Bacteria 1866
970 Ga0307413_10001842 3300031824 Bacteria 8343
971 Ga0307413_10002091 3300031824 Bacteria 7997
972 Ga0307413_10006358 3300031824 Bacteria 5383
973 Ga0307413_10031527 3300031824 Bacteria 2992
974 Ga0307413_10055726 3300031824 Bacteria 2407
975 Ga0307413_10067122 3300031824 Bacteria 2241
976 Ga0307413_10074613 3300031824 Bacteria 2149
977 Ga0307413_10079652 3300031824 Bacteria 2095
978 Ga0307413_10203183 3300031824 Bacteria 1432
979 Ga0307413_10316330 3300031824 Bacteria 1190
980 Ga0307413_10701827 3300031824 Bacteria 840
981 Ga0307413_10760750 3300031824 Bacteria 811
982 Ga0307413_10957308 3300031824 Bacteria 731
983 Ga0307413_11250943 3300031824 Bacteria 647
984 Ga0307413_11340826 3300031824 Bacteria 627
985 Ga0307413_11758549 3300031824 Bacteria 554
986 Ga0307410_10000285 3300031852 Bacteria 19565
987 Ga0307410_10000967 3300031852 Bacteria 12342
988 Ga0307410_10022252 3300031852 Bacteria 3914
989 Ga0307410_10022355 3300031852 Bacteria 3907
990 Ga0307410_10054575 3300031852 Bacteria 2709
991 Ga0307410_10057005 3300031852 Bacteria 2658
992 Ga0307410_10067694 3300031852 Bacteria 2464
993 Ga0307410_10109480 3300031852 Bacteria 1996
994 Ga0307410_10126427 3300031852 Bacteria 1872
995 Ga0307410_10654568 3300031852 Bacteria 881
996 Ga0307410_10712613 3300031852 Bacteria 847
997 Ga0307410_10869233 3300031852 Bacteria 771
998 Ga0307410_10958461 3300031852 Bacteria 736
999 Ga0307410_11030798 3300031852 Bacteria 711
1000 Ga0307406_10009039 3300031901 Bacteria 5572
1001 Ga0307406_10030981 3300031901 Bacteria 3253
1002 Ga0307406_10074742 3300031901 Bacteria 2232
1003 Ga0307406_10102636 3300031901 Bacteria 1951
1004 Ga0307406_10139031 3300031901 Bacteria 1716
1005 Ga0307406_10208490 3300031901 Bacteria 1444
1006 Ga0307406_10257460 3300031901 Bacteria 1318
1007 Ga0307406_10392032 3300031901 Bacteria 1098
1008 Ga0307406_10824787 3300031901 Bacteria 784
1009 Ga0307406_11310203 3300031901 Bacteria 632
1010 Ga0307406_11468420 3300031901 Bacteria 599
1011 Ga0307407_10005111 3300031903 Bacteria 5655
1012 Ga0307407_10005124 3300031903 Bacteria 5650
1013 Ga0307407_10044520 3300031903 Bacteria 2502
1014 Ga0307407_10122956 3300031903 Bacteria 1648
1015 Ga0307407_10241220 3300031903 Bacteria 1233
1016 Ga0307407_10500819 3300031903 Bacteria 890
1017 Ga0307407_10543982 3300031903 Bacteria 857
1018 Ga0307407_10568148 3300031903 Bacteria 840
1019 Ga0307407_10942719 3300031903 Bacteria 664
1020 Ga0307407_10954127 3300031903 Bacteria 660
1021 Ga0307407_11254962 3300031903 Bacteria 580
1022 Ga0307412_10005885 3300031911 Bacteria 6908
1023 Ga0307412_10007821 3300031911 Bacteria 6085
1024 Ga0307412_10016367 3300031911 Bacteria 4416
1025 Ga0307412_10060199 3300031911 Bacteria 2548
1026 Ga0307412_10075320 3300031911 Bacteria 2315
1027 Ga0307412_10094473 3300031911 Bacteria 2100
1028 Ga0307412_10139932 3300031911 Bacteria 1771
1029 Ga0307412_10202806 3300031911 Bacteria 1507
1030 Ga0307412_10361947 3300031911 Bacteria 1168
1031 Ga0307412_10791122 3300031911 Bacteria 822
1032 Ga0307412_10863760 3300031911 Bacteria 790
1033 Ga0307412_11152646 3300031911 Bacteria 692
1034 Ga0307412_11837595 3300031911 Bacteria 558
1035 Ga0307409_100005454 3300031995 Bacteria 7326
1036 Ga0307409_100008795 3300031995 Bacteria 6156
1037 Ga0307409_100032235 3300031995 Bacteria 3796
1038 Ga0307409_100047584 3300031995 Bacteria 3256
1039 Ga0307409_100055663 3300031995 Bacteria 3055
1040 Ga0307409_100079063 3300031995 Bacteria 2648
1041 Ga0307409_100079067 3300031995 Bacteria 2648
1042 Ga0307409_100172626 3300031995 Bacteria 1904
1043 Ga0307409_100487723 3300031995 Bacteria 1197
1044 Ga0307409_100541231 3300031995 Bacteria 1141
1045 Ga0307409_100655432 3300031995 Bacteria 1044
1046 Ga0307409_100810599 3300031995 Bacteria 944
1047 Ga0307409_101036773 3300031995 Bacteria 839
1048 Ga0307409_101214543 3300031995 Bacteria 777
1049 Ga0307409_101843172 3300031995 Bacteria 634
1050 Ga0307409_102131522 3300031995 Bacteria 590
1051 Ga0307416_100003682 3300032002 Bacteria 9079
1052 Ga0307416_100009003 3300032002 Bacteria 6494
1053 Ga0307416_100016074 3300032002 Bacteria 5188
1054 Ga0307416_100092060 3300032002 Bacteria 2606
1055 Ga0307416_100113896 3300032002 Bacteria 2391
1056 Ga0307416_100116989 3300032002 Bacteria 2365
1057 Ga0307416_100118263 3300032002 Bacteria 2355
1058 Ga0307416_100417503 3300032002 Bacteria 1385
1059 Ga0307416_100491460 3300032002 Bacteria 1289
1060 Ga0307416_100535955 3300032002 Bacteria 1241
1061 Ga0307416_100538135 3300032002 Bacteria 1239
1062 Ga0307416_100612039 3300032002 Bacteria 1170
1063 Ga0307416_100650942 3300032002 Bacteria 1138
1064 Ga0307416_100833658 3300032002 Bacteria 1019
1065 Ga0307416_101065588 3300032002 Bacteria 912
1066 Ga0307416_101526866 3300032002 Bacteria 773
1067 Ga0307416_102777375 3300032002 Bacteria 585
1068 Ga0307414_10036134 3300032004 Bacteria 3295
1069 Ga0307414_10074656 3300032004 Bacteria 2457
1070 Ga0307414_10180246 3300032004 Bacteria 1698
1071 Ga0307414_10726338 3300032004 Bacteria 901
1072 Ga0307414_10756896 3300032004 Bacteria 883
1073 Ga0307414_10956519 3300032004 Bacteria 787
1074 Ga0307414_10986856 3300032004 Bacteria 775
1075 Ga0307411_10000568 3300032005 Bacteria 13149
1076 Ga0307411_10005072 3300032005 Bacteria 6412
1077 Ga0307411_10012793 3300032005 Bacteria 4598
1078 Ga0307411_10020764 3300032005 Bacteria 3828
1079 Ga0307411_10114848 3300032005 Bacteria 1935
1080 Ga0307411_10118769 3300032005 Bacteria 1908
1081 Ga0307411_10209710 3300032005 Bacteria 1503
1082 Ga0307411_10336063 3300032005 Bacteria 1226
1083 Ga0307411_10347332 3300032005 Bacteria 1208
1084 Ga0307411_10825064 3300032005 Bacteria 818
1085 Ga0307411_10889294 3300032005 Bacteria 790
1086 Ga0307415_100004310 3300032126 Bacteria 7364
1087 Ga0307415_100004471 3300032126 Bacteria 7257
1088 Ga0307415_100006886 3300032126 Bacteria 6172
1089 Ga0307415_100017495 3300032126 Bacteria 4301
1090 Ga0307415_100073037 3300032126 Bacteria 2418
1091 Ga0307415_100077926 3300032126 Bacteria 2355
1092 Ga0307415_100116777 3300032126 Bacteria 1991
1093 Ga0307415_100232082 3300032126 Bacteria 1487
1094 Ga0307415_100238109 3300032126 Bacteria 1470
1095 Ga0307415_100315483 3300032126 Bacteria 1301
1096 Ga0307415_100443838 3300032126 Bacteria 1120
1097 Ga0307415_101090887 3300032126 Bacteria 747
1098 Ga0316583_10001183 3300032133 Bacteria 8556
1099 Ga0316583_10017879 3300032133 Bacteria 2546
1100 Ga0316583_10084259 3300032133 Bacteria 1110
1101 Ga0316585_10001668 3300032137 Bacteria 5889
1102 Ga0316580_10001460 3300032139 Bacteria 6181
1103 Ga0316592_1120642 3300033524 Bacteria 609
1104 Ga0316588_1148391 3300033528 Bacteria 601
1105 Ga0316596_1039349 3300033541 Bacteria 1240
1106 Ga0373930_0074044 3300034816 Bacteria 778
1107 Ga0373948_0059906 3300034817 Bacteria 834
1108 Ga0373950_0080083 3300034818 Bacteria 681
1109 Ga0373958_0022561 3300034819 Bacteria 1177
1110 Ga0373958_0094801 3300034819 Bacteria 693
1111 Ga0373959_0006266 3300034820 Bacteria 1969
1112 Ga0373959_0013525 3300034820 Bacteria 1473
1113 Ga0373959_0078539 3300034820 Bacteria 757
1114 Ga0373938_0034724 3300034957 Bacteria 1097
1115 Ga0373938_0246200 3300034957 Bacteria 510
1116 Ga0373926_0269996 3300035083 Bacteria 661
1117 Ga0373928_0033370 3300035084 Bacteria 1151
1118 Ga0373928_0062653 3300035084 Bacteria 903
1119 Ga0373928_0154152 3300035084 Bacteria 638
1120 Ga0373929_0026783 3300035085 Bacteria 1207
1121 Ga0373929_0029820 3300035085 Bacteria 1160
1122 Ga0373929_0056692 3300035085 Bacteria 908
1123 Ga0373934_0141970 3300035086 Bacteria 982
1124 Ga0373934_0454027 3300035086 Bacteria 537
1125 Ga0373940_0074398 3300035088 Bacteria 994
1126 Ga0373944_0057368 3300035089 Bacteria 1241
1127 Ga0373949_0250311 3300035090 Bacteria 548
1128 Ga0373952_0021650 3300035092 Bacteria 1359
1129 Ga0373952_0022759 3300035092 Bacteria 1334
1130 Ga0373952_0044807 3300035092 Bacteria 1035
1131 Ga0373923_0036974 3300035111 Bacteria 1996
1132 Ga0373932_0170684 3300035112 Bacteria 758
1133 Ga0373939_0067213 3300035114 Bacteria 1157
1134 Ga0373939_0254051 3300035114 Bacteria 685
1135 Ga0373941_0017581 3300035115 Bacteria 1962
1136 Ga0373941_0232439 3300035115 Bacteria 713
1137 Ga0373945_0397345 3300035116 Bacteria 604
1138 Ga0373953_0014696 3300035117 Bacteria 2822
1139 Ga0373954_0236932 3300035118 Bacteria 898
1140 Ga0373956_0149048 3300035119 Bacteria 1100
1141 Ga0373956_0345775 3300035119 Bacteria 709
1142 Ga0373957_0106980 3300035120 Bacteria 1124
1143 Ga0373960_0040013 3300035121 Bacteria 1351
1144 Ga0373960_0121692 3300035121 Bacteria 867
1145 Ga0373960_0200705 3300035121 Bacteria 705
1146 Ga0373943_0015892 3300035170 Bacteria 3425
1147 Ga0373943_0407194 3300035170 Bacteria 786
1148 Ga0373946_0276367 3300035171 Bacteria 825
1149 Ga0373946_0676961 3300035171 Bacteria 538
1150 Ga0373955_0088617 3300035172 Bacteria 1760
1151 Ga0373942_0037456 3300035207 Bacteria 1311
1152 Ga0373942_0199256 3300035207 Bacteria 663
1153 Ga0373961_0000555 3300035241 Bacteria 14114
1154 Ga0373961_0036950 3300035241 Bacteria 1393
1155 Ga0373961_0314891 3300035241 Bacteria 582
1156 Ga0373962_0259282 3300035242 Bacteria 606
1157 Ga0316574_0007172 3300035398 Bacteria 6090
1158 Ga0316574_0331037 3300035398 Bacteria 966
1159 Ga0316574_0355322 3300035398 Bacteria 927
1160 Ga0373924_0040307 3300035410 Bacteria 1911
1161 Ga0373931_0065790 3300035691 Bacteria 1965
1162 Ga0373931_0113587 3300035691 Bacteria 1540
1163 Ga0373931_0233081 3300035691 Bacteria 1113
1164 Ga0373931_0424587 3300035691 Bacteria 846
1165 Ga0373931_0856974 3300035691 Bacteria 608
1166 Ga0373935_0058549 3300035692 Bacteria 2461
1167 Ga0373933_0002765 3300035724 Bacteria 9786
1168 Ga0373937_0001688 3300036401 Bacteria 18564
1169 Ga0373937_0063603 3300036401 Bacteria 3394
1170 Ga0373937_0245517 3300036401 Bacteria 1687
1171 Ga0373937_0517704 3300036401 Bacteria 1133
1172 Ga0373937_1029058 3300036401 Bacteria 772
1173 Ga0373937_1128300 3300036401 Bacteria 733
1174 Ga0373937_1565581 3300036401 Bacteria 606
1175 Ga0316582_0015599 3300036647 Bacteria 4351
1176 Ga0316582_0945318 3300036647 Unclassified 589
1177 Ga0316584_0007216 3300036712 Bacteria 7583
1178 Ga0373925_0078483 3300037068 Bacteria 2507
1179 Ga0373925_0176928 3300037068 Bacteria 1687
1180 Ga0373925_0292667 3300037068 Bacteria 1313
1181 Ga0373925_0487257 3300037068 Bacteria 1012
1182 Ga0395899_0151372 3300037312 Bacteria 1644
1183 Ga0395900_0024491 3300037418 Bacteria 6181
1184 Ga0395898_1598012 3300037466 Bacteria 576
1185 Ga0395905_0025260 3300037471 Bacteria 5602
1186 Ga0395905_0067530 3300037471 Bacteria 3349
1187 Ga0395905_1312912 3300037471 Bacteria 627
1188 Ga0395905_1736610 3300037471 Bacteria 529
1189 Ga0436364_0100568 3300037853 Bacteria 510
1190 Ga0436364_0390676 3300037853 Bacteria 919
1191 Ga0436364_1537478 3300037853 Bacteria 519
1192 Ga0395901_0001770 3300038443 Bacteria 22280
1193 Ga0242419_003585 3300038698 Bacteria 1056
1194 Ga0242420_050187 3300038996 Bacteria 814
1195 Ga0436365_0223155 3300039437 Bacteria 890
1196 Ga0436365_0234011 3300039437 Bacteria 932
1197 Ga0436365_0408308 3300039437 Bacteria 3423
1198 Ga0436365_1264253 3300039437 Bacteria 2413
1199 Ga0436365_1424311 3300039437 Bacteria 1839
1200 Ga0436365_1599614 3300039437 Bacteria 517
1201 Ga0439439_0048325 3300041406 Bacteria 1112
1202 Ga0439439_0178061 3300041406 Bacteria 612
1203 Ga0439453_0097394 3300041408 Bacteria 652
1204 Ga0451793_0749803 3300041452 Bacteria 2075
1205 Ga0451795_1463064 3300041456 Bacteria 634
1206 Ga0451802_1318879 3300041460 Bacteria 788
1207 Ga0451807_0674211 3300041486 Bacteria 3051
1208 Ga0451807_1934356 3300041486 Bacteria 718
1209 Ga0451807_2773123 3300041486 Bacteria 790
1210 Ga0451839_1015318 3300041496 Bacteria 506
1211 Ga0451845_0267143 3300041501 Bacteria 643
1212 Ga0451853_2480235 3300041512 Bacteria 901
1213 Ga0451853_2725406 3300041512 Bacteria 510
1214 Ga0439433_0143812 3300041999 Bacteria 611
1215 Ga0439432_163717 3300042006 Bacteria 650
1216 Ga0439449_0103716 3300042007 Bacteria 1052
1217 Ga0439455_0022797 3300042012 Bacteria 1504
1218 Ga0439456_080993 3300042013 Bacteria 725
1219 Ga0439446_0049325 3300042156 Bacteria 1255
1220 Ga0439446_0053270 3300042156 Bacteria 1212
1221 Ga0439446_0174111 3300042156 Bacteria 717
1222 Ga0439446_0346855 3300042156 Bacteria 528
1223 Ga0439434_0081628 3300042435 Bacteria 1026
1224 Ga0439434_0157571 3300042435 Bacteria 753
1225 Ga0439459_0037912 3300042438 Bacteria 1012
1226 Ga0451577_0049852 3300042876 Bacteria 3738
1227 Ga0451577_0208168 3300042876 Bacteria 1766
1228 Ga0451577_0391595 3300042876 Bacteria 1261
1229 Ga0453683_0012099 3300044673 Bacteria 5665
1230 Ga0453683_0182841 3300044673 Bacteria 1330
1231 Ga0453683_0714274 3300044673 Bacteria 657
1232 Ga0453683_0746648 3300044673 Bacteria 643
1233 Ga0466965_0134875 3300044683 Bacteria 1282
1234 Ga0466965_0435969 3300044683 Bacteria 728
1235 Ga0466961_0216372 3300044693 Bacteria 1182
1236 Ga0466963_0055834 3300044694 Bacteria 2627
1237 Ga0466964_0133383 3300044706 Bacteria 1134
1238 Ga0453684_0062783 3300044712 Bacteria 4756
1239 Ga0453684_0532052 3300044712 Bacteria 1297
1240 Ga0453684_0714362 3300044712 Bacteria 1088
1241 Ga0453684_1371210 3300044712 Bacteria 734
1242 Ga0453684_1964546 3300044712 Bacteria 590
1243 Ga0453684_2365960 3300044712 Bacteria 527
1244 Ga0466970_0649912 3300044765 Bacteria 613
1245 Ga0466957_0209596 3300044842 Bacteria 1283
1246 Ga0466960_0145973 3300044901 Bacteria 1260
1247 Ga0466960_0176826 3300044901 Bacteria 1155
1248 Ga0466959_0772507 3300045049 Bacteria 643
1249 Ga0466959_1022370 3300045049 Bacteria 550
1250 Ga0451576_0032102 3300045051 Bacteria 5596
1251 Ga0451576_0153457 3300045051 Bacteria 2402
1252 Ga0451576_0237355 3300045051 Bacteria 1904
1253 Ga0451576_0252033 3300045051 Bacteria 1845
1254 Ga0451576_0297024 3300045051 Bacteria 1689
1255 Ga0451576_0308436 3300045051 Bacteria 1655
1256 Ga0451576_0388486 3300045051 Bacteria 1463
1257 Ga0466958_0198001 3300045836 Bacteria 1278
1258 Ga0466958_0629169 3300045836 Bacteria 698
1259 Ga0466967_0277810 3300045976 Bacteria 1606
1260 Ga0466967_1060643 3300045976 Bacteria 807
1261 Ga0466967_1139939 3300045976 Bacteria 777
1262 Ga0495592_0402576 3300046454 Bacteria 866
1263 Ga0495592_0498975 3300046454 Bacteria 755
1264 Ga0495603_0021202 3300046455 Bacteria 3934
1265 Ga0495603_0043390 3300046455 Bacteria 2685
1266 Ga0495590_0238336 3300046457 Bacteria 675
1267 Ga0495629_0048696 3300046459 Bacteria 2971
1268 Ga0495629_0073936 3300046459 Bacteria 2380
1269 Ga0495629_0077215 3300046459 Bacteria 2325
1270 Ga0495629_0615914 3300046459 Bacteria 725
1271 Ga0495629_0678831 3300046459 Bacteria 685
1272 Ga0495651_0017188 3300046462 Bacteria 5605
1273 Ga0495651_0084014 3300046462 Bacteria 2399
1274 Ga0495651_0243225 3300046462 Bacteria 1233
1275 Ga0495653_0026437 3300046463 Bacteria 4653
1276 Ga0495580_0016230 3300046472 Bacteria 5595
1277 Ga0495580_0076246 3300046472 Bacteria 2339
1278 Ga0495580_0087356 3300046472 Bacteria 2172
1279 Ga0495580_0113415 3300046472 Bacteria 1883
1280 Ga0495582_0010686 3300046473 Bacteria 5050
1281 Ga0495582_0014832 3300046473 Bacteria 4282
1282 Ga0495582_0109507 3300046473 Bacteria 1551
1283 Ga0495582_0197880 3300046473 Bacteria 1147
1284 Ga0495605_0283024 3300046474 Bacteria 704
1285 Ga0495605_0494223 3300046474 Bacteria 500
1286 Ga0495639_0004714 3300046475 Bacteria 5862
1287 Ga0495639_0067391 3300046475 Bacteria 1648
1288 Ga0495662_0097571 3300046476 Bacteria 1436
1289 Ga0495662_0117049 3300046476 Bacteria 1307
1290 Ga0495664_0463726 3300046477 Bacteria 758
1291 Ga0495584_0592649 3300046491 Bacteria 565
1292 Ga0495594_0005611 3300046499 Bacteria 6449
1293 Ga0495594_0069873 3300046499 Bacteria 1951
1294 Ga0495594_0118996 3300046499 Bacteria 1492
1295 Ga0495596_0010087 3300046500 Bacteria 4131
1296 Ga0495583_0164843 3300046506 Bacteria 913
1297 Ga0495608_0033181 3300046511 Bacteria 3491
1298 Ga0495608_0103342 3300046511 Bacteria 1836
1299 Ga0495608_0266708 3300046511 Bacteria 1065
1300 Ga0495608_0501057 3300046511 Bacteria 735
1301 Ga0495618_0000743 3300046514 Bacteria 22768
1302 Ga0495618_0036169 3300046514 Bacteria 3098
1303 Ga0495618_0422616 3300046514 Bacteria 812
1304 Ga0495618_0821398 3300046514 Bacteria 540
1305 Ga0495628_0214703 3300046516 Bacteria 1446
1306 Ga0495628_0229371 3300046516 Bacteria 1392
1307 Ga0495630_0094702 3300046517 Bacteria 2257
1308 Ga0495630_0176568 3300046517 Bacteria 1628
1309 Ga0495630_0462261 3300046517 Bacteria 972
1310 Ga0495630_0559980 3300046517 Bacteria 876
1311 Ga0495630_0814085 3300046517 Bacteria 713
1312 Ga0495630_0953767 3300046517 Bacteria 652
1313 Ga0495643_0072184 3300046522 Bacteria 1811
1314 Ga0495663_0020324 3300046525 Bacteria 1905
1315 Ga0495663_0020379 3300046525 Bacteria 1903
1316 Ga0495666_0012771 3300046526 Bacteria 4187
1317 Ga0495642_0053960 3300046528 Bacteria 1657
1318 Ga0495652_0123654 3300046529 Bacteria 2059
1319 Ga0495652_0156344 3300046529 Bacteria 1775
1320 Ga0495665_0014539 3300046531 Bacteria 4244
1321 Ga0495665_0028776 3300046531 Bacteria 2977
1322 Ga0495665_0250977 3300046531 Bacteria 911
1323 Ga0495640_0156834 3300046533 Bacteria 1461
1324 Ga0495640_0185177 3300046533 Bacteria 1325
1325 Ga0495640_0629692 3300046533 Bacteria 646
1326 Ga0495586_0015359 3300046535 Bacteria 4074
1327 Ga0495586_0126327 3300046535 Bacteria 1430
1328 Ga0495586_0174630 3300046535 Bacteria 1214
1329 Ga0495586_0301689 3300046535 Bacteria 918
1330 Ga0495586_0319161 3300046535 Bacteria 891
1331 Ga0495586_0508105 3300046535 Bacteria 695
1332 Ga0495587_0267041 3300046536 Bacteria 960
1333 Ga0495587_0447806 3300046536 Bacteria 715
1334 Ga0495587_0619377 3300046536 Bacteria 595
1335 Ga0495598_0268802 3300046537 Bacteria 637
1336 Ga0495621_0041710 3300046539 Bacteria 1612
1337 Ga0495621_0053555 3300046539 Bacteria 1449
1338 Ga0495645_0013239 3300046543 Bacteria 5830
1339 Ga0495645_0238829 3300046543 Bacteria 1213
1340 Ga0495645_0680694 3300046543 Bacteria 626
1341 Ga0495622_0380357 3300046557 Bacteria 609
1342 Ga0495667_0016331 3300046559 Bacteria 5016
1343 Ga0495667_0063143 3300046559 Bacteria 2425
1344 Ga0495667_0220730 3300046559 Bacteria 1210
1345 Ga0495656_0085019 3300046615 Bacteria 1436
1346 Ga0495634_0150620 3300046642 Bacteria 1471
1347 Ga0495634_0171853 3300046642 Bacteria 1361
1348 Ga0495634_0192667 3300046642 Bacteria 1270
1349 Ga0495635_0054906 3300046663 Bacteria 2744
1350 Ga0495635_0084340 3300046663 Bacteria 2174
1351 Ga0495659_0249609 3300046664 Bacteria 739
1352 Ga0495661_0341275 3300046665 Bacteria 740
1353 Ga0495588_0088616 3300046674 Bacteria 1620
1354 Ga0495657_0049025 3300046675 Bacteria 2847
1355 Ga0495657_0113082 3300046675 Bacteria 1718
1356 Ga0495599_0010652 3300046678 Bacteria 5627
1357 Ga0495599_0015785 3300046678 Bacteria 4688
1358 Ga0495599_0224563 3300046678 Bacteria 1148
1359 Ga0495623_0017452 3300046679 Bacteria 4637
1360 Ga0495623_0082831 3300046679 Bacteria 1982
1361 Ga0495623_0108146 3300046679 Bacteria 1688
1362 Ga0495646_0016342 3300046680 Bacteria 4709
1363 Ga0495646_0626111 3300046680 Bacteria 545
1364 Ga0495647_0139968 3300046681 Bacteria 1031
1365 Ga0495647_0631783 3300046681 Bacteria 504
1366 Ga0495658_0060006 3300046683 Bacteria 2180
1367 Ga0495658_0110421 3300046683 Bacteria 1653
1368 Ga0495658_0338908 3300046683 Bacteria 955
1369 Ga0495658_0495585 3300046683 Bacteria 781
1370 Ga0495669_0163695 3300046684 Bacteria 1056
1371 Ga0495669_0640093 3300046684 Bacteria 517
1372 Ga0495613_0035641 3300046689 Bacteria 3691
1373 Ga0495613_0182583 3300046689 Bacteria 1485
1374 Ga0495613_0399046 3300046689 Bacteria 938
1375 Ga0495613_0467808 3300046689 Bacteria 852
1376 Ga0495624_0148945 3300046690 Bacteria 1432
1377 Ga0495600_0043998 3300046809 Bacteria 2913
1378 Ga0495581_0162192 3300047315 Bacteria 1307
1379 Ga0495581_0661507 3300047315 Bacteria 603
1380 Ga0495581_0675231 3300047315 Bacteria 596
1381 Ga0495581_0843010 3300047315 Bacteria 525
1382 Ga0495604_0027250 3300047317 Bacteria 4546
1383 Ga0495604_0104964 3300047317 Bacteria 2069
1384 Ga0495636_0036783 3300047318 Bacteria 2020
1385 Ga0495636_0174422 3300047318 Bacteria 973
1386 Ga0495674_0022976 3300047319 Bacteria 5745
1387 Ga0495674_0260821 3300047319 Bacteria 1424
1388 Ga0495674_0899048 3300047319 Bacteria 683
1389 Ga0495676_0582121 3300047321 Bacteria 730
1390 Ga0495680_0013035 3300047322 Bacteria 7271
1391 Ga0495680_0091581 3300047322 Bacteria 2279
1392 Ga0495680_0287504 3300047322 Bacteria 1157
1393 Ga0495680_0442587 3300047322 Bacteria 891
1394 Ga0495680_0722849 3300047322 Bacteria 656
1395 Ga0495680_0893525 3300047322 Bacteria 574
1396 Ga0495675_0079198 3300047444 Bacteria 2069
1397 Ga0495675_0170389 3300047444 Bacteria 1337
1398 Ga0495677_0106504 3300047445 Bacteria 1064
1399 Ga0495685_031250 3300047447 Bacteria 1831
1400 Ga0495684_0071242 3300047471 Bacteria 2641
1401 Ga0495684_0116099 3300047471 Bacteria 2018
1402 Ga0495684_0169445 3300047471 Bacteria 1625
1403 Ga0495684_0271682 3300047471 Bacteria 1226
1404 Ga0495684_0288272 3300047471 Bacteria 1182
1405 Ga0495684_0504246 3300047471 Bacteria 832
1406 Ga0495593_0201702 3300047673 Bacteria 1000
1407 Ga0495602_0013466 3300048088 Bacteria 8359
1408 Ga0495602_0100827 3300048088 Bacteria 2370
1409 Ga0495602_0239437 3300048088 Bacteria 1358
1410 Ga0495602_0401675 3300048088 Bacteria 977
1411 Ga0495602_0923954 3300048088 Bacteria 579
1412 Ga0495615_0252670 3300048090 Bacteria 559
1413 Ga0496100_0078491 3300048903 Bacteria 2222
1414 Ga0496100_0109226 3300048903 Bacteria 1919
1415 Ga0496100_0289027 3300048903 Bacteria 1224
1416 Ga0496100_0800416 3300048903 Bacteria 738
1417 Ga0496101_0056945 3300048904 Bacteria 2826
1418 Ga0496101_0111991 3300048904 Bacteria 2055
1419 Ga0496101_1124416 3300048904 Bacteria 616
1420 Ga0496102_0172439 3300048905 Bacteria 2036
1421 Ga0496102_0970077 3300048905 Bacteria 771
1422 Ga0496104_0065574 3300048907 Bacteria 3446
1423 Ga0496104_0309521 3300048907 Bacteria 1492
1424 Ga0496104_0399240 3300048907 Bacteria 1287
1425 Ga0496105_0059694 3300048908 Bacteria 3147
1426 Ga0496105_0070746 3300048908 Bacteria 2884
1427 Ga0496105_0147782 3300048908 Bacteria 1933
1428 Ga0496106_0027640 3300048909 Bacteria 4226
1429 Ga0496106_0064193 3300048909 Bacteria 2793
1430 Ga0496106_0318902 3300048909 Bacteria 1247
1431 Ga0496106_0342753 3300048909 Bacteria 1200
1432 Ga0496106_0578785 3300048909 Bacteria 900
1433 Ga0496107_0261224 3300048910 Bacteria 1288
1434 Ga0496107_0344283 3300048910 Bacteria 1109
1435 Ga0496107_0711641 3300048910 Bacteria 738
1436 Ga0496108_0035987 3300048911 Bacteria 4117
1437 Ga0496108_0592139 3300048911 Bacteria 966
1438 Ga0496108_1009386 3300048911 Bacteria 710
1439 Ga0496109_0039889 3300048912 Bacteria 4251
1440 Ga0496109_0042753 3300048912 Bacteria 4106
1441 Ga0496109_0043173 3300048912 Bacteria 4086
1442 Ga0496110_0007094 3300048913 Bacteria 8919
1443 Ga0496110_0089104 3300048913 Bacteria 2757
1444 Ga0496110_0151553 3300048913 Bacteria 2099
1445 Ga0496111_0001415 3300048914 Bacteria 13651
1446 Ga0496111_0072867 3300048914 Bacteria 2500
1447 Ga0496111_0553796 3300048914 Bacteria 844
1448 Ga0496112_0002541 3300048915 Bacteria 14732
1449 Ga0496112_0024016 3300048915 Bacteria 5833
1450 Ga0496112_0060181 3300048915 Bacteria 3742
1451 Ga0496112_0079427 3300048915 Bacteria 3245
1452 Ga0496112_0104391 3300048915 Bacteria 2804
1453 Ga0496112_0976500 3300048915 Bacteria 767
1454 Ga0496112_1175577 3300048915 Bacteria 684
1455 Ga0496113_0047161 3300048916 Bacteria 3201
1456 Ga0496113_0075448 3300048916 Bacteria 2573
1457 Ga0496113_0156046 3300048916 Bacteria 1802
1458 Ga0496113_0813883 3300048916 Bacteria 742
1459 Ga0496113_1115274 3300048916 Bacteria 618
1460 Ga0496114_0000001 3300048917 Bacteria 893286
1461 Ga0496114_0047313 3300048917 Bacteria 3578
1462 Ga0496114_1019079 3300048917 Bacteria 711
1463 Ga0496115_0082370 3300048918 Bacteria 2621
1464 Ga0501306_024127 3300049127 Bacteria 867
1465 Ga0501306_049510 3300049127 Bacteria 671
1466 Ga0501308_074347 3300049128 Bacteria 532
1467 Ga0501310_074323 3300049130 Bacteria 525
1468 Ga0501307_001003 3300049162 Bacteria 2216
1469 Ga0501307_051693 3300049162 Bacteria 619
1470 Ga0501296_050298 3300049519 Bacteria 609
1471 Ga0501298_006514 3300049521 Bacteria 1911
1472 Ga0501298_071487 3300049521 Bacteria 750
1473 Ga0501303_022268 3300049526 Bacteria 684
1474 Ga0501313_033044 3300049529 Bacteria 676
1475 Ga0501313_066371 3300049529 Bacteria 517
1476 Ga0501314_036139 3300049530 Bacteria 564
1477 Ga0501315_027200 3300049531 Bacteria 806
1478 Ga0501317_089645 3300049533 Bacteria 542
1479 Ga0501320_034979 3300049536 Bacteria 639
1480 Ga0501031_0115077 3300049568 Bacteria 1757
1481 Ga0501031_0232197 3300049568 Bacteria 1200
1482 Ga0501031_0959922 3300049568 Bacteria 547
1483 Ga0501032_0082763 3300049569 Bacteria 2135
1484 Ga0501032_0670862 3300049569 Bacteria 658
1485 Ga0501033_0245632 3300049570 Bacteria 1269
1486 Ga0501033_0458016 3300049570 Bacteria 885
1487 Ga0501033_0773273 3300049570 Unclassified 650
1488 Ga0501034_0000132 3300049571 Bacteria 138635
1489 Ga0501034_0044308 3300049571 Bacteria 4500
1490 Ga0501034_0196452 3300049571 Bacteria 1977
1491 Ga0501034_0396995 3300049571 Bacteria 1302
1492 Ga0501034_0762996 3300049571 Bacteria 862
1493 Ga0501034_0806897 3300049571 Bacteria 831
1494 Ga0501036_0170582 3300049572 Bacteria 1833
1495 Ga0501036_0190593 3300049572 Bacteria 1725
1496 Ga0501036_0297376 3300049572 Bacteria 1350
1497 Ga0501036_0311648 3300049572 Bacteria 1315
1498 Ga0501037_0287470 3300049573 Bacteria 1144
1499 Ga0501037_0427947 3300049573 Bacteria 905
1500 Ga0501037_0451245 3300049573 Bacteria 877
1501 Ga0501037_0693149 3300049573 Bacteria 678
1502 Ga0501038_0011902 3300049574 Bacteria 7941
1503 Ga0501038_0353513 3300049574 Bacteria 1144
1504 Ga0501038_0513220 3300049574 Bacteria 915
1505 Ga0501038_1208946 3300049574 Bacteria 548
1506 Ga0501039_0103131 3300049575 Bacteria 2227
1507 Ga0501039_0196869 3300049575 Bacteria 1584
1508 Ga0501039_0663518 3300049575 Bacteria 816
1509 Ga0501040_0021934 3300049576 Bacteria 4270
1510 Ga0501040_0069484 3300049576 Bacteria 2429
1511 Ga0501041_0023985 3300049577 Bacteria 3660
1512 Ga0501041_0117942 3300049577 Bacteria 1648
1513 Ga0501041_0135383 3300049577 Bacteria 1535
1514 Ga0501041_0398134 3300049577 Bacteria 872
1515 Ga0501042_0037878 3300049578 Bacteria 3423
1516 Ga0501042_0215413 3300049578 Bacteria 1385
1517 Ga0501042_0407104 3300049578 Bacteria 986
1518 Ga0501042_0533108 3300049578 Bacteria 853
1519 Ga0501043_0000829 3300049579 Bacteria 27458
1520 Ga0501043_0047600 3300049579 Bacteria 3371
1521 Ga0501046_0000117 3300049580 Bacteria 84016
1522 Ga0501046_0028687 3300049580 Bacteria 4531
1523 Ga0501046_0047535 3300049580 Bacteria 3402
1524 Ga0501046_0102764 3300049580 Bacteria 2191
1525 Ga0501046_0213074 3300049580 Bacteria 1433
1526 Ga0501046_0278630 3300049580 Bacteria 1225
1527 Ga0501046_0447386 3300049580 Bacteria 929
1528 Ga0501047_0029942 3300049581 Bacteria 5247
1529 Ga0501047_0130028 3300049581 Bacteria 2398
1530 Ga0501047_0130576 3300049581 Bacteria 2393
1531 Ga0501048_0031361 3300049582 Bacteria 3844
1532 Ga0501048_0118379 3300049582 Bacteria 1871
1533 Ga0501048_0186441 3300049582 Bacteria 1470
1534 Ga0501048_0229725 3300049582 Bacteria 1316
1535 Ga0501048_0373847 3300049582 Bacteria 1017
1536 Ga0501048_0473535 3300049582 Bacteria 897
1537 Ga0501048_0620527 3300049582 Bacteria 776
1538 Ga0501067_0014484 3300049583 Bacteria 4365
1539 Ga0501067_0039490 3300049583 Bacteria 2620
1540 Ga0501067_0060801 3300049583 Bacteria 2091
1541 Ga0501067_0066718 3300049583 Bacteria 1992
1542 Ga0501067_0232860 3300049583 Bacteria 1025
1543 Ga0501067_0328662 3300049583 Bacteria 851
1544 Ga0501068_0001673 3300049584 Bacteria 11845
1545 Ga0501068_0008160 3300049584 Bacteria 5818
1546 Ga0501068_0075235 3300049584 Bacteria 2065
1547 Ga0501068_0131811 3300049584 Bacteria 1563
1548 Ga0501068_0335310 3300049584 Bacteria 971
1549 Ga0501068_1054470 3300049584 Bacteria 537
1550 Ga0501069_0008330 3300049585 Bacteria 5444
1551 Ga0501069_0017995 3300049585 Bacteria 3810
1552 Ga0501069_0074284 3300049585 Bacteria 1907
1553 Ga0501069_0183155 3300049585 Bacteria 1211
1554 Ga0501069_0212562 3300049585 Bacteria 1123
1555 Ga0501069_0273842 3300049585 Bacteria 987
1556 Ga0501069_0772874 3300049585 Bacteria 581
1557 Ga0501069_0815877 3300049585 Bacteria 566
1558 Ga0501070_0013050 3300049586 Bacteria 7001
1559 Ga0501070_0032011 3300049586 Bacteria 4403
1560 Ga0501070_0063385 3300049586 Bacteria 3062
1561 Ga0501070_0069675 3300049586 Bacteria 2912
1562 Ga0501070_0089832 3300049586 Bacteria 2542
1563 Ga0501070_0097328 3300049586 Bacteria 2434
1564 Ga0501070_0171248 3300049586 Bacteria 1788
1565 Ga0501070_0509274 3300049586 Bacteria 966
1566 Ga0501070_0513201 3300049586 Bacteria 962
1567 Ga0501071_0012801 3300049587 Bacteria 5704
1568 Ga0501071_0238684 3300049587 Bacteria 1370
1569 Ga0501071_0481689 3300049587 Bacteria 951
1570 Ga0501071_0732719 3300049587 Bacteria 761
1571 Ga0501071_0839822 3300049587 Bacteria 708
1572 Ga0501071_0919752 3300049587 Bacteria 675
1573 Ga0501072_0006109 3300049588 Bacteria 9187
1574 Ga0501072_0010585 3300049588 Bacteria 7024
1575 Ga0501072_0032455 3300049588 Bacteria 4090
1576 Ga0501072_0053900 3300049588 Bacteria 3168
1577 Ga0501072_0154703 3300049588 Bacteria 1829
1578 Ga0501072_0209787 3300049588 Bacteria 1552
1579 Ga0501072_0212282 3300049588 Bacteria 1542
1580 Ga0501072_0234614 3300049588 Bacteria 1461
1581 Ga0501072_0265703 3300049588 Bacteria 1365
1582 Ga0501072_0658239 3300049588 Bacteria 824
1583 Ga0501072_1358210 3300049588 Bacteria 550
1584 Ga0501073_0170984 3300049589 Bacteria 1504
1585 Ga0501073_0174870 3300049589 Bacteria 1486
1586 Ga0501073_0772218 3300049589 Bacteria 663
1587 Ga0501074_0069510 3300049590 Bacteria 2532
1588 Ga0501074_0084841 3300049590 Bacteria 2270
1589 Ga0501074_0165238 3300049590 Bacteria 1580
1590 Ga0501074_0246973 3300049590 Bacteria 1269
1591 Ga0501075_0006664 3300049591 Bacteria 7962
1592 Ga0501075_0029122 3300049591 Bacteria 4082
1593 Ga0501075_0036489 3300049591 Bacteria 3669
1594 Ga0501075_0165817 3300049591 Bacteria 1685
1595 Ga0501075_0267549 3300049591 Bacteria 1303
1596 Ga0501075_0319160 3300049591 Bacteria 1184
1597 Ga0501076_0006442 3300049592 Bacteria 8516
1598 Ga0501076_0054868 3300049592 Bacteria 3159
1599 Ga0501076_0069214 3300049592 Bacteria 2820
1600 Ga0501076_0219729 3300049592 Bacteria 1553
1601 Ga0501076_0226375 3300049592 Bacteria 1528
1602 Ga0501076_0244716 3300049592 Bacteria 1467
1603 Ga0501076_0547773 3300049592 Bacteria 954
1604 Ga0501076_0949277 3300049592 Bacteria 709
1605 Ga0501076_1109836 3300049592 Bacteria 651
1606 Ga0501077_0002603 3300049593 Bacteria 10813
1607 Ga0501077_0003447 3300049593 Bacteria 9494
1608 Ga0501077_0048237 3300049593 Bacteria 2705
1609 Ga0501077_0152205 3300049593 Bacteria 1468
1610 Ga0501077_0243273 3300049593 Bacteria 1144
1611 Ga0501077_0383412 3300049593 Bacteria 898
1612 Ga0501077_0619854 3300049593 Bacteria 695
1613 Ga0501198_152313 3300049649 Bacteria 510
1614 Ga0501202_033027 3300049652 Bacteria 1088
1615 Ga0501202_053765 3300049652 Bacteria 897
1616 Ga0501209_004058 3300049656 Bacteria 2494
1617 Ga0501209_143699 3300049656 Bacteria 716
1618 Ga0501216_009705 3300049660 Bacteria 1539
1619 Ga0501216_046341 3300049660 Bacteria 844
1620 Ga0501216_067720 3300049660 Bacteria 732
1621 Ga0501216_174444 3300049660 Bacteria 522
1622 Ga0501217_119395 3300049661 Bacteria 764
1623 Ga0501217_189877 3300049661 Bacteria 635
1624 Ga0501217_243053 3300049661 Bacteria 577
1625 Ga0501223_008477 3300049663 Bacteria 2097
1626 Ga0501224_001238 3300049664 Bacteria 3359
1627 Ga0501227_018036 3300049665 Bacteria 1598
1628 Ga0501230_009571 3300049667 Bacteria 1494
1629 Ga0501233_004905 3300049668 Bacteria 2474
1630 Ga0501233_101052 3300049668 Bacteria 763
1631 Ga0501235_007524 3300049669 Bacteria 2370
1632 Ga0501236_051361 3300049670 Bacteria 709
1633 Ga0501239_013408 3300049672 Bacteria 938
1634 Ga0501239_025043 3300049672 Bacteria 755
1635 Ga0501239_027332 3300049672 Bacteria 732
1636 Ga0501242_033433 3300049674 Bacteria 704
1637 Ga0501242_052523 3300049674 Bacteria 602
1638 Ga0501243_004221 3300049675 Bacteria 2151
1639 Ga0501243_012793 3300049675 Bacteria 1328
1640 Ga0501247_010669 3300049677 Bacteria 1097
1641 Ga0501249_018960 3300049679 Bacteria 1491
1642 Ga0501249_172577 3300049679 Bacteria 555
1643 Ga0501250_041481 3300049680 Bacteria 677
1644 Ga0501251_076902 3300049681 Bacteria 579
1645 Ga0501253_078750 3300049683 Bacteria 740
1646 Ga0501256_042400 3300049685 Bacteria 543
1647 Ga0501257_008968 3300049686 Bacteria 2254
1648 Ga0501257_118845 3300049686 Bacteria 706
1649 Ga0501257_123774 3300049686 Bacteria 695
1650 Ga0501257_166148 3300049686 Bacteria 617
1651 Ga0501257_166883 3300049686 Bacteria 616
1652 Ga0501258_012429 3300049687 Bacteria 923
1653 Ga0501259_084809 3300049688 Bacteria 702
1654 Ga0501259_143473 3300049688 Bacteria 586
1655 Ga0501261_045769 3300049690 Bacteria 703
1656 Ga0501261_050502 3300049690 Bacteria 680
1657 Ga0501221_065122 3300049704 Bacteria 850
1658 Ga0501221_111637 3300049704 Bacteria 689
1659 Ga0501221_237514 3300049704 Bacteria 519
1660 Ga0501225_0004791 3300049705 Bacteria 4004
1661 Ga0501234_001400 3300049707 Bacteria 3791
1662 Ga0501234_097071 3300049707 Bacteria 533
1663 Ga0501079_0012691 3300049741 Bacteria 6435
1664 Ga0501079_0019559 3300049741 Bacteria 5172
1665 Ga0501079_0035622 3300049741 Bacteria 3832
1666 Ga0501079_0055628 3300049741 Bacteria 3053
1667 Ga0501079_0074686 3300049741 Bacteria 2621
1668 Ga0501079_0162200 3300049741 Bacteria 1743
1669 Ga0501079_0202075 3300049741 Bacteria 1552
1670 Ga0501079_0610392 3300049741 Bacteria 858
1671 Ga0501079_0611211 3300049741 Bacteria 858
1672 Ga0501079_0718441 3300049741 Bacteria 786
1673 Ga0501080_0002929 3300049742 Bacteria 14986
1674 Ga0501080_0004569 3300049742 Bacteria 12338
1675 Ga0501080_0092828 3300049742 Bacteria 2803
1676 Ga0501080_0365132 3300049742 Bacteria 1302
1677 Ga0501080_0404222 3300049742 Bacteria 1228
1678 Ga0501080_0607070 3300049742 Bacteria 971
1679 Ga0501080_1618640 3300049742 Bacteria 548
1680 Ga0501081_0019645 3300049743 Bacteria 4501
1681 Ga0501081_0084738 3300049743 Bacteria 2223
1682 Ga0501081_0099127 3300049743 Bacteria 2058
1683 Ga0501081_0125422 3300049743 Bacteria 1831
1684 Ga0501081_1455032 3300049743 Bacteria 520
1685 Ga0501083_0000071 3300049744 Bacteria 67336
1686 Ga0501083_0014932 3300049744 Bacteria 5433
1687 Ga0501083_0043800 3300049744 Bacteria 3031
1688 Ga0501083_0083137 3300049744 Bacteria 2121
1689 Ga0501083_0212131 3300049744 Bacteria 1262
1690 Ga0501083_0348811 3300049744 Bacteria 962
1691 Ga0501083_0923936 3300049744 Bacteria 568
1692 Ga0501232_010440 3300049757 Bacteria 1047
1693 Ga0501262_049657 3300049759 Bacteria 646
1694 Ga0501263_055879 3300049760 Bacteria 609
1695 Ga0501265_030122 3300049762 Bacteria 777
1696 Ga0501266_003064 3300049763 Bacteria 2080
1697 Ga0501267_004229 3300049764 Bacteria 1327
1698 Ga0501267_008912 3300049764 Bacteria 995
1699 Ga0501268_002758 3300049765 Bacteria 2340
1700 Ga0501268_008026 3300049765 Bacteria 1588
1701 Ga0501268_034317 3300049765 Bacteria 932
1702 Ga0501268_039586 3300049765 Bacteria 883
1703 Ga0501268_046406 3300049765 Bacteria 831
1704 Ga0501268_100477 3300049765 Bacteria 619
1705 Ga0501268_107212 3300049765 Bacteria 606
1706 Ga0501270_012851 3300049767 Bacteria 1150
1707 Ga0501270_070908 3300049767 Bacteria 673
1708 Ga0501270_092479 3300049767 Bacteria 619
1709 Ga0501270_108129 3300049767 Bacteria 590
1710 Ga0501271_002195 3300049768 Bacteria 1725
1711 Ga0501272_013617 3300049769 Bacteria 933
1712 Ga0501273_008374 3300049770 Bacteria 1238
1713 Ga0501273_035883 3300049770 Bacteria 720
1714 Ga0501273_080648 3300049770 Bacteria 541
1715 Ga0501274_002181 3300049771 Bacteria 1526
1716 Ga0501275_043350 3300049772 Bacteria 638
1717 Ga0501283_008388 3300049779 Bacteria 1488
1718 Ga0501035_0124162 3300049822 Bacteria 2254
1719 Ga0501035_0186524 3300049822 Bacteria 1785
1720 Ga0501035_0204036 3300049822 Bacteria 1694
1721 Ga0501035_0583180 3300049822 Bacteria 913
1722 Ga0501035_0792784 3300049822 Bacteria 757
1723 Ga0501035_1113324 3300049822 Bacteria 616
1724 Ga0501044_0013639 3300049823 Bacteria 8783
1725 Ga0501044_0064096 3300049823 Bacteria 3753
1726 Ga0501044_0074963 3300049823 Bacteria 3436
1727 Ga0501044_0431474 3300049823 Bacteria 1227
1728 Ga0501044_0502384 3300049823 Bacteria 1114
1729 Ga0501044_0630322 3300049823 Bacteria 963
1730 Ga0501045_0004175 3300049824 Bacteria 9980
1731 Ga0501045_0032763 3300049824 Bacteria 3766
1732 Ga0501045_0086402 3300049824 Bacteria 2315
1733 Ga0501045_0161793 3300049824 Bacteria 1666
1734 Ga0501045_0241244 3300049824 Bacteria 1345
1735 Ga0501045_0330576 3300049824 Bacteria 1134
1736 Ga0501045_0562930 3300049824 Bacteria 845
1737 Ga0501204_013205 3300049850 Bacteria 1001
1738 Ga0501212_001652 3300049851 Bacteria 2552
1739 Ga0501212_083701 3300049851 Bacteria 580
1740 nmdc:mga05p37_151379_c1 3300050507 Bacteria 2837
1741 nmdc:mga05p37_429595_c1 3300050507 Bacteria 1535
1742 nmdc:mga05p37_518028_c1 3300050507 Bacteria 1365
1743 nmdc:mga05p37_663841_c1 3300050507 Bacteria 1165
1744 nmdc:mga09592_311408_c1 3300050508 Bacteria 1364
1745 nmdc:mga09592_413108_c1 3300050508 Bacteria 1166
1746 nmdc:mga09592_759854_c1 3300050508 Bacteria 822
1747 nmdc:mga0qj67_339484_c1 3300050509 Bacteria 1215
1748 nmdc:mga0qj67_77954_c1 3300050509 Bacteria 2652
1749 nmdc:mga0qj67_793471_c1 3300050509 Bacteria 750
1750 nmdc:mga06r32_1497899_c1 3300050510 Bacteria 615
1751 nmdc:mga06r32_342365_c1 3300050510 Bacteria 1480
1752 nmdc:mga06r32_429330_c1 3300050510 Bacteria 1302
1753 nmdc:mga06r32_46152_c1 3300050510 Bacteria 4157
1754 nmdc:mga06r32_6558_c1 3300050510 Bacteria 10457
1755 nmdc:mga08y16_116742_c1 3300050511 Bacteria 2778
1756 nmdc:mga08y16_144197_c1 3300050511 Bacteria 2475
1757 nmdc:mga08y16_22055_c1 3300050511 Bacteria 6725
1758 nmdc:mga08y16_281933_c1 3300050511 Bacteria 1714
1759 nmdc:mga08y16_288511_c1 3300050511 Bacteria 1692
1760 nmdc:mga08y16_311113_c1 3300050511 Bacteria 1622
1761 nmdc:mga08y16_315866_c1 3300050511 Bacteria 1609
1762 nmdc:mga08y16_699500_c1 3300050511 Bacteria 1014
1763 nmdc:mga0n895_1181678_c1 3300050512 Bacteria 739
1764 nmdc:mga0n895_190360_c1 3300050512 Bacteria 2083
1765 nmdc:mga0n895_21843_c1 3300050512 Bacteria 5991
1766 nmdc:mga0n895_253314_c1 3300050512 Bacteria 1787
1767 nmdc:mga0n895_358036_c1 3300050512 Bacteria 1478
1768 nmdc:mga0n895_464171_c1 3300050512 Bacteria 1278
1769 nmdc:mga0n895_512489_c1 3300050512 Bacteria 1208
1770 nmdc:mga0n895_516105_c1 3300050512 Bacteria 1203
1771 nmdc:mga0n895_573569_c1 3300050512 Bacteria 1133
1772 nmdc:mga0rr50_11870_c2 3300050513 Bacteria 5117
1773 nmdc:mga0rr50_1342219_c1 3300050513 Bacteria 606
1774 nmdc:mga0rr50_274532_c1 3300050513 Bacteria 1405
1775 nmdc:mga0rr50_409005_c1 3300050513 Bacteria 1147
1776 nmdc:mga0rr50_508223_c1 3300050513 Bacteria 1025
1777 nmdc:mga0rr50_677514_c1 3300050513 Bacteria 880
1778 nmdc:mga08x19_145676_c1 3300050514 Bacteria 1602
1779 nmdc:mga08x19_1503_c1 3300050514 Bacteria 14447
1780 nmdc:mga08x19_24882_c1 3300050514 Bacteria 3726
1781 nmdc:mga08x19_98185_c1 3300050514 Bacteria 1940
1782 nmdc:mga0a205_26534_c1 3300050515 Bacteria 5526
1783 nmdc:mga0a205_71485_c1 3300050515 Bacteria 3351
1784 Ga0495601_0410362 3300053077 Bacteria 878
1785 Ga0495655_0204864 3300053083 Bacteria 646
1786 Ga0495655_0287792 3300053083 Bacteria 562
1787 Ga0495595_0402086 3300053084 Bacteria 694
1788 Ga0495595_0672761 3300053084 Bacteria 530
1789 Ga0495619_0033082 3300053085 Bacteria 3357
1790 Ga0495619_0216400 3300053085 Bacteria 1327
1791 Ga0495619_0901547 3300053085 Bacteria 595
1792 Ga0501084_0032504 3300054114 Bacteria 4364
1793 Ga0501084_0040463 3300054114 Bacteria 3899
1794 Ga0501084_0042401 3300054114 Bacteria 3807
1795 Ga0501084_0053363 3300054114 Bacteria 3381
1796 Ga0501084_0055496 3300054114 Bacteria 3314
1797 Ga0501084_0060696 3300054114 Bacteria 3165
1798 Ga0501084_0980505 3300054114 Bacteria 710
1799 Ga0501084_1171158 3300054114 Unclassified 645
1800 Ga0590071_003501 3300059421 Bacteria 3853
1801 Ga0590071_006633 3300059421 Bacteria 2751
1802 Ga0590071_007102 3300059421 Bacteria 2652
1803 Ga0590071_009609 3300059421 Bacteria 2271
1804 Ga0590071_018064 3300059421 Bacteria 1658
1805 Ga0590074_010487 3300059423 Bacteria 1549
1806 Ga0590074_063876 3300059423 Bacteria 687
1807 Ga0590075_044972 3300059424 Bacteria 1130
1808 Ga0590077_064462 3300059426 Bacteria 833
1809 Ga0587084_125122 3300059477 Bacteria 544
1810 Ga0587066_016651 3300059490 Bacteria 1161
1811 Ga0587073_0076206 3300059492 Bacteria 822
1812 Ga0587085_153754 3300059506 Bacteria 533
1813 Ga0587085_183001 3300059506 Bacteria 503
1814 Ga0587091_057781 3300059511 Bacteria 815
1815 Ga0587091_084500 3300059511 Bacteria 718
1816 Ga0587113_036215 3300059625 Bacteria 577
1817 Ga0587067_142955 3300059640 Bacteria 594
1818 Ga0587076_201833 3300059645 Bacteria 512
1819 Ga0587079_047120 3300059647 Bacteria 892
1820 Ga0587071_013833 3300060344 Bacteria 1396
1821 Ga0587071_109511 3300060344 Bacteria 648
1822 Ga0501082_0004163 3300060353 Bacteria 12644
1823 Ga0501082_0019498 3300060353 Bacteria 5847
1824 Ga0501082_0033970 3300060353 Bacteria 4399
1825 Ga0501082_0052165 3300060353 Bacteria 3525
1826 Ga0501082_0061602 3300060353 Bacteria 3230
1827 Ga0501082_0063320 3300060353 Bacteria 3184
1828 Ga0501082_0071941 3300060353 Bacteria 2978
1829 Ga0501082_0112785 3300060353 Bacteria 2354
1830 Ga0501082_0226165 3300060353 Bacteria 1628
1831 Ga0501082_0404454 3300060353 Bacteria 1191
1832 Ga0501082_0462845 3300060353 Bacteria 1108
1833 Ga0501082_0472839 3300060353 Bacteria 1095
1834 Ga0501082_0898369 3300060353 Bacteria 775
1835 Ga0501082_1328866 3300060353 Bacteria 628
1836 Ga0530510_0055415 3300061734 Bacteria 2864
1837 Ga0530510_0113500 3300061734 Bacteria 1986
1838 Ga0530510_0155250 3300061734 Bacteria 1691
1839 Ga0530510_0165371 3300061734 Bacteria 1637
1840 Ga0530510_0331267 3300061734 Bacteria 1142
1841 Ga0530510_0469868 3300061734 Bacteria 952
1842 Ga0530510_1158495 3300061734 Bacteria 592
1843 Ga0530510_1211158 3300061734 Bacteria 579
1844 Ga0496112_0606487
1845 JGI26145J50221_1006158
1846 Ga0058863_10086968
1847 Ga0058861_11789312
1848 Ga0058862_12643353
1849 Ga0065712_10074846
1850 Ga0065712_10439994
1851 Ga0065712_10815210
1852 Ga0065715_10057212
1853 Ga0065715_10116004
1854 Ga0065715_10299813
1855 Ga0065715_10811487
1856 Ga0065707_10432448
1857 Ga0065707_10717645
1858 Ga0070658_10171352
1859 Ga0070658_10561985
1860 Ga0070658_11648416
1861 Ga0070658_11812599
1862 Ga0070676_10010363
1863 Ga0070676_10089561
1864 Ga0070676_10624397
1865 Ga0070683_100003340
1866 Ga0070683_100058071
1867 Ga0070683_100071412
1868 Ga0070683_100366719
1869 Ga0070683_100862286
1870 Ga0070683_100935969
1871 Ga0070683_101036957
1872 Ga0070683_101164768
1873 Ga0070683_101170690
1874 Ga0070690_100021133
1875 Ga0070690_100086374
1876 Ga0070690_100216988
1877 Ga0070670_100240332
1878 Ga0070670_100322579
1879 Ga0070670_100727273
1880 Ga0070670_100806131
1881 Ga0070677_10078225
1882 Ga0070677_10528114
1883 Ga0068869_100874259
1884 Ga0068869_100892987
1885 Ga0068869_100907740
1886 Ga0068869_100984090
1887 Ga0068869_100984138
1888 Ga0070666_10093653
1889 Ga0070666_10215569
1890 Ga0070666_10327378
1891 Ga0070666_10847074
1892 Ga0070680_100003421
1893 Ga0070680_100011604
1894 Ga0070680_100048050
1895 Ga0070680_100103171
1896 Ga0070680_100119665
1897 Ga0070680_100156870
1898 Ga0070680_100163795
1899 Ga0070680_100321809
1900 Ga0070680_100369443
1901 Ga0070680_100464968
1902 Ga0070680_100466058
1903 Ga0070680_101315673
1904 Ga0070682_100029919
1905 Ga0070682_100060558
1906 Ga0070682_100203345
1907 Ga0070682_100307437
1908 Ga0070682_100309796
1909 Ga0070682_101120793
1910 Ga0068868_100013085
1911 Ga0068868_100141727
1912 Ga0068868_100320488
1913 Ga0068868_100783022
1914 Ga0068868_101742480
1915 Ga0070660_100100995
1916 Ga0070660_100250698
1917 Ga0070660_100293209
1918 Ga0070660_101042557
1919 Ga0070660_101050711
1920 Ga0070660_101184695
1921 Ga0070689_100012783
1922 Ga0070689_100031628
1923 Ga0070689_100038522
1924 Ga0070689_100118383
1925 Ga0070689_101465145
1926 Ga0070691_10028966
1927 Ga0070691_10186317
1928 Ga0070691_10272178
1929 Ga0070687_100018908
1930 Ga0070687_100038862
1931 Ga0070687_100623865
1932 Ga0070661_100028453
1933 Ga0070661_100029610
1934 Ga0070661_100034455
1935 Ga0070661_100323146
1936 Ga0070661_100383300
1937 Ga0070661_100459024
1938 Ga0070661_100512303
1939 Ga0070661_101477934
1940 Ga0070661_101593807
1941 Ga0070661_101786665
1942 Ga0070692_10085682
1943 Ga0070692_10152386
1944 Ga0070692_10236677
1945 Ga0070692_10595750
1946 Ga0070692_11148700
1947 Ga0070668_100254925
1948 Ga0070668_100802060
1949 Ga0070668_101483884
1950 Ga0070669_100025980
1951 Ga0070669_100182704
1952 Ga0070669_100218637
1953 Ga0070669_100571542
1954 Ga0070675_100303016
1955 Ga0070675_100374469
1956 Ga0070675_101472671
1957 Ga0070675_101610651
1958 Ga0070675_101702594
1959 Ga0070671_100079081
1960 Ga0070671_100159410
1961 Ga0070671_100181105
1962 Ga0070671_101392007
1963 Ga0070671_101835633
1964 Ga0070674_100075414
1965 Ga0070674_101764079
1966 Ga0070674_101938091
1967 Ga0070673_100003685
1968 Ga0070673_100024226
1969 Ga0070673_100153788
1970 Ga0070673_100499084
1971 Ga0070673_102163037
1972 Ga0070688_100024866
1973 Ga0070688_100028355
1974 Ga0070688_100394857
1975 Ga0070659_100058242
1976 Ga0070659_100108977
1977 Ga0070659_100116694
1978 Ga0070659_100245326
1979 Ga0070659_100601719
1980 Ga0070659_100915992
1981 Ga0070659_101134747
1982 Ga0070659_101444930
1983 Ga0070667_100043630
1984 Ga0070667_100093065
1985 Ga0070667_100611410
1986 Ga0070703_10122590
1987 Ga0070709_10006385
1988 Ga0070709_10036785
1989 Ga0070709_10171398
1990 Ga0070714_100000411
1991 Ga0070714_100139880
1992 Ga0070714_100462329
1993 Ga0070714_100710189
1994 Ga0070713_100065550
1995 Ga0070713_100583856
1996 Ga0070713_101027119
1997 Ga0070713_101642690
1998 Ga0070710_10128761
1999 Ga0070701_10062320
2000 Ga0070701_10624172
2001 Ga0070711_100034546
2002 Ga0070711_100079312
2003 Ga0070705_100020535
2004 Ga0070705_100090555
2005 Ga0070705_100169323
2006 Ga0070705_101704231
2007 Ga0070700_100195386
2008 Ga0070700_101012060
2009 Ga0070694_100555824
2010 Ga0070694_100825210
2011 Ga0070694_100977120
2012 Ga0070694_101097517
2013 Ga0070708_100001661
2014 Ga0070708_100003800
2015 Ga0070708_100018839
2016 Ga0070708_100020893
2017 Ga0070708_100055604
2018 Ga0070708_100335677
2019 Ga0070708_100338186
2020 Ga0070708_100366252
2021 Ga0070708_101042104
2022 Ga0070708_101463714
2023 Ga0070663_100005346
2024 Ga0070663_100094822
2025 Ga0070663_100798646
2026 Ga0070663_101530009
2027 Ga0070678_100053888
2028 Ga0070678_100352274
2029 Ga0070662_100054587
2030 Ga0070662_100198764
2031 Ga0070662_100251955
2032 Ga0070662_100452728
2033 Ga0070662_100704165
2034 Ga0070681_10035181
2035 Ga0070681_10044619
2036 Ga0070681_10053922
2037 Ga0070681_10078280
2038 Ga0070681_10116033
2039 Ga0070681_10160574
2040 Ga0070681_10171280
2041 Ga0070681_10225090
2042 Ga0070681_10227553
2043 Ga0070681_10415728
2044 Ga0070681_10477193
2045 Ga0070681_10498751
2046 Ga0070681_10758644
2047 Ga0070681_11130055
2048 Ga0070681_11251139
2049 Ga0068867_100093589
2050 Ga0068867_100262442
2051 Ga0068867_100786095
2052 Ga0068867_101256728
2053 Ga0068867_101331788
2054 Ga0070685_10028108
2055 Ga0070685_10117314
2056 Ga0070685_10262680
2057 Ga0070706_100006592
2058 Ga0070706_100115208
2059 Ga0070706_100171538
2060 Ga0070706_100188726
2061 Ga0070706_100354241
2062 Ga0070706_100502739
2063 Ga0070707_100016356
2064 Ga0070707_100019047
2065 Ga0070707_100198999
2066 Ga0070707_100439225
2067 Ga0070707_100939600
2068 Ga0070707_100948615
2069 Ga0070707_100995176
2070 Ga0070698_100001954
2071 Ga0070698_100024253
2072 Ga0070698_100030896
2073 Ga0070698_100052230
2074 Ga0070698_100466389
2075 Ga0070698_102150056
2076 Ga0070699_100003912
2077 Ga0070699_100071160
2078 Ga0070699_100096501
2079 Ga0070699_100243299
2080 Ga0070699_100244307
2081 Ga0070699_100314429
2082 Ga0070699_100484652
2083 Ga0070699_100864240
2084 Ga0070699_100922820
2085 Ga0070699_101175842
2086 Ga0070699_101184395
2087 Ga0070699_101192268
2088 Ga0070699_101674234
2089 Ga0070679_100014655
2090 Ga0070679_100019482
2091 Ga0070679_100045568
2092 Ga0070679_100052627
2093 Ga0070679_100091847
2094 Ga0070679_100165137
2095 Ga0070679_100243051
2096 Ga0070679_100249770
2097 Ga0070679_100321944
2098 Ga0070679_100443075
2099 Ga0070679_100609953
2100 Ga0070684_100005718
2101 Ga0070684_100041533
2102 Ga0070684_100152966
2103 Ga0070684_100172651
2104 Ga0070684_100298128
2105 Ga0070684_100349691
2106 Ga0070684_100585927
2107 Ga0070684_100611370
2108 Ga0070684_100976783
2109 Ga0070684_101063874
2110 Ga0070697_100034669
2111 Ga0070697_100159646
2112 Ga0070697_100173667
2113 Ga0070697_100255073
2114 Ga0070697_100308839
2115 Ga0070697_100352424
2116 Ga0070697_101146138
2117 Ga0068853_100040762
2118 Ga0068853_100176850
2119 Ga0068853_100203663
2120 Ga0068853_100246394
2121 Ga0068853_100355905
2122 Ga0068853_101652526
2123 Ga0070672_100038933
2124 Ga0070672_100061495
2125 Ga0070672_100079274
2126 Ga0070672_100308147
2127 Ga0070672_100322927
2128 Ga0070672_102016100
2129 Ga0070686_100247099
2130 Ga0070686_100365031
2131 Ga0070686_100481563
2132 Ga0070695_100006011
2133 Ga0070695_100006164
2134 Ga0070695_100081722
2135 Ga0070695_100210430
2136 Ga0070695_100294995
2137 Ga0070695_101000870
2138 Ga0070696_100014069
2139 Ga0070696_100064301
2140 Ga0070696_100199231
2141 Ga0070696_100287300
2142 Ga0070696_100345231
2143 Ga0070696_100640509
2144 Ga0070696_100698752
2145 Ga0070696_101931493
2146 Ga0070693_100000799
2147 Ga0070693_100133923
2148 Ga0070693_100610723
2149 Ga0070693_100700302
2150 Ga0070693_100877039
2151 Ga0070665_100124547
2152 Ga0070665_101359628
2153 Ga0070665_102322188
2154 Ga0070704_100129452
2155 Ga0070704_100324442
2156 Ga0070704_100337516
2157 Ga0070704_100347075
2158 Ga0070704_100529683
2159 Ga0068855_100033387
2160 Ga0068855_100389264
2161 Ga0068855_100533266
2162 Ga0068855_100817487
2163 Ga0068855_101726342
2164 Ga0068855_101906615
2165 Ga0070664_100008033
2166 Ga0070664_100229505
2167 Ga0070664_100276901
2168 Ga0070664_100312256
2169 Ga0070664_100385803
2170 Ga0070664_100616820
2171 Ga0070664_100678751
2172 Ga0070664_100738379
2173 Ga0070664_102173296
2174 Ga0068857_100009735
2175 Ga0068857_100024265
2176 Ga0068857_100205597
2177 Ga0068857_100306504
2178 Ga0068854_100008727
2179 Ga0068854_100013720
2180 Ga0068854_100069785
2181 Ga0068854_100168844
2182 Ga0068854_100999751
2183 Ga0068854_101564314
2184 Ga0068856_100073182
2185 Ga0068856_100776822
2186 Ga0068856_100902275
2187 Ga0070702_100251803
2188 Ga0070702_100499928
2189 Ga0070702_100565489
2190 Ga0070702_101245784
2191 Ga0070702_101297416
2192 Ga0068852_100026550
2193 Ga0068852_100029132
2194 Ga0068852_100241182
2195 Ga0068852_100495111
2196 Ga0068852_100622674
2197 Ga0068852_101294854
2198 Ga0068852_102534548
2199 Ga0068859_100039441
2200 Ga0068859_100216391
2201 Ga0068859_100351569
2202 Ga0068859_100624071
2203 Ga0068859_100725038
2204 Ga0068864_100207043
2205 Ga0068864_100277387
2206 Ga0068864_100736050
2207 Ga0068866_10025649
2208 Ga0068866_10131416
2209 Ga0068866_10854617
2210 Ga0068866_11036562
2211 Ga0068861_100234025
2212 Ga0068861_100912461
2213 Ga0068851_10620593
2214 Ga0068870_10011998
2215 Ga0068870_10270076
2216 Ga0068870_10446384
2217 Ga0068863_100037716
2218 Ga0068863_100119013
2219 Ga0068863_100223270
2220 Ga0068863_100276028
2221 Ga0068863_100284520
2222 Ga0068863_100525038
2223 Ga0068863_101634340
2224 Ga0068863_102623373
2225 Ga0068858_100393383
2226 Ga0068858_100400542
2227 Ga0068858_101117216
2228 Ga0068858_101182529
2229 Ga0068860_100530559
2230 Ga0068860_100708526
2231 Ga0068862_100513910
2232 Ga0068862_100624739
2233 Ga0068862_101218995
2234 Ga0081455_10243169
2235 Ga0081455_10245504
2236 Ga0081538_10078237
2237 Ga0081539_10023333
2238 Ga0081539_10215463
2239 Ga0075432_10303059
2240 Ga0070715_10091235
2241 Ga0070715_10614808
2242 Ga0070715_10781552
2243 Ga0070716_100014957
2244 Ga0070716_100120125
2245 Ga0070716_100185223
2246 Ga0070712_100150856
2247 Ga0070712_100602962
2248 Ga0070712_101180134
2249 Ga0097621_100072407
2250 Ga0097621_100114591
2251 Ga0097621_101288906
2252 Ga0068871_100188895
2253 Ga0068871_100349234
2254 Ga0068871_100524840
2255 Ga0068871_100790188
2256 Ga0075428_100483856
2257 Ga0075428_101106268
2258 Ga0075428_102713510
2259 Ga0075430_100388623
2260 Ga0075430_101203605
2261 Ga0075431_100066106
2262 Ga0075431_100132267
2263 Ga0075431_100445223
2264 Ga0075431_100446411
2265 Ga0075431_100679135
2266 Ga0075433_10014445
2267 Ga0075433_10017586
2268 Ga0075433_10048621
2269 Ga0075433_10082656
2270 Ga0075433_10453291
2271 Ga0075433_10475033
2272 Ga0075434_100039856
2273 Ga0075434_100056118
2274 Ga0075434_100293178
2275 Ga0075434_100411482
2276 Ga0075434_100623359
2277 Ga0075434_100881444
2278 Ga0075429_100019213
2279 Ga0075429_100181478
2280 Ga0075429_100278121
2281 Ga0075429_101064640
2282 Ga0068865_100094461
2283 Ga0068865_100136783
2284 Ga0068865_100273628
2285 Ga0068865_100787660
2286 Ga0068865_100999212
2287 Ga0075436_100000105
2288 Ga0075436_100011027
2289 Ga0075436_100034048
2290 Ga0075436_100145157
2291 Ga0075436_100293565
2292 Ga0075436_100506269
2293 Ga0097620_100039441
2294 Ga0097620_100216397
2295 Ga0097620_100351562
2296 Ga0097620_100624048
2297 Ga0097620_100725107
2298 Ga0075435_100039577
2299 Ga0075435_100093480
2300 Ga0075435_100458431
2301 Ga0075435_101173550
2302 Ga0075435_101207494
2303 Ga0075435_101501941
2304 Ga0099794_10232222
2305 Ga0099794_10235798
2306 Ga0099794_10805773
2307 Ga0099795_10031621
2308 Ga0105240_10101231
2309 Ga0105240_10106067
2310 Ga0105240_10377512
2311 Ga0105240_11405854
2312 Ga0105240_12715848
2313 Ga0111539_10250172
2314 Ga0111539_10296278
2315 Ga0111539_10875500
2316 Ga0111539_12150536
2317 Ga0105245_10094704
2318 Ga0105245_10155732
2319 Ga0105245_10219981
2320 Ga0105245_10429375
2321 Ga0105245_10470338
2322 Ga0105245_10564960
2323 Ga0105245_11336780
2324 Ga0105245_11604509
2325 Ga0105247_10723337
2326 Ga0114129_10032671
2327 Ga0114129_10074165
2328 Ga0114129_10442964
2329 Ga0114129_10603869
2330 Ga0114129_10768010
2331 Ga0114129_10794816
2332 Ga0114129_10971514
2333 Ga0105243_10345671
2334 Ga0105243_10657686
2335 Ga0105243_10911407
2336 Ga0105243_12099905
2337 Ga0105243_12447293
2338 Ga0105241_10146778
2339 Ga0105241_10357475
2340 Ga0105242_10149144
2341 Ga0105242_11282820
2342 Ga0105248_10122714
2343 Ga0105248_10322129
2344 Ga0105248_10673931
2345 Ga0105248_11222903
2346 Ga0105248_11563113
2347 Ga0105248_12130074
2348 Ga0105248_12276975
2349 Ga0105237_10688214
2350 Ga0105237_11180422
2351 Ga0105238_10074647
2352 Ga0105238_10911998
2353 Ga0105238_11817297
2354 Ga0105249_10747690
2355 Ga0105249_10974948
2356 Ga0105239_10977094
2357 Ga0105239_11728858
2358 Ga0105239_13235952
2359 Ga0105246_10135906
2360 Ga0157318_1028166
2361 Ga0157341_1042080
2362 Ga0157323_1004571
2363 Ga0157339_1028615
2364 Ga0157342_1020734
2365 Ga0157316_1015673
2366 Ga0157373_10075094
2367 Ga0157373_10107506
2368 Ga0157373_10134672
2369 Ga0157373_10261289
2370 Ga0157371_10502250
2371 Ga0157371_11376732
2372 Ga0157370_10006391
2373 Ga0157370_10051328
2374 Ga0157370_10284510
2375 Ga0157370_10885631
2376 Ga0157370_11354269
2377 Ga0157370_11584828
2378 Ga0157369_10129033
2379 Ga0157369_10360263
2380 Ga0157369_10966313
2381 Ga0157369_11050120
2382 Ga0157369_12520277
2383 Ga0157374_10841745
2384 Ga0157374_10938383
2385 Ga0157374_11612879
2386 Ga0157374_11672773
2387 Ga0157378_10107312
2388 Ga0157378_10168578
2389 Ga0157378_10392433
2390 Ga0157378_10924224
2391 Ga0157378_11111228
2392 Ga0157378_11206617
2393 Ga0157378_11286448
2394 Ga0157378_11793893
2395 Ga0157378_12350404
2396 Ga0157378_12778686
2397 Ga0163162_10771069
2398 Ga0163162_10942245
2399 Ga0163162_11353130
2400 Ga0163162_12210203
2401 Ga0163162_12562676
2402 Ga0157372_10353040
2403 Ga0157372_10360783
2404 Ga0157372_10398247
2405 Ga0157372_10437193
2406 Ga0157372_10438515
2407 Ga0157372_10707076
2408 Ga0157372_11176516
2409 Ga0157372_11335691
2410 Ga0157372_11876377
2411 Ga0157372_12916985
2412 Ga0157372_13205857
2413 Ga0157375_10470699
2414 Ga0157375_10773256
2415 Ga0157375_12065547
2416 Ga0163163_10308590
2417 Ga0163163_10308637
2418 Ga0163163_10395870
2419 Ga0163163_10833141
2420 Ga0163163_11090999
2421 Ga0157380_11276920
2422 Ga0157380_13177473
2423 Ga0182008_10006718
2424 Ga0157377_10220127
2425 Ga0157379_10648203
2426 Ga0157379_11019995
2427 Ga0157379_11275611
2428 Ga0157379_11425219
2429 Ga0157379_12463332
2430 Ga0157376_10346309
2431 Ga0157376_10688632
2432 Ga0157376_10976839
2433 Ga0157376_12139206
2434 Ga0157376_13037862
2435 Ga0182007_10245076
2436 Ga0163161_10184027
2437 Ga0163161_10551308
2438 Ga0163161_12037071
2439 Ga0206356_11621450
2440 Ga0206349_1309757
2441 Ga0213876_10010709
2442 Ga0213876_10244513
2443 Ga0213876_10253805
2444 Ga0207666_1023196
2445 Ga0207697_10011385
2446 Ga0207656_10283209
2447 Ga0207682_10016764
2448 Ga0207692_10077555
2449 Ga0207642_10008208
2450 Ga0207642_10469862
2451 Ga0207642_10568459
2452 Ga0207642_10642395
2453 Ga0207688_10027380
2454 Ga0207688_10684318
2455 Ga0207680_10025729
2456 Ga0207680_10125424
2457 Ga0207680_10351990
2458 Ga0207685_10030303
2459 Ga0207699_10001230
2460 Ga0207699_10044660
2461 Ga0207699_10127954
2462 Ga0207699_10560054
2463 Ga0207645_10018114
2464 Ga0207645_10185904
2465 Ga0207645_10193216
2466 Ga0207643_10003364
2467 Ga0207643_10281215
2468 Ga0207705_10027229
2469 Ga0207705_10029211
2470 Ga0207705_10031424
2471 Ga0207705_10278431
2472 Ga0207705_10461503
2473 Ga0207705_10694084
2474 Ga0207684_10022976
2475 Ga0207684_10199408
2476 Ga0207684_10321730
2477 Ga0207684_10460484
2478 Ga0207684_10466072
2479 Ga0207684_11038716
2480 Ga0207654_10028743
2481 Ga0207707_10004257
2482 Ga0207707_10020853
2483 Ga0207707_10041250
2484 Ga0207707_10068861
2485 Ga0207707_10075446
2486 Ga0207707_10097923
2487 Ga0207707_10627301
2488 Ga0207707_10784898
2489 Ga0207707_10861232
2490 Ga0207707_11104162
2491 Ga0207695_10004617
2492 Ga0207695_10013424
2493 Ga0207695_10070341
2494 Ga0207695_10226195
2495 Ga0207671_10127670
2496 Ga0207671_11569578
2497 Ga0207693_10130240
2498 Ga0207693_10177031
2499 Ga0207693_10182171
2500 Ga0207693_10361372
2501 Ga0207693_10440034
2502 Ga0207693_10488937
2503 Ga0207663_10008487
2504 Ga0207663_10073763
2505 Ga0207663_10511946
2506 Ga0207663_10892089
2507 Ga0207660_10004139
2508 Ga0207660_10032435
2509 Ga0207660_10044376
2510 Ga0207660_10046045
2511 Ga0207660_10088243
2512 Ga0207660_10097907
2513 Ga0207660_10168557
2514 Ga0207660_10478573
2515 Ga0207660_10681750
2516 Ga0207660_11266911
2517 Ga0207662_10007104
2518 Ga0207662_10037541
2519 Ga0207662_10185746
2520 Ga0207662_10247582
2521 Ga0207662_10304538
2522 Ga0207662_10722687
2523 Ga0207657_10001138
2524 Ga0207657_10047239
2525 Ga0207657_10133641
2526 Ga0207657_10281579
2527 Ga0207657_10553571
2528 Ga0207649_10025188
2529 Ga0207649_10032190
2530 Ga0207649_10058649
2531 Ga0207649_10118913
2532 Ga0207649_10167119
2533 Ga0207649_10178625
2534 Ga0207649_10525517
2535 Ga0207649_10526993
2536 Ga0207649_11091551
2537 Ga0207652_10011077
2538 Ga0207652_10012004
2539 Ga0207652_10042922
2540 Ga0207652_10065009
2541 Ga0207652_10093206
2542 Ga0207652_10180913
2543 Ga0207652_10261717
2544 Ga0207652_10261985
2545 Ga0207652_10324641
2546 Ga0207652_10444285
2547 Ga0207652_10539114
2548 Ga0207652_10917515
2549 Ga0207652_10968089
2550 Ga0207646_10019243
2551 Ga0207646_10035672
2552 Ga0207646_10103586
2553 Ga0207646_10409012
2554 Ga0207646_10473825
2555 Ga0207646_10536794
2556 Ga0207646_11799240
2557 Ga0207681_10068781
2558 Ga0207681_10085457
2559 Ga0207681_10205225
2560 Ga0207681_10544386
2561 Ga0207681_10545758
2562 Ga0207694_10026946
2563 Ga0207694_10248765
2564 Ga0207694_10275749
2565 Ga0207694_10843780
2566 Ga0207650_10010393
2567 Ga0207650_10249865
2568 Ga0207650_11374444
2569 Ga0207659_10022346
2570 Ga0207659_10208752
2571 Ga0207659_10218655
2572 Ga0207659_10497834
2573 Ga0207659_11195230
2574 Ga0207659_11694803
2575 Ga0207687_10075869
2576 Ga0207687_10136950
2577 Ga0207687_10400629
2578 Ga0207687_11183420
2579 Ga0207687_11722786
2580 Ga0207700_10087723
2581 Ga0207700_10483316
2582 Ga0207664_10000099
2583 Ga0207664_10012437
2584 Ga0207664_10420601
2585 Ga0207664_11970421
2586 Ga0207644_10227703
2587 Ga0207644_10490086
2588 Ga0207644_10860658
2589 Ga0207644_11627165
2590 Ga0207690_10070701
2591 Ga0207690_10076401
2592 Ga0207690_10207916
2593 Ga0207706_10075992
2594 Ga0207706_10150224
2595 Ga0207706_10535245
2596 Ga0207706_10556469
2597 Ga0207706_11007915
2598 Ga0207706_11353459
2599 Ga0207686_10060773
2600 Ga0207686_11131820
2601 Ga0207686_11331536
2602 Ga0207709_10081832
2603 Ga0207709_11327797
2604 Ga0207670_10004353
2605 Ga0207670_10018648
2606 Ga0207670_10107499
2607 Ga0207670_10301182
2608 Ga0207670_11139326
2609 Ga0207670_11928134
2610 Ga0207669_10346609
2611 Ga0207669_10350187
2612 Ga0207669_11052314
2613 Ga0207704_10040337
2614 Ga0207704_11302836
2615 Ga0207704_11365406
2616 Ga0207665_10021871
2617 Ga0207665_10024947
2618 Ga0207665_10097926
2619 Ga0207665_10197621
2620 Ga0207665_11293580
2621 Ga0207691_10032808
2622 Ga0207691_10046795
2623 Ga0207691_10153386
2624 Ga0207691_10322355
2625 Ga0207711_10183645
2626 Ga0207711_11200148
2627 Ga0207711_11895670
2628 Ga0207711_12060576
2629 Ga0207689_10019641
2630 Ga0207689_10053633
2631 Ga0207689_10123876
2632 Ga0207661_10001907
2633 Ga0207661_10004866
2634 Ga0207661_10047859
2635 Ga0207661_10179812
2636 Ga0207661_11788099
2637 Ga0207679_10002650
2638 Ga0207679_10192419
2639 Ga0207679_10218788
2640 Ga0207679_10314992
2641 Ga0207679_10316793
2642 Ga0207679_10741175
2643 Ga0207679_10752364
2644 Ga0207679_10822952
2645 Ga0207679_10872568
2646 Ga0207679_11249370
2647 Ga0207679_11269312
2648 Ga0207679_12086469
2649 Ga0207679_12138210
2650 Ga0207667_10034763
2651 Ga0207667_10658021
2652 Ga0207667_11478457
2653 Ga0207667_12081101
2654 Ga0207651_10021908
2655 Ga0207651_10036217
2656 Ga0207651_10071067
2657 Ga0207651_10128156
2658 Ga0207651_10173474
2659 Ga0207712_10675161
2660 Ga0207668_10281849
2661 Ga0207668_10808508
2662 Ga0207640_10001854
2663 Ga0207640_10129033
2664 Ga0207640_10238690
2665 Ga0207640_10280376
2666 Ga0207640_10583783
2667 Ga0207640_10719024
2668 Ga0207658_11026684
2669 Ga0207658_12005943
2670 Ga0207677_10012623
2671 Ga0207677_10058774
2672 Ga0207677_10092972
2673 Ga0207677_10216912
2674 Ga0207677_10287200
2675 Ga0207677_10416302
2676 Ga0207703_11017431
2677 Ga0207703_12206895
2678 Ga0207639_10002689
2679 Ga0207639_10051893
2680 Ga0207639_10204557
2681 Ga0207639_10217878
2682 Ga0207639_10798015
2683 Ga0207639_11176347
2684 Ga0207639_11760032
2685 Ga0207678_10012023
2686 Ga0207678_10076305
2687 Ga0207678_11960182
2688 Ga0207708_10112088
2689 Ga0207708_10156616
2690 Ga0207708_10614938
2691 Ga0207708_10795262
2692 Ga0207708_11220680
2693 Ga0207708_12019120
2694 Ga0207702_10036288
2695 Ga0207702_10086091
2696 Ga0207702_10249947
2697 Ga0207702_10868485
2698 Ga0207702_11628407
2699 Ga0207641_10070450
2700 Ga0207641_10281147
2701 Ga0207641_10464731
2702 Ga0207641_10611440
2703 Ga0207641_11270260
2704 Ga0207648_10048391
2705 Ga0207648_10097740
2706 Ga0207648_10203821
2707 Ga0207648_10306254
2708 Ga0207648_10654520
2709 Ga0207676_10180609
2710 Ga0207676_10297097
2711 Ga0207676_11001064
2712 Ga0207676_11162364
2713 Ga0207676_11353882
2714 Ga0207674_10048180
2715 Ga0207674_10082972
2716 Ga0207674_10100870
2717 Ga0207674_10101100
2718 Ga0207674_10168287
2719 Ga0207674_10268372
2720 Ga0207674_11749475
2721 Ga0207675_100316888
2722 Ga0207683_10028596
2723 Ga0207683_10035142
2724 Ga0207683_10127379
2725 Ga0207683_10618670
2726 Ga0207698_10038152
2727 Ga0207698_10046102
2728 Ga0207698_10601353
2729 Ga0207698_11574528
2730 Ga0207698_11688725
2731 Ga0207698_12636717
2732 Ga0209973_1018244
2733 Ga0209973_1021955
2734 Ga0209967_1084390
2735 Ga0209984_1013486
2736 Ga0209984_1054251
2737 Ga0209995_1003150
2738 Ga0209995_1009325
2739 Ga0209968_1003096
2740 Ga0209999_1002599
2741 Ga0209999_1091843
2742 Ga0209999_1124806
2743 Ga0209982_1017982
2744 Ga0209970_1024737
2745 Ga0209970_1052785
2746 Ga0210002_1043222
2747 Ga0210002_1082987
2748 Ga0209983_1000810
2749 Ga0209983_1018496
2750 Ga0209983_1019830
2751 Ga0209971_1020116
2752 Ga0209966_1000982
2753 Ga0209966_1108664
2754 Ga0209998_10003458
2755 Ga0209998_10080529
2756 Ga0209974_10007380
2757 Ga0209974_10007508
2758 Ga0207428_10011903
2759 Ga0207428_10193964
2760 Ga0207428_10276111
2761 Ga0207428_10401508
2762 Ga0268266_10142482
2763 Ga0268266_10237157
2764 Ga0268265_10067252
2765 Ga0268265_10415410
2766 Ga0268265_10574631
2767 Ga0268265_10859804
2768 Ga0268265_11001979
2769 Ga0268264_10221374
2770 Ga0268264_10630454
2771 Ga0265323_10056890
2772 Ga0265338_10051633
2773 Ga0316182_1255157
2774 Ga0265320_10064432
2775 Ga0265327_10087014
2776 Ga0265316_10934161
2777 Ga0307408_100016817
2778 Ga0307408_100019763
2779 Ga0307408_100046769
2780 Ga0307408_100052712
2781 Ga0307408_100062503
2782 Ga0307408_100099262
2783 Ga0307408_100153960
2784 Ga0307408_100223526
2785 Ga0307408_100406940
2786 Ga0307408_100424859
2787 Ga0307408_100713907
2788 Ga0307408_100864679
2789 Ga0307408_101332649
2790 Ga0265313_10145536
2791 Ga0316575_10039695
2792 Ga0316575_10385885
2793 Ga0316579_10001157
2794 Ga0265314_10001956
2795 Ga0265342_10633398
2796 Ga0316576_10004863
2797 Ga0316576_10044118
2798 Ga0316578_10001113
2799 Ga0307405_10003326
2800 Ga0307405_10004504
2801 Ga0307405_10081500
2802 Ga0307405_10083760
2803 Ga0307405_10100967
2804 Ga0307405_10107686
2805 Ga0307405_10116149
2806 Ga0307405_10152371
2807 Ga0307405_10250335
2808 Ga0307405_11012285
2809 Ga0307405_11208907
2810 Ga0307405_11333273
2811 Ga0316577_10008737
2812 Ga0316577_10076737
2813 Ga0307413_10001842
2814 Ga0307413_10002091
2815 Ga0307413_10006358
2816 Ga0307413_10031527
2817 Ga0307413_10055726
2818 Ga0307413_10067122
2819 Ga0307413_10074613
2820 Ga0307413_10079652
2821 Ga0307413_10203183
2822 Ga0307413_10316330
2823 Ga0307413_10701827
2824 Ga0307413_10760750
2825 Ga0307413_10957308
2826 Ga0307413_11250943
2827 Ga0307413_11340826
2828 Ga0307413_11758549
2829 Ga0307410_10000285
2830 Ga0307410_10000967
2831 Ga0307410_10022252
2832 Ga0307410_10022355
2833 Ga0307410_10054575
2834 Ga0307410_10057005
2835 Ga0307410_10067694
2836 Ga0307410_10109480
2837 Ga0307410_10126427
2838 Ga0307410_10654568
2839 Ga0307410_10712613
2840 Ga0307410_10869233
2841 Ga0307410_10958461
2842 Ga0307410_11030798
2843 Ga0307406_10009039
2844 Ga0307406_10030981
2845 Ga0307406_10074742
2846 Ga0307406_10102636
2847 Ga0307406_10139031
2848 Ga0307406_10208490
2849 Ga0307406_10257460
2850 Ga0307406_10392032
2851 Ga0307406_10824787
2852 Ga0307406_11310203
2853 Ga0307406_11468420
2854 Ga0307407_10005111
2855 Ga0307407_10005124
2856 Ga0307407_10044520
2857 Ga0307407_10122956
2858 Ga0307407_10241220
2859 Ga0307407_10500819
2860 Ga0307407_10543982
2861 Ga0307407_10568148
2862 Ga0307407_10942719
2863 Ga0307407_10954127
2864 Ga0307407_11254962
2865 Ga0307412_10005885
2866 Ga0307412_10007821
2867 Ga0307412_10016367
2868 Ga0307412_10060199
2869 Ga0307412_10075320
2870 Ga0307412_10094473
2871 Ga0307412_10139932
2872 Ga0307412_10202806
2873 Ga0307412_10361947
2874 Ga0307412_10791122
2875 Ga0307412_10863760
2876 Ga0307412_11152646
2877 Ga0307412_11837595
2878 Ga0307409_100005454
2879 Ga0307409_100008795
2880 Ga0307409_100032235
2881 Ga0307409_100047584
2882 Ga0307409_100055663
2883 Ga0307409_100079063
2884 Ga0307409_100079067
2885 Ga0307409_100172626
2886 Ga0307409_100487723
2887 Ga0307409_100541231
2888 Ga0307409_100655432
2889 Ga0307409_100810599
2890 Ga0307409_101036773
2891 Ga0307409_101214543
2892 Ga0307409_101843172
2893 Ga0307409_102131522
2894 Ga0307416_100003682
2895 Ga0307416_100009003
2896 Ga0307416_100016074
2897 Ga0307416_100092060
2898 Ga0307416_100113896
2899 Ga0307416_100116989
2900 Ga0307416_100118263
2901 Ga0307416_100417503
2902 Ga0307416_100491460
2903 Ga0307416_100535955
2904 Ga0307416_100538135
2905 Ga0307416_100612039
2906 Ga0307416_100650942
2907 Ga0307416_100833658
2908 Ga0307416_101065588
2909 Ga0307416_101526866
2910 Ga0307416_102777375
2911 Ga0307414_10036134
2912 Ga0307414_10074656
2913 Ga0307414_10180246
2914 Ga0307414_10726338
2915 Ga0307414_10756896
2916 Ga0307414_10956519
2917 Ga0307414_10986856
2918 Ga0307411_10000568
2919 Ga0307411_10005072
2920 Ga0307411_10012793
2921 Ga0307411_10020764
2922 Ga0307411_10114848
2923 Ga0307411_10118769
2924 Ga0307411_10209710
2925 Ga0307411_10336063
2926 Ga0307411_10347332
2927 Ga0307411_10825064
2928 Ga0307411_10889294
2929 Ga0307415_100004310
2930 Ga0307415_100004471
2931 Ga0307415_100006886
2932 Ga0307415_100017495
2933 Ga0307415_100073037
2934 Ga0307415_100077926
2935 Ga0307415_100116777
2936 Ga0307415_100232082
2937 Ga0307415_100238109
2938 Ga0307415_100315483
2939 Ga0307415_100443838
2940 Ga0307415_101090887
2941 Ga0316583_10001183
2942 Ga0316583_10017879
2943 Ga0316583_10084259
2944 Ga0316585_10001668
2945 Ga0316580_10001460
2946 Ga0316592_1120642
2947 Ga0316588_1148391
2948 Ga0316596_1039349
2949 Ga0373930_0074044
2950 Ga0373948_0059906
2951 Ga0373950_0080083
2952 Ga0373958_0022561
2953 Ga0373958_0094801
2954 Ga0373959_0006266
2955 Ga0373959_0013525
2956 Ga0373959_0078539
2957 Ga0373938_0034724
2958 Ga0373938_0246200
2959 Ga0373926_0269996
2960 Ga0373928_0033370
2961 Ga0373928_0062653
2962 Ga0373928_0154152
2963 Ga0373929_0026783
2964 Ga0373929_0029820
2965 Ga0373929_0056692
2966 Ga0373934_0141970
2967 Ga0373934_0454027
2968 Ga0373940_0074398
2969 Ga0373944_0057368
2970 Ga0373949_0250311
2971 Ga0373952_0021650
2972 Ga0373952_0022759
2973 Ga0373952_0044807
2974 Ga0373923_0036974
2975 Ga0373932_0170684
2976 Ga0373939_0067213
2977 Ga0373939_0254051
2978 Ga0373941_0017581
2979 Ga0373941_0232439
2980 Ga0373945_0397345
2981 Ga0373953_0014696
2982 Ga0373954_0236932
2983 Ga0373956_0149048
2984 Ga0373956_0345775
2985 Ga0373957_0106980
2986 Ga0373960_0040013
2987 Ga0373960_0121692
2988 Ga0373960_0200705
2989 Ga0373943_0015892
2990 Ga0373943_0407194
2991 Ga0373946_0276367
2992 Ga0373946_0676961
2993 Ga0373955_0088617
2994 Ga0373942_0037456
2995 Ga0373942_0199256
2996 Ga0373961_0000555
2997 Ga0373961_0036950
2998 Ga0373961_0314891
2999 Ga0373962_0259282
3000 Ga0316574_0007172
3001 Ga0316574_0331037
3002 Ga0316574_0355322
3003 Ga0373924_0040307
3004 Ga0373931_0065790
3005 Ga0373931_0113587
3006 Ga0373931_0233081
3007 Ga0373931_0424587
3008 Ga0373931_0856974
3009 Ga0373935_0058549
3010 Ga0373933_0002765
3011 Ga0373937_0001688
3012 Ga0373937_0063603
3013 Ga0373937_0245517
3014 Ga0373937_0517704
3015 Ga0373937_1029058
3016 Ga0373937_1128300
3017 Ga0373937_1565581
3018 Ga0316582_0015599
3019 Ga0316582_0945318
3020 Ga0316584_0007216
3021 Ga0373925_0078483
3022 Ga0373925_0176928
3023 Ga0373925_0292667
3024 Ga0373925_0487257
3025 Ga0395899_0151372
3026 Ga0395900_0024491
3027 Ga0395898_1598012
3028 Ga0395905_0025260
3029 Ga0395905_0067530
3030 Ga0395905_1312912
3031 Ga0395905_1736610
3032 Ga0436364_0100568
3033 Ga0436364_0390676
3034 Ga0436364_1537478
3035 Ga0395901_0001770
3036 Ga0242419_003585
3037 Ga0242420_050187
3038 Ga0436365_0223155
3039 Ga0436365_0234011
3040 Ga0436365_0408308
3041 Ga0436365_1264253
3042 Ga0436365_1424311
3043 Ga0436365_1599614
3044 Ga0439439_0048325
3045 Ga0439439_0178061
3046 Ga0439453_0097394
3047 Ga0451793_0749803
3048 Ga0451795_1463064
3049 Ga0451802_1318879
3050 Ga0451807_0674211
3051 Ga0451807_1934356
3052 Ga0451807_2773123
3053 Ga0451839_1015318
3054 Ga0451845_0267143
3055 Ga0451853_2480235
3056 Ga0451853_2725406
3057 Ga0439433_0143812
3058 Ga0439432_163717
3059 Ga0439449_0103716
3060 Ga0439455_0022797
3061 Ga0439456_080993
3062 Ga0439446_0049325
3063 Ga0439446_0053270
3064 Ga0439446_0174111
3065 Ga0439446_0346855
3066 Ga0439434_0081628
3067 Ga0439434_0157571
3068 Ga0439459_0037912
3069 Ga0451577_0049852
3070 Ga0451577_0208168
3071 Ga0451577_0391595
3072 Ga0453683_0012099
3073 Ga0453683_0182841
3074 Ga0453683_0714274
3075 Ga0453683_0746648
3076 Ga0466965_0134875
3077 Ga0466965_0435969
3078 Ga0466961_0216372
3079 Ga0466963_0055834
3080 Ga0466964_0133383
3081 Ga0453684_0062783
3082 Ga0453684_0532052
3083 Ga0453684_0714362
3084 Ga0453684_1371210
3085 Ga0453684_1964546
3086 Ga0453684_2365960
3087 Ga0466970_0649912
3088 Ga0466957_0209596
3089 Ga0466960_0145973
3090 Ga0466960_0176826
3091 Ga0466959_0772507
3092 Ga0466959_1022370
3093 Ga0451576_0032102
3094 Ga0451576_0153457
3095 Ga0451576_0237355
3096 Ga0451576_0252033
3097 Ga0451576_0297024
3098 Ga0451576_0308436
3099 Ga0451576_0388486
3100 Ga0466958_0198001
3101 Ga0466958_0629169
3102 Ga0466967_0277810
3103 Ga0466967_1060643
3104 Ga0466967_1139939
3105 Ga0495592_0402576
3106 Ga0495592_0498975
3107 Ga0495603_0021202
3108 Ga0495603_0043390
3109 Ga0495590_0238336
3110 Ga0495629_0048696
3111 Ga0495629_0073936
3112 Ga0495629_0077215
3113 Ga0495629_0615914
3114 Ga0495629_0678831
3115 Ga0495651_0017188
3116 Ga0495651_0084014
3117 Ga0495651_0243225
3118 Ga0495653_0026437
3119 Ga0495580_0016230
3120 Ga0495580_0076246
3121 Ga0495580_0087356
3122 Ga0495580_0113415
3123 Ga0495582_0010686
3124 Ga0495582_0014832
3125 Ga0495582_0109507
3126 Ga0495582_0197880
3127 Ga0495605_0283024
3128 Ga0495605_0494223
3129 Ga0495639_0004714
3130 Ga0495639_0067391
3131 Ga0495662_0097571
3132 Ga0495662_0117049
3133 Ga0495664_0463726
3134 Ga0495584_0592649
3135 Ga0495594_0005611
3136 Ga0495594_0069873
3137 Ga0495594_0118996
3138 Ga0495596_0010087
3139 Ga0495583_0164843
3140 Ga0495608_0033181
3141 Ga0495608_0103342
3142 Ga0495608_0266708
3143 Ga0495608_0501057
3144 Ga0495618_0000743
3145 Ga0495618_0036169
3146 Ga0495618_0422616
3147 Ga0495618_0821398
3148 Ga0495628_0214703
3149 Ga0495628_0229371
3150 Ga0495630_0094702
3151 Ga0495630_0176568
3152 Ga0495630_0462261
3153 Ga0495630_0559980
3154 Ga0495630_0814085
3155 Ga0495630_0953767
3156 Ga0495643_0072184
3157 Ga0495663_0020324
3158 Ga0495663_0020379
3159 Ga0495666_0012771
3160 Ga0495642_0053960
3161 Ga0495652_0123654
3162 Ga0495652_0156344
3163 Ga0495665_0014539
3164 Ga0495665_0028776
3165 Ga0495665_0250977
3166 Ga0495640_0156834
3167 Ga0495640_0185177
3168 Ga0495640_0629692
3169 Ga0495586_0015359
3170 Ga0495586_0126327
3171 Ga0495586_0174630
3172 Ga0495586_0301689
3173 Ga0495586_0319161
3174 Ga0495586_0508105
3175 Ga0495587_0267041
3176 Ga0495587_0447806
3177 Ga0495587_0619377
3178 Ga0495598_0268802
3179 Ga0495621_0041710
3180 Ga0495621_0053555
3181 Ga0495645_0013239
3182 Ga0495645_0238829
3183 Ga0495645_0680694
3184 Ga0495622_0380357
3185 Ga0495667_0016331
3186 Ga0495667_0063143
3187 Ga0495667_0220730
3188 Ga0495656_0085019
3189 Ga0495634_0150620
3190 Ga0495634_0171853
3191 Ga0495634_0192667
3192 Ga0495635_0054906
3193 Ga0495635_0084340
3194 Ga0495659_0249609
3195 Ga0495661_0341275
3196 Ga0495588_0088616
3197 Ga0495657_0049025
3198 Ga0495657_0113082
3199 Ga0495599_0010652
3200 Ga0495599_0015785
3201 Ga0495599_0224563
3202 Ga0495623_0017452
3203 Ga0495623_0082831
3204 Ga0495623_0108146
3205 Ga0495646_0016342
3206 Ga0495646_0626111
3207 Ga0495647_0139968
3208 Ga0495647_0631783
3209 Ga0495658_0060006
3210 Ga0495658_0110421
3211 Ga0495658_0338908
3212 Ga0495658_0495585
3213 Ga0495669_0163695
3214 Ga0495669_0640093
3215 Ga0495613_0035641
3216 Ga0495613_0182583
3217 Ga0495613_0399046
3218 Ga0495613_0467808
3219 Ga0495624_0148945
3220 Ga0495600_0043998
3221 Ga0495581_0162192
3222 Ga0495581_0661507
3223 Ga0495581_0675231
3224 Ga0495581_0843010
3225 Ga0495604_0027250
3226 Ga0495604_0104964
3227 Ga0495636_0036783
3228 Ga0495636_0174422
3229 Ga0495674_0022976
3230 Ga0495674_0260821
3231 Ga0495674_0899048
3232 Ga0495676_0582121
3233 Ga0495680_0013035
3234 Ga0495680_0091581
3235 Ga0495680_0287504
3236 Ga0495680_0442587
3237 Ga0495680_0722849
3238 Ga0495680_0893525
3239 Ga0495675_0079198
3240 Ga0495675_0170389
3241 Ga0495677_0106504
3242 Ga0495685_031250
3243 Ga0495684_0071242
3244 Ga0495684_0116099
3245 Ga0495684_0169445
3246 Ga0495684_0271682
3247 Ga0495684_0288272
3248 Ga0495684_0504246
3249 Ga0495593_0201702
3250 Ga0495602_0013466
3251 Ga0495602_0100827
3252 Ga0495602_0239437
3253 Ga0495602_0401675
3254 Ga0495602_0923954
3255 Ga0495615_0252670
3256 Ga0496100_0078491
3257 Ga0496100_0109226
3258 Ga0496100_0289027
3259 Ga0496100_0800416
3260 Ga0496101_0056945
3261 Ga0496101_0111991
3262 Ga0496101_1124416
3263 Ga0496102_0172439
3264 Ga0496102_0970077
3265 Ga0496104_0065574
3266 Ga0496104_0309521
3267 Ga0496104_0399240
3268 Ga0496105_0059694
3269 Ga0496105_0070746
3270 Ga0496105_0147782
3271 Ga0496106_0027640
3272 Ga0496106_0064193
3273 Ga0496106_0318902
3274 Ga0496106_0342753
3275 Ga0496106_0578785
3276 Ga0496107_0261224
3277 Ga0496107_0344283
3278 Ga0496107_0711641
3279 Ga0496108_0035987
3280 Ga0496108_0592139
3281 Ga0496108_1009386
3282 Ga0496109_0039889
3283 Ga0496109_0042753
3284 Ga0496109_0043173
3285 Ga0496110_0007094
3286 Ga0496110_0089104
3287 Ga0496110_0151553
3288 Ga0496111_0001415
3289 Ga0496111_0072867
3290 Ga0496111_0553796
3291 Ga0496112_0002541
3292 Ga0496112_0024016
3293 Ga0496112_0060181
3294 Ga0496112_0079427
3295 Ga0496112_0104391
3296 Ga0496112_0976500
3297 Ga0496112_1175577
3298 Ga0496113_0047161
3299 Ga0496113_0075448
3300 Ga0496113_0156046
3301 Ga0496113_0813883
3302 Ga0496113_1115274
3303 Ga0496114_0000001
3304 Ga0496114_0047313
3305 Ga0496114_1019079
3306 Ga0496115_0082370
3307 Ga0501306_024127
3308 Ga0501306_049510
3309 Ga0501308_074347
3310 Ga0501310_074323
3311 Ga0501307_001003
3312 Ga0501307_051693
3313 Ga0501296_050298
3314 Ga0501298_006514
3315 Ga0501298_071487
3316 Ga0501303_022268
3317 Ga0501313_033044
3318 Ga0501313_066371
3319 Ga0501314_036139
3320 Ga0501315_027200
3321 Ga0501317_089645
3322 Ga0501320_034979
3323 Ga0501031_0115077
3324 Ga0501031_0232197
3325 Ga0501031_0959922
3326 Ga0501032_0082763
3327 Ga0501032_0670862
3328 Ga0501033_0245632
3329 Ga0501033_0458016
3330 Ga0501033_0773273
3331 Ga0501034_0000132
3332 Ga0501034_0044308
3333 Ga0501034_0196452
3334 Ga0501034_0396995
3335 Ga0501034_0762996
3336 Ga0501034_0806897
3337 Ga0501036_0170582
3338 Ga0501036_0190593
3339 Ga0501036_0297376
3340 Ga0501036_0311648
3341 Ga0501037_0287470
3342 Ga0501037_0427947
3343 Ga0501037_0451245
3344 Ga0501037_0693149
3345 Ga0501038_0011902
3346 Ga0501038_0353513
3347 Ga0501038_0513220
3348 Ga0501038_1208946
3349 Ga0501039_0103131
3350 Ga0501039_0196869
3351 Ga0501039_0663518
3352 Ga0501040_0021934
3353 Ga0501040_0069484
3354 Ga0501041_0023985
3355 Ga0501041_0117942
3356 Ga0501041_0135383
3357 Ga0501041_0398134
3358 Ga0501042_0037878
3359 Ga0501042_0215413
3360 Ga0501042_0407104
3361 Ga0501042_0533108
3362 Ga0501043_0000829
3363 Ga0501043_0047600
3364 Ga0501046_0000117
3365 Ga0501046_0028687
3366 Ga0501046_0047535
3367 Ga0501046_0102764
3368 Ga0501046_0213074
3369 Ga0501046_0278630
3370 Ga0501046_0447386
3371 Ga0501047_0029942
3372 Ga0501047_0130028
3373 Ga0501047_0130576
3374 Ga0501048_0031361
3375 Ga0501048_0118379
3376 Ga0501048_0186441
3377 Ga0501048_0229725
3378 Ga0501048_0373847
3379 Ga0501048_0473535
3380 Ga0501048_0620527
3381 Ga0501067_0014484
3382 Ga0501067_0039490
3383 Ga0501067_0060801
3384 Ga0501067_0066718
3385 Ga0501067_0232860
3386 Ga0501067_0328662
3387 Ga0501068_0001673
3388 Ga0501068_0008160
3389 Ga0501068_0075235
3390 Ga0501068_0131811
3391 Ga0501068_0335310
3392 Ga0501068_1054470
3393 Ga0501069_0008330
3394 Ga0501069_0017995
3395 Ga0501069_0074284
3396 Ga0501069_0183155
3397 Ga0501069_0212562
3398 Ga0501069_0273842
3399 Ga0501069_0772874
3400 Ga0501069_0815877
3401 Ga0501070_0013050
3402 Ga0501070_0032011
3403 Ga0501070_0063385
3404 Ga0501070_0069675
3405 Ga0501070_0089832
3406 Ga0501070_0097328
3407 Ga0501070_0171248
3408 Ga0501070_0509274
3409 Ga0501070_0513201
3410 Ga0501071_0012801
3411 Ga0501071_0238684
3412 Ga0501071_0481689
3413 Ga0501071_0732719
3414 Ga0501071_0839822
3415 Ga0501071_0919752
3416 Ga0501072_0006109
3417 Ga0501072_0010585
3418 Ga0501072_0032455
3419 Ga0501072_0053900
3420 Ga0501072_0154703
3421 Ga0501072_0209787
3422 Ga0501072_0212282
3423 Ga0501072_0234614
3424 Ga0501072_0265703
3425 Ga0501072_0658239
3426 Ga0501072_1358210
3427 Ga0501073_0170984
3428 Ga0501073_0174870
3429 Ga0501073_0772218
3430 Ga0501074_0069510
3431 Ga0501074_0084841
3432 Ga0501074_0165238
3433 Ga0501074_0246973
3434 Ga0501075_0006664
3435 Ga0501075_0029122
3436 Ga0501075_0036489
3437 Ga0501075_0165817
3438 Ga0501075_0267549
3439 Ga0501075_0319160
3440 Ga0501076_0006442
3441 Ga0501076_0054868
3442 Ga0501076_0069214
3443 Ga0501076_0219729
3444 Ga0501076_0226375
3445 Ga0501076_0244716
3446 Ga0501076_0547773
3447 Ga0501076_0949277
3448 Ga0501076_1109836
3449 Ga0501077_0002603
3450 Ga0501077_0003447
3451 Ga0501077_0048237
3452 Ga0501077_0152205
3453 Ga0501077_0243273
3454 Ga0501077_0383412
3455 Ga0501077_0619854
3456 Ga0501198_152313
3457 Ga0501202_033027
3458 Ga0501202_053765
3459 Ga0501209_004058
3460 Ga0501209_143699
3461 Ga0501216_009705
3462 Ga0501216_046341
3463 Ga0501216_067720
3464 Ga0501216_174444
3465 Ga0501217_119395
3466 Ga0501217_189877
3467 Ga0501217_243053
3468 Ga0501223_008477
3469 Ga0501224_001238
3470 Ga0501227_018036
3471 Ga0501230_009571
3472 Ga0501233_004905
3473 Ga0501233_101052
3474 Ga0501235_007524
3475 Ga0501236_051361
3476 Ga0501239_013408
3477 Ga0501239_025043
3478 Ga0501239_027332
3479 Ga0501242_033433
3480 Ga0501242_052523
3481 Ga0501243_004221
3482 Ga0501243_012793
3483 Ga0501247_010669
3484 Ga0501249_018960
3485 Ga0501249_172577
3486 Ga0501250_041481
3487 Ga0501251_076902
3488 Ga0501253_078750
3489 Ga0501256_042400
3490 Ga0501257_008968
3491 Ga0501257_118845
3492 Ga0501257_123774
3493 Ga0501257_166148
3494 Ga0501257_166883
3495 Ga0501258_012429
3496 Ga0501259_084809
3497 Ga0501259_143473
3498 Ga0501261_045769
3499 Ga0501261_050502
3500 Ga0501221_065122
3501 Ga0501221_111637
3502 Ga0501221_237514
3503 Ga0501225_0004791
3504 Ga0501234_001400
3505 Ga0501234_097071
3506 Ga0501079_0012691
3507 Ga0501079_0019559
3508 Ga0501079_0035622
3509 Ga0501079_0055628
3510 Ga0501079_0074686
3511 Ga0501079_0162200
3512 Ga0501079_0202075
3513 Ga0501079_0610392
3514 Ga0501079_0611211
3515 Ga0501079_0718441
3516 Ga0501080_0002929
3517 Ga0501080_0004569
3518 Ga0501080_0092828
3519 Ga0501080_0365132
3520 Ga0501080_0404222
3521 Ga0501080_0607070
3522 Ga0501080_1618640
3523 Ga0501081_0019645
3524 Ga0501081_0084738
3525 Ga0501081_0099127
3526 Ga0501081_0125422
3527 Ga0501081_1455032
3528 Ga0501083_0000071
3529 Ga0501083_0014932
3530 Ga0501083_0043800
3531 Ga0501083_0083137
3532 Ga0501083_0212131
3533 Ga0501083_0348811
3534 Ga0501083_0923936
3535 Ga0501232_010440
3536 Ga0501262_049657
3537 Ga0501263_055879
3538 Ga0501265_030122
3539 Ga0501266_003064
3540 Ga0501267_004229
3541 Ga0501267_008912
3542 Ga0501268_002758
3543 Ga0501268_008026
3544 Ga0501268_034317
3545 Ga0501268_039586
3546 Ga0501268_046406
3547 Ga0501268_100477
3548 Ga0501268_107212
3549 Ga0501270_012851
3550 Ga0501270_070908
3551 Ga0501270_092479
3552 Ga0501270_108129
3553 Ga0501271_002195
3554 Ga0501272_013617
3555 Ga0501273_008374
3556 Ga0501273_035883
3557 Ga0501273_080648
3558 Ga0501274_002181
3559 Ga0501275_043350
3560 Ga0501283_008388
3561 Ga0501035_0124162
3562 Ga0501035_0186524
3563 Ga0501035_0204036
3564 Ga0501035_0583180
3565 Ga0501035_0792784
3566 Ga0501035_1113324
3567 Ga0501044_0013639
3568 Ga0501044_0064096
3569 Ga0501044_0074963
3570 Ga0501044_0431474
3571 Ga0501044_0502384
3572 Ga0501044_0630322
3573 Ga0501045_0004175
3574 Ga0501045_0032763
3575 Ga0501045_0086402
3576 Ga0501045_0161793
3577 Ga0501045_0241244
3578 Ga0501045_0330576
3579 Ga0501045_0562930
3580 Ga0501204_013205
3581 Ga0501212_001652
3582 Ga0501212_083701
3583 nmdc:mga05p37_151379_c1
3584 nmdc:mga05p37_429595_c1
3585 nmdc:mga05p37_518028_c1
3586 nmdc:mga05p37_663841_c1
3587 nmdc:mga09592_311408_c1
3588 nmdc:mga09592_413108_c1
3589 nmdc:mga09592_759854_c1
3590 nmdc:mga0qj67_339484_c1
3591 nmdc:mga0qj67_77954_c1
3592 nmdc:mga0qj67_793471_c1
3593 nmdc:mga06r32_1497899_c1
3594 nmdc:mga06r32_342365_c1
3595 nmdc:mga06r32_429330_c1
3596 nmdc:mga06r32_46152_c1
3597 nmdc:mga06r32_6558_c1
3598 nmdc:mga08y16_116742_c1
3599 nmdc:mga08y16_144197_c1
3600 nmdc:mga08y16_22055_c1
3601 nmdc:mga08y16_281933_c1
3602 nmdc:mga08y16_288511_c1
3603 nmdc:mga08y16_311113_c1
3604 nmdc:mga08y16_315866_c1
3605 nmdc:mga08y16_699500_c1
3606 nmdc:mga0n895_1181678_c1
3607 nmdc:mga0n895_190360_c1
3608 nmdc:mga0n895_21843_c1
3609 nmdc:mga0n895_253314_c1
3610 nmdc:mga0n895_358036_c1
3611 nmdc:mga0n895_464171_c1
3612 nmdc:mga0n895_512489_c1
3613 nmdc:mga0n895_516105_c1
3614 nmdc:mga0n895_573569_c1
3615 nmdc:mga0rr50_11870_c2
3616 nmdc:mga0rr50_1342219_c1
3617 nmdc:mga0rr50_274532_c1
3618 nmdc:mga0rr50_409005_c1
3619 nmdc:mga0rr50_508223_c1
3620 nmdc:mga0rr50_677514_c1
3621 nmdc:mga08x19_145676_c1
3622 nmdc:mga08x19_1503_c1
3623 nmdc:mga08x19_24882_c1
3624 nmdc:mga08x19_98185_c1
3625 nmdc:mga0a205_26534_c1
3626 nmdc:mga0a205_71485_c1
3627 Ga0495601_0410362
3628 Ga0495655_0204864
3629 Ga0495655_0287792
3630 Ga0495595_0402086
3631 Ga0495595_0672761
3632 Ga0495619_0033082
3633 Ga0495619_0216400
3634 Ga0495619_0901547
3635 Ga0501084_0032504
3636 Ga0501084_0040463
3637 Ga0501084_0042401
3638 Ga0501084_0053363
3639 Ga0501084_0055496
3640 Ga0501084_0060696
3641 Ga0501084_0980505
3642 Ga0501084_1171158
3643 Ga0590071_003501
3644 Ga0590071_006633
3645 Ga0590071_007102
3646 Ga0590071_009609
3647 Ga0590071_018064
3648 Ga0590074_010487
3649 Ga0590074_063876
3650 Ga0590075_044972
3651 Ga0590077_064462
3652 Ga0587084_125122
3653 Ga0587066_016651
3654 Ga0587073_0076206
3655 Ga0587085_153754
3656 Ga0587085_183001
3657 Ga0587091_057781
3658 Ga0587091_084500
3659 Ga0587113_036215
3660 Ga0587067_142955
3661 Ga0587076_201833
3662 Ga0587079_047120
3663 Ga0587071_013833
3664 Ga0587071_109511
3665 Ga0501082_0004163
3666 Ga0501082_0019498
3667 Ga0501082_0033970
3668 Ga0501082_0052165
3669 Ga0501082_0061602
3670 Ga0501082_0063320
3671 Ga0501082_0071941
3672 Ga0501082_0112785
3673 Ga0501082_0226165
3674 Ga0501082_0404454
3675 Ga0501082_0462845
3676 Ga0501082_0472839
3677 Ga0501082_0898369
3678 Ga0501082_1328866
3679 Ga0530510_0055415
3680 Ga0530510_0113500
3681 Ga0530510_0155250
3682 Ga0530510_0165371
3683 Ga0530510_0331267
3684 Ga0530510_0469868
3685 Ga0530510_1158495
3686 Ga0530510_1211158

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9657 15 76
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9441 8 83
7qv3-assembly1.cif.gz_s bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9377 4 80
7qv3-assembly1.cif.gz_s bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9262 4 80
8buu-assembly1.cif.gz_s are-abcf vmlr2 bound to a 70s ribosome 0.9236 2 84
ID Description Score Start End Superfamily
af_P06588_1_92_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9482 8 83 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9025 7 83 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8973 4 81 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8925 3 81 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8865 4 81 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A7C7UQP5-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9738 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A7C7UQP5-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9617 1 78 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1F4QGH0-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9374 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A661WLB4-F1-model_v4 Small ribosomal subunit protein uS19 0.9309 1 83 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-H6T3U6-F1-model_v4 Small ribosomal subunit protein uS19c (30S ribosomal protein S19, chloroplastic) 0.93 7 85 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009536
GO:0019843

Map