F495872
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1843 | 535 | 3686 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0606487|Ga0496112_0606487_308_607 |
| Length | 99 |
| Sequence | VSRSVKKGPFVEDSLKKKIETLNSRNEKKVVKTWSRPSVILPIMVGHTIAVHDGRRHVPVFITENMVGHRLGEFAATRTFKGHGRGAAAETATTVKAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 2 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 120 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 121 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 122 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 123 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 124 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 238 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 256 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 257 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 258 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 262 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 263 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 264 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 265 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 266 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 298 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 299 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 301 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 302 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 307 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 310 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 311 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 316 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 317 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 318 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 319 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 320 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 321 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 322 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 323 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 324 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 325 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 326 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 327 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 328 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 329 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 330 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 331 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 332 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 333 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 334 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 335 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 336 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 337 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 338 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 339 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 340 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 407 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 408 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 409 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 410 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 413 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 422 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 423 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 424 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 456 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 457 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 458 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 459 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 460 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 461 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 462 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 463 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 464 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 465 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 466 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 467 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 468 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 469 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 470 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 471 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 472 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 473 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 474 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 475 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 476 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 477 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 478 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 479 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 480 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 481 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 482 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 483 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 488 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 489 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 490 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 491 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 492 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 493 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 494 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 495 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 496 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 497 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 498 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 499 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 500 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 501 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 505 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 506 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 521 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 522 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 523 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 524 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 1.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.15 |
| Rhizosphere | 95.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496112_0606487 | 3300048915 | Bacteria | 1026 |
| 2 | JGI26145J50221_1006158 | 3300003371 | Bacteria | 1002 |
| 3 | Ga0058863_10086968 | 3300004799 | Bacteria | 3231 |
| 4 | Ga0058861_11789312 | 3300004800 | Bacteria | 647 |
| 5 | Ga0058862_12643353 | 3300004803 | Bacteria | 986 |
| 6 | Ga0065712_10074846 | 3300005290 | Bacteria | 3994 |
| 7 | Ga0065712_10439994 | 3300005290 | Bacteria | 695 |
| 8 | Ga0065712_10815210 | 3300005290 | Bacteria | 505 |
| 9 | Ga0065715_10057212 | 3300005293 | Bacteria | 946 |
| 10 | Ga0065715_10116004 | 3300005293 | Bacteria | 2395 |
| 11 | Ga0065715_10299813 | 3300005293 | Bacteria | 1044 |
| 12 | Ga0065715_10811487 | 3300005293 | Bacteria | 606 |
| 13 | Ga0065707_10432448 | 3300005295 | Bacteria | 819 |
| 14 | Ga0065707_10717645 | 3300005295 | Bacteria | 608 |
| 15 | Ga0070658_10171352 | 3300005327 | Bacteria | 1823 |
| 16 | Ga0070658_10561985 | 3300005327 | Bacteria | 987 |
| 17 | Ga0070658_11648416 | 3300005327 | Bacteria | 555 |
| 18 | Ga0070658_11812599 | 3300005327 | Bacteria | 528 |
| 19 | Ga0070676_10010363 | 3300005328 | Bacteria | 5055 |
| 20 | Ga0070676_10089561 | 3300005328 | Bacteria | 1882 |
| 21 | Ga0070676_10624397 | 3300005328 | Bacteria | 779 |
| 22 | Ga0070683_100003340 | 3300005329 | Bacteria | 12981 |
| 23 | Ga0070683_100058071 | 3300005329 | Bacteria | 3595 |
| 24 | Ga0070683_100071412 | 3300005329 | Bacteria | 3239 |
| 25 | Ga0070683_100366719 | 3300005329 | Bacteria | 1372 |
| 26 | Ga0070683_100862286 | 3300005329 | Bacteria | 868 |
| 27 | Ga0070683_100935969 | 3300005329 | Bacteria | 831 |
| 28 | Ga0070683_101036957 | 3300005329 | Bacteria | 788 |
| 29 | Ga0070683_101164768 | 3300005329 | Bacteria | 741 |
| 30 | Ga0070683_101170690 | 3300005329 | Bacteria | 739 |
| 31 | Ga0070690_100021133 | 3300005330 | Bacteria | 3971 |
| 32 | Ga0070690_100086374 | 3300005330 | Bacteria | 2059 |
| 33 | Ga0070690_100216988 | 3300005330 | Bacteria | 1338 |
| 34 | Ga0070670_100240332 | 3300005331 | Bacteria | 1577 |
| 35 | Ga0070670_100322579 | 3300005331 | Bacteria | 1353 |
| 36 | Ga0070670_100727273 | 3300005331 | Bacteria | 893 |
| 37 | Ga0070670_100806131 | 3300005331 | Bacteria | 848 |
| 38 | Ga0070677_10078225 | 3300005333 | Bacteria | 1409 |
| 39 | Ga0070677_10528114 | 3300005333 | Bacteria | 644 |
| 40 | Ga0068869_100874259 | 3300005334 | Bacteria | 776 |
| 41 | Ga0068869_100892987 | 3300005334 | Bacteria | 769 |
| 42 | Ga0068869_100907740 | 3300005334 | Bacteria | 763 |
| 43 | Ga0068869_100984090 | 3300005334 | Bacteria | 734 |
| 44 | Ga0068869_100984138 | 3300005334 | Bacteria | 734 |
| 45 | Ga0070666_10093653 | 3300005335 | Bacteria | 2065 |
| 46 | Ga0070666_10215569 | 3300005335 | Bacteria | 1353 |
| 47 | Ga0070666_10327378 | 3300005335 | Bacteria | 1094 |
| 48 | Ga0070666_10847074 | 3300005335 | Bacteria | 674 |
| 49 | Ga0070680_100003421 | 3300005336 | Bacteria | 11843 |
| 50 | Ga0070680_100011604 | 3300005336 | Bacteria | 6824 |
| 51 | Ga0070680_100048050 | 3300005336 | Bacteria | 3477 |
| 52 | Ga0070680_100103171 | 3300005336 | Bacteria | 2369 |
| 53 | Ga0070680_100119665 | 3300005336 | Bacteria | 2197 |
| 54 | Ga0070680_100156870 | 3300005336 | Bacteria | 1912 |
| 55 | Ga0070680_100163795 | 3300005336 | Bacteria | 1869 |
| 56 | Ga0070680_100321809 | 3300005336 | Bacteria | 1313 |
| 57 | Ga0070680_100369443 | 3300005336 | Bacteria | 1220 |
| 58 | Ga0070680_100464968 | 3300005336 | Bacteria | 1081 |
| 59 | Ga0070680_100466058 | 3300005336 | Bacteria | 1079 |
| 60 | Ga0070680_101315673 | 3300005336 | Bacteria | 625 |
| 61 | Ga0070682_100029919 | 3300005337 | Bacteria | 3282 |
| 62 | Ga0070682_100060558 | 3300005337 | Bacteria | 2394 |
| 63 | Ga0070682_100203345 | 3300005337 | Bacteria | 1398 |
| 64 | Ga0070682_100307437 | 3300005337 | Bacteria | 1166 |
| 65 | Ga0070682_100309796 | 3300005337 | Bacteria | 1162 |
| 66 | Ga0070682_101120793 | 3300005337 | Bacteria | 660 |
| 67 | Ga0068868_100013085 | 3300005338 | Bacteria | 6075 |
| 68 | Ga0068868_100141727 | 3300005338 | Bacteria | 1973 |
| 69 | Ga0068868_100320488 | 3300005338 | Bacteria | 1320 |
| 70 | Ga0068868_100783022 | 3300005338 | Bacteria | 859 |
| 71 | Ga0068868_101742480 | 3300005338 | Bacteria | 588 |
| 72 | Ga0070660_100100995 | 3300005339 | Bacteria | 2285 |
| 73 | Ga0070660_100250698 | 3300005339 | Bacteria | 1444 |
| 74 | Ga0070660_100293209 | 3300005339 | Bacteria | 1332 |
| 75 | Ga0070660_101042557 | 3300005339 | Bacteria | 691 |
| 76 | Ga0070660_101050711 | 3300005339 | Bacteria | 689 |
| 77 | Ga0070660_101184695 | 3300005339 | Bacteria | 647 |
| 78 | Ga0070689_100012783 | 3300005340 | Bacteria | 6060 |
| 79 | Ga0070689_100031628 | 3300005340 | Bacteria | 4023 |
| 80 | Ga0070689_100038522 | 3300005340 | Bacteria | 3658 |
| 81 | Ga0070689_100118383 | 3300005340 | Bacteria | 2113 |
| 82 | Ga0070689_101465145 | 3300005340 | Bacteria | 618 |
| 83 | Ga0070691_10028966 | 3300005341 | Bacteria | 2590 |
| 84 | Ga0070691_10186317 | 3300005341 | Bacteria | 1083 |
| 85 | Ga0070691_10272178 | 3300005341 | Bacteria | 916 |
| 86 | Ga0070687_100018908 | 3300005343 | Bacteria | 3196 |
| 87 | Ga0070687_100038862 | 3300005343 | Bacteria | 2388 |
| 88 | Ga0070687_100623865 | 3300005343 | Bacteria | 744 |
| 89 | Ga0070661_100028453 | 3300005344 | Bacteria | 4031 |
| 90 | Ga0070661_100029610 | 3300005344 | Bacteria | 3952 |
| 91 | Ga0070661_100034455 | 3300005344 | Bacteria | 3671 |
| 92 | Ga0070661_100323146 | 3300005344 | Bacteria | 1205 |
| 93 | Ga0070661_100383300 | 3300005344 | Bacteria | 1109 |
| 94 | Ga0070661_100459024 | 3300005344 | Bacteria | 1014 |
| 95 | Ga0070661_100512303 | 3300005344 | Bacteria | 961 |
| 96 | Ga0070661_101477934 | 3300005344 | Bacteria | 573 |
| 97 | Ga0070661_101593807 | 3300005344 | Bacteria | 552 |
| 98 | Ga0070661_101786665 | 3300005344 | Bacteria | 522 |
| 99 | Ga0070692_10085682 | 3300005345 | Bacteria | 1704 |
| 100 | Ga0070692_10152386 | 3300005345 | Bacteria | 1318 |
| 101 | Ga0070692_10236677 | 3300005345 | Bacteria | 1086 |
| 102 | Ga0070692_10595750 | 3300005345 | Bacteria | 730 |
| 103 | Ga0070692_11148700 | 3300005345 | Bacteria | 551 |
| 104 | Ga0070668_100254925 | 3300005347 | Bacteria | 1457 |
| 105 | Ga0070668_100802060 | 3300005347 | Bacteria | 836 |
| 106 | Ga0070668_101483884 | 3300005347 | Bacteria | 620 |
| 107 | Ga0070669_100025980 | 3300005353 | Bacteria | 4211 |
| 108 | Ga0070669_100182704 | 3300005353 | Bacteria | 1641 |
| 109 | Ga0070669_100218637 | 3300005353 | Bacteria | 1506 |
| 110 | Ga0070669_100571542 | 3300005353 | Bacteria | 944 |
| 111 | Ga0070675_100303016 | 3300005354 | Bacteria | 1408 |
| 112 | Ga0070675_100374469 | 3300005354 | Bacteria | 1266 |
| 113 | Ga0070675_101472671 | 3300005354 | Bacteria | 628 |
| 114 | Ga0070675_101610651 | 3300005354 | Bacteria | 599 |
| 115 | Ga0070675_101702594 | 3300005354 | Bacteria | 582 |
| 116 | Ga0070671_100079081 | 3300005355 | Bacteria | 2748 |
| 117 | Ga0070671_100159410 | 3300005355 | Bacteria | 1907 |
| 118 | Ga0070671_100181105 | 3300005355 | Bacteria | 1784 |
| 119 | Ga0070671_101392007 | 3300005355 | Bacteria | 620 |
| 120 | Ga0070671_101835633 | 3300005355 | Bacteria | 539 |
| 121 | Ga0070674_100075414 | 3300005356 | Bacteria | 2395 |
| 122 | Ga0070674_101764079 | 3300005356 | Bacteria | 561 |
| 123 | Ga0070674_101938091 | 3300005356 | Bacteria | 536 |
| 124 | Ga0070673_100003685 | 3300005364 | Bacteria | 9600 |
| 125 | Ga0070673_100024226 | 3300005364 | Bacteria | 4447 |
| 126 | Ga0070673_100153788 | 3300005364 | Bacteria | 1950 |
| 127 | Ga0070673_100499084 | 3300005364 | Bacteria | 1100 |
| 128 | Ga0070673_102163037 | 3300005364 | Bacteria | 529 |
| 129 | Ga0070688_100024866 | 3300005365 | Bacteria | 3539 |
| 130 | Ga0070688_100028355 | 3300005365 | Bacteria | 3341 |
| 131 | Ga0070688_100394857 | 3300005365 | Bacteria | 1022 |
| 132 | Ga0070659_100058242 | 3300005366 | Bacteria | 3048 |
| 133 | Ga0070659_100108977 | 3300005366 | Bacteria | 2234 |
| 134 | Ga0070659_100116694 | 3300005366 | Bacteria | 2158 |
| 135 | Ga0070659_100245326 | 3300005366 | Bacteria | 1483 |
| 136 | Ga0070659_100601719 | 3300005366 | Bacteria | 945 |
| 137 | Ga0070659_100915992 | 3300005366 | Bacteria | 767 |
| 138 | Ga0070659_101134747 | 3300005366 | Bacteria | 690 |
| 139 | Ga0070659_101444930 | 3300005366 | Bacteria | 612 |
| 140 | Ga0070667_100043630 | 3300005367 | Bacteria | 3764 |
| 141 | Ga0070667_100093065 | 3300005367 | Bacteria | 2595 |
| 142 | Ga0070667_100611410 | 3300005367 | Bacteria | 1005 |
| 143 | Ga0070703_10122590 | 3300005406 | Bacteria | 945 |
| 144 | Ga0070709_10006385 | 3300005434 | Bacteria | 6421 |
| 145 | Ga0070709_10036785 | 3300005434 | Bacteria | 2985 |
| 146 | Ga0070709_10171398 | 3300005434 | Bacteria | 1517 |
| 147 | Ga0070714_100000411 | 3300005435 | Bacteria | 31485 |
| 148 | Ga0070714_100139880 | 3300005435 | Bacteria | 2171 |
| 149 | Ga0070714_100462329 | 3300005435 | Bacteria | 1206 |
| 150 | Ga0070714_100710189 | 3300005435 | Bacteria | 970 |
| 151 | Ga0070713_100065550 | 3300005436 | Bacteria | 3051 |
| 152 | Ga0070713_100583856 | 3300005436 | Bacteria | 1060 |
| 153 | Ga0070713_101027119 | 3300005436 | Bacteria | 796 |
| 154 | Ga0070713_101642690 | 3300005436 | Bacteria | 624 |
| 155 | Ga0070710_10128761 | 3300005437 | Bacteria | 1541 |
| 156 | Ga0070701_10062320 | 3300005438 | Bacteria | 1969 |
| 157 | Ga0070701_10624172 | 3300005438 | Bacteria | 716 |
| 158 | Ga0070711_100034546 | 3300005439 | Bacteria | 3373 |
| 159 | Ga0070711_100079312 | 3300005439 | Bacteria | 2335 |
| 160 | Ga0070705_100020535 | 3300005440 | Bacteria | 3499 |
| 161 | Ga0070705_100090555 | 3300005440 | Bacteria | 1904 |
| 162 | Ga0070705_100169323 | 3300005440 | Bacteria | 1469 |
| 163 | Ga0070705_101704231 | 3300005440 | Bacteria | 533 |
| 164 | Ga0070700_100195386 | 3300005441 | Bacteria | 1417 |
| 165 | Ga0070700_101012060 | 3300005441 | Bacteria | 684 |
| 166 | Ga0070694_100555824 | 3300005444 | Bacteria | 919 |
| 167 | Ga0070694_100825210 | 3300005444 | Bacteria | 761 |
| 168 | Ga0070694_100977120 | 3300005444 | Bacteria | 702 |
| 169 | Ga0070694_101097517 | 3300005444 | Bacteria | 664 |
| 170 | Ga0070708_100001661 | 3300005445 | Bacteria | 17067 |
| 171 | Ga0070708_100003800 | 3300005445 | Bacteria | 11845 |
| 172 | Ga0070708_100018839 | 3300005445 | Bacteria | 5782 |
| 173 | Ga0070708_100020893 | 3300005445 | Bacteria | 5528 |
| 174 | Ga0070708_100055604 | 3300005445 | Bacteria | 3519 |
| 175 | Ga0070708_100335677 | 3300005445 | Bacteria | 1424 |
| 176 | Ga0070708_100338186 | 3300005445 | Bacteria | 1418 |
| 177 | Ga0070708_100366252 | 3300005445 | Bacteria | 1358 |
| 178 | Ga0070708_101042104 | 3300005445 | Bacteria | 767 |
| 179 | Ga0070708_101463714 | 3300005445 | Bacteria | 637 |
| 180 | Ga0070663_100005346 | 3300005455 | Bacteria | 7621 |
| 181 | Ga0070663_100094822 | 3300005455 | Bacteria | 2217 |
| 182 | Ga0070663_100798646 | 3300005455 | Bacteria | 809 |
| 183 | Ga0070663_101530009 | 3300005455 | Bacteria | 593 |
| 184 | Ga0070678_100053888 | 3300005456 | Bacteria | 2927 |
| 185 | Ga0070678_100352274 | 3300005456 | Bacteria | 1266 |
| 186 | Ga0070662_100054587 | 3300005457 | Bacteria | 2896 |
| 187 | Ga0070662_100198764 | 3300005457 | Bacteria | 1589 |
| 188 | Ga0070662_100251955 | 3300005457 | Bacteria | 1420 |
| 189 | Ga0070662_100452728 | 3300005457 | Bacteria | 1065 |
| 190 | Ga0070662_100704165 | 3300005457 | Bacteria | 855 |
| 191 | Ga0070681_10035181 | 3300005458 | Bacteria | 5031 |
| 192 | Ga0070681_10044619 | 3300005458 | Bacteria | 4438 |
| 193 | Ga0070681_10053922 | 3300005458 | Bacteria | 4006 |
| 194 | Ga0070681_10078280 | 3300005458 | Bacteria | 3263 |
| 195 | Ga0070681_10116033 | 3300005458 | Bacteria | 2615 |
| 196 | Ga0070681_10160574 | 3300005458 | Bacteria | 2171 |
| 197 | Ga0070681_10171280 | 3300005458 | Bacteria | 2093 |
| 198 | Ga0070681_10225090 | 3300005458 | Bacteria | 1790 |
| 199 | Ga0070681_10227553 | 3300005458 | Bacteria | 1779 |
| 200 | Ga0070681_10415728 | 3300005458 | Bacteria | 1256 |
| 201 | Ga0070681_10477193 | 3300005458 | Bacteria | 1160 |
| 202 | Ga0070681_10498751 | 3300005458 | Bacteria | 1130 |
| 203 | Ga0070681_10758644 | 3300005458 | Bacteria | 887 |
| 204 | Ga0070681_11130055 | 3300005458 | Bacteria | 705 |
| 205 | Ga0070681_11251139 | 3300005458 | Bacteria | 664 |
| 206 | Ga0068867_100093589 | 3300005459 | Bacteria | 2284 |
| 207 | Ga0068867_100262442 | 3300005459 | Bacteria | 1409 |
| 208 | Ga0068867_100786095 | 3300005459 | Bacteria | 847 |
| 209 | Ga0068867_101256728 | 3300005459 | Bacteria | 682 |
| 210 | Ga0068867_101331788 | 3300005459 | Bacteria | 664 |
| 211 | Ga0070685_10028108 | 3300005466 | Bacteria | 3114 |
| 212 | Ga0070685_10117314 | 3300005466 | Bacteria | 1648 |
| 213 | Ga0070685_10262680 | 3300005466 | Bacteria | 1149 |
| 214 | Ga0070706_100006592 | 3300005467 | Bacteria | 10949 |
| 215 | Ga0070706_100115208 | 3300005467 | Bacteria | 2503 |
| 216 | Ga0070706_100171538 | 3300005467 | Bacteria | 2026 |
| 217 | Ga0070706_100188726 | 3300005467 | Bacteria | 1926 |
| 218 | Ga0070706_100354241 | 3300005467 | Bacteria | 1368 |
| 219 | Ga0070706_100502739 | 3300005467 | Bacteria | 1128 |
| 220 | Ga0070707_100016356 | 3300005468 | Bacteria | 6962 |
| 221 | Ga0070707_100019047 | 3300005468 | Bacteria | 6463 |
| 222 | Ga0070707_100198999 | 3300005468 | Bacteria | 1953 |
| 223 | Ga0070707_100439225 | 3300005468 | Bacteria | 1265 |
| 224 | Ga0070707_100939600 | 3300005468 | Bacteria | 829 |
| 225 | Ga0070707_100948615 | 3300005468 | Bacteria | 825 |
| 226 | Ga0070707_100995176 | 3300005468 | Bacteria | 804 |
| 227 | Ga0070698_100001954 | 3300005471 | Bacteria | 22884 |
| 228 | Ga0070698_100024253 | 3300005471 | Bacteria | 6330 |
| 229 | Ga0070698_100030896 | 3300005471 | Bacteria | 5554 |
| 230 | Ga0070698_100052230 | 3300005471 | Bacteria | 4160 |
| 231 | Ga0070698_100466389 | 3300005471 | Bacteria | 1199 |
| 232 | Ga0070698_102150056 | 3300005471 | Bacteria | 512 |
| 233 | Ga0070699_100003912 | 3300005518 | Bacteria | 13158 |
| 234 | Ga0070699_100071160 | 3300005518 | Bacteria | 3025 |
| 235 | Ga0070699_100096501 | 3300005518 | Bacteria | 2589 |
| 236 | Ga0070699_100243299 | 3300005518 | Bacteria | 1607 |
| 237 | Ga0070699_100244307 | 3300005518 | Bacteria | 1603 |
| 238 | Ga0070699_100314429 | 3300005518 | Bacteria | 1406 |
| 239 | Ga0070699_100484652 | 3300005518 | Bacteria | 1122 |
| 240 | Ga0070699_100864240 | 3300005518 | Bacteria | 828 |
| 241 | Ga0070699_100922820 | 3300005518 | Bacteria | 800 |
| 242 | Ga0070699_101175842 | 3300005518 | Bacteria | 704 |
| 243 | Ga0070699_101184395 | 3300005518 | Bacteria | 701 |
| 244 | Ga0070699_101192268 | 3300005518 | Bacteria | 698 |
| 245 | Ga0070699_101674234 | 3300005518 | Bacteria | 583 |
| 246 | Ga0070679_100014655 | 3300005530 | Bacteria | 7534 |
| 247 | Ga0070679_100019482 | 3300005530 | Bacteria | 6597 |
| 248 | Ga0070679_100045568 | 3300005530 | Bacteria | 4370 |
| 249 | Ga0070679_100052627 | 3300005530 | Bacteria | 4054 |
| 250 | Ga0070679_100091847 | 3300005530 | Bacteria | 3023 |
| 251 | Ga0070679_100165137 | 3300005530 | Bacteria | 2187 |
| 252 | Ga0070679_100243051 | 3300005530 | Bacteria | 1757 |
| 253 | Ga0070679_100249770 | 3300005530 | Bacteria | 1730 |
| 254 | Ga0070679_100321944 | 3300005530 | Bacteria | 1495 |
| 255 | Ga0070679_100443075 | 3300005530 | Bacteria | 1243 |
| 256 | Ga0070679_100609953 | 3300005530 | Bacteria | 1034 |
| 257 | Ga0070684_100005718 | 3300005535 | Bacteria | 9552 |
| 258 | Ga0070684_100041533 | 3300005535 | Bacteria | 3965 |
| 259 | Ga0070684_100152966 | 3300005535 | Bacteria | 2091 |
| 260 | Ga0070684_100172651 | 3300005535 | Bacteria | 1964 |
| 261 | Ga0070684_100298128 | 3300005535 | Bacteria | 1479 |
| 262 | Ga0070684_100349691 | 3300005535 | Bacteria | 1359 |
| 263 | Ga0070684_100585927 | 3300005535 | Bacteria | 1036 |
| 264 | Ga0070684_100611370 | 3300005535 | Bacteria | 1014 |
| 265 | Ga0070684_100976783 | 3300005535 | Bacteria | 794 |
| 266 | Ga0070684_101063874 | 3300005535 | Bacteria | 760 |
| 267 | Ga0070697_100034669 | 3300005536 | Bacteria | 4070 |
| 268 | Ga0070697_100159646 | 3300005536 | Bacteria | 1904 |
| 269 | Ga0070697_100173667 | 3300005536 | Bacteria | 1825 |
| 270 | Ga0070697_100255073 | 3300005536 | Bacteria | 1500 |
| 271 | Ga0070697_100308839 | 3300005536 | Bacteria | 1360 |
| 272 | Ga0070697_100352424 | 3300005536 | Bacteria | 1271 |
| 273 | Ga0070697_101146138 | 3300005536 | Bacteria | 692 |
| 274 | Ga0068853_100040762 | 3300005539 | Bacteria | 3963 |
| 275 | Ga0068853_100176850 | 3300005539 | Bacteria | 1933 |
| 276 | Ga0068853_100203663 | 3300005539 | Bacteria | 1801 |
| 277 | Ga0068853_100246394 | 3300005539 | Bacteria | 1639 |
| 278 | Ga0068853_100355905 | 3300005539 | Bacteria | 1363 |
| 279 | Ga0068853_101652526 | 3300005539 | Bacteria | 621 |
| 280 | Ga0070672_100038933 | 3300005543 | Bacteria | 3637 |
| 281 | Ga0070672_100061495 | 3300005543 | Bacteria | 2960 |
| 282 | Ga0070672_100079274 | 3300005543 | Bacteria | 2628 |
| 283 | Ga0070672_100308147 | 3300005543 | Bacteria | 1343 |
| 284 | Ga0070672_100322927 | 3300005543 | Bacteria | 1312 |
| 285 | Ga0070672_102016100 | 3300005543 | Bacteria | 520 |
| 286 | Ga0070686_100247099 | 3300005544 | Bacteria | 1301 |
| 287 | Ga0070686_100365031 | 3300005544 | Bacteria | 1089 |
| 288 | Ga0070686_100481563 | 3300005544 | Bacteria | 960 |
| 289 | Ga0070695_100006011 | 3300005545 | Bacteria | 7165 |
| 290 | Ga0070695_100006164 | 3300005545 | Bacteria | 7087 |
| 291 | Ga0070695_100081722 | 3300005545 | Bacteria | 2139 |
| 292 | Ga0070695_100210430 | 3300005545 | Bacteria | 1395 |
| 293 | Ga0070695_100294995 | 3300005545 | Bacteria | 1196 |
| 294 | Ga0070695_101000870 | 3300005545 | Bacteria | 680 |
| 295 | Ga0070696_100014069 | 3300005546 | Bacteria | 5371 |
| 296 | Ga0070696_100064301 | 3300005546 | Bacteria | 2570 |
| 297 | Ga0070696_100199231 | 3300005546 | Bacteria | 1494 |
| 298 | Ga0070696_100287300 | 3300005546 | Bacteria | 1255 |
| 299 | Ga0070696_100345231 | 3300005546 | Bacteria | 1151 |
| 300 | Ga0070696_100640509 | 3300005546 | Bacteria | 861 |
| 301 | Ga0070696_100698752 | 3300005546 | Bacteria | 826 |
| 302 | Ga0070696_101931493 | 3300005546 | Bacteria | 512 |
| 303 | Ga0070693_100000799 | 3300005547 | Bacteria | 13905 |
| 304 | Ga0070693_100133923 | 3300005547 | Bacteria | 1552 |
| 305 | Ga0070693_100610723 | 3300005547 | Bacteria | 788 |
| 306 | Ga0070693_100700302 | 3300005547 | Bacteria | 741 |
| 307 | Ga0070693_100877039 | 3300005547 | Bacteria | 671 |
| 308 | Ga0070665_100124547 | 3300005548 | Bacteria | 2579 |
| 309 | Ga0070665_101359628 | 3300005548 | Bacteria | 720 |
| 310 | Ga0070665_102322188 | 3300005548 | Unclassified | 539 |
| 311 | Ga0070704_100129452 | 3300005549 | Bacteria | 1953 |
| 312 | Ga0070704_100324442 | 3300005549 | Bacteria | 1291 |
| 313 | Ga0070704_100337516 | 3300005549 | Bacteria | 1268 |
| 314 | Ga0070704_100347075 | 3300005549 | Bacteria | 1252 |
| 315 | Ga0070704_100529683 | 3300005549 | Bacteria | 1027 |
| 316 | Ga0068855_100033387 | 3300005563 | Bacteria | 6141 |
| 317 | Ga0068855_100389264 | 3300005563 | Bacteria | 1529 |
| 318 | Ga0068855_100533266 | 3300005563 | Bacteria | 1272 |
| 319 | Ga0068855_100817487 | 3300005563 | Bacteria | 989 |
| 320 | Ga0068855_101726342 | 3300005563 | Bacteria | 638 |
| 321 | Ga0068855_101906615 | 3300005563 | Bacteria | 602 |
| 322 | Ga0070664_100008033 | 3300005564 | Bacteria | 8527 |
| 323 | Ga0070664_100229505 | 3300005564 | Bacteria | 1664 |
| 324 | Ga0070664_100276901 | 3300005564 | Bacteria | 1512 |
| 325 | Ga0070664_100312256 | 3300005564 | Bacteria | 1423 |
| 326 | Ga0070664_100385803 | 3300005564 | Bacteria | 1279 |
| 327 | Ga0070664_100616820 | 3300005564 | Bacteria | 1007 |
| 328 | Ga0070664_100678751 | 3300005564 | Bacteria | 959 |
| 329 | Ga0070664_100738379 | 3300005564 | Bacteria | 918 |
| 330 | Ga0070664_102173296 | 3300005564 | Bacteria | 527 |
| 331 | Ga0068857_100009735 | 3300005577 | Bacteria | 8348 |
| 332 | Ga0068857_100024265 | 3300005577 | Bacteria | 5337 |
| 333 | Ga0068857_100205597 | 3300005577 | Bacteria | 1796 |
| 334 | Ga0068857_100306504 | 3300005577 | Bacteria | 1464 |
| 335 | Ga0068854_100008727 | 3300005578 | Bacteria | 6524 |
| 336 | Ga0068854_100013720 | 3300005578 | Bacteria | 5325 |
| 337 | Ga0068854_100069785 | 3300005578 | Bacteria | 2567 |
| 338 | Ga0068854_100168844 | 3300005578 | Bacteria | 1701 |
| 339 | Ga0068854_100999751 | 3300005578 | Bacteria | 740 |
| 340 | Ga0068854_101564314 | 3300005578 | Bacteria | 600 |
| 341 | Ga0068856_100073182 | 3300005614 | Bacteria | 3393 |
| 342 | Ga0068856_100776822 | 3300005614 | Bacteria | 978 |
| 343 | Ga0068856_100902275 | 3300005614 | Bacteria | 903 |
| 344 | Ga0070702_100251803 | 3300005615 | Bacteria | 1198 |
| 345 | Ga0070702_100499928 | 3300005615 | Bacteria | 893 |
| 346 | Ga0070702_100565489 | 3300005615 | Bacteria | 847 |
| 347 | Ga0070702_101245784 | 3300005615 | Bacteria | 602 |
| 348 | Ga0070702_101297416 | 3300005615 | Bacteria | 591 |
| 349 | Ga0068852_100026550 | 3300005616 | Bacteria | 4709 |
| 350 | Ga0068852_100029132 | 3300005616 | Bacteria | 4530 |
| 351 | Ga0068852_100241182 | 3300005616 | Bacteria | 1727 |
| 352 | Ga0068852_100495111 | 3300005616 | Bacteria | 1216 |
| 353 | Ga0068852_100622674 | 3300005616 | Bacteria | 1085 |
| 354 | Ga0068852_101294854 | 3300005616 | Bacteria | 750 |
| 355 | Ga0068852_102534548 | 3300005616 | Bacteria | 533 |
| 356 | Ga0068859_100039441 | 3300005617 | Bacteria | 4737 |
| 357 | Ga0068859_100216391 | 3300005617 | Bacteria | 2003 |
| 358 | Ga0068859_100351569 | 3300005617 | Bacteria | 1569 |
| 359 | Ga0068859_100624071 | 3300005617 | Bacteria | 1170 |
| 360 | Ga0068859_100725038 | 3300005617 | Unclassified | 1084 |
| 361 | Ga0068864_100207043 | 3300005618 | Bacteria | 1805 |
| 362 | Ga0068864_100277387 | 3300005618 | Bacteria | 1563 |
| 363 | Ga0068864_100736050 | 3300005618 | Bacteria | 965 |
| 364 | Ga0068866_10025649 | 3300005718 | Bacteria | 2773 |
| 365 | Ga0068866_10131416 | 3300005718 | Bacteria | 1424 |
| 366 | Ga0068866_10854617 | 3300005718 | Bacteria | 637 |
| 367 | Ga0068866_11036562 | 3300005718 | Bacteria | 585 |
| 368 | Ga0068861_100234025 | 3300005719 | Bacteria | 1559 |
| 369 | Ga0068861_100912461 | 3300005719 | Bacteria | 833 |
| 370 | Ga0068851_10620593 | 3300005834 | Bacteria | 659 |
| 371 | Ga0068870_10011998 | 3300005840 | Bacteria | 4034 |
| 372 | Ga0068870_10270076 | 3300005840 | Bacteria | 1062 |
| 373 | Ga0068870_10446384 | 3300005840 | Bacteria | 852 |
| 374 | Ga0068863_100037716 | 3300005841 | Bacteria | 4599 |
| 375 | Ga0068863_100119013 | 3300005841 | Bacteria | 2517 |
| 376 | Ga0068863_100223270 | 3300005841 | Bacteria | 1816 |
| 377 | Ga0068863_100276028 | 3300005841 | Bacteria | 1627 |
| 378 | Ga0068863_100284520 | 3300005841 | Bacteria | 1602 |
| 379 | Ga0068863_100525038 | 3300005841 | Bacteria | 1167 |
| 380 | Ga0068863_101634340 | 3300005841 | Bacteria | 654 |
| 381 | Ga0068863_102623373 | 3300005841 | Bacteria | 513 |
| 382 | Ga0068858_100393383 | 3300005842 | Bacteria | 1331 |
| 383 | Ga0068858_100400542 | 3300005842 | Bacteria | 1319 |
| 384 | Ga0068858_101117216 | 3300005842 | Bacteria | 774 |
| 385 | Ga0068858_101182529 | 3300005842 | Bacteria | 751 |
| 386 | Ga0068860_100530559 | 3300005843 | Bacteria | 1178 |
| 387 | Ga0068860_100708526 | 3300005843 | Bacteria | 1017 |
| 388 | Ga0068862_100513910 | 3300005844 | Bacteria | 1139 |
| 389 | Ga0068862_100624739 | 3300005844 | Bacteria | 1037 |
| 390 | Ga0068862_101218995 | 3300005844 | Bacteria | 751 |
| 391 | Ga0081455_10243169 | 3300005937 | Bacteria | 1321 |
| 392 | Ga0081455_10245504 | 3300005937 | Bacteria | 1313 |
| 393 | Ga0081538_10078237 | 3300005981 | Bacteria | 1776 |
| 394 | Ga0081539_10023333 | 3300005985 | Bacteria | 4055 |
| 395 | Ga0081539_10215463 | 3300005985 | Bacteria | 877 |
| 396 | Ga0075432_10303059 | 3300006058 | Bacteria | 664 |
| 397 | Ga0070715_10091235 | 3300006163 | Bacteria | 1402 |
| 398 | Ga0070715_10614808 | 3300006163 | Bacteria | 639 |
| 399 | Ga0070715_10781552 | 3300006163 | Bacteria | 578 |
| 400 | Ga0070716_100014957 | 3300006173 | Bacteria | 3982 |
| 401 | Ga0070716_100120125 | 3300006173 | Bacteria | 1644 |
| 402 | Ga0070716_100185223 | 3300006173 | Bacteria | 1371 |
| 403 | Ga0070712_100150856 | 3300006175 | Bacteria | 1784 |
| 404 | Ga0070712_100602962 | 3300006175 | Bacteria | 930 |
| 405 | Ga0070712_101180134 | 3300006175 | Bacteria | 666 |
| 406 | Ga0097621_100072407 | 3300006237 | Bacteria | 2850 |
| 407 | Ga0097621_100114591 | 3300006237 | Bacteria | 2281 |
| 408 | Ga0097621_101288906 | 3300006237 | Bacteria | 690 |
| 409 | Ga0068871_100188895 | 3300006358 | Bacteria | 1774 |
| 410 | Ga0068871_100349234 | 3300006358 | Bacteria | 1308 |
| 411 | Ga0068871_100524840 | 3300006358 | Bacteria | 1070 |
| 412 | Ga0068871_100790188 | 3300006358 | Unclassified | 874 |
| 413 | Ga0075428_100483856 | 3300006844 | Bacteria | 1325 |
| 414 | Ga0075428_101106268 | 3300006844 | Bacteria | 837 |
| 415 | Ga0075428_102713510 | 3300006844 | Bacteria | 505 |
| 416 | Ga0075430_100388623 | 3300006846 | Bacteria | 1151 |
| 417 | Ga0075430_101203605 | 3300006846 | Bacteria | 624 |
| 418 | Ga0075431_100066106 | 3300006847 | Bacteria | 3732 |
| 419 | Ga0075431_100132267 | 3300006847 | Bacteria | 2573 |
| 420 | Ga0075431_100445223 | 3300006847 | Bacteria | 1292 |
| 421 | Ga0075431_100446411 | 3300006847 | Bacteria | 1290 |
| 422 | Ga0075431_100679135 | 3300006847 | Bacteria | 1009 |
| 423 | Ga0075433_10014445 | 3300006852 | Bacteria | 6452 |
| 424 | Ga0075433_10017586 | 3300006852 | Bacteria | 5928 |
| 425 | Ga0075433_10048621 | 3300006852 | Bacteria | 3689 |
| 426 | Ga0075433_10082656 | 3300006852 | Bacteria | 2832 |
| 427 | Ga0075433_10453291 | 3300006852 | Bacteria | 1131 |
| 428 | Ga0075433_10475033 | 3300006852 | Bacteria | 1101 |
| 429 | Ga0075434_100039856 | 3300006871 | Bacteria | 4652 |
| 430 | Ga0075434_100056118 | 3300006871 | Bacteria | 3914 |
| 431 | Ga0075434_100293178 | 3300006871 | Bacteria | 1647 |
| 432 | Ga0075434_100411482 | 3300006871 | Bacteria | 1373 |
| 433 | Ga0075434_100623359 | 3300006871 | Bacteria | 1097 |
| 434 | Ga0075434_100881444 | 3300006871 | Bacteria | 910 |
| 435 | Ga0075429_100019213 | 3300006880 | Bacteria | 5920 |
| 436 | Ga0075429_100181478 | 3300006880 | Bacteria | 1844 |
| 437 | Ga0075429_100278121 | 3300006880 | Bacteria | 1466 |
| 438 | Ga0075429_101064640 | 3300006880 | Bacteria | 707 |
| 439 | Ga0068865_100094461 | 3300006881 | Bacteria | 2176 |
| 440 | Ga0068865_100136783 | 3300006881 | Bacteria | 1842 |
| 441 | Ga0068865_100273628 | 3300006881 | Bacteria | 1342 |
| 442 | Ga0068865_100787660 | 3300006881 | Bacteria | 819 |
| 443 | Ga0068865_100999212 | 3300006881 | Bacteria | 732 |
| 444 | Ga0075436_100000105 | 3300006914 | Bacteria | 50007 |
| 445 | Ga0075436_100011027 | 3300006914 | Bacteria | 6202 |
| 446 | Ga0075436_100034048 | 3300006914 | Bacteria | 3511 |
| 447 | Ga0075436_100145157 | 3300006914 | Bacteria | 1668 |
| 448 | Ga0075436_100293565 | 3300006914 | Bacteria | 1164 |
| 449 | Ga0075436_100506269 | 3300006914 | Bacteria | 884 |
| 450 | Ga0097620_100039441 | 3300006931 | Bacteria | 4737 |
| 451 | Ga0097620_100216397 | 3300006931 | Bacteria | 2003 |
| 452 | Ga0097620_100351562 | 3300006931 | Bacteria | 1569 |
| 453 | Ga0097620_100624048 | 3300006931 | Bacteria | 1170 |
| 454 | Ga0097620_100725107 | 3300006931 | Unclassified | 1084 |
| 455 | Ga0075435_100039577 | 3300007076 | Bacteria | 3762 |
| 456 | Ga0075435_100093480 | 3300007076 | Bacteria | 2485 |
| 457 | Ga0075435_100458431 | 3300007076 | Bacteria | 1100 |
| 458 | Ga0075435_101173550 | 3300007076 | Bacteria | 672 |
| 459 | Ga0075435_101207494 | 3300007076 | Bacteria | 662 |
| 460 | Ga0075435_101501941 | 3300007076 | Bacteria | 591 |
| 461 | Ga0099794_10232222 | 3300007265 | Bacteria | 949 |
| 462 | Ga0099794_10235798 | 3300007265 | Bacteria | 942 |
| 463 | Ga0099794_10805773 | 3300007265 | Bacteria | 502 |
| 464 | Ga0099795_10031621 | 3300007788 | Bacteria | 1824 |
| 465 | Ga0105240_10101231 | 3300009093 | Bacteria | 3505 |
| 466 | Ga0105240_10106067 | 3300009093 | Bacteria | 3409 |
| 467 | Ga0105240_10377512 | 3300009093 | Bacteria | 1601 |
| 468 | Ga0105240_11405854 | 3300009093 | Bacteria | 733 |
| 469 | Ga0105240_12715848 | 3300009093 | Bacteria | 510 |
| 470 | Ga0111539_10250172 | 3300009094 | Bacteria | 2064 |
| 471 | Ga0111539_10296278 | 3300009094 | Bacteria | 1882 |
| 472 | Ga0111539_10875500 | 3300009094 | Bacteria | 1045 |
| 473 | Ga0111539_12150536 | 3300009094 | Bacteria | 647 |
| 474 | Ga0105245_10094704 | 3300009098 | Bacteria | 2753 |
| 475 | Ga0105245_10155732 | 3300009098 | Bacteria | 2164 |
| 476 | Ga0105245_10219981 | 3300009098 | Bacteria | 1832 |
| 477 | Ga0105245_10429375 | 3300009098 | Bacteria | 1326 |
| 478 | Ga0105245_10470338 | 3300009098 | Bacteria | 1269 |
| 479 | Ga0105245_10564960 | 3300009098 | Bacteria | 1161 |
| 480 | Ga0105245_11336780 | 3300009098 | Bacteria | 766 |
| 481 | Ga0105245_11604509 | 3300009098 | Bacteria | 702 |
| 482 | Ga0105247_10723337 | 3300009101 | Bacteria | 752 |
| 483 | Ga0114129_10032671 | 3300009147 | Bacteria | 7353 |
| 484 | Ga0114129_10074165 | 3300009147 | Bacteria | 4740 |
| 485 | Ga0114129_10442964 | 3300009147 | Bacteria | 1705 |
| 486 | Ga0114129_10603869 | 3300009147 | Bacteria | 1421 |
| 487 | Ga0114129_10768010 | 3300009147 | Bacteria | 1232 |
| 488 | Ga0114129_10794816 | 3300009147 | Bacteria | 1207 |
| 489 | Ga0114129_10971514 | 3300009147 | Bacteria | 1071 |
| 490 | Ga0105243_10345671 | 3300009148 | Bacteria | 1364 |
| 491 | Ga0105243_10657686 | 3300009148 | Bacteria | 1016 |
| 492 | Ga0105243_10911407 | 3300009148 | Bacteria | 875 |
| 493 | Ga0105243_12099905 | 3300009148 | Bacteria | 601 |
| 494 | Ga0105243_12447293 | 3300009148 | Bacteria | 561 |
| 495 | Ga0105241_10146778 | 3300009174 | Bacteria | 1925 |
| 496 | Ga0105241_10357475 | 3300009174 | Bacteria | 1270 |
| 497 | Ga0105242_10149144 | 3300009176 | Bacteria | 2038 |
| 498 | Ga0105242_11282820 | 3300009176 | Bacteria | 755 |
| 499 | Ga0105248_10122714 | 3300009177 | Bacteria | 2931 |
| 500 | Ga0105248_10322129 | 3300009177 | Bacteria | 1741 |
| 501 | Ga0105248_10673931 | 3300009177 | Bacteria | 1167 |
| 502 | Ga0105248_11222903 | 3300009177 | Bacteria | 849 |
| 503 | Ga0105248_11563113 | 3300009177 | Bacteria | 747 |
| 504 | Ga0105248_12130074 | 3300009177 | Bacteria | 638 |
| 505 | Ga0105248_12276975 | 3300009177 | Bacteria | 617 |
| 506 | Ga0105237_10688214 | 3300009545 | Bacteria | 1029 |
| 507 | Ga0105237_11180422 | 3300009545 | Bacteria | 772 |
| 508 | Ga0105238_10074647 | 3300009551 | Bacteria | 3383 |
| 509 | Ga0105238_10911998 | 3300009551 | Bacteria | 897 |
| 510 | Ga0105238_11817297 | 3300009551 | Bacteria | 641 |
| 511 | Ga0105249_10747690 | 3300009553 | Bacteria | 1040 |
| 512 | Ga0105249_10974948 | 3300009553 | Bacteria | 916 |
| 513 | Ga0105239_10977094 | 3300010375 | Bacteria | 973 |
| 514 | Ga0105239_11728858 | 3300010375 | Bacteria | 724 |
| 515 | Ga0105239_13235952 | 3300010375 | Bacteria | 530 |
| 516 | Ga0105246_10135906 | 3300011119 | Bacteria | 1843 |
| 517 | Ga0157318_1028166 | 3300012482 | Bacteria | 541 |
| 518 | Ga0157341_1042080 | 3300012494 | Bacteria | 532 |
| 519 | Ga0157323_1004571 | 3300012495 | Bacteria | 891 |
| 520 | Ga0157339_1028615 | 3300012505 | Bacteria | 639 |
| 521 | Ga0157342_1020734 | 3300012507 | Bacteria | 762 |
| 522 | Ga0157316_1015673 | 3300012510 | Bacteria | 770 |
| 523 | Ga0157373_10075094 | 3300013100 | Bacteria | 2385 |
| 524 | Ga0157373_10107506 | 3300013100 | Bacteria | 1961 |
| 525 | Ga0157373_10134672 | 3300013100 | Bacteria | 1737 |
| 526 | Ga0157373_10261289 | 3300013100 | Bacteria | 1225 |
| 527 | Ga0157371_10502250 | 3300013102 | Bacteria | 896 |
| 528 | Ga0157371_11376732 | 3300013102 | Bacteria | 547 |
| 529 | Ga0157370_10006391 | 3300013104 | Bacteria | 13004 |
| 530 | Ga0157370_10051328 | 3300013104 | Bacteria | 3939 |
| 531 | Ga0157370_10284510 | 3300013104 | Bacteria | 1527 |
| 532 | Ga0157370_10885631 | 3300013104 | Bacteria | 810 |
| 533 | Ga0157370_11354269 | 3300013104 | Bacteria | 641 |
| 534 | Ga0157370_11584828 | 3300013104 | Bacteria | 588 |
| 535 | Ga0157369_10129033 | 3300013105 | Bacteria | 2680 |
| 536 | Ga0157369_10360263 | 3300013105 | Bacteria | 1510 |
| 537 | Ga0157369_10966313 | 3300013105 | Bacteria | 873 |
| 538 | Ga0157369_11050120 | 3300013105 | Bacteria | 833 |
| 539 | Ga0157369_12520277 | 3300013105 | Bacteria | 521 |
| 540 | Ga0157374_10841745 | 3300013296 | Bacteria | 934 |
| 541 | Ga0157374_10938383 | 3300013296 | Bacteria | 884 |
| 542 | Ga0157374_11612879 | 3300013296 | Bacteria | 673 |
| 543 | Ga0157374_11672773 | 3300013296 | Bacteria | 661 |
| 544 | Ga0157378_10107312 | 3300013297 | Bacteria | 2555 |
| 545 | Ga0157378_10168578 | 3300013297 | Bacteria | 2052 |
| 546 | Ga0157378_10392433 | 3300013297 | Bacteria | 1365 |
| 547 | Ga0157378_10924224 | 3300013297 | Bacteria | 904 |
| 548 | Ga0157378_11111228 | 3300013297 | Bacteria | 828 |
| 549 | Ga0157378_11206617 | 3300013297 | Bacteria | 796 |
| 550 | Ga0157378_11286448 | 3300013297 | Bacteria | 772 |
| 551 | Ga0157378_11793893 | 3300013297 | Bacteria | 662 |
| 552 | Ga0157378_12350404 | 3300013297 | Bacteria | 585 |
| 553 | Ga0157378_12778686 | 3300013297 | Bacteria | 542 |
| 554 | Ga0163162_10771069 | 3300013306 | Bacteria | 1080 |
| 555 | Ga0163162_10942245 | 3300013306 | Bacteria | 975 |
| 556 | Ga0163162_11353130 | 3300013306 | Bacteria | 810 |
| 557 | Ga0163162_12210203 | 3300013306 | Bacteria | 632 |
| 558 | Ga0163162_12562676 | 3300013306 | Bacteria | 587 |
| 559 | Ga0157372_10353040 | 3300013307 | Bacteria | 1713 |
| 560 | Ga0157372_10360783 | 3300013307 | Bacteria | 1693 |
| 561 | Ga0157372_10398247 | 3300013307 | Bacteria | 1604 |
| 562 | Ga0157372_10437193 | 3300013307 | Bacteria | 1525 |
| 563 | Ga0157372_10438515 | 3300013307 | Bacteria | 1522 |
| 564 | Ga0157372_10707076 | 3300013307 | Bacteria | 1173 |
| 565 | Ga0157372_11176516 | 3300013307 | Bacteria | 886 |
| 566 | Ga0157372_11335691 | 3300013307 | Bacteria | 827 |
| 567 | Ga0157372_11876377 | 3300013307 | Bacteria | 689 |
| 568 | Ga0157372_12916985 | 3300013307 | Bacteria | 547 |
| 569 | Ga0157372_13205857 | 3300013307 | Bacteria | 522 |
| 570 | Ga0157375_10470699 | 3300013308 | Unclassified | 1422 |
| 571 | Ga0157375_10773256 | 3300013308 | Bacteria | 1110 |
| 572 | Ga0157375_12065547 | 3300013308 | Bacteria | 678 |
| 573 | Ga0163163_10308590 | 3300014325 | Bacteria | 1635 |
| 574 | Ga0163163_10308637 | 3300014325 | Bacteria | 1635 |
| 575 | Ga0163163_10395870 | 3300014325 | Bacteria | 1439 |
| 576 | Ga0163163_10833141 | 3300014325 | Bacteria | 986 |
| 577 | Ga0163163_11090999 | 3300014325 | Bacteria | 861 |
| 578 | Ga0157380_11276920 | 3300014326 | Bacteria | 781 |
| 579 | Ga0157380_13177473 | 3300014326 | Bacteria | 524 |
| 580 | Ga0182008_10006718 | 3300014497 | Bacteria | 6404 |
| 581 | Ga0157377_10220127 | 3300014745 | Bacteria | 1215 |
| 582 | Ga0157379_10648203 | 3300014968 | Bacteria | 989 |
| 583 | Ga0157379_11019995 | 3300014968 | Bacteria | 789 |
| 584 | Ga0157379_11275611 | 3300014968 | Bacteria | 709 |
| 585 | Ga0157379_11425219 | 3300014968 | Bacteria | 672 |
| 586 | Ga0157379_12463332 | 3300014968 | Bacteria | 520 |
| 587 | Ga0157376_10346309 | 3300014969 | Bacteria | 1421 |
| 588 | Ga0157376_10688632 | 3300014969 | Bacteria | 1026 |
| 589 | Ga0157376_10976839 | 3300014969 | Bacteria | 868 |
| 590 | Ga0157376_12139206 | 3300014969 | Bacteria | 598 |
| 591 | Ga0157376_13037862 | 3300014969 | Bacteria | 508 |
| 592 | Ga0182007_10245076 | 3300015262 | Bacteria | 641 |
| 593 | Ga0163161_10184027 | 3300017792 | Bacteria | 1603 |
| 594 | Ga0163161_10551308 | 3300017792 | Unclassified | 945 |
| 595 | Ga0163161_12037071 | 3300017792 | Bacteria | 510 |
| 596 | Ga0206356_11621450 | 3300020070 | Bacteria | 820 |
| 597 | Ga0206349_1309757 | 3300020075 | Bacteria | 563 |
| 598 | Ga0213876_10010709 | 3300021384 | Bacteria | 4913 |
| 599 | Ga0213876_10244513 | 3300021384 | Bacteria | 953 |
| 600 | Ga0213876_10253805 | 3300021384 | Bacteria | 935 |
| 601 | Ga0207666_1023196 | 3300025271 | Bacteria | 922 |
| 602 | Ga0207697_10011385 | 3300025315 | Bacteria | 3763 |
| 603 | Ga0207656_10283209 | 3300025321 | Bacteria | 818 |
| 604 | Ga0207682_10016764 | 3300025893 | Bacteria | 2859 |
| 605 | Ga0207692_10077555 | 3300025898 | Bacteria | 1768 |
| 606 | Ga0207642_10008208 | 3300025899 | Bacteria | 3569 |
| 607 | Ga0207642_10469862 | 3300025899 | Bacteria | 765 |
| 608 | Ga0207642_10568459 | 3300025899 | Bacteria | 702 |
| 609 | Ga0207642_10642395 | 3300025899 | Bacteria | 664 |
| 610 | Ga0207688_10027380 | 3300025901 | Bacteria | 3136 |
| 611 | Ga0207688_10684318 | 3300025901 | Bacteria | 648 |
| 612 | Ga0207680_10025729 | 3300025903 | Bacteria | 3250 |
| 613 | Ga0207680_10125424 | 3300025903 | Bacteria | 1685 |
| 614 | Ga0207680_10351990 | 3300025903 | Bacteria | 1035 |
| 615 | Ga0207685_10030303 | 3300025905 | Bacteria | 1924 |
| 616 | Ga0207699_10001230 | 3300025906 | Bacteria | 12159 |
| 617 | Ga0207699_10044660 | 3300025906 | Bacteria | 2580 |
| 618 | Ga0207699_10127954 | 3300025906 | Bacteria | 1652 |
| 619 | Ga0207699_10560054 | 3300025906 | Bacteria | 830 |
| 620 | Ga0207645_10018114 | 3300025907 | Bacteria | 4642 |
| 621 | Ga0207645_10185904 | 3300025907 | Bacteria | 1364 |
| 622 | Ga0207645_10193216 | 3300025907 | Bacteria | 1338 |
| 623 | Ga0207643_10003364 | 3300025908 | Bacteria | 8615 |
| 624 | Ga0207643_10281215 | 3300025908 | Bacteria | 1032 |
| 625 | Ga0207705_10027229 | 3300025909 | Bacteria | 4075 |
| 626 | Ga0207705_10029211 | 3300025909 | Bacteria | 3930 |
| 627 | Ga0207705_10031424 | 3300025909 | Bacteria | 3790 |
| 628 | Ga0207705_10278431 | 3300025909 | Bacteria | 1280 |
| 629 | Ga0207705_10461503 | 3300025909 | Bacteria | 985 |
| 630 | Ga0207705_10694084 | 3300025909 | Bacteria | 791 |
| 631 | Ga0207684_10022976 | 3300025910 | Bacteria | 5326 |
| 632 | Ga0207684_10199408 | 3300025910 | Bacteria | 1726 |
| 633 | Ga0207684_10321730 | 3300025910 | Bacteria | 1333 |
| 634 | Ga0207684_10460484 | 3300025910 | Bacteria | 1091 |
| 635 | Ga0207684_10466072 | 3300025910 | Bacteria | 1084 |
| 636 | Ga0207684_11038716 | 3300025910 | Bacteria | 684 |
| 637 | Ga0207654_10028743 | 3300025911 | Bacteria | 3034 |
| 638 | Ga0207707_10004257 | 3300025912 | Bacteria | 12664 |
| 639 | Ga0207707_10020853 | 3300025912 | Bacteria | 5725 |
| 640 | Ga0207707_10041250 | 3300025912 | Bacteria | 4031 |
| 641 | Ga0207707_10068861 | 3300025912 | Bacteria | 3084 |
| 642 | Ga0207707_10075446 | 3300025912 | Bacteria | 2942 |
| 643 | Ga0207707_10097923 | 3300025912 | Bacteria | 2564 |
| 644 | Ga0207707_10627301 | 3300025912 | Bacteria | 908 |
| 645 | Ga0207707_10784898 | 3300025912 | Bacteria | 794 |
| 646 | Ga0207707_10861232 | 3300025912 | Bacteria | 751 |
| 647 | Ga0207707_11104162 | 3300025912 | Bacteria | 646 |
| 648 | Ga0207695_10004617 | 3300025913 | Bacteria | 18682 |
| 649 | Ga0207695_10013424 | 3300025913 | Bacteria | 9771 |
| 650 | Ga0207695_10070341 | 3300025913 | Bacteria | 3578 |
| 651 | Ga0207695_10226195 | 3300025913 | Bacteria | 1777 |
| 652 | Ga0207671_10127670 | 3300025914 | Bacteria | 1950 |
| 653 | Ga0207671_11569578 | 3300025914 | Bacteria | 507 |
| 654 | Ga0207693_10130240 | 3300025915 | Bacteria | 1977 |
| 655 | Ga0207693_10177031 | 3300025915 | Bacteria | 1678 |
| 656 | Ga0207693_10182171 | 3300025915 | Bacteria | 1653 |
| 657 | Ga0207693_10361372 | 3300025915 | Bacteria | 1136 |
| 658 | Ga0207693_10440034 | 3300025915 | Bacteria | 1019 |
| 659 | Ga0207693_10488937 | 3300025915 | Bacteria | 961 |
| 660 | Ga0207663_10008487 | 3300025916 | Bacteria | 5375 |
| 661 | Ga0207663_10073763 | 3300025916 | Bacteria | 2210 |
| 662 | Ga0207663_10511946 | 3300025916 | Bacteria | 934 |
| 663 | Ga0207663_10892089 | 3300025916 | Bacteria | 711 |
| 664 | Ga0207660_10004139 | 3300025917 | Bacteria | 9438 |
| 665 | Ga0207660_10032435 | 3300025917 | Bacteria | 3605 |
| 666 | Ga0207660_10044376 | 3300025917 | Bacteria | 3128 |
| 667 | Ga0207660_10046045 | 3300025917 | Bacteria | 3077 |
| 668 | Ga0207660_10088243 | 3300025917 | Bacteria | 2293 |
| 669 | Ga0207660_10097907 | 3300025917 | Bacteria | 2187 |
| 670 | Ga0207660_10168557 | 3300025917 | Bacteria | 1694 |
| 671 | Ga0207660_10478573 | 3300025917 | Bacteria | 1009 |
| 672 | Ga0207660_10681750 | 3300025917 | Bacteria | 838 |
| 673 | Ga0207660_11266911 | 3300025917 | Bacteria | 599 |
| 674 | Ga0207662_10007104 | 3300025918 | Bacteria | 6083 |
| 675 | Ga0207662_10037541 | 3300025918 | Bacteria | 2835 |
| 676 | Ga0207662_10185746 | 3300025918 | Bacteria | 1339 |
| 677 | Ga0207662_10247582 | 3300025918 | Bacteria | 1169 |
| 678 | Ga0207662_10304538 | 3300025918 | Bacteria | 1060 |
| 679 | Ga0207662_10722687 | 3300025918 | Bacteria | 699 |
| 680 | Ga0207657_10001138 | 3300025919 | Bacteria | 28229 |
| 681 | Ga0207657_10047239 | 3300025919 | Bacteria | 3765 |
| 682 | Ga0207657_10133641 | 3300025919 | Bacteria | 2032 |
| 683 | Ga0207657_10281579 | 3300025919 | Bacteria | 1320 |
| 684 | Ga0207657_10553571 | 3300025919 | Bacteria | 899 |
| 685 | Ga0207649_10025188 | 3300025920 | Bacteria | 3466 |
| 686 | Ga0207649_10032190 | 3300025920 | Bacteria | 3124 |
| 687 | Ga0207649_10058649 | 3300025920 | Bacteria | 2411 |
| 688 | Ga0207649_10118913 | 3300025920 | Bacteria | 1778 |
| 689 | Ga0207649_10167119 | 3300025920 | Bacteria | 1529 |
| 690 | Ga0207649_10178625 | 3300025920 | Bacteria | 1484 |
| 691 | Ga0207649_10525517 | 3300025920 | Bacteria | 903 |
| 692 | Ga0207649_10526993 | 3300025920 | Bacteria | 901 |
| 693 | Ga0207649_11091551 | 3300025920 | Bacteria | 629 |
| 694 | Ga0207652_10011077 | 3300025921 | Bacteria | 7269 |
| 695 | Ga0207652_10012004 | 3300025921 | Bacteria | 6992 |
| 696 | Ga0207652_10042922 | 3300025921 | Bacteria | 3850 |
| 697 | Ga0207652_10065009 | 3300025921 | Bacteria | 3157 |
| 698 | Ga0207652_10093206 | 3300025921 | Bacteria | 2650 |
| 699 | Ga0207652_10180913 | 3300025921 | Bacteria | 1895 |
| 700 | Ga0207652_10261717 | 3300025921 | Bacteria | 1560 |
| 701 | Ga0207652_10261985 | 3300025921 | Bacteria | 1559 |
| 702 | Ga0207652_10324641 | 3300025921 | Bacteria | 1390 |
| 703 | Ga0207652_10444285 | 3300025921 | Bacteria | 1169 |
| 704 | Ga0207652_10539114 | 3300025921 | Bacteria | 1049 |
| 705 | Ga0207652_10917515 | 3300025921 | Bacteria | 773 |
| 706 | Ga0207652_10968089 | 3300025921 | Bacteria | 749 |
| 707 | Ga0207646_10019243 | 3300025922 | Bacteria | 6348 |
| 708 | Ga0207646_10035672 | 3300025922 | Bacteria | 4491 |
| 709 | Ga0207646_10103586 | 3300025922 | Bacteria | 2552 |
| 710 | Ga0207646_10409012 | 3300025922 | Bacteria | 1225 |
| 711 | Ga0207646_10473825 | 3300025922 | Bacteria | 1129 |
| 712 | Ga0207646_10536794 | 3300025922 | Bacteria | 1052 |
| 713 | Ga0207646_11799240 | 3300025922 | Bacteria | 524 |
| 714 | Ga0207681_10068781 | 3300025923 | Bacteria | 2461 |
| 715 | Ga0207681_10085457 | 3300025923 | Bacteria | 2239 |
| 716 | Ga0207681_10205225 | 3300025923 | Bacteria | 1515 |
| 717 | Ga0207681_10544386 | 3300025923 | Bacteria | 955 |
| 718 | Ga0207681_10545758 | 3300025923 | Bacteria | 953 |
| 719 | Ga0207694_10026946 | 3300025924 | Bacteria | 4377 |
| 720 | Ga0207694_10248765 | 3300025924 | Bacteria | 1454 |
| 721 | Ga0207694_10275749 | 3300025924 | Bacteria | 1380 |
| 722 | Ga0207694_10843780 | 3300025924 | Bacteria | 774 |
| 723 | Ga0207650_10010393 | 3300025925 | Bacteria | 6382 |
| 724 | Ga0207650_10249865 | 3300025925 | Bacteria | 1435 |
| 725 | Ga0207650_11374444 | 3300025925 | Bacteria | 601 |
| 726 | Ga0207659_10022346 | 3300025926 | Bacteria | 4211 |
| 727 | Ga0207659_10208752 | 3300025926 | Bacteria | 1564 |
| 728 | Ga0207659_10218655 | 3300025926 | Bacteria | 1530 |
| 729 | Ga0207659_10497834 | 3300025926 | Bacteria | 1031 |
| 730 | Ga0207659_11195230 | 3300025926 | Bacteria | 654 |
| 731 | Ga0207659_11694803 | 3300025926 | Bacteria | 538 |
| 732 | Ga0207687_10075869 | 3300025927 | Bacteria | 2414 |
| 733 | Ga0207687_10136950 | 3300025927 | Bacteria | 1853 |
| 734 | Ga0207687_10400629 | 3300025927 | Bacteria | 1129 |
| 735 | Ga0207687_11183420 | 3300025927 | Bacteria | 657 |
| 736 | Ga0207687_11722786 | 3300025927 | Bacteria | 537 |
| 737 | Ga0207700_10087723 | 3300025928 | Bacteria | 2447 |
| 738 | Ga0207700_10483316 | 3300025928 | Bacteria | 1094 |
| 739 | Ga0207664_10000099 | 3300025929 | Bacteria | 80206 |
| 740 | Ga0207664_10012437 | 3300025929 | Bacteria | 6084 |
| 741 | Ga0207664_10420601 | 3300025929 | Bacteria | 1190 |
| 742 | Ga0207664_11970421 | 3300025929 | Bacteria | 507 |
| 743 | Ga0207644_10227703 | 3300025931 | Bacteria | 1480 |
| 744 | Ga0207644_10490086 | 3300025931 | Bacteria | 1013 |
| 745 | Ga0207644_10860658 | 3300025931 | Bacteria | 759 |
| 746 | Ga0207644_11627165 | 3300025931 | Bacteria | 541 |
| 747 | Ga0207690_10070701 | 3300025932 | Bacteria | 2405 |
| 748 | Ga0207690_10076401 | 3300025932 | Bacteria | 2325 |
| 749 | Ga0207690_10207916 | 3300025932 | Bacteria | 1490 |
| 750 | Ga0207706_10075992 | 3300025933 | Bacteria | 2955 |
| 751 | Ga0207706_10150224 | 3300025933 | Bacteria | 2049 |
| 752 | Ga0207706_10535245 | 3300025933 | Bacteria | 1009 |
| 753 | Ga0207706_10556469 | 3300025933 | Bacteria | 987 |
| 754 | Ga0207706_11007915 | 3300025933 | Bacteria | 699 |
| 755 | Ga0207706_11353459 | 3300025933 | Bacteria | 586 |
| 756 | Ga0207686_10060773 | 3300025934 | Bacteria | 2393 |
| 757 | Ga0207686_11131820 | 3300025934 | Bacteria | 639 |
| 758 | Ga0207686_11331536 | 3300025934 | Bacteria | 590 |
| 759 | Ga0207709_10081832 | 3300025935 | Bacteria | 2083 |
| 760 | Ga0207709_11327797 | 3300025935 | Bacteria | 595 |
| 761 | Ga0207670_10004353 | 3300025936 | Bacteria | 7611 |
| 762 | Ga0207670_10018648 | 3300025936 | Bacteria | 4224 |
| 763 | Ga0207670_10107499 | 3300025936 | Bacteria | 2003 |
| 764 | Ga0207670_10301182 | 3300025936 | Bacteria | 1255 |
| 765 | Ga0207670_11139326 | 3300025936 | Bacteria | 659 |
| 766 | Ga0207670_11928134 | 3300025936 | Bacteria | 502 |
| 767 | Ga0207669_10346609 | 3300025937 | Bacteria | 1146 |
| 768 | Ga0207669_10350187 | 3300025937 | Bacteria | 1141 |
| 769 | Ga0207669_11052314 | 3300025937 | Bacteria | 685 |
| 770 | Ga0207704_10040337 | 3300025938 | Bacteria | 2727 |
| 771 | Ga0207704_11302836 | 3300025938 | Bacteria | 621 |
| 772 | Ga0207704_11365406 | 3300025938 | Bacteria | 607 |
| 773 | Ga0207665_10021871 | 3300025939 | Bacteria | 4206 |
| 774 | Ga0207665_10024947 | 3300025939 | Bacteria | 3943 |
| 775 | Ga0207665_10097926 | 3300025939 | Bacteria | 2043 |
| 776 | Ga0207665_10197621 | 3300025939 | Bacteria | 1464 |
| 777 | Ga0207665_11293580 | 3300025939 | Bacteria | 581 |
| 778 | Ga0207691_10032808 | 3300025940 | Bacteria | 4839 |
| 779 | Ga0207691_10046795 | 3300025940 | Bacteria | 3973 |
| 780 | Ga0207691_10153386 | 3300025940 | Bacteria | 2025 |
| 781 | Ga0207691_10322355 | 3300025940 | Bacteria | 1325 |
| 782 | Ga0207711_10183645 | 3300025941 | Bacteria | 1903 |
| 783 | Ga0207711_11200148 | 3300025941 | Bacteria | 700 |
| 784 | Ga0207711_11895670 | 3300025941 | Bacteria | 539 |
| 785 | Ga0207711_12060576 | 3300025941 | Bacteria | 513 |
| 786 | Ga0207689_10019641 | 3300025942 | Bacteria | 5694 |
| 787 | Ga0207689_10053633 | 3300025942 | Bacteria | 3322 |
| 788 | Ga0207689_10123876 | 3300025942 | Bacteria | 2126 |
| 789 | Ga0207661_10001907 | 3300025944 | Bacteria | 14301 |
| 790 | Ga0207661_10004866 | 3300025944 | Bacteria | 9413 |
| 791 | Ga0207661_10047859 | 3300025944 | Bacteria | 3396 |
| 792 | Ga0207661_10179812 | 3300025944 | Bacteria | 1847 |
| 793 | Ga0207661_11788099 | 3300025944 | Bacteria | 560 |
| 794 | Ga0207679_10002650 | 3300025945 | Bacteria | 11044 |
| 795 | Ga0207679_10192419 | 3300025945 | Bacteria | 1697 |
| 796 | Ga0207679_10218788 | 3300025945 | Bacteria | 1601 |
| 797 | Ga0207679_10314992 | 3300025945 | Bacteria | 1353 |
| 798 | Ga0207679_10316793 | 3300025945 | Bacteria | 1349 |
| 799 | Ga0207679_10741175 | 3300025945 | Bacteria | 893 |
| 800 | Ga0207679_10752364 | 3300025945 | Bacteria | 886 |
| 801 | Ga0207679_10822952 | 3300025945 | Bacteria | 847 |
| 802 | Ga0207679_10872568 | 3300025945 | Bacteria | 822 |
| 803 | Ga0207679_11249370 | 3300025945 | Bacteria | 682 |
| 804 | Ga0207679_11269312 | 3300025945 | Bacteria | 676 |
| 805 | Ga0207679_12086469 | 3300025945 | Bacteria | 515 |
| 806 | Ga0207679_12138210 | 3300025945 | Bacteria | 508 |
| 807 | Ga0207667_10034763 | 3300025949 | Bacteria | 5409 |
| 808 | Ga0207667_10658021 | 3300025949 | Bacteria | 1053 |
| 809 | Ga0207667_11478457 | 3300025949 | Bacteria | 651 |
| 810 | Ga0207667_12081101 | 3300025949 | Bacteria | 526 |
| 811 | Ga0207651_10021908 | 3300025960 | Bacteria | 3893 |
| 812 | Ga0207651_10036217 | 3300025960 | Bacteria | 3219 |
| 813 | Ga0207651_10071067 | 3300025960 | Bacteria | 2465 |
| 814 | Ga0207651_10128156 | 3300025960 | Bacteria | 1937 |
| 815 | Ga0207651_10173474 | 3300025960 | Bacteria | 1703 |
| 816 | Ga0207712_10675161 | 3300025961 | Bacteria | 900 |
| 817 | Ga0207668_10281849 | 3300025972 | Bacteria | 1363 |
| 818 | Ga0207668_10808508 | 3300025972 | Bacteria | 830 |
| 819 | Ga0207640_10001854 | 3300025981 | Bacteria | 11325 |
| 820 | Ga0207640_10129033 | 3300025981 | Bacteria | 1825 |
| 821 | Ga0207640_10238690 | 3300025981 | Bacteria | 1403 |
| 822 | Ga0207640_10280376 | 3300025981 | Bacteria | 1309 |
| 823 | Ga0207640_10583783 | 3300025981 | Bacteria | 944 |
| 824 | Ga0207640_10719024 | 3300025981 | Bacteria | 858 |
| 825 | Ga0207658_11026684 | 3300025986 | Bacteria | 752 |
| 826 | Ga0207658_12005943 | 3300025986 | Bacteria | 527 |
| 827 | Ga0207677_10012623 | 3300026023 | Bacteria | 4866 |
| 828 | Ga0207677_10058774 | 3300026023 | Bacteria | 2649 |
| 829 | Ga0207677_10092972 | 3300026023 | Bacteria | 2197 |
| 830 | Ga0207677_10216912 | 3300026023 | Bacteria | 1532 |
| 831 | Ga0207677_10287200 | 3300026023 | Bacteria | 1353 |
| 832 | Ga0207677_10416302 | 3300026023 | Bacteria | 1143 |
| 833 | Ga0207703_11017431 | 3300026035 | Bacteria | 795 |
| 834 | Ga0207703_12206895 | 3300026035 | Bacteria | 526 |
| 835 | Ga0207639_10002689 | 3300026041 | Bacteria | 11930 |
| 836 | Ga0207639_10051893 | 3300026041 | Bacteria | 3122 |
| 837 | Ga0207639_10204557 | 3300026041 | Bacteria | 1695 |
| 838 | Ga0207639_10217878 | 3300026041 | Bacteria | 1647 |
| 839 | Ga0207639_10798015 | 3300026041 | Bacteria | 880 |
| 840 | Ga0207639_11176347 | 3300026041 | Bacteria | 720 |
| 841 | Ga0207639_11760032 | 3300026041 | Bacteria | 580 |
| 842 | Ga0207678_10012023 | 3300026067 | Bacteria | 7601 |
| 843 | Ga0207678_10076305 | 3300026067 | Bacteria | 2871 |
| 844 | Ga0207678_11960182 | 3300026067 | Bacteria | 510 |
| 845 | Ga0207708_10112088 | 3300026075 | Bacteria | 2118 |
| 846 | Ga0207708_10156616 | 3300026075 | Bacteria | 1796 |
| 847 | Ga0207708_10614938 | 3300026075 | Bacteria | 922 |
| 848 | Ga0207708_10795262 | 3300026075 | Bacteria | 814 |
| 849 | Ga0207708_11220680 | 3300026075 | Bacteria | 658 |
| 850 | Ga0207708_12019120 | 3300026075 | Bacteria | 505 |
| 851 | Ga0207702_10036288 | 3300026078 | Bacteria | 4123 |
| 852 | Ga0207702_10086091 | 3300026078 | Bacteria | 2740 |
| 853 | Ga0207702_10249947 | 3300026078 | Bacteria | 1665 |
| 854 | Ga0207702_10868485 | 3300026078 | Bacteria | 893 |
| 855 | Ga0207702_11628407 | 3300026078 | Bacteria | 639 |
| 856 | Ga0207641_10070450 | 3300026088 | Bacteria | 3004 |
| 857 | Ga0207641_10281147 | 3300026088 | Bacteria | 1565 |
| 858 | Ga0207641_10464731 | 3300026088 | Bacteria | 1224 |
| 859 | Ga0207641_10611440 | 3300026088 | Bacteria | 1068 |
| 860 | Ga0207641_11270260 | 3300026088 | Bacteria | 736 |
| 861 | Ga0207648_10048391 | 3300026089 | Bacteria | 3722 |
| 862 | Ga0207648_10097740 | 3300026089 | Bacteria | 2569 |
| 863 | Ga0207648_10203821 | 3300026089 | Bacteria | 1755 |
| 864 | Ga0207648_10306254 | 3300026089 | Bacteria | 1426 |
| 865 | Ga0207648_10654520 | 3300026089 | Bacteria | 971 |
| 866 | Ga0207676_10180609 | 3300026095 | Bacteria | 1847 |
| 867 | Ga0207676_10297097 | 3300026095 | Bacteria | 1473 |
| 868 | Ga0207676_11001064 | 3300026095 | Bacteria | 823 |
| 869 | Ga0207676_11162364 | 3300026095 | Bacteria | 764 |
| 870 | Ga0207676_11353882 | 3300026095 | Bacteria | 707 |
| 871 | Ga0207674_10048180 | 3300026116 | Bacteria | 4363 |
| 872 | Ga0207674_10082972 | 3300026116 | Bacteria | 3205 |
| 873 | Ga0207674_10100870 | 3300026116 | Bacteria | 2868 |
| 874 | Ga0207674_10101100 | 3300026116 | Bacteria | 2864 |
| 875 | Ga0207674_10168287 | 3300026116 | Bacteria | 2145 |
| 876 | Ga0207674_10268372 | 3300026116 | Bacteria | 1654 |
| 877 | Ga0207674_11749475 | 3300026116 | Bacteria | 589 |
| 878 | Ga0207675_100316888 | 3300026118 | Bacteria | 1522 |
| 879 | Ga0207683_10028596 | 3300026121 | Bacteria | 4822 |
| 880 | Ga0207683_10035142 | 3300026121 | Bacteria | 4359 |
| 881 | Ga0207683_10127379 | 3300026121 | Bacteria | 2289 |
| 882 | Ga0207683_10618670 | 3300026121 | Bacteria | 1003 |
| 883 | Ga0207698_10038152 | 3300026142 | Bacteria | 3547 |
| 884 | Ga0207698_10046102 | 3300026142 | Bacteria | 3289 |
| 885 | Ga0207698_10601353 | 3300026142 | Bacteria | 1084 |
| 886 | Ga0207698_11574528 | 3300026142 | Bacteria | 672 |
| 887 | Ga0207698_11688725 | 3300026142 | Bacteria | 649 |
| 888 | Ga0207698_12636717 | 3300026142 | Bacteria | 512 |
| 889 | Ga0209973_1018244 | 3300027252 | Bacteria | 908 |
| 890 | Ga0209973_1021955 | 3300027252 | Bacteria | 854 |
| 891 | Ga0209967_1084390 | 3300027364 | Bacteria | 500 |
| 892 | Ga0209984_1013486 | 3300027424 | Bacteria | 1073 |
| 893 | Ga0209984_1054251 | 3300027424 | Bacteria | 589 |
| 894 | Ga0209995_1003150 | 3300027471 | Bacteria | 2621 |
| 895 | Ga0209995_1009325 | 3300027471 | Bacteria | 1586 |
| 896 | Ga0209968_1003096 | 3300027526 | Bacteria | 2493 |
| 897 | Ga0209999_1002599 | 3300027543 | Bacteria | 3194 |
| 898 | Ga0209999_1091843 | 3300027543 | Bacteria | 589 |
| 899 | Ga0209999_1124806 | 3300027543 | Bacteria | 505 |
| 900 | Ga0209982_1017982 | 3300027552 | Bacteria | 1080 |
| 901 | Ga0209970_1024737 | 3300027614 | Bacteria | 1027 |
| 902 | Ga0209970_1052785 | 3300027614 | Bacteria | 737 |
| 903 | Ga0210002_1043222 | 3300027617 | Bacteria | 768 |
| 904 | Ga0210002_1082987 | 3300027617 | Bacteria | 572 |
| 905 | Ga0209983_1000810 | 3300027665 | Bacteria | 6831 |
| 906 | Ga0209983_1018496 | 3300027665 | Bacteria | 1447 |
| 907 | Ga0209983_1019830 | 3300027665 | Bacteria | 1399 |
| 908 | Ga0209971_1020116 | 3300027682 | Bacteria | 1586 |
| 909 | Ga0209966_1000982 | 3300027695 | Bacteria | 5325 |
| 910 | Ga0209966_1108664 | 3300027695 | Bacteria | 631 |
| 911 | Ga0209998_10003458 | 3300027717 | Bacteria | 3451 |
| 912 | Ga0209998_10080529 | 3300027717 | Bacteria | 789 |
| 913 | Ga0209974_10007380 | 3300027876 | Bacteria | 3789 |
| 914 | Ga0209974_10007508 | 3300027876 | Bacteria | 3752 |
| 915 | Ga0207428_10011903 | 3300027907 | Bacteria | 7658 |
| 916 | Ga0207428_10193964 | 3300027907 | Bacteria | 1530 |
| 917 | Ga0207428_10276111 | 3300027907 | Bacteria | 1248 |
| 918 | Ga0207428_10401508 | 3300027907 | Bacteria | 1003 |
| 919 | Ga0268266_10142482 | 3300028379 | Bacteria | 2152 |
| 920 | Ga0268266_10237157 | 3300028379 | Bacteria | 1682 |
| 921 | Ga0268265_10067252 | 3300028380 | Bacteria | 2773 |
| 922 | Ga0268265_10415410 | 3300028380 | Bacteria | 1248 |
| 923 | Ga0268265_10574631 | 3300028380 | Bacteria | 1073 |
| 924 | Ga0268265_10859804 | 3300028380 | Bacteria | 888 |
| 925 | Ga0268265_11001979 | 3300028380 | Bacteria | 825 |
| 926 | Ga0268264_10221374 | 3300028381 | Bacteria | 1742 |
| 927 | Ga0268264_10630454 | 3300028381 | Bacteria | 1059 |
| 928 | Ga0265323_10056890 | 3300028653 | Bacteria | 1370 |
| 929 | Ga0265338_10051633 | 3300028800 | Bacteria | 3699 |
| 930 | Ga0316182_1255157 | 3300030745 | Bacteria | 836 |
| 931 | Ga0265320_10064432 | 3300031240 | Unclassified | 1741 |
| 932 | Ga0265327_10087014 | 3300031251 | Bacteria | 1531 |
| 933 | Ga0265316_10934161 | 3300031344 | Bacteria | 605 |
| 934 | Ga0307408_100016817 | 3300031548 | Bacteria | 4889 |
| 935 | Ga0307408_100019763 | 3300031548 | Bacteria | 4537 |
| 936 | Ga0307408_100046769 | 3300031548 | Bacteria | 3096 |
| 937 | Ga0307408_100052712 | 3300031548 | Bacteria | 2935 |
| 938 | Ga0307408_100062503 | 3300031548 | Bacteria | 2721 |
| 939 | Ga0307408_100099262 | 3300031548 | Bacteria | 2215 |
| 940 | Ga0307408_100153960 | 3300031548 | Bacteria | 1818 |
| 941 | Ga0307408_100223526 | 3300031548 | Bacteria | 1538 |
| 942 | Ga0307408_100406940 | 3300031548 | Bacteria | 1170 |
| 943 | Ga0307408_100424859 | 3300031548 | Bacteria | 1147 |
| 944 | Ga0307408_100713907 | 3300031548 | Bacteria | 902 |
| 945 | Ga0307408_100864679 | 3300031548 | Bacteria | 825 |
| 946 | Ga0307408_101332649 | 3300031548 | Bacteria | 674 |
| 947 | Ga0265313_10145536 | 3300031595 | Bacteria | 1016 |
| 948 | Ga0316575_10039695 | 3300031665 | Bacteria | 1859 |
| 949 | Ga0316575_10385885 | 3300031665 | Bacteria | 599 |
| 950 | Ga0316579_10001157 | 3300031691 | Bacteria | 9386 |
| 951 | Ga0265314_10001956 | 3300031711 | Bacteria | 21935 |
| 952 | Ga0265342_10633398 | 3300031712 | Bacteria | 538 |
| 953 | Ga0316576_10004863 | 3300031727 | Bacteria | 8124 |
| 954 | Ga0316576_10044118 | 3300031727 | Bacteria | 3220 |
| 955 | Ga0316578_10001113 | 3300031728 | Bacteria | 10503 |
| 956 | Ga0307405_10003326 | 3300031731 | Bacteria | 7362 |
| 957 | Ga0307405_10004504 | 3300031731 | Bacteria | 6595 |
| 958 | Ga0307405_10081500 | 3300031731 | Bacteria | 2115 |
| 959 | Ga0307405_10083760 | 3300031731 | Bacteria | 2091 |
| 960 | Ga0307405_10100967 | 3300031731 | Bacteria | 1935 |
| 961 | Ga0307405_10107686 | 3300031731 | Bacteria | 1882 |
| 962 | Ga0307405_10116149 | 3300031731 | Bacteria | 1822 |
| 963 | Ga0307405_10152371 | 3300031731 | Bacteria | 1627 |
| 964 | Ga0307405_10250335 | 3300031731 | Bacteria | 1318 |
| 965 | Ga0307405_11012285 | 3300031731 | Bacteria | 709 |
| 966 | Ga0307405_11208907 | 3300031731 | Bacteria | 654 |
| 967 | Ga0307405_11333273 | 3300031731 | Bacteria | 625 |
| 968 | Ga0316577_10008737 | 3300031733 | Bacteria | 5430 |
| 969 | Ga0316577_10076737 | 3300031733 | Bacteria | 1866 |
| 970 | Ga0307413_10001842 | 3300031824 | Bacteria | 8343 |
| 971 | Ga0307413_10002091 | 3300031824 | Bacteria | 7997 |
| 972 | Ga0307413_10006358 | 3300031824 | Bacteria | 5383 |
| 973 | Ga0307413_10031527 | 3300031824 | Bacteria | 2992 |
| 974 | Ga0307413_10055726 | 3300031824 | Bacteria | 2407 |
| 975 | Ga0307413_10067122 | 3300031824 | Bacteria | 2241 |
| 976 | Ga0307413_10074613 | 3300031824 | Bacteria | 2149 |
| 977 | Ga0307413_10079652 | 3300031824 | Bacteria | 2095 |
| 978 | Ga0307413_10203183 | 3300031824 | Bacteria | 1432 |
| 979 | Ga0307413_10316330 | 3300031824 | Bacteria | 1190 |
| 980 | Ga0307413_10701827 | 3300031824 | Bacteria | 840 |
| 981 | Ga0307413_10760750 | 3300031824 | Bacteria | 811 |
| 982 | Ga0307413_10957308 | 3300031824 | Bacteria | 731 |
| 983 | Ga0307413_11250943 | 3300031824 | Bacteria | 647 |
| 984 | Ga0307413_11340826 | 3300031824 | Bacteria | 627 |
| 985 | Ga0307413_11758549 | 3300031824 | Bacteria | 554 |
| 986 | Ga0307410_10000285 | 3300031852 | Bacteria | 19565 |
| 987 | Ga0307410_10000967 | 3300031852 | Bacteria | 12342 |
| 988 | Ga0307410_10022252 | 3300031852 | Bacteria | 3914 |
| 989 | Ga0307410_10022355 | 3300031852 | Bacteria | 3907 |
| 990 | Ga0307410_10054575 | 3300031852 | Bacteria | 2709 |
| 991 | Ga0307410_10057005 | 3300031852 | Bacteria | 2658 |
| 992 | Ga0307410_10067694 | 3300031852 | Bacteria | 2464 |
| 993 | Ga0307410_10109480 | 3300031852 | Bacteria | 1996 |
| 994 | Ga0307410_10126427 | 3300031852 | Bacteria | 1872 |
| 995 | Ga0307410_10654568 | 3300031852 | Bacteria | 881 |
| 996 | Ga0307410_10712613 | 3300031852 | Bacteria | 847 |
| 997 | Ga0307410_10869233 | 3300031852 | Bacteria | 771 |
| 998 | Ga0307410_10958461 | 3300031852 | Bacteria | 736 |
| 999 | Ga0307410_11030798 | 3300031852 | Bacteria | 711 |
| 1000 | Ga0307406_10009039 | 3300031901 | Bacteria | 5572 |
| 1001 | Ga0307406_10030981 | 3300031901 | Bacteria | 3253 |
| 1002 | Ga0307406_10074742 | 3300031901 | Bacteria | 2232 |
| 1003 | Ga0307406_10102636 | 3300031901 | Bacteria | 1951 |
| 1004 | Ga0307406_10139031 | 3300031901 | Bacteria | 1716 |
| 1005 | Ga0307406_10208490 | 3300031901 | Bacteria | 1444 |
| 1006 | Ga0307406_10257460 | 3300031901 | Bacteria | 1318 |
| 1007 | Ga0307406_10392032 | 3300031901 | Bacteria | 1098 |
| 1008 | Ga0307406_10824787 | 3300031901 | Bacteria | 784 |
| 1009 | Ga0307406_11310203 | 3300031901 | Bacteria | 632 |
| 1010 | Ga0307406_11468420 | 3300031901 | Bacteria | 599 |
| 1011 | Ga0307407_10005111 | 3300031903 | Bacteria | 5655 |
| 1012 | Ga0307407_10005124 | 3300031903 | Bacteria | 5650 |
| 1013 | Ga0307407_10044520 | 3300031903 | Bacteria | 2502 |
| 1014 | Ga0307407_10122956 | 3300031903 | Bacteria | 1648 |
| 1015 | Ga0307407_10241220 | 3300031903 | Bacteria | 1233 |
| 1016 | Ga0307407_10500819 | 3300031903 | Bacteria | 890 |
| 1017 | Ga0307407_10543982 | 3300031903 | Bacteria | 857 |
| 1018 | Ga0307407_10568148 | 3300031903 | Bacteria | 840 |
| 1019 | Ga0307407_10942719 | 3300031903 | Bacteria | 664 |
| 1020 | Ga0307407_10954127 | 3300031903 | Bacteria | 660 |
| 1021 | Ga0307407_11254962 | 3300031903 | Bacteria | 580 |
| 1022 | Ga0307412_10005885 | 3300031911 | Bacteria | 6908 |
| 1023 | Ga0307412_10007821 | 3300031911 | Bacteria | 6085 |
| 1024 | Ga0307412_10016367 | 3300031911 | Bacteria | 4416 |
| 1025 | Ga0307412_10060199 | 3300031911 | Bacteria | 2548 |
| 1026 | Ga0307412_10075320 | 3300031911 | Bacteria | 2315 |
| 1027 | Ga0307412_10094473 | 3300031911 | Bacteria | 2100 |
| 1028 | Ga0307412_10139932 | 3300031911 | Bacteria | 1771 |
| 1029 | Ga0307412_10202806 | 3300031911 | Bacteria | 1507 |
| 1030 | Ga0307412_10361947 | 3300031911 | Bacteria | 1168 |
| 1031 | Ga0307412_10791122 | 3300031911 | Bacteria | 822 |
| 1032 | Ga0307412_10863760 | 3300031911 | Bacteria | 790 |
| 1033 | Ga0307412_11152646 | 3300031911 | Bacteria | 692 |
| 1034 | Ga0307412_11837595 | 3300031911 | Bacteria | 558 |
| 1035 | Ga0307409_100005454 | 3300031995 | Bacteria | 7326 |
| 1036 | Ga0307409_100008795 | 3300031995 | Bacteria | 6156 |
| 1037 | Ga0307409_100032235 | 3300031995 | Bacteria | 3796 |
| 1038 | Ga0307409_100047584 | 3300031995 | Bacteria | 3256 |
| 1039 | Ga0307409_100055663 | 3300031995 | Bacteria | 3055 |
| 1040 | Ga0307409_100079063 | 3300031995 | Bacteria | 2648 |
| 1041 | Ga0307409_100079067 | 3300031995 | Bacteria | 2648 |
| 1042 | Ga0307409_100172626 | 3300031995 | Bacteria | 1904 |
| 1043 | Ga0307409_100487723 | 3300031995 | Bacteria | 1197 |
| 1044 | Ga0307409_100541231 | 3300031995 | Bacteria | 1141 |
| 1045 | Ga0307409_100655432 | 3300031995 | Bacteria | 1044 |
| 1046 | Ga0307409_100810599 | 3300031995 | Bacteria | 944 |
| 1047 | Ga0307409_101036773 | 3300031995 | Bacteria | 839 |
| 1048 | Ga0307409_101214543 | 3300031995 | Bacteria | 777 |
| 1049 | Ga0307409_101843172 | 3300031995 | Bacteria | 634 |
| 1050 | Ga0307409_102131522 | 3300031995 | Bacteria | 590 |
| 1051 | Ga0307416_100003682 | 3300032002 | Bacteria | 9079 |
| 1052 | Ga0307416_100009003 | 3300032002 | Bacteria | 6494 |
| 1053 | Ga0307416_100016074 | 3300032002 | Bacteria | 5188 |
| 1054 | Ga0307416_100092060 | 3300032002 | Bacteria | 2606 |
| 1055 | Ga0307416_100113896 | 3300032002 | Bacteria | 2391 |
| 1056 | Ga0307416_100116989 | 3300032002 | Bacteria | 2365 |
| 1057 | Ga0307416_100118263 | 3300032002 | Bacteria | 2355 |
| 1058 | Ga0307416_100417503 | 3300032002 | Bacteria | 1385 |
| 1059 | Ga0307416_100491460 | 3300032002 | Bacteria | 1289 |
| 1060 | Ga0307416_100535955 | 3300032002 | Bacteria | 1241 |
| 1061 | Ga0307416_100538135 | 3300032002 | Bacteria | 1239 |
| 1062 | Ga0307416_100612039 | 3300032002 | Bacteria | 1170 |
| 1063 | Ga0307416_100650942 | 3300032002 | Bacteria | 1138 |
| 1064 | Ga0307416_100833658 | 3300032002 | Bacteria | 1019 |
| 1065 | Ga0307416_101065588 | 3300032002 | Bacteria | 912 |
| 1066 | Ga0307416_101526866 | 3300032002 | Bacteria | 773 |
| 1067 | Ga0307416_102777375 | 3300032002 | Bacteria | 585 |
| 1068 | Ga0307414_10036134 | 3300032004 | Bacteria | 3295 |
| 1069 | Ga0307414_10074656 | 3300032004 | Bacteria | 2457 |
| 1070 | Ga0307414_10180246 | 3300032004 | Bacteria | 1698 |
| 1071 | Ga0307414_10726338 | 3300032004 | Bacteria | 901 |
| 1072 | Ga0307414_10756896 | 3300032004 | Bacteria | 883 |
| 1073 | Ga0307414_10956519 | 3300032004 | Bacteria | 787 |
| 1074 | Ga0307414_10986856 | 3300032004 | Bacteria | 775 |
| 1075 | Ga0307411_10000568 | 3300032005 | Bacteria | 13149 |
| 1076 | Ga0307411_10005072 | 3300032005 | Bacteria | 6412 |
| 1077 | Ga0307411_10012793 | 3300032005 | Bacteria | 4598 |
| 1078 | Ga0307411_10020764 | 3300032005 | Bacteria | 3828 |
| 1079 | Ga0307411_10114848 | 3300032005 | Bacteria | 1935 |
| 1080 | Ga0307411_10118769 | 3300032005 | Bacteria | 1908 |
| 1081 | Ga0307411_10209710 | 3300032005 | Bacteria | 1503 |
| 1082 | Ga0307411_10336063 | 3300032005 | Bacteria | 1226 |
| 1083 | Ga0307411_10347332 | 3300032005 | Bacteria | 1208 |
| 1084 | Ga0307411_10825064 | 3300032005 | Bacteria | 818 |
| 1085 | Ga0307411_10889294 | 3300032005 | Bacteria | 790 |
| 1086 | Ga0307415_100004310 | 3300032126 | Bacteria | 7364 |
| 1087 | Ga0307415_100004471 | 3300032126 | Bacteria | 7257 |
| 1088 | Ga0307415_100006886 | 3300032126 | Bacteria | 6172 |
| 1089 | Ga0307415_100017495 | 3300032126 | Bacteria | 4301 |
| 1090 | Ga0307415_100073037 | 3300032126 | Bacteria | 2418 |
| 1091 | Ga0307415_100077926 | 3300032126 | Bacteria | 2355 |
| 1092 | Ga0307415_100116777 | 3300032126 | Bacteria | 1991 |
| 1093 | Ga0307415_100232082 | 3300032126 | Bacteria | 1487 |
| 1094 | Ga0307415_100238109 | 3300032126 | Bacteria | 1470 |
| 1095 | Ga0307415_100315483 | 3300032126 | Bacteria | 1301 |
| 1096 | Ga0307415_100443838 | 3300032126 | Bacteria | 1120 |
| 1097 | Ga0307415_101090887 | 3300032126 | Bacteria | 747 |
| 1098 | Ga0316583_10001183 | 3300032133 | Bacteria | 8556 |
| 1099 | Ga0316583_10017879 | 3300032133 | Bacteria | 2546 |
| 1100 | Ga0316583_10084259 | 3300032133 | Bacteria | 1110 |
| 1101 | Ga0316585_10001668 | 3300032137 | Bacteria | 5889 |
| 1102 | Ga0316580_10001460 | 3300032139 | Bacteria | 6181 |
| 1103 | Ga0316592_1120642 | 3300033524 | Bacteria | 609 |
| 1104 | Ga0316588_1148391 | 3300033528 | Bacteria | 601 |
| 1105 | Ga0316596_1039349 | 3300033541 | Bacteria | 1240 |
| 1106 | Ga0373930_0074044 | 3300034816 | Bacteria | 778 |
| 1107 | Ga0373948_0059906 | 3300034817 | Bacteria | 834 |
| 1108 | Ga0373950_0080083 | 3300034818 | Bacteria | 681 |
| 1109 | Ga0373958_0022561 | 3300034819 | Bacteria | 1177 |
| 1110 | Ga0373958_0094801 | 3300034819 | Bacteria | 693 |
| 1111 | Ga0373959_0006266 | 3300034820 | Bacteria | 1969 |
| 1112 | Ga0373959_0013525 | 3300034820 | Bacteria | 1473 |
| 1113 | Ga0373959_0078539 | 3300034820 | Bacteria | 757 |
| 1114 | Ga0373938_0034724 | 3300034957 | Bacteria | 1097 |
| 1115 | Ga0373938_0246200 | 3300034957 | Bacteria | 510 |
| 1116 | Ga0373926_0269996 | 3300035083 | Bacteria | 661 |
| 1117 | Ga0373928_0033370 | 3300035084 | Bacteria | 1151 |
| 1118 | Ga0373928_0062653 | 3300035084 | Bacteria | 903 |
| 1119 | Ga0373928_0154152 | 3300035084 | Bacteria | 638 |
| 1120 | Ga0373929_0026783 | 3300035085 | Bacteria | 1207 |
| 1121 | Ga0373929_0029820 | 3300035085 | Bacteria | 1160 |
| 1122 | Ga0373929_0056692 | 3300035085 | Bacteria | 908 |
| 1123 | Ga0373934_0141970 | 3300035086 | Bacteria | 982 |
| 1124 | Ga0373934_0454027 | 3300035086 | Bacteria | 537 |
| 1125 | Ga0373940_0074398 | 3300035088 | Bacteria | 994 |
| 1126 | Ga0373944_0057368 | 3300035089 | Bacteria | 1241 |
| 1127 | Ga0373949_0250311 | 3300035090 | Bacteria | 548 |
| 1128 | Ga0373952_0021650 | 3300035092 | Bacteria | 1359 |
| 1129 | Ga0373952_0022759 | 3300035092 | Bacteria | 1334 |
| 1130 | Ga0373952_0044807 | 3300035092 | Bacteria | 1035 |
| 1131 | Ga0373923_0036974 | 3300035111 | Bacteria | 1996 |
| 1132 | Ga0373932_0170684 | 3300035112 | Bacteria | 758 |
| 1133 | Ga0373939_0067213 | 3300035114 | Bacteria | 1157 |
| 1134 | Ga0373939_0254051 | 3300035114 | Bacteria | 685 |
| 1135 | Ga0373941_0017581 | 3300035115 | Bacteria | 1962 |
| 1136 | Ga0373941_0232439 | 3300035115 | Bacteria | 713 |
| 1137 | Ga0373945_0397345 | 3300035116 | Bacteria | 604 |
| 1138 | Ga0373953_0014696 | 3300035117 | Bacteria | 2822 |
| 1139 | Ga0373954_0236932 | 3300035118 | Bacteria | 898 |
| 1140 | Ga0373956_0149048 | 3300035119 | Bacteria | 1100 |
| 1141 | Ga0373956_0345775 | 3300035119 | Bacteria | 709 |
| 1142 | Ga0373957_0106980 | 3300035120 | Bacteria | 1124 |
| 1143 | Ga0373960_0040013 | 3300035121 | Bacteria | 1351 |
| 1144 | Ga0373960_0121692 | 3300035121 | Bacteria | 867 |
| 1145 | Ga0373960_0200705 | 3300035121 | Bacteria | 705 |
| 1146 | Ga0373943_0015892 | 3300035170 | Bacteria | 3425 |
| 1147 | Ga0373943_0407194 | 3300035170 | Bacteria | 786 |
| 1148 | Ga0373946_0276367 | 3300035171 | Bacteria | 825 |
| 1149 | Ga0373946_0676961 | 3300035171 | Bacteria | 538 |
| 1150 | Ga0373955_0088617 | 3300035172 | Bacteria | 1760 |
| 1151 | Ga0373942_0037456 | 3300035207 | Bacteria | 1311 |
| 1152 | Ga0373942_0199256 | 3300035207 | Bacteria | 663 |
| 1153 | Ga0373961_0000555 | 3300035241 | Bacteria | 14114 |
| 1154 | Ga0373961_0036950 | 3300035241 | Bacteria | 1393 |
| 1155 | Ga0373961_0314891 | 3300035241 | Bacteria | 582 |
| 1156 | Ga0373962_0259282 | 3300035242 | Bacteria | 606 |
| 1157 | Ga0316574_0007172 | 3300035398 | Bacteria | 6090 |
| 1158 | Ga0316574_0331037 | 3300035398 | Bacteria | 966 |
| 1159 | Ga0316574_0355322 | 3300035398 | Bacteria | 927 |
| 1160 | Ga0373924_0040307 | 3300035410 | Bacteria | 1911 |
| 1161 | Ga0373931_0065790 | 3300035691 | Bacteria | 1965 |
| 1162 | Ga0373931_0113587 | 3300035691 | Bacteria | 1540 |
| 1163 | Ga0373931_0233081 | 3300035691 | Bacteria | 1113 |
| 1164 | Ga0373931_0424587 | 3300035691 | Bacteria | 846 |
| 1165 | Ga0373931_0856974 | 3300035691 | Bacteria | 608 |
| 1166 | Ga0373935_0058549 | 3300035692 | Bacteria | 2461 |
| 1167 | Ga0373933_0002765 | 3300035724 | Bacteria | 9786 |
| 1168 | Ga0373937_0001688 | 3300036401 | Bacteria | 18564 |
| 1169 | Ga0373937_0063603 | 3300036401 | Bacteria | 3394 |
| 1170 | Ga0373937_0245517 | 3300036401 | Bacteria | 1687 |
| 1171 | Ga0373937_0517704 | 3300036401 | Bacteria | 1133 |
| 1172 | Ga0373937_1029058 | 3300036401 | Bacteria | 772 |
| 1173 | Ga0373937_1128300 | 3300036401 | Bacteria | 733 |
| 1174 | Ga0373937_1565581 | 3300036401 | Bacteria | 606 |
| 1175 | Ga0316582_0015599 | 3300036647 | Bacteria | 4351 |
| 1176 | Ga0316582_0945318 | 3300036647 | Unclassified | 589 |
| 1177 | Ga0316584_0007216 | 3300036712 | Bacteria | 7583 |
| 1178 | Ga0373925_0078483 | 3300037068 | Bacteria | 2507 |
| 1179 | Ga0373925_0176928 | 3300037068 | Bacteria | 1687 |
| 1180 | Ga0373925_0292667 | 3300037068 | Bacteria | 1313 |
| 1181 | Ga0373925_0487257 | 3300037068 | Bacteria | 1012 |
| 1182 | Ga0395899_0151372 | 3300037312 | Bacteria | 1644 |
| 1183 | Ga0395900_0024491 | 3300037418 | Bacteria | 6181 |
| 1184 | Ga0395898_1598012 | 3300037466 | Bacteria | 576 |
| 1185 | Ga0395905_0025260 | 3300037471 | Bacteria | 5602 |
| 1186 | Ga0395905_0067530 | 3300037471 | Bacteria | 3349 |
| 1187 | Ga0395905_1312912 | 3300037471 | Bacteria | 627 |
| 1188 | Ga0395905_1736610 | 3300037471 | Bacteria | 529 |
| 1189 | Ga0436364_0100568 | 3300037853 | Bacteria | 510 |
| 1190 | Ga0436364_0390676 | 3300037853 | Bacteria | 919 |
| 1191 | Ga0436364_1537478 | 3300037853 | Bacteria | 519 |
| 1192 | Ga0395901_0001770 | 3300038443 | Bacteria | 22280 |
| 1193 | Ga0242419_003585 | 3300038698 | Bacteria | 1056 |
| 1194 | Ga0242420_050187 | 3300038996 | Bacteria | 814 |
| 1195 | Ga0436365_0223155 | 3300039437 | Bacteria | 890 |
| 1196 | Ga0436365_0234011 | 3300039437 | Bacteria | 932 |
| 1197 | Ga0436365_0408308 | 3300039437 | Bacteria | 3423 |
| 1198 | Ga0436365_1264253 | 3300039437 | Bacteria | 2413 |
| 1199 | Ga0436365_1424311 | 3300039437 | Bacteria | 1839 |
| 1200 | Ga0436365_1599614 | 3300039437 | Bacteria | 517 |
| 1201 | Ga0439439_0048325 | 3300041406 | Bacteria | 1112 |
| 1202 | Ga0439439_0178061 | 3300041406 | Bacteria | 612 |
| 1203 | Ga0439453_0097394 | 3300041408 | Bacteria | 652 |
| 1204 | Ga0451793_0749803 | 3300041452 | Bacteria | 2075 |
| 1205 | Ga0451795_1463064 | 3300041456 | Bacteria | 634 |
| 1206 | Ga0451802_1318879 | 3300041460 | Bacteria | 788 |
| 1207 | Ga0451807_0674211 | 3300041486 | Bacteria | 3051 |
| 1208 | Ga0451807_1934356 | 3300041486 | Bacteria | 718 |
| 1209 | Ga0451807_2773123 | 3300041486 | Bacteria | 790 |
| 1210 | Ga0451839_1015318 | 3300041496 | Bacteria | 506 |
| 1211 | Ga0451845_0267143 | 3300041501 | Bacteria | 643 |
| 1212 | Ga0451853_2480235 | 3300041512 | Bacteria | 901 |
| 1213 | Ga0451853_2725406 | 3300041512 | Bacteria | 510 |
| 1214 | Ga0439433_0143812 | 3300041999 | Bacteria | 611 |
| 1215 | Ga0439432_163717 | 3300042006 | Bacteria | 650 |
| 1216 | Ga0439449_0103716 | 3300042007 | Bacteria | 1052 |
| 1217 | Ga0439455_0022797 | 3300042012 | Bacteria | 1504 |
| 1218 | Ga0439456_080993 | 3300042013 | Bacteria | 725 |
| 1219 | Ga0439446_0049325 | 3300042156 | Bacteria | 1255 |
| 1220 | Ga0439446_0053270 | 3300042156 | Bacteria | 1212 |
| 1221 | Ga0439446_0174111 | 3300042156 | Bacteria | 717 |
| 1222 | Ga0439446_0346855 | 3300042156 | Bacteria | 528 |
| 1223 | Ga0439434_0081628 | 3300042435 | Bacteria | 1026 |
| 1224 | Ga0439434_0157571 | 3300042435 | Bacteria | 753 |
| 1225 | Ga0439459_0037912 | 3300042438 | Bacteria | 1012 |
| 1226 | Ga0451577_0049852 | 3300042876 | Bacteria | 3738 |
| 1227 | Ga0451577_0208168 | 3300042876 | Bacteria | 1766 |
| 1228 | Ga0451577_0391595 | 3300042876 | Bacteria | 1261 |
| 1229 | Ga0453683_0012099 | 3300044673 | Bacteria | 5665 |
| 1230 | Ga0453683_0182841 | 3300044673 | Bacteria | 1330 |
| 1231 | Ga0453683_0714274 | 3300044673 | Bacteria | 657 |
| 1232 | Ga0453683_0746648 | 3300044673 | Bacteria | 643 |
| 1233 | Ga0466965_0134875 | 3300044683 | Bacteria | 1282 |
| 1234 | Ga0466965_0435969 | 3300044683 | Bacteria | 728 |
| 1235 | Ga0466961_0216372 | 3300044693 | Bacteria | 1182 |
| 1236 | Ga0466963_0055834 | 3300044694 | Bacteria | 2627 |
| 1237 | Ga0466964_0133383 | 3300044706 | Bacteria | 1134 |
| 1238 | Ga0453684_0062783 | 3300044712 | Bacteria | 4756 |
| 1239 | Ga0453684_0532052 | 3300044712 | Bacteria | 1297 |
| 1240 | Ga0453684_0714362 | 3300044712 | Bacteria | 1088 |
| 1241 | Ga0453684_1371210 | 3300044712 | Bacteria | 734 |
| 1242 | Ga0453684_1964546 | 3300044712 | Bacteria | 590 |
| 1243 | Ga0453684_2365960 | 3300044712 | Bacteria | 527 |
| 1244 | Ga0466970_0649912 | 3300044765 | Bacteria | 613 |
| 1245 | Ga0466957_0209596 | 3300044842 | Bacteria | 1283 |
| 1246 | Ga0466960_0145973 | 3300044901 | Bacteria | 1260 |
| 1247 | Ga0466960_0176826 | 3300044901 | Bacteria | 1155 |
| 1248 | Ga0466959_0772507 | 3300045049 | Bacteria | 643 |
| 1249 | Ga0466959_1022370 | 3300045049 | Bacteria | 550 |
| 1250 | Ga0451576_0032102 | 3300045051 | Bacteria | 5596 |
| 1251 | Ga0451576_0153457 | 3300045051 | Bacteria | 2402 |
| 1252 | Ga0451576_0237355 | 3300045051 | Bacteria | 1904 |
| 1253 | Ga0451576_0252033 | 3300045051 | Bacteria | 1845 |
| 1254 | Ga0451576_0297024 | 3300045051 | Bacteria | 1689 |
| 1255 | Ga0451576_0308436 | 3300045051 | Bacteria | 1655 |
| 1256 | Ga0451576_0388486 | 3300045051 | Bacteria | 1463 |
| 1257 | Ga0466958_0198001 | 3300045836 | Bacteria | 1278 |
| 1258 | Ga0466958_0629169 | 3300045836 | Bacteria | 698 |
| 1259 | Ga0466967_0277810 | 3300045976 | Bacteria | 1606 |
| 1260 | Ga0466967_1060643 | 3300045976 | Bacteria | 807 |
| 1261 | Ga0466967_1139939 | 3300045976 | Bacteria | 777 |
| 1262 | Ga0495592_0402576 | 3300046454 | Bacteria | 866 |
| 1263 | Ga0495592_0498975 | 3300046454 | Bacteria | 755 |
| 1264 | Ga0495603_0021202 | 3300046455 | Bacteria | 3934 |
| 1265 | Ga0495603_0043390 | 3300046455 | Bacteria | 2685 |
| 1266 | Ga0495590_0238336 | 3300046457 | Bacteria | 675 |
| 1267 | Ga0495629_0048696 | 3300046459 | Bacteria | 2971 |
| 1268 | Ga0495629_0073936 | 3300046459 | Bacteria | 2380 |
| 1269 | Ga0495629_0077215 | 3300046459 | Bacteria | 2325 |
| 1270 | Ga0495629_0615914 | 3300046459 | Bacteria | 725 |
| 1271 | Ga0495629_0678831 | 3300046459 | Bacteria | 685 |
| 1272 | Ga0495651_0017188 | 3300046462 | Bacteria | 5605 |
| 1273 | Ga0495651_0084014 | 3300046462 | Bacteria | 2399 |
| 1274 | Ga0495651_0243225 | 3300046462 | Bacteria | 1233 |
| 1275 | Ga0495653_0026437 | 3300046463 | Bacteria | 4653 |
| 1276 | Ga0495580_0016230 | 3300046472 | Bacteria | 5595 |
| 1277 | Ga0495580_0076246 | 3300046472 | Bacteria | 2339 |
| 1278 | Ga0495580_0087356 | 3300046472 | Bacteria | 2172 |
| 1279 | Ga0495580_0113415 | 3300046472 | Bacteria | 1883 |
| 1280 | Ga0495582_0010686 | 3300046473 | Bacteria | 5050 |
| 1281 | Ga0495582_0014832 | 3300046473 | Bacteria | 4282 |
| 1282 | Ga0495582_0109507 | 3300046473 | Bacteria | 1551 |
| 1283 | Ga0495582_0197880 | 3300046473 | Bacteria | 1147 |
| 1284 | Ga0495605_0283024 | 3300046474 | Bacteria | 704 |
| 1285 | Ga0495605_0494223 | 3300046474 | Bacteria | 500 |
| 1286 | Ga0495639_0004714 | 3300046475 | Bacteria | 5862 |
| 1287 | Ga0495639_0067391 | 3300046475 | Bacteria | 1648 |
| 1288 | Ga0495662_0097571 | 3300046476 | Bacteria | 1436 |
| 1289 | Ga0495662_0117049 | 3300046476 | Bacteria | 1307 |
| 1290 | Ga0495664_0463726 | 3300046477 | Bacteria | 758 |
| 1291 | Ga0495584_0592649 | 3300046491 | Bacteria | 565 |
| 1292 | Ga0495594_0005611 | 3300046499 | Bacteria | 6449 |
| 1293 | Ga0495594_0069873 | 3300046499 | Bacteria | 1951 |
| 1294 | Ga0495594_0118996 | 3300046499 | Bacteria | 1492 |
| 1295 | Ga0495596_0010087 | 3300046500 | Bacteria | 4131 |
| 1296 | Ga0495583_0164843 | 3300046506 | Bacteria | 913 |
| 1297 | Ga0495608_0033181 | 3300046511 | Bacteria | 3491 |
| 1298 | Ga0495608_0103342 | 3300046511 | Bacteria | 1836 |
| 1299 | Ga0495608_0266708 | 3300046511 | Bacteria | 1065 |
| 1300 | Ga0495608_0501057 | 3300046511 | Bacteria | 735 |
| 1301 | Ga0495618_0000743 | 3300046514 | Bacteria | 22768 |
| 1302 | Ga0495618_0036169 | 3300046514 | Bacteria | 3098 |
| 1303 | Ga0495618_0422616 | 3300046514 | Bacteria | 812 |
| 1304 | Ga0495618_0821398 | 3300046514 | Bacteria | 540 |
| 1305 | Ga0495628_0214703 | 3300046516 | Bacteria | 1446 |
| 1306 | Ga0495628_0229371 | 3300046516 | Bacteria | 1392 |
| 1307 | Ga0495630_0094702 | 3300046517 | Bacteria | 2257 |
| 1308 | Ga0495630_0176568 | 3300046517 | Bacteria | 1628 |
| 1309 | Ga0495630_0462261 | 3300046517 | Bacteria | 972 |
| 1310 | Ga0495630_0559980 | 3300046517 | Bacteria | 876 |
| 1311 | Ga0495630_0814085 | 3300046517 | Bacteria | 713 |
| 1312 | Ga0495630_0953767 | 3300046517 | Bacteria | 652 |
| 1313 | Ga0495643_0072184 | 3300046522 | Bacteria | 1811 |
| 1314 | Ga0495663_0020324 | 3300046525 | Bacteria | 1905 |
| 1315 | Ga0495663_0020379 | 3300046525 | Bacteria | 1903 |
| 1316 | Ga0495666_0012771 | 3300046526 | Bacteria | 4187 |
| 1317 | Ga0495642_0053960 | 3300046528 | Bacteria | 1657 |
| 1318 | Ga0495652_0123654 | 3300046529 | Bacteria | 2059 |
| 1319 | Ga0495652_0156344 | 3300046529 | Bacteria | 1775 |
| 1320 | Ga0495665_0014539 | 3300046531 | Bacteria | 4244 |
| 1321 | Ga0495665_0028776 | 3300046531 | Bacteria | 2977 |
| 1322 | Ga0495665_0250977 | 3300046531 | Bacteria | 911 |
| 1323 | Ga0495640_0156834 | 3300046533 | Bacteria | 1461 |
| 1324 | Ga0495640_0185177 | 3300046533 | Bacteria | 1325 |
| 1325 | Ga0495640_0629692 | 3300046533 | Bacteria | 646 |
| 1326 | Ga0495586_0015359 | 3300046535 | Bacteria | 4074 |
| 1327 | Ga0495586_0126327 | 3300046535 | Bacteria | 1430 |
| 1328 | Ga0495586_0174630 | 3300046535 | Bacteria | 1214 |
| 1329 | Ga0495586_0301689 | 3300046535 | Bacteria | 918 |
| 1330 | Ga0495586_0319161 | 3300046535 | Bacteria | 891 |
| 1331 | Ga0495586_0508105 | 3300046535 | Bacteria | 695 |
| 1332 | Ga0495587_0267041 | 3300046536 | Bacteria | 960 |
| 1333 | Ga0495587_0447806 | 3300046536 | Bacteria | 715 |
| 1334 | Ga0495587_0619377 | 3300046536 | Bacteria | 595 |
| 1335 | Ga0495598_0268802 | 3300046537 | Bacteria | 637 |
| 1336 | Ga0495621_0041710 | 3300046539 | Bacteria | 1612 |
| 1337 | Ga0495621_0053555 | 3300046539 | Bacteria | 1449 |
| 1338 | Ga0495645_0013239 | 3300046543 | Bacteria | 5830 |
| 1339 | Ga0495645_0238829 | 3300046543 | Bacteria | 1213 |
| 1340 | Ga0495645_0680694 | 3300046543 | Bacteria | 626 |
| 1341 | Ga0495622_0380357 | 3300046557 | Bacteria | 609 |
| 1342 | Ga0495667_0016331 | 3300046559 | Bacteria | 5016 |
| 1343 | Ga0495667_0063143 | 3300046559 | Bacteria | 2425 |
| 1344 | Ga0495667_0220730 | 3300046559 | Bacteria | 1210 |
| 1345 | Ga0495656_0085019 | 3300046615 | Bacteria | 1436 |
| 1346 | Ga0495634_0150620 | 3300046642 | Bacteria | 1471 |
| 1347 | Ga0495634_0171853 | 3300046642 | Bacteria | 1361 |
| 1348 | Ga0495634_0192667 | 3300046642 | Bacteria | 1270 |
| 1349 | Ga0495635_0054906 | 3300046663 | Bacteria | 2744 |
| 1350 | Ga0495635_0084340 | 3300046663 | Bacteria | 2174 |
| 1351 | Ga0495659_0249609 | 3300046664 | Bacteria | 739 |
| 1352 | Ga0495661_0341275 | 3300046665 | Bacteria | 740 |
| 1353 | Ga0495588_0088616 | 3300046674 | Bacteria | 1620 |
| 1354 | Ga0495657_0049025 | 3300046675 | Bacteria | 2847 |
| 1355 | Ga0495657_0113082 | 3300046675 | Bacteria | 1718 |
| 1356 | Ga0495599_0010652 | 3300046678 | Bacteria | 5627 |
| 1357 | Ga0495599_0015785 | 3300046678 | Bacteria | 4688 |
| 1358 | Ga0495599_0224563 | 3300046678 | Bacteria | 1148 |
| 1359 | Ga0495623_0017452 | 3300046679 | Bacteria | 4637 |
| 1360 | Ga0495623_0082831 | 3300046679 | Bacteria | 1982 |
| 1361 | Ga0495623_0108146 | 3300046679 | Bacteria | 1688 |
| 1362 | Ga0495646_0016342 | 3300046680 | Bacteria | 4709 |
| 1363 | Ga0495646_0626111 | 3300046680 | Bacteria | 545 |
| 1364 | Ga0495647_0139968 | 3300046681 | Bacteria | 1031 |
| 1365 | Ga0495647_0631783 | 3300046681 | Bacteria | 504 |
| 1366 | Ga0495658_0060006 | 3300046683 | Bacteria | 2180 |
| 1367 | Ga0495658_0110421 | 3300046683 | Bacteria | 1653 |
| 1368 | Ga0495658_0338908 | 3300046683 | Bacteria | 955 |
| 1369 | Ga0495658_0495585 | 3300046683 | Bacteria | 781 |
| 1370 | Ga0495669_0163695 | 3300046684 | Bacteria | 1056 |
| 1371 | Ga0495669_0640093 | 3300046684 | Bacteria | 517 |
| 1372 | Ga0495613_0035641 | 3300046689 | Bacteria | 3691 |
| 1373 | Ga0495613_0182583 | 3300046689 | Bacteria | 1485 |
| 1374 | Ga0495613_0399046 | 3300046689 | Bacteria | 938 |
| 1375 | Ga0495613_0467808 | 3300046689 | Bacteria | 852 |
| 1376 | Ga0495624_0148945 | 3300046690 | Bacteria | 1432 |
| 1377 | Ga0495600_0043998 | 3300046809 | Bacteria | 2913 |
| 1378 | Ga0495581_0162192 | 3300047315 | Bacteria | 1307 |
| 1379 | Ga0495581_0661507 | 3300047315 | Bacteria | 603 |
| 1380 | Ga0495581_0675231 | 3300047315 | Bacteria | 596 |
| 1381 | Ga0495581_0843010 | 3300047315 | Bacteria | 525 |
| 1382 | Ga0495604_0027250 | 3300047317 | Bacteria | 4546 |
| 1383 | Ga0495604_0104964 | 3300047317 | Bacteria | 2069 |
| 1384 | Ga0495636_0036783 | 3300047318 | Bacteria | 2020 |
| 1385 | Ga0495636_0174422 | 3300047318 | Bacteria | 973 |
| 1386 | Ga0495674_0022976 | 3300047319 | Bacteria | 5745 |
| 1387 | Ga0495674_0260821 | 3300047319 | Bacteria | 1424 |
| 1388 | Ga0495674_0899048 | 3300047319 | Bacteria | 683 |
| 1389 | Ga0495676_0582121 | 3300047321 | Bacteria | 730 |
| 1390 | Ga0495680_0013035 | 3300047322 | Bacteria | 7271 |
| 1391 | Ga0495680_0091581 | 3300047322 | Bacteria | 2279 |
| 1392 | Ga0495680_0287504 | 3300047322 | Bacteria | 1157 |
| 1393 | Ga0495680_0442587 | 3300047322 | Bacteria | 891 |
| 1394 | Ga0495680_0722849 | 3300047322 | Bacteria | 656 |
| 1395 | Ga0495680_0893525 | 3300047322 | Bacteria | 574 |
| 1396 | Ga0495675_0079198 | 3300047444 | Bacteria | 2069 |
| 1397 | Ga0495675_0170389 | 3300047444 | Bacteria | 1337 |
| 1398 | Ga0495677_0106504 | 3300047445 | Bacteria | 1064 |
| 1399 | Ga0495685_031250 | 3300047447 | Bacteria | 1831 |
| 1400 | Ga0495684_0071242 | 3300047471 | Bacteria | 2641 |
| 1401 | Ga0495684_0116099 | 3300047471 | Bacteria | 2018 |
| 1402 | Ga0495684_0169445 | 3300047471 | Bacteria | 1625 |
| 1403 | Ga0495684_0271682 | 3300047471 | Bacteria | 1226 |
| 1404 | Ga0495684_0288272 | 3300047471 | Bacteria | 1182 |
| 1405 | Ga0495684_0504246 | 3300047471 | Bacteria | 832 |
| 1406 | Ga0495593_0201702 | 3300047673 | Bacteria | 1000 |
| 1407 | Ga0495602_0013466 | 3300048088 | Bacteria | 8359 |
| 1408 | Ga0495602_0100827 | 3300048088 | Bacteria | 2370 |
| 1409 | Ga0495602_0239437 | 3300048088 | Bacteria | 1358 |
| 1410 | Ga0495602_0401675 | 3300048088 | Bacteria | 977 |
| 1411 | Ga0495602_0923954 | 3300048088 | Bacteria | 579 |
| 1412 | Ga0495615_0252670 | 3300048090 | Bacteria | 559 |
| 1413 | Ga0496100_0078491 | 3300048903 | Bacteria | 2222 |
| 1414 | Ga0496100_0109226 | 3300048903 | Bacteria | 1919 |
| 1415 | Ga0496100_0289027 | 3300048903 | Bacteria | 1224 |
| 1416 | Ga0496100_0800416 | 3300048903 | Bacteria | 738 |
| 1417 | Ga0496101_0056945 | 3300048904 | Bacteria | 2826 |
| 1418 | Ga0496101_0111991 | 3300048904 | Bacteria | 2055 |
| 1419 | Ga0496101_1124416 | 3300048904 | Bacteria | 616 |
| 1420 | Ga0496102_0172439 | 3300048905 | Bacteria | 2036 |
| 1421 | Ga0496102_0970077 | 3300048905 | Bacteria | 771 |
| 1422 | Ga0496104_0065574 | 3300048907 | Bacteria | 3446 |
| 1423 | Ga0496104_0309521 | 3300048907 | Bacteria | 1492 |
| 1424 | Ga0496104_0399240 | 3300048907 | Bacteria | 1287 |
| 1425 | Ga0496105_0059694 | 3300048908 | Bacteria | 3147 |
| 1426 | Ga0496105_0070746 | 3300048908 | Bacteria | 2884 |
| 1427 | Ga0496105_0147782 | 3300048908 | Bacteria | 1933 |
| 1428 | Ga0496106_0027640 | 3300048909 | Bacteria | 4226 |
| 1429 | Ga0496106_0064193 | 3300048909 | Bacteria | 2793 |
| 1430 | Ga0496106_0318902 | 3300048909 | Bacteria | 1247 |
| 1431 | Ga0496106_0342753 | 3300048909 | Bacteria | 1200 |
| 1432 | Ga0496106_0578785 | 3300048909 | Bacteria | 900 |
| 1433 | Ga0496107_0261224 | 3300048910 | Bacteria | 1288 |
| 1434 | Ga0496107_0344283 | 3300048910 | Bacteria | 1109 |
| 1435 | Ga0496107_0711641 | 3300048910 | Bacteria | 738 |
| 1436 | Ga0496108_0035987 | 3300048911 | Bacteria | 4117 |
| 1437 | Ga0496108_0592139 | 3300048911 | Bacteria | 966 |
| 1438 | Ga0496108_1009386 | 3300048911 | Bacteria | 710 |
| 1439 | Ga0496109_0039889 | 3300048912 | Bacteria | 4251 |
| 1440 | Ga0496109_0042753 | 3300048912 | Bacteria | 4106 |
| 1441 | Ga0496109_0043173 | 3300048912 | Bacteria | 4086 |
| 1442 | Ga0496110_0007094 | 3300048913 | Bacteria | 8919 |
| 1443 | Ga0496110_0089104 | 3300048913 | Bacteria | 2757 |
| 1444 | Ga0496110_0151553 | 3300048913 | Bacteria | 2099 |
| 1445 | Ga0496111_0001415 | 3300048914 | Bacteria | 13651 |
| 1446 | Ga0496111_0072867 | 3300048914 | Bacteria | 2500 |
| 1447 | Ga0496111_0553796 | 3300048914 | Bacteria | 844 |
| 1448 | Ga0496112_0002541 | 3300048915 | Bacteria | 14732 |
| 1449 | Ga0496112_0024016 | 3300048915 | Bacteria | 5833 |
| 1450 | Ga0496112_0060181 | 3300048915 | Bacteria | 3742 |
| 1451 | Ga0496112_0079427 | 3300048915 | Bacteria | 3245 |
| 1452 | Ga0496112_0104391 | 3300048915 | Bacteria | 2804 |
| 1453 | Ga0496112_0976500 | 3300048915 | Bacteria | 767 |
| 1454 | Ga0496112_1175577 | 3300048915 | Bacteria | 684 |
| 1455 | Ga0496113_0047161 | 3300048916 | Bacteria | 3201 |
| 1456 | Ga0496113_0075448 | 3300048916 | Bacteria | 2573 |
| 1457 | Ga0496113_0156046 | 3300048916 | Bacteria | 1802 |
| 1458 | Ga0496113_0813883 | 3300048916 | Bacteria | 742 |
| 1459 | Ga0496113_1115274 | 3300048916 | Bacteria | 618 |
| 1460 | Ga0496114_0000001 | 3300048917 | Bacteria | 893286 |
| 1461 | Ga0496114_0047313 | 3300048917 | Bacteria | 3578 |
| 1462 | Ga0496114_1019079 | 3300048917 | Bacteria | 711 |
| 1463 | Ga0496115_0082370 | 3300048918 | Bacteria | 2621 |
| 1464 | Ga0501306_024127 | 3300049127 | Bacteria | 867 |
| 1465 | Ga0501306_049510 | 3300049127 | Bacteria | 671 |
| 1466 | Ga0501308_074347 | 3300049128 | Bacteria | 532 |
| 1467 | Ga0501310_074323 | 3300049130 | Bacteria | 525 |
| 1468 | Ga0501307_001003 | 3300049162 | Bacteria | 2216 |
| 1469 | Ga0501307_051693 | 3300049162 | Bacteria | 619 |
| 1470 | Ga0501296_050298 | 3300049519 | Bacteria | 609 |
| 1471 | Ga0501298_006514 | 3300049521 | Bacteria | 1911 |
| 1472 | Ga0501298_071487 | 3300049521 | Bacteria | 750 |
| 1473 | Ga0501303_022268 | 3300049526 | Bacteria | 684 |
| 1474 | Ga0501313_033044 | 3300049529 | Bacteria | 676 |
| 1475 | Ga0501313_066371 | 3300049529 | Bacteria | 517 |
| 1476 | Ga0501314_036139 | 3300049530 | Bacteria | 564 |
| 1477 | Ga0501315_027200 | 3300049531 | Bacteria | 806 |
| 1478 | Ga0501317_089645 | 3300049533 | Bacteria | 542 |
| 1479 | Ga0501320_034979 | 3300049536 | Bacteria | 639 |
| 1480 | Ga0501031_0115077 | 3300049568 | Bacteria | 1757 |
| 1481 | Ga0501031_0232197 | 3300049568 | Bacteria | 1200 |
| 1482 | Ga0501031_0959922 | 3300049568 | Bacteria | 547 |
| 1483 | Ga0501032_0082763 | 3300049569 | Bacteria | 2135 |
| 1484 | Ga0501032_0670862 | 3300049569 | Bacteria | 658 |
| 1485 | Ga0501033_0245632 | 3300049570 | Bacteria | 1269 |
| 1486 | Ga0501033_0458016 | 3300049570 | Bacteria | 885 |
| 1487 | Ga0501033_0773273 | 3300049570 | Unclassified | 650 |
| 1488 | Ga0501034_0000132 | 3300049571 | Bacteria | 138635 |
| 1489 | Ga0501034_0044308 | 3300049571 | Bacteria | 4500 |
| 1490 | Ga0501034_0196452 | 3300049571 | Bacteria | 1977 |
| 1491 | Ga0501034_0396995 | 3300049571 | Bacteria | 1302 |
| 1492 | Ga0501034_0762996 | 3300049571 | Bacteria | 862 |
| 1493 | Ga0501034_0806897 | 3300049571 | Bacteria | 831 |
| 1494 | Ga0501036_0170582 | 3300049572 | Bacteria | 1833 |
| 1495 | Ga0501036_0190593 | 3300049572 | Bacteria | 1725 |
| 1496 | Ga0501036_0297376 | 3300049572 | Bacteria | 1350 |
| 1497 | Ga0501036_0311648 | 3300049572 | Bacteria | 1315 |
| 1498 | Ga0501037_0287470 | 3300049573 | Bacteria | 1144 |
| 1499 | Ga0501037_0427947 | 3300049573 | Bacteria | 905 |
| 1500 | Ga0501037_0451245 | 3300049573 | Bacteria | 877 |
| 1501 | Ga0501037_0693149 | 3300049573 | Bacteria | 678 |
| 1502 | Ga0501038_0011902 | 3300049574 | Bacteria | 7941 |
| 1503 | Ga0501038_0353513 | 3300049574 | Bacteria | 1144 |
| 1504 | Ga0501038_0513220 | 3300049574 | Bacteria | 915 |
| 1505 | Ga0501038_1208946 | 3300049574 | Bacteria | 548 |
| 1506 | Ga0501039_0103131 | 3300049575 | Bacteria | 2227 |
| 1507 | Ga0501039_0196869 | 3300049575 | Bacteria | 1584 |
| 1508 | Ga0501039_0663518 | 3300049575 | Bacteria | 816 |
| 1509 | Ga0501040_0021934 | 3300049576 | Bacteria | 4270 |
| 1510 | Ga0501040_0069484 | 3300049576 | Bacteria | 2429 |
| 1511 | Ga0501041_0023985 | 3300049577 | Bacteria | 3660 |
| 1512 | Ga0501041_0117942 | 3300049577 | Bacteria | 1648 |
| 1513 | Ga0501041_0135383 | 3300049577 | Bacteria | 1535 |
| 1514 | Ga0501041_0398134 | 3300049577 | Bacteria | 872 |
| 1515 | Ga0501042_0037878 | 3300049578 | Bacteria | 3423 |
| 1516 | Ga0501042_0215413 | 3300049578 | Bacteria | 1385 |
| 1517 | Ga0501042_0407104 | 3300049578 | Bacteria | 986 |
| 1518 | Ga0501042_0533108 | 3300049578 | Bacteria | 853 |
| 1519 | Ga0501043_0000829 | 3300049579 | Bacteria | 27458 |
| 1520 | Ga0501043_0047600 | 3300049579 | Bacteria | 3371 |
| 1521 | Ga0501046_0000117 | 3300049580 | Bacteria | 84016 |
| 1522 | Ga0501046_0028687 | 3300049580 | Bacteria | 4531 |
| 1523 | Ga0501046_0047535 | 3300049580 | Bacteria | 3402 |
| 1524 | Ga0501046_0102764 | 3300049580 | Bacteria | 2191 |
| 1525 | Ga0501046_0213074 | 3300049580 | Bacteria | 1433 |
| 1526 | Ga0501046_0278630 | 3300049580 | Bacteria | 1225 |
| 1527 | Ga0501046_0447386 | 3300049580 | Bacteria | 929 |
| 1528 | Ga0501047_0029942 | 3300049581 | Bacteria | 5247 |
| 1529 | Ga0501047_0130028 | 3300049581 | Bacteria | 2398 |
| 1530 | Ga0501047_0130576 | 3300049581 | Bacteria | 2393 |
| 1531 | Ga0501048_0031361 | 3300049582 | Bacteria | 3844 |
| 1532 | Ga0501048_0118379 | 3300049582 | Bacteria | 1871 |
| 1533 | Ga0501048_0186441 | 3300049582 | Bacteria | 1470 |
| 1534 | Ga0501048_0229725 | 3300049582 | Bacteria | 1316 |
| 1535 | Ga0501048_0373847 | 3300049582 | Bacteria | 1017 |
| 1536 | Ga0501048_0473535 | 3300049582 | Bacteria | 897 |
| 1537 | Ga0501048_0620527 | 3300049582 | Bacteria | 776 |
| 1538 | Ga0501067_0014484 | 3300049583 | Bacteria | 4365 |
| 1539 | Ga0501067_0039490 | 3300049583 | Bacteria | 2620 |
| 1540 | Ga0501067_0060801 | 3300049583 | Bacteria | 2091 |
| 1541 | Ga0501067_0066718 | 3300049583 | Bacteria | 1992 |
| 1542 | Ga0501067_0232860 | 3300049583 | Bacteria | 1025 |
| 1543 | Ga0501067_0328662 | 3300049583 | Bacteria | 851 |
| 1544 | Ga0501068_0001673 | 3300049584 | Bacteria | 11845 |
| 1545 | Ga0501068_0008160 | 3300049584 | Bacteria | 5818 |
| 1546 | Ga0501068_0075235 | 3300049584 | Bacteria | 2065 |
| 1547 | Ga0501068_0131811 | 3300049584 | Bacteria | 1563 |
| 1548 | Ga0501068_0335310 | 3300049584 | Bacteria | 971 |
| 1549 | Ga0501068_1054470 | 3300049584 | Bacteria | 537 |
| 1550 | Ga0501069_0008330 | 3300049585 | Bacteria | 5444 |
| 1551 | Ga0501069_0017995 | 3300049585 | Bacteria | 3810 |
| 1552 | Ga0501069_0074284 | 3300049585 | Bacteria | 1907 |
| 1553 | Ga0501069_0183155 | 3300049585 | Bacteria | 1211 |
| 1554 | Ga0501069_0212562 | 3300049585 | Bacteria | 1123 |
| 1555 | Ga0501069_0273842 | 3300049585 | Bacteria | 987 |
| 1556 | Ga0501069_0772874 | 3300049585 | Bacteria | 581 |
| 1557 | Ga0501069_0815877 | 3300049585 | Bacteria | 566 |
| 1558 | Ga0501070_0013050 | 3300049586 | Bacteria | 7001 |
| 1559 | Ga0501070_0032011 | 3300049586 | Bacteria | 4403 |
| 1560 | Ga0501070_0063385 | 3300049586 | Bacteria | 3062 |
| 1561 | Ga0501070_0069675 | 3300049586 | Bacteria | 2912 |
| 1562 | Ga0501070_0089832 | 3300049586 | Bacteria | 2542 |
| 1563 | Ga0501070_0097328 | 3300049586 | Bacteria | 2434 |
| 1564 | Ga0501070_0171248 | 3300049586 | Bacteria | 1788 |
| 1565 | Ga0501070_0509274 | 3300049586 | Bacteria | 966 |
| 1566 | Ga0501070_0513201 | 3300049586 | Bacteria | 962 |
| 1567 | Ga0501071_0012801 | 3300049587 | Bacteria | 5704 |
| 1568 | Ga0501071_0238684 | 3300049587 | Bacteria | 1370 |
| 1569 | Ga0501071_0481689 | 3300049587 | Bacteria | 951 |
| 1570 | Ga0501071_0732719 | 3300049587 | Bacteria | 761 |
| 1571 | Ga0501071_0839822 | 3300049587 | Bacteria | 708 |
| 1572 | Ga0501071_0919752 | 3300049587 | Bacteria | 675 |
| 1573 | Ga0501072_0006109 | 3300049588 | Bacteria | 9187 |
| 1574 | Ga0501072_0010585 | 3300049588 | Bacteria | 7024 |
| 1575 | Ga0501072_0032455 | 3300049588 | Bacteria | 4090 |
| 1576 | Ga0501072_0053900 | 3300049588 | Bacteria | 3168 |
| 1577 | Ga0501072_0154703 | 3300049588 | Bacteria | 1829 |
| 1578 | Ga0501072_0209787 | 3300049588 | Bacteria | 1552 |
| 1579 | Ga0501072_0212282 | 3300049588 | Bacteria | 1542 |
| 1580 | Ga0501072_0234614 | 3300049588 | Bacteria | 1461 |
| 1581 | Ga0501072_0265703 | 3300049588 | Bacteria | 1365 |
| 1582 | Ga0501072_0658239 | 3300049588 | Bacteria | 824 |
| 1583 | Ga0501072_1358210 | 3300049588 | Bacteria | 550 |
| 1584 | Ga0501073_0170984 | 3300049589 | Bacteria | 1504 |
| 1585 | Ga0501073_0174870 | 3300049589 | Bacteria | 1486 |
| 1586 | Ga0501073_0772218 | 3300049589 | Bacteria | 663 |
| 1587 | Ga0501074_0069510 | 3300049590 | Bacteria | 2532 |
| 1588 | Ga0501074_0084841 | 3300049590 | Bacteria | 2270 |
| 1589 | Ga0501074_0165238 | 3300049590 | Bacteria | 1580 |
| 1590 | Ga0501074_0246973 | 3300049590 | Bacteria | 1269 |
| 1591 | Ga0501075_0006664 | 3300049591 | Bacteria | 7962 |
| 1592 | Ga0501075_0029122 | 3300049591 | Bacteria | 4082 |
| 1593 | Ga0501075_0036489 | 3300049591 | Bacteria | 3669 |
| 1594 | Ga0501075_0165817 | 3300049591 | Bacteria | 1685 |
| 1595 | Ga0501075_0267549 | 3300049591 | Bacteria | 1303 |
| 1596 | Ga0501075_0319160 | 3300049591 | Bacteria | 1184 |
| 1597 | Ga0501076_0006442 | 3300049592 | Bacteria | 8516 |
| 1598 | Ga0501076_0054868 | 3300049592 | Bacteria | 3159 |
| 1599 | Ga0501076_0069214 | 3300049592 | Bacteria | 2820 |
| 1600 | Ga0501076_0219729 | 3300049592 | Bacteria | 1553 |
| 1601 | Ga0501076_0226375 | 3300049592 | Bacteria | 1528 |
| 1602 | Ga0501076_0244716 | 3300049592 | Bacteria | 1467 |
| 1603 | Ga0501076_0547773 | 3300049592 | Bacteria | 954 |
| 1604 | Ga0501076_0949277 | 3300049592 | Bacteria | 709 |
| 1605 | Ga0501076_1109836 | 3300049592 | Bacteria | 651 |
| 1606 | Ga0501077_0002603 | 3300049593 | Bacteria | 10813 |
| 1607 | Ga0501077_0003447 | 3300049593 | Bacteria | 9494 |
| 1608 | Ga0501077_0048237 | 3300049593 | Bacteria | 2705 |
| 1609 | Ga0501077_0152205 | 3300049593 | Bacteria | 1468 |
| 1610 | Ga0501077_0243273 | 3300049593 | Bacteria | 1144 |
| 1611 | Ga0501077_0383412 | 3300049593 | Bacteria | 898 |
| 1612 | Ga0501077_0619854 | 3300049593 | Bacteria | 695 |
| 1613 | Ga0501198_152313 | 3300049649 | Bacteria | 510 |
| 1614 | Ga0501202_033027 | 3300049652 | Bacteria | 1088 |
| 1615 | Ga0501202_053765 | 3300049652 | Bacteria | 897 |
| 1616 | Ga0501209_004058 | 3300049656 | Bacteria | 2494 |
| 1617 | Ga0501209_143699 | 3300049656 | Bacteria | 716 |
| 1618 | Ga0501216_009705 | 3300049660 | Bacteria | 1539 |
| 1619 | Ga0501216_046341 | 3300049660 | Bacteria | 844 |
| 1620 | Ga0501216_067720 | 3300049660 | Bacteria | 732 |
| 1621 | Ga0501216_174444 | 3300049660 | Bacteria | 522 |
| 1622 | Ga0501217_119395 | 3300049661 | Bacteria | 764 |
| 1623 | Ga0501217_189877 | 3300049661 | Bacteria | 635 |
| 1624 | Ga0501217_243053 | 3300049661 | Bacteria | 577 |
| 1625 | Ga0501223_008477 | 3300049663 | Bacteria | 2097 |
| 1626 | Ga0501224_001238 | 3300049664 | Bacteria | 3359 |
| 1627 | Ga0501227_018036 | 3300049665 | Bacteria | 1598 |
| 1628 | Ga0501230_009571 | 3300049667 | Bacteria | 1494 |
| 1629 | Ga0501233_004905 | 3300049668 | Bacteria | 2474 |
| 1630 | Ga0501233_101052 | 3300049668 | Bacteria | 763 |
| 1631 | Ga0501235_007524 | 3300049669 | Bacteria | 2370 |
| 1632 | Ga0501236_051361 | 3300049670 | Bacteria | 709 |
| 1633 | Ga0501239_013408 | 3300049672 | Bacteria | 938 |
| 1634 | Ga0501239_025043 | 3300049672 | Bacteria | 755 |
| 1635 | Ga0501239_027332 | 3300049672 | Bacteria | 732 |
| 1636 | Ga0501242_033433 | 3300049674 | Bacteria | 704 |
| 1637 | Ga0501242_052523 | 3300049674 | Bacteria | 602 |
| 1638 | Ga0501243_004221 | 3300049675 | Bacteria | 2151 |
| 1639 | Ga0501243_012793 | 3300049675 | Bacteria | 1328 |
| 1640 | Ga0501247_010669 | 3300049677 | Bacteria | 1097 |
| 1641 | Ga0501249_018960 | 3300049679 | Bacteria | 1491 |
| 1642 | Ga0501249_172577 | 3300049679 | Bacteria | 555 |
| 1643 | Ga0501250_041481 | 3300049680 | Bacteria | 677 |
| 1644 | Ga0501251_076902 | 3300049681 | Bacteria | 579 |
| 1645 | Ga0501253_078750 | 3300049683 | Bacteria | 740 |
| 1646 | Ga0501256_042400 | 3300049685 | Bacteria | 543 |
| 1647 | Ga0501257_008968 | 3300049686 | Bacteria | 2254 |
| 1648 | Ga0501257_118845 | 3300049686 | Bacteria | 706 |
| 1649 | Ga0501257_123774 | 3300049686 | Bacteria | 695 |
| 1650 | Ga0501257_166148 | 3300049686 | Bacteria | 617 |
| 1651 | Ga0501257_166883 | 3300049686 | Bacteria | 616 |
| 1652 | Ga0501258_012429 | 3300049687 | Bacteria | 923 |
| 1653 | Ga0501259_084809 | 3300049688 | Bacteria | 702 |
| 1654 | Ga0501259_143473 | 3300049688 | Bacteria | 586 |
| 1655 | Ga0501261_045769 | 3300049690 | Bacteria | 703 |
| 1656 | Ga0501261_050502 | 3300049690 | Bacteria | 680 |
| 1657 | Ga0501221_065122 | 3300049704 | Bacteria | 850 |
| 1658 | Ga0501221_111637 | 3300049704 | Bacteria | 689 |
| 1659 | Ga0501221_237514 | 3300049704 | Bacteria | 519 |
| 1660 | Ga0501225_0004791 | 3300049705 | Bacteria | 4004 |
| 1661 | Ga0501234_001400 | 3300049707 | Bacteria | 3791 |
| 1662 | Ga0501234_097071 | 3300049707 | Bacteria | 533 |
| 1663 | Ga0501079_0012691 | 3300049741 | Bacteria | 6435 |
| 1664 | Ga0501079_0019559 | 3300049741 | Bacteria | 5172 |
| 1665 | Ga0501079_0035622 | 3300049741 | Bacteria | 3832 |
| 1666 | Ga0501079_0055628 | 3300049741 | Bacteria | 3053 |
| 1667 | Ga0501079_0074686 | 3300049741 | Bacteria | 2621 |
| 1668 | Ga0501079_0162200 | 3300049741 | Bacteria | 1743 |
| 1669 | Ga0501079_0202075 | 3300049741 | Bacteria | 1552 |
| 1670 | Ga0501079_0610392 | 3300049741 | Bacteria | 858 |
| 1671 | Ga0501079_0611211 | 3300049741 | Bacteria | 858 |
| 1672 | Ga0501079_0718441 | 3300049741 | Bacteria | 786 |
| 1673 | Ga0501080_0002929 | 3300049742 | Bacteria | 14986 |
| 1674 | Ga0501080_0004569 | 3300049742 | Bacteria | 12338 |
| 1675 | Ga0501080_0092828 | 3300049742 | Bacteria | 2803 |
| 1676 | Ga0501080_0365132 | 3300049742 | Bacteria | 1302 |
| 1677 | Ga0501080_0404222 | 3300049742 | Bacteria | 1228 |
| 1678 | Ga0501080_0607070 | 3300049742 | Bacteria | 971 |
| 1679 | Ga0501080_1618640 | 3300049742 | Bacteria | 548 |
| 1680 | Ga0501081_0019645 | 3300049743 | Bacteria | 4501 |
| 1681 | Ga0501081_0084738 | 3300049743 | Bacteria | 2223 |
| 1682 | Ga0501081_0099127 | 3300049743 | Bacteria | 2058 |
| 1683 | Ga0501081_0125422 | 3300049743 | Bacteria | 1831 |
| 1684 | Ga0501081_1455032 | 3300049743 | Bacteria | 520 |
| 1685 | Ga0501083_0000071 | 3300049744 | Bacteria | 67336 |
| 1686 | Ga0501083_0014932 | 3300049744 | Bacteria | 5433 |
| 1687 | Ga0501083_0043800 | 3300049744 | Bacteria | 3031 |
| 1688 | Ga0501083_0083137 | 3300049744 | Bacteria | 2121 |
| 1689 | Ga0501083_0212131 | 3300049744 | Bacteria | 1262 |
| 1690 | Ga0501083_0348811 | 3300049744 | Bacteria | 962 |
| 1691 | Ga0501083_0923936 | 3300049744 | Bacteria | 568 |
| 1692 | Ga0501232_010440 | 3300049757 | Bacteria | 1047 |
| 1693 | Ga0501262_049657 | 3300049759 | Bacteria | 646 |
| 1694 | Ga0501263_055879 | 3300049760 | Bacteria | 609 |
| 1695 | Ga0501265_030122 | 3300049762 | Bacteria | 777 |
| 1696 | Ga0501266_003064 | 3300049763 | Bacteria | 2080 |
| 1697 | Ga0501267_004229 | 3300049764 | Bacteria | 1327 |
| 1698 | Ga0501267_008912 | 3300049764 | Bacteria | 995 |
| 1699 | Ga0501268_002758 | 3300049765 | Bacteria | 2340 |
| 1700 | Ga0501268_008026 | 3300049765 | Bacteria | 1588 |
| 1701 | Ga0501268_034317 | 3300049765 | Bacteria | 932 |
| 1702 | Ga0501268_039586 | 3300049765 | Bacteria | 883 |
| 1703 | Ga0501268_046406 | 3300049765 | Bacteria | 831 |
| 1704 | Ga0501268_100477 | 3300049765 | Bacteria | 619 |
| 1705 | Ga0501268_107212 | 3300049765 | Bacteria | 606 |
| 1706 | Ga0501270_012851 | 3300049767 | Bacteria | 1150 |
| 1707 | Ga0501270_070908 | 3300049767 | Bacteria | 673 |
| 1708 | Ga0501270_092479 | 3300049767 | Bacteria | 619 |
| 1709 | Ga0501270_108129 | 3300049767 | Bacteria | 590 |
| 1710 | Ga0501271_002195 | 3300049768 | Bacteria | 1725 |
| 1711 | Ga0501272_013617 | 3300049769 | Bacteria | 933 |
| 1712 | Ga0501273_008374 | 3300049770 | Bacteria | 1238 |
| 1713 | Ga0501273_035883 | 3300049770 | Bacteria | 720 |
| 1714 | Ga0501273_080648 | 3300049770 | Bacteria | 541 |
| 1715 | Ga0501274_002181 | 3300049771 | Bacteria | 1526 |
| 1716 | Ga0501275_043350 | 3300049772 | Bacteria | 638 |
| 1717 | Ga0501283_008388 | 3300049779 | Bacteria | 1488 |
| 1718 | Ga0501035_0124162 | 3300049822 | Bacteria | 2254 |
| 1719 | Ga0501035_0186524 | 3300049822 | Bacteria | 1785 |
| 1720 | Ga0501035_0204036 | 3300049822 | Bacteria | 1694 |
| 1721 | Ga0501035_0583180 | 3300049822 | Bacteria | 913 |
| 1722 | Ga0501035_0792784 | 3300049822 | Bacteria | 757 |
| 1723 | Ga0501035_1113324 | 3300049822 | Bacteria | 616 |
| 1724 | Ga0501044_0013639 | 3300049823 | Bacteria | 8783 |
| 1725 | Ga0501044_0064096 | 3300049823 | Bacteria | 3753 |
| 1726 | Ga0501044_0074963 | 3300049823 | Bacteria | 3436 |
| 1727 | Ga0501044_0431474 | 3300049823 | Bacteria | 1227 |
| 1728 | Ga0501044_0502384 | 3300049823 | Bacteria | 1114 |
| 1729 | Ga0501044_0630322 | 3300049823 | Bacteria | 963 |
| 1730 | Ga0501045_0004175 | 3300049824 | Bacteria | 9980 |
| 1731 | Ga0501045_0032763 | 3300049824 | Bacteria | 3766 |
| 1732 | Ga0501045_0086402 | 3300049824 | Bacteria | 2315 |
| 1733 | Ga0501045_0161793 | 3300049824 | Bacteria | 1666 |
| 1734 | Ga0501045_0241244 | 3300049824 | Bacteria | 1345 |
| 1735 | Ga0501045_0330576 | 3300049824 | Bacteria | 1134 |
| 1736 | Ga0501045_0562930 | 3300049824 | Bacteria | 845 |
| 1737 | Ga0501204_013205 | 3300049850 | Bacteria | 1001 |
| 1738 | Ga0501212_001652 | 3300049851 | Bacteria | 2552 |
| 1739 | Ga0501212_083701 | 3300049851 | Bacteria | 580 |
| 1740 | nmdc:mga05p37_151379_c1 | 3300050507 | Bacteria | 2837 |
| 1741 | nmdc:mga05p37_429595_c1 | 3300050507 | Bacteria | 1535 |
| 1742 | nmdc:mga05p37_518028_c1 | 3300050507 | Bacteria | 1365 |
| 1743 | nmdc:mga05p37_663841_c1 | 3300050507 | Bacteria | 1165 |
| 1744 | nmdc:mga09592_311408_c1 | 3300050508 | Bacteria | 1364 |
| 1745 | nmdc:mga09592_413108_c1 | 3300050508 | Bacteria | 1166 |
| 1746 | nmdc:mga09592_759854_c1 | 3300050508 | Bacteria | 822 |
| 1747 | nmdc:mga0qj67_339484_c1 | 3300050509 | Bacteria | 1215 |
| 1748 | nmdc:mga0qj67_77954_c1 | 3300050509 | Bacteria | 2652 |
| 1749 | nmdc:mga0qj67_793471_c1 | 3300050509 | Bacteria | 750 |
| 1750 | nmdc:mga06r32_1497899_c1 | 3300050510 | Bacteria | 615 |
| 1751 | nmdc:mga06r32_342365_c1 | 3300050510 | Bacteria | 1480 |
| 1752 | nmdc:mga06r32_429330_c1 | 3300050510 | Bacteria | 1302 |
| 1753 | nmdc:mga06r32_46152_c1 | 3300050510 | Bacteria | 4157 |
| 1754 | nmdc:mga06r32_6558_c1 | 3300050510 | Bacteria | 10457 |
| 1755 | nmdc:mga08y16_116742_c1 | 3300050511 | Bacteria | 2778 |
| 1756 | nmdc:mga08y16_144197_c1 | 3300050511 | Bacteria | 2475 |
| 1757 | nmdc:mga08y16_22055_c1 | 3300050511 | Bacteria | 6725 |
| 1758 | nmdc:mga08y16_281933_c1 | 3300050511 | Bacteria | 1714 |
| 1759 | nmdc:mga08y16_288511_c1 | 3300050511 | Bacteria | 1692 |
| 1760 | nmdc:mga08y16_311113_c1 | 3300050511 | Bacteria | 1622 |
| 1761 | nmdc:mga08y16_315866_c1 | 3300050511 | Bacteria | 1609 |
| 1762 | nmdc:mga08y16_699500_c1 | 3300050511 | Bacteria | 1014 |
| 1763 | nmdc:mga0n895_1181678_c1 | 3300050512 | Bacteria | 739 |
| 1764 | nmdc:mga0n895_190360_c1 | 3300050512 | Bacteria | 2083 |
| 1765 | nmdc:mga0n895_21843_c1 | 3300050512 | Bacteria | 5991 |
| 1766 | nmdc:mga0n895_253314_c1 | 3300050512 | Bacteria | 1787 |
| 1767 | nmdc:mga0n895_358036_c1 | 3300050512 | Bacteria | 1478 |
| 1768 | nmdc:mga0n895_464171_c1 | 3300050512 | Bacteria | 1278 |
| 1769 | nmdc:mga0n895_512489_c1 | 3300050512 | Bacteria | 1208 |
| 1770 | nmdc:mga0n895_516105_c1 | 3300050512 | Bacteria | 1203 |
| 1771 | nmdc:mga0n895_573569_c1 | 3300050512 | Bacteria | 1133 |
| 1772 | nmdc:mga0rr50_11870_c2 | 3300050513 | Bacteria | 5117 |
| 1773 | nmdc:mga0rr50_1342219_c1 | 3300050513 | Bacteria | 606 |
| 1774 | nmdc:mga0rr50_274532_c1 | 3300050513 | Bacteria | 1405 |
| 1775 | nmdc:mga0rr50_409005_c1 | 3300050513 | Bacteria | 1147 |
| 1776 | nmdc:mga0rr50_508223_c1 | 3300050513 | Bacteria | 1025 |
| 1777 | nmdc:mga0rr50_677514_c1 | 3300050513 | Bacteria | 880 |
| 1778 | nmdc:mga08x19_145676_c1 | 3300050514 | Bacteria | 1602 |
| 1779 | nmdc:mga08x19_1503_c1 | 3300050514 | Bacteria | 14447 |
| 1780 | nmdc:mga08x19_24882_c1 | 3300050514 | Bacteria | 3726 |
| 1781 | nmdc:mga08x19_98185_c1 | 3300050514 | Bacteria | 1940 |
| 1782 | nmdc:mga0a205_26534_c1 | 3300050515 | Bacteria | 5526 |
| 1783 | nmdc:mga0a205_71485_c1 | 3300050515 | Bacteria | 3351 |
| 1784 | Ga0495601_0410362 | 3300053077 | Bacteria | 878 |
| 1785 | Ga0495655_0204864 | 3300053083 | Bacteria | 646 |
| 1786 | Ga0495655_0287792 | 3300053083 | Bacteria | 562 |
| 1787 | Ga0495595_0402086 | 3300053084 | Bacteria | 694 |
| 1788 | Ga0495595_0672761 | 3300053084 | Bacteria | 530 |
| 1789 | Ga0495619_0033082 | 3300053085 | Bacteria | 3357 |
| 1790 | Ga0495619_0216400 | 3300053085 | Bacteria | 1327 |
| 1791 | Ga0495619_0901547 | 3300053085 | Bacteria | 595 |
| 1792 | Ga0501084_0032504 | 3300054114 | Bacteria | 4364 |
| 1793 | Ga0501084_0040463 | 3300054114 | Bacteria | 3899 |
| 1794 | Ga0501084_0042401 | 3300054114 | Bacteria | 3807 |
| 1795 | Ga0501084_0053363 | 3300054114 | Bacteria | 3381 |
| 1796 | Ga0501084_0055496 | 3300054114 | Bacteria | 3314 |
| 1797 | Ga0501084_0060696 | 3300054114 | Bacteria | 3165 |
| 1798 | Ga0501084_0980505 | 3300054114 | Bacteria | 710 |
| 1799 | Ga0501084_1171158 | 3300054114 | Unclassified | 645 |
| 1800 | Ga0590071_003501 | 3300059421 | Bacteria | 3853 |
| 1801 | Ga0590071_006633 | 3300059421 | Bacteria | 2751 |
| 1802 | Ga0590071_007102 | 3300059421 | Bacteria | 2652 |
| 1803 | Ga0590071_009609 | 3300059421 | Bacteria | 2271 |
| 1804 | Ga0590071_018064 | 3300059421 | Bacteria | 1658 |
| 1805 | Ga0590074_010487 | 3300059423 | Bacteria | 1549 |
| 1806 | Ga0590074_063876 | 3300059423 | Bacteria | 687 |
| 1807 | Ga0590075_044972 | 3300059424 | Bacteria | 1130 |
| 1808 | Ga0590077_064462 | 3300059426 | Bacteria | 833 |
| 1809 | Ga0587084_125122 | 3300059477 | Bacteria | 544 |
| 1810 | Ga0587066_016651 | 3300059490 | Bacteria | 1161 |
| 1811 | Ga0587073_0076206 | 3300059492 | Bacteria | 822 |
| 1812 | Ga0587085_153754 | 3300059506 | Bacteria | 533 |
| 1813 | Ga0587085_183001 | 3300059506 | Bacteria | 503 |
| 1814 | Ga0587091_057781 | 3300059511 | Bacteria | 815 |
| 1815 | Ga0587091_084500 | 3300059511 | Bacteria | 718 |
| 1816 | Ga0587113_036215 | 3300059625 | Bacteria | 577 |
| 1817 | Ga0587067_142955 | 3300059640 | Bacteria | 594 |
| 1818 | Ga0587076_201833 | 3300059645 | Bacteria | 512 |
| 1819 | Ga0587079_047120 | 3300059647 | Bacteria | 892 |
| 1820 | Ga0587071_013833 | 3300060344 | Bacteria | 1396 |
| 1821 | Ga0587071_109511 | 3300060344 | Bacteria | 648 |
| 1822 | Ga0501082_0004163 | 3300060353 | Bacteria | 12644 |
| 1823 | Ga0501082_0019498 | 3300060353 | Bacteria | 5847 |
| 1824 | Ga0501082_0033970 | 3300060353 | Bacteria | 4399 |
| 1825 | Ga0501082_0052165 | 3300060353 | Bacteria | 3525 |
| 1826 | Ga0501082_0061602 | 3300060353 | Bacteria | 3230 |
| 1827 | Ga0501082_0063320 | 3300060353 | Bacteria | 3184 |
| 1828 | Ga0501082_0071941 | 3300060353 | Bacteria | 2978 |
| 1829 | Ga0501082_0112785 | 3300060353 | Bacteria | 2354 |
| 1830 | Ga0501082_0226165 | 3300060353 | Bacteria | 1628 |
| 1831 | Ga0501082_0404454 | 3300060353 | Bacteria | 1191 |
| 1832 | Ga0501082_0462845 | 3300060353 | Bacteria | 1108 |
| 1833 | Ga0501082_0472839 | 3300060353 | Bacteria | 1095 |
| 1834 | Ga0501082_0898369 | 3300060353 | Bacteria | 775 |
| 1835 | Ga0501082_1328866 | 3300060353 | Bacteria | 628 |
| 1836 | Ga0530510_0055415 | 3300061734 | Bacteria | 2864 |
| 1837 | Ga0530510_0113500 | 3300061734 | Bacteria | 1986 |
| 1838 | Ga0530510_0155250 | 3300061734 | Bacteria | 1691 |
| 1839 | Ga0530510_0165371 | 3300061734 | Bacteria | 1637 |
| 1840 | Ga0530510_0331267 | 3300061734 | Bacteria | 1142 |
| 1841 | Ga0530510_0469868 | 3300061734 | Bacteria | 952 |
| 1842 | Ga0530510_1158495 | 3300061734 | Bacteria | 592 |
| 1843 | Ga0530510_1211158 | 3300061734 | Bacteria | 579 |
| 1844 | Ga0496112_0606487 | |||
| 1845 | JGI26145J50221_1006158 | |||
| 1846 | Ga0058863_10086968 | |||
| 1847 | Ga0058861_11789312 | |||
| 1848 | Ga0058862_12643353 | |||
| 1849 | Ga0065712_10074846 | |||
| 1850 | Ga0065712_10439994 | |||
| 1851 | Ga0065712_10815210 | |||
| 1852 | Ga0065715_10057212 | |||
| 1853 | Ga0065715_10116004 | |||
| 1854 | Ga0065715_10299813 | |||
| 1855 | Ga0065715_10811487 | |||
| 1856 | Ga0065707_10432448 | |||
| 1857 | Ga0065707_10717645 | |||
| 1858 | Ga0070658_10171352 | |||
| 1859 | Ga0070658_10561985 | |||
| 1860 | Ga0070658_11648416 | |||
| 1861 | Ga0070658_11812599 | |||
| 1862 | Ga0070676_10010363 | |||
| 1863 | Ga0070676_10089561 | |||
| 1864 | Ga0070676_10624397 | |||
| 1865 | Ga0070683_100003340 | |||
| 1866 | Ga0070683_100058071 | |||
| 1867 | Ga0070683_100071412 | |||
| 1868 | Ga0070683_100366719 | |||
| 1869 | Ga0070683_100862286 | |||
| 1870 | Ga0070683_100935969 | |||
| 1871 | Ga0070683_101036957 | |||
| 1872 | Ga0070683_101164768 | |||
| 1873 | Ga0070683_101170690 | |||
| 1874 | Ga0070690_100021133 | |||
| 1875 | Ga0070690_100086374 | |||
| 1876 | Ga0070690_100216988 | |||
| 1877 | Ga0070670_100240332 | |||
| 1878 | Ga0070670_100322579 | |||
| 1879 | Ga0070670_100727273 | |||
| 1880 | Ga0070670_100806131 | |||
| 1881 | Ga0070677_10078225 | |||
| 1882 | Ga0070677_10528114 | |||
| 1883 | Ga0068869_100874259 | |||
| 1884 | Ga0068869_100892987 | |||
| 1885 | Ga0068869_100907740 | |||
| 1886 | Ga0068869_100984090 | |||
| 1887 | Ga0068869_100984138 | |||
| 1888 | Ga0070666_10093653 | |||
| 1889 | Ga0070666_10215569 | |||
| 1890 | Ga0070666_10327378 | |||
| 1891 | Ga0070666_10847074 | |||
| 1892 | Ga0070680_100003421 | |||
| 1893 | Ga0070680_100011604 | |||
| 1894 | Ga0070680_100048050 | |||
| 1895 | Ga0070680_100103171 | |||
| 1896 | Ga0070680_100119665 | |||
| 1897 | Ga0070680_100156870 | |||
| 1898 | Ga0070680_100163795 | |||
| 1899 | Ga0070680_100321809 | |||
| 1900 | Ga0070680_100369443 | |||
| 1901 | Ga0070680_100464968 | |||
| 1902 | Ga0070680_100466058 | |||
| 1903 | Ga0070680_101315673 | |||
| 1904 | Ga0070682_100029919 | |||
| 1905 | Ga0070682_100060558 | |||
| 1906 | Ga0070682_100203345 | |||
| 1907 | Ga0070682_100307437 | |||
| 1908 | Ga0070682_100309796 | |||
| 1909 | Ga0070682_101120793 | |||
| 1910 | Ga0068868_100013085 | |||
| 1911 | Ga0068868_100141727 | |||
| 1912 | Ga0068868_100320488 | |||
| 1913 | Ga0068868_100783022 | |||
| 1914 | Ga0068868_101742480 | |||
| 1915 | Ga0070660_100100995 | |||
| 1916 | Ga0070660_100250698 | |||
| 1917 | Ga0070660_100293209 | |||
| 1918 | Ga0070660_101042557 | |||
| 1919 | Ga0070660_101050711 | |||
| 1920 | Ga0070660_101184695 | |||
| 1921 | Ga0070689_100012783 | |||
| 1922 | Ga0070689_100031628 | |||
| 1923 | Ga0070689_100038522 | |||
| 1924 | Ga0070689_100118383 | |||
| 1925 | Ga0070689_101465145 | |||
| 1926 | Ga0070691_10028966 | |||
| 1927 | Ga0070691_10186317 | |||
| 1928 | Ga0070691_10272178 | |||
| 1929 | Ga0070687_100018908 | |||
| 1930 | Ga0070687_100038862 | |||
| 1931 | Ga0070687_100623865 | |||
| 1932 | Ga0070661_100028453 | |||
| 1933 | Ga0070661_100029610 | |||
| 1934 | Ga0070661_100034455 | |||
| 1935 | Ga0070661_100323146 | |||
| 1936 | Ga0070661_100383300 | |||
| 1937 | Ga0070661_100459024 | |||
| 1938 | Ga0070661_100512303 | |||
| 1939 | Ga0070661_101477934 | |||
| 1940 | Ga0070661_101593807 | |||
| 1941 | Ga0070661_101786665 | |||
| 1942 | Ga0070692_10085682 | |||
| 1943 | Ga0070692_10152386 | |||
| 1944 | Ga0070692_10236677 | |||
| 1945 | Ga0070692_10595750 | |||
| 1946 | Ga0070692_11148700 | |||
| 1947 | Ga0070668_100254925 | |||
| 1948 | Ga0070668_100802060 | |||
| 1949 | Ga0070668_101483884 | |||
| 1950 | Ga0070669_100025980 | |||
| 1951 | Ga0070669_100182704 | |||
| 1952 | Ga0070669_100218637 | |||
| 1953 | Ga0070669_100571542 | |||
| 1954 | Ga0070675_100303016 | |||
| 1955 | Ga0070675_100374469 | |||
| 1956 | Ga0070675_101472671 | |||
| 1957 | Ga0070675_101610651 | |||
| 1958 | Ga0070675_101702594 | |||
| 1959 | Ga0070671_100079081 | |||
| 1960 | Ga0070671_100159410 | |||
| 1961 | Ga0070671_100181105 | |||
| 1962 | Ga0070671_101392007 | |||
| 1963 | Ga0070671_101835633 | |||
| 1964 | Ga0070674_100075414 | |||
| 1965 | Ga0070674_101764079 | |||
| 1966 | Ga0070674_101938091 | |||
| 1967 | Ga0070673_100003685 | |||
| 1968 | Ga0070673_100024226 | |||
| 1969 | Ga0070673_100153788 | |||
| 1970 | Ga0070673_100499084 | |||
| 1971 | Ga0070673_102163037 | |||
| 1972 | Ga0070688_100024866 | |||
| 1973 | Ga0070688_100028355 | |||
| 1974 | Ga0070688_100394857 | |||
| 1975 | Ga0070659_100058242 | |||
| 1976 | Ga0070659_100108977 | |||
| 1977 | Ga0070659_100116694 | |||
| 1978 | Ga0070659_100245326 | |||
| 1979 | Ga0070659_100601719 | |||
| 1980 | Ga0070659_100915992 | |||
| 1981 | Ga0070659_101134747 | |||
| 1982 | Ga0070659_101444930 | |||
| 1983 | Ga0070667_100043630 | |||
| 1984 | Ga0070667_100093065 | |||
| 1985 | Ga0070667_100611410 | |||
| 1986 | Ga0070703_10122590 | |||
| 1987 | Ga0070709_10006385 | |||
| 1988 | Ga0070709_10036785 | |||
| 1989 | Ga0070709_10171398 | |||
| 1990 | Ga0070714_100000411 | |||
| 1991 | Ga0070714_100139880 | |||
| 1992 | Ga0070714_100462329 | |||
| 1993 | Ga0070714_100710189 | |||
| 1994 | Ga0070713_100065550 | |||
| 1995 | Ga0070713_100583856 | |||
| 1996 | Ga0070713_101027119 | |||
| 1997 | Ga0070713_101642690 | |||
| 1998 | Ga0070710_10128761 | |||
| 1999 | Ga0070701_10062320 | |||
| 2000 | Ga0070701_10624172 | |||
| 2001 | Ga0070711_100034546 | |||
| 2002 | Ga0070711_100079312 | |||
| 2003 | Ga0070705_100020535 | |||
| 2004 | Ga0070705_100090555 | |||
| 2005 | Ga0070705_100169323 | |||
| 2006 | Ga0070705_101704231 | |||
| 2007 | Ga0070700_100195386 | |||
| 2008 | Ga0070700_101012060 | |||
| 2009 | Ga0070694_100555824 | |||
| 2010 | Ga0070694_100825210 | |||
| 2011 | Ga0070694_100977120 | |||
| 2012 | Ga0070694_101097517 | |||
| 2013 | Ga0070708_100001661 | |||
| 2014 | Ga0070708_100003800 | |||
| 2015 | Ga0070708_100018839 | |||
| 2016 | Ga0070708_100020893 | |||
| 2017 | Ga0070708_100055604 | |||
| 2018 | Ga0070708_100335677 | |||
| 2019 | Ga0070708_100338186 | |||
| 2020 | Ga0070708_100366252 | |||
| 2021 | Ga0070708_101042104 | |||
| 2022 | Ga0070708_101463714 | |||
| 2023 | Ga0070663_100005346 | |||
| 2024 | Ga0070663_100094822 | |||
| 2025 | Ga0070663_100798646 | |||
| 2026 | Ga0070663_101530009 | |||
| 2027 | Ga0070678_100053888 | |||
| 2028 | Ga0070678_100352274 | |||
| 2029 | Ga0070662_100054587 | |||
| 2030 | Ga0070662_100198764 | |||
| 2031 | Ga0070662_100251955 | |||
| 2032 | Ga0070662_100452728 | |||
| 2033 | Ga0070662_100704165 | |||
| 2034 | Ga0070681_10035181 | |||
| 2035 | Ga0070681_10044619 | |||
| 2036 | Ga0070681_10053922 | |||
| 2037 | Ga0070681_10078280 | |||
| 2038 | Ga0070681_10116033 | |||
| 2039 | Ga0070681_10160574 | |||
| 2040 | Ga0070681_10171280 | |||
| 2041 | Ga0070681_10225090 | |||
| 2042 | Ga0070681_10227553 | |||
| 2043 | Ga0070681_10415728 | |||
| 2044 | Ga0070681_10477193 | |||
| 2045 | Ga0070681_10498751 | |||
| 2046 | Ga0070681_10758644 | |||
| 2047 | Ga0070681_11130055 | |||
| 2048 | Ga0070681_11251139 | |||
| 2049 | Ga0068867_100093589 | |||
| 2050 | Ga0068867_100262442 | |||
| 2051 | Ga0068867_100786095 | |||
| 2052 | Ga0068867_101256728 | |||
| 2053 | Ga0068867_101331788 | |||
| 2054 | Ga0070685_10028108 | |||
| 2055 | Ga0070685_10117314 | |||
| 2056 | Ga0070685_10262680 | |||
| 2057 | Ga0070706_100006592 | |||
| 2058 | Ga0070706_100115208 | |||
| 2059 | Ga0070706_100171538 | |||
| 2060 | Ga0070706_100188726 | |||
| 2061 | Ga0070706_100354241 | |||
| 2062 | Ga0070706_100502739 | |||
| 2063 | Ga0070707_100016356 | |||
| 2064 | Ga0070707_100019047 | |||
| 2065 | Ga0070707_100198999 | |||
| 2066 | Ga0070707_100439225 | |||
| 2067 | Ga0070707_100939600 | |||
| 2068 | Ga0070707_100948615 | |||
| 2069 | Ga0070707_100995176 | |||
| 2070 | Ga0070698_100001954 | |||
| 2071 | Ga0070698_100024253 | |||
| 2072 | Ga0070698_100030896 | |||
| 2073 | Ga0070698_100052230 | |||
| 2074 | Ga0070698_100466389 | |||
| 2075 | Ga0070698_102150056 | |||
| 2076 | Ga0070699_100003912 | |||
| 2077 | Ga0070699_100071160 | |||
| 2078 | Ga0070699_100096501 | |||
| 2079 | Ga0070699_100243299 | |||
| 2080 | Ga0070699_100244307 | |||
| 2081 | Ga0070699_100314429 | |||
| 2082 | Ga0070699_100484652 | |||
| 2083 | Ga0070699_100864240 | |||
| 2084 | Ga0070699_100922820 | |||
| 2085 | Ga0070699_101175842 | |||
| 2086 | Ga0070699_101184395 | |||
| 2087 | Ga0070699_101192268 | |||
| 2088 | Ga0070699_101674234 | |||
| 2089 | Ga0070679_100014655 | |||
| 2090 | Ga0070679_100019482 | |||
| 2091 | Ga0070679_100045568 | |||
| 2092 | Ga0070679_100052627 | |||
| 2093 | Ga0070679_100091847 | |||
| 2094 | Ga0070679_100165137 | |||
| 2095 | Ga0070679_100243051 | |||
| 2096 | Ga0070679_100249770 | |||
| 2097 | Ga0070679_100321944 | |||
| 2098 | Ga0070679_100443075 | |||
| 2099 | Ga0070679_100609953 | |||
| 2100 | Ga0070684_100005718 | |||
| 2101 | Ga0070684_100041533 | |||
| 2102 | Ga0070684_100152966 | |||
| 2103 | Ga0070684_100172651 | |||
| 2104 | Ga0070684_100298128 | |||
| 2105 | Ga0070684_100349691 | |||
| 2106 | Ga0070684_100585927 | |||
| 2107 | Ga0070684_100611370 | |||
| 2108 | Ga0070684_100976783 | |||
| 2109 | Ga0070684_101063874 | |||
| 2110 | Ga0070697_100034669 | |||
| 2111 | Ga0070697_100159646 | |||
| 2112 | Ga0070697_100173667 | |||
| 2113 | Ga0070697_100255073 | |||
| 2114 | Ga0070697_100308839 | |||
| 2115 | Ga0070697_100352424 | |||
| 2116 | Ga0070697_101146138 | |||
| 2117 | Ga0068853_100040762 | |||
| 2118 | Ga0068853_100176850 | |||
| 2119 | Ga0068853_100203663 | |||
| 2120 | Ga0068853_100246394 | |||
| 2121 | Ga0068853_100355905 | |||
| 2122 | Ga0068853_101652526 | |||
| 2123 | Ga0070672_100038933 | |||
| 2124 | Ga0070672_100061495 | |||
| 2125 | Ga0070672_100079274 | |||
| 2126 | Ga0070672_100308147 | |||
| 2127 | Ga0070672_100322927 | |||
| 2128 | Ga0070672_102016100 | |||
| 2129 | Ga0070686_100247099 | |||
| 2130 | Ga0070686_100365031 | |||
| 2131 | Ga0070686_100481563 | |||
| 2132 | Ga0070695_100006011 | |||
| 2133 | Ga0070695_100006164 | |||
| 2134 | Ga0070695_100081722 | |||
| 2135 | Ga0070695_100210430 | |||
| 2136 | Ga0070695_100294995 | |||
| 2137 | Ga0070695_101000870 | |||
| 2138 | Ga0070696_100014069 | |||
| 2139 | Ga0070696_100064301 | |||
| 2140 | Ga0070696_100199231 | |||
| 2141 | Ga0070696_100287300 | |||
| 2142 | Ga0070696_100345231 | |||
| 2143 | Ga0070696_100640509 | |||
| 2144 | Ga0070696_100698752 | |||
| 2145 | Ga0070696_101931493 | |||
| 2146 | Ga0070693_100000799 | |||
| 2147 | Ga0070693_100133923 | |||
| 2148 | Ga0070693_100610723 | |||
| 2149 | Ga0070693_100700302 | |||
| 2150 | Ga0070693_100877039 | |||
| 2151 | Ga0070665_100124547 | |||
| 2152 | Ga0070665_101359628 | |||
| 2153 | Ga0070665_102322188 | |||
| 2154 | Ga0070704_100129452 | |||
| 2155 | Ga0070704_100324442 | |||
| 2156 | Ga0070704_100337516 | |||
| 2157 | Ga0070704_100347075 | |||
| 2158 | Ga0070704_100529683 | |||
| 2159 | Ga0068855_100033387 | |||
| 2160 | Ga0068855_100389264 | |||
| 2161 | Ga0068855_100533266 | |||
| 2162 | Ga0068855_100817487 | |||
| 2163 | Ga0068855_101726342 | |||
| 2164 | Ga0068855_101906615 | |||
| 2165 | Ga0070664_100008033 | |||
| 2166 | Ga0070664_100229505 | |||
| 2167 | Ga0070664_100276901 | |||
| 2168 | Ga0070664_100312256 | |||
| 2169 | Ga0070664_100385803 | |||
| 2170 | Ga0070664_100616820 | |||
| 2171 | Ga0070664_100678751 | |||
| 2172 | Ga0070664_100738379 | |||
| 2173 | Ga0070664_102173296 | |||
| 2174 | Ga0068857_100009735 | |||
| 2175 | Ga0068857_100024265 | |||
| 2176 | Ga0068857_100205597 | |||
| 2177 | Ga0068857_100306504 | |||
| 2178 | Ga0068854_100008727 | |||
| 2179 | Ga0068854_100013720 | |||
| 2180 | Ga0068854_100069785 | |||
| 2181 | Ga0068854_100168844 | |||
| 2182 | Ga0068854_100999751 | |||
| 2183 | Ga0068854_101564314 | |||
| 2184 | Ga0068856_100073182 | |||
| 2185 | Ga0068856_100776822 | |||
| 2186 | Ga0068856_100902275 | |||
| 2187 | Ga0070702_100251803 | |||
| 2188 | Ga0070702_100499928 | |||
| 2189 | Ga0070702_100565489 | |||
| 2190 | Ga0070702_101245784 | |||
| 2191 | Ga0070702_101297416 | |||
| 2192 | Ga0068852_100026550 | |||
| 2193 | Ga0068852_100029132 | |||
| 2194 | Ga0068852_100241182 | |||
| 2195 | Ga0068852_100495111 | |||
| 2196 | Ga0068852_100622674 | |||
| 2197 | Ga0068852_101294854 | |||
| 2198 | Ga0068852_102534548 | |||
| 2199 | Ga0068859_100039441 | |||
| 2200 | Ga0068859_100216391 | |||
| 2201 | Ga0068859_100351569 | |||
| 2202 | Ga0068859_100624071 | |||
| 2203 | Ga0068859_100725038 | |||
| 2204 | Ga0068864_100207043 | |||
| 2205 | Ga0068864_100277387 | |||
| 2206 | Ga0068864_100736050 | |||
| 2207 | Ga0068866_10025649 | |||
| 2208 | Ga0068866_10131416 | |||
| 2209 | Ga0068866_10854617 | |||
| 2210 | Ga0068866_11036562 | |||
| 2211 | Ga0068861_100234025 | |||
| 2212 | Ga0068861_100912461 | |||
| 2213 | Ga0068851_10620593 | |||
| 2214 | Ga0068870_10011998 | |||
| 2215 | Ga0068870_10270076 | |||
| 2216 | Ga0068870_10446384 | |||
| 2217 | Ga0068863_100037716 | |||
| 2218 | Ga0068863_100119013 | |||
| 2219 | Ga0068863_100223270 | |||
| 2220 | Ga0068863_100276028 | |||
| 2221 | Ga0068863_100284520 | |||
| 2222 | Ga0068863_100525038 | |||
| 2223 | Ga0068863_101634340 | |||
| 2224 | Ga0068863_102623373 | |||
| 2225 | Ga0068858_100393383 | |||
| 2226 | Ga0068858_100400542 | |||
| 2227 | Ga0068858_101117216 | |||
| 2228 | Ga0068858_101182529 | |||
| 2229 | Ga0068860_100530559 | |||
| 2230 | Ga0068860_100708526 | |||
| 2231 | Ga0068862_100513910 | |||
| 2232 | Ga0068862_100624739 | |||
| 2233 | Ga0068862_101218995 | |||
| 2234 | Ga0081455_10243169 | |||
| 2235 | Ga0081455_10245504 | |||
| 2236 | Ga0081538_10078237 | |||
| 2237 | Ga0081539_10023333 | |||
| 2238 | Ga0081539_10215463 | |||
| 2239 | Ga0075432_10303059 | |||
| 2240 | Ga0070715_10091235 | |||
| 2241 | Ga0070715_10614808 | |||
| 2242 | Ga0070715_10781552 | |||
| 2243 | Ga0070716_100014957 | |||
| 2244 | Ga0070716_100120125 | |||
| 2245 | Ga0070716_100185223 | |||
| 2246 | Ga0070712_100150856 | |||
| 2247 | Ga0070712_100602962 | |||
| 2248 | Ga0070712_101180134 | |||
| 2249 | Ga0097621_100072407 | |||
| 2250 | Ga0097621_100114591 | |||
| 2251 | Ga0097621_101288906 | |||
| 2252 | Ga0068871_100188895 | |||
| 2253 | Ga0068871_100349234 | |||
| 2254 | Ga0068871_100524840 | |||
| 2255 | Ga0068871_100790188 | |||
| 2256 | Ga0075428_100483856 | |||
| 2257 | Ga0075428_101106268 | |||
| 2258 | Ga0075428_102713510 | |||
| 2259 | Ga0075430_100388623 | |||
| 2260 | Ga0075430_101203605 | |||
| 2261 | Ga0075431_100066106 | |||
| 2262 | Ga0075431_100132267 | |||
| 2263 | Ga0075431_100445223 | |||
| 2264 | Ga0075431_100446411 | |||
| 2265 | Ga0075431_100679135 | |||
| 2266 | Ga0075433_10014445 | |||
| 2267 | Ga0075433_10017586 | |||
| 2268 | Ga0075433_10048621 | |||
| 2269 | Ga0075433_10082656 | |||
| 2270 | Ga0075433_10453291 | |||
| 2271 | Ga0075433_10475033 | |||
| 2272 | Ga0075434_100039856 | |||
| 2273 | Ga0075434_100056118 | |||
| 2274 | Ga0075434_100293178 | |||
| 2275 | Ga0075434_100411482 | |||
| 2276 | Ga0075434_100623359 | |||
| 2277 | Ga0075434_100881444 | |||
| 2278 | Ga0075429_100019213 | |||
| 2279 | Ga0075429_100181478 | |||
| 2280 | Ga0075429_100278121 | |||
| 2281 | Ga0075429_101064640 | |||
| 2282 | Ga0068865_100094461 | |||
| 2283 | Ga0068865_100136783 | |||
| 2284 | Ga0068865_100273628 | |||
| 2285 | Ga0068865_100787660 | |||
| 2286 | Ga0068865_100999212 | |||
| 2287 | Ga0075436_100000105 | |||
| 2288 | Ga0075436_100011027 | |||
| 2289 | Ga0075436_100034048 | |||
| 2290 | Ga0075436_100145157 | |||
| 2291 | Ga0075436_100293565 | |||
| 2292 | Ga0075436_100506269 | |||
| 2293 | Ga0097620_100039441 | |||
| 2294 | Ga0097620_100216397 | |||
| 2295 | Ga0097620_100351562 | |||
| 2296 | Ga0097620_100624048 | |||
| 2297 | Ga0097620_100725107 | |||
| 2298 | Ga0075435_100039577 | |||
| 2299 | Ga0075435_100093480 | |||
| 2300 | Ga0075435_100458431 | |||
| 2301 | Ga0075435_101173550 | |||
| 2302 | Ga0075435_101207494 | |||
| 2303 | Ga0075435_101501941 | |||
| 2304 | Ga0099794_10232222 | |||
| 2305 | Ga0099794_10235798 | |||
| 2306 | Ga0099794_10805773 | |||
| 2307 | Ga0099795_10031621 | |||
| 2308 | Ga0105240_10101231 | |||
| 2309 | Ga0105240_10106067 | |||
| 2310 | Ga0105240_10377512 | |||
| 2311 | Ga0105240_11405854 | |||
| 2312 | Ga0105240_12715848 | |||
| 2313 | Ga0111539_10250172 | |||
| 2314 | Ga0111539_10296278 | |||
| 2315 | Ga0111539_10875500 | |||
| 2316 | Ga0111539_12150536 | |||
| 2317 | Ga0105245_10094704 | |||
| 2318 | Ga0105245_10155732 | |||
| 2319 | Ga0105245_10219981 | |||
| 2320 | Ga0105245_10429375 | |||
| 2321 | Ga0105245_10470338 | |||
| 2322 | Ga0105245_10564960 | |||
| 2323 | Ga0105245_11336780 | |||
| 2324 | Ga0105245_11604509 | |||
| 2325 | Ga0105247_10723337 | |||
| 2326 | Ga0114129_10032671 | |||
| 2327 | Ga0114129_10074165 | |||
| 2328 | Ga0114129_10442964 | |||
| 2329 | Ga0114129_10603869 | |||
| 2330 | Ga0114129_10768010 | |||
| 2331 | Ga0114129_10794816 | |||
| 2332 | Ga0114129_10971514 | |||
| 2333 | Ga0105243_10345671 | |||
| 2334 | Ga0105243_10657686 | |||
| 2335 | Ga0105243_10911407 | |||
| 2336 | Ga0105243_12099905 | |||
| 2337 | Ga0105243_12447293 | |||
| 2338 | Ga0105241_10146778 | |||
| 2339 | Ga0105241_10357475 | |||
| 2340 | Ga0105242_10149144 | |||
| 2341 | Ga0105242_11282820 | |||
| 2342 | Ga0105248_10122714 | |||
| 2343 | Ga0105248_10322129 | |||
| 2344 | Ga0105248_10673931 | |||
| 2345 | Ga0105248_11222903 | |||
| 2346 | Ga0105248_11563113 | |||
| 2347 | Ga0105248_12130074 | |||
| 2348 | Ga0105248_12276975 | |||
| 2349 | Ga0105237_10688214 | |||
| 2350 | Ga0105237_11180422 | |||
| 2351 | Ga0105238_10074647 | |||
| 2352 | Ga0105238_10911998 | |||
| 2353 | Ga0105238_11817297 | |||
| 2354 | Ga0105249_10747690 | |||
| 2355 | Ga0105249_10974948 | |||
| 2356 | Ga0105239_10977094 | |||
| 2357 | Ga0105239_11728858 | |||
| 2358 | Ga0105239_13235952 | |||
| 2359 | Ga0105246_10135906 | |||
| 2360 | Ga0157318_1028166 | |||
| 2361 | Ga0157341_1042080 | |||
| 2362 | Ga0157323_1004571 | |||
| 2363 | Ga0157339_1028615 | |||
| 2364 | Ga0157342_1020734 | |||
| 2365 | Ga0157316_1015673 | |||
| 2366 | Ga0157373_10075094 | |||
| 2367 | Ga0157373_10107506 | |||
| 2368 | Ga0157373_10134672 | |||
| 2369 | Ga0157373_10261289 | |||
| 2370 | Ga0157371_10502250 | |||
| 2371 | Ga0157371_11376732 | |||
| 2372 | Ga0157370_10006391 | |||
| 2373 | Ga0157370_10051328 | |||
| 2374 | Ga0157370_10284510 | |||
| 2375 | Ga0157370_10885631 | |||
| 2376 | Ga0157370_11354269 | |||
| 2377 | Ga0157370_11584828 | |||
| 2378 | Ga0157369_10129033 | |||
| 2379 | Ga0157369_10360263 | |||
| 2380 | Ga0157369_10966313 | |||
| 2381 | Ga0157369_11050120 | |||
| 2382 | Ga0157369_12520277 | |||
| 2383 | Ga0157374_10841745 | |||
| 2384 | Ga0157374_10938383 | |||
| 2385 | Ga0157374_11612879 | |||
| 2386 | Ga0157374_11672773 | |||
| 2387 | Ga0157378_10107312 | |||
| 2388 | Ga0157378_10168578 | |||
| 2389 | Ga0157378_10392433 | |||
| 2390 | Ga0157378_10924224 | |||
| 2391 | Ga0157378_11111228 | |||
| 2392 | Ga0157378_11206617 | |||
| 2393 | Ga0157378_11286448 | |||
| 2394 | Ga0157378_11793893 | |||
| 2395 | Ga0157378_12350404 | |||
| 2396 | Ga0157378_12778686 | |||
| 2397 | Ga0163162_10771069 | |||
| 2398 | Ga0163162_10942245 | |||
| 2399 | Ga0163162_11353130 | |||
| 2400 | Ga0163162_12210203 | |||
| 2401 | Ga0163162_12562676 | |||
| 2402 | Ga0157372_10353040 | |||
| 2403 | Ga0157372_10360783 | |||
| 2404 | Ga0157372_10398247 | |||
| 2405 | Ga0157372_10437193 | |||
| 2406 | Ga0157372_10438515 | |||
| 2407 | Ga0157372_10707076 | |||
| 2408 | Ga0157372_11176516 | |||
| 2409 | Ga0157372_11335691 | |||
| 2410 | Ga0157372_11876377 | |||
| 2411 | Ga0157372_12916985 | |||
| 2412 | Ga0157372_13205857 | |||
| 2413 | Ga0157375_10470699 | |||
| 2414 | Ga0157375_10773256 | |||
| 2415 | Ga0157375_12065547 | |||
| 2416 | Ga0163163_10308590 | |||
| 2417 | Ga0163163_10308637 | |||
| 2418 | Ga0163163_10395870 | |||
| 2419 | Ga0163163_10833141 | |||
| 2420 | Ga0163163_11090999 | |||
| 2421 | Ga0157380_11276920 | |||
| 2422 | Ga0157380_13177473 | |||
| 2423 | Ga0182008_10006718 | |||
| 2424 | Ga0157377_10220127 | |||
| 2425 | Ga0157379_10648203 | |||
| 2426 | Ga0157379_11019995 | |||
| 2427 | Ga0157379_11275611 | |||
| 2428 | Ga0157379_11425219 | |||
| 2429 | Ga0157379_12463332 | |||
| 2430 | Ga0157376_10346309 | |||
| 2431 | Ga0157376_10688632 | |||
| 2432 | Ga0157376_10976839 | |||
| 2433 | Ga0157376_12139206 | |||
| 2434 | Ga0157376_13037862 | |||
| 2435 | Ga0182007_10245076 | |||
| 2436 | Ga0163161_10184027 | |||
| 2437 | Ga0163161_10551308 | |||
| 2438 | Ga0163161_12037071 | |||
| 2439 | Ga0206356_11621450 | |||
| 2440 | Ga0206349_1309757 | |||
| 2441 | Ga0213876_10010709 | |||
| 2442 | Ga0213876_10244513 | |||
| 2443 | Ga0213876_10253805 | |||
| 2444 | Ga0207666_1023196 | |||
| 2445 | Ga0207697_10011385 | |||
| 2446 | Ga0207656_10283209 | |||
| 2447 | Ga0207682_10016764 | |||
| 2448 | Ga0207692_10077555 | |||
| 2449 | Ga0207642_10008208 | |||
| 2450 | Ga0207642_10469862 | |||
| 2451 | Ga0207642_10568459 | |||
| 2452 | Ga0207642_10642395 | |||
| 2453 | Ga0207688_10027380 | |||
| 2454 | Ga0207688_10684318 | |||
| 2455 | Ga0207680_10025729 | |||
| 2456 | Ga0207680_10125424 | |||
| 2457 | Ga0207680_10351990 | |||
| 2458 | Ga0207685_10030303 | |||
| 2459 | Ga0207699_10001230 | |||
| 2460 | Ga0207699_10044660 | |||
| 2461 | Ga0207699_10127954 | |||
| 2462 | Ga0207699_10560054 | |||
| 2463 | Ga0207645_10018114 | |||
| 2464 | Ga0207645_10185904 | |||
| 2465 | Ga0207645_10193216 | |||
| 2466 | Ga0207643_10003364 | |||
| 2467 | Ga0207643_10281215 | |||
| 2468 | Ga0207705_10027229 | |||
| 2469 | Ga0207705_10029211 | |||
| 2470 | Ga0207705_10031424 | |||
| 2471 | Ga0207705_10278431 | |||
| 2472 | Ga0207705_10461503 | |||
| 2473 | Ga0207705_10694084 | |||
| 2474 | Ga0207684_10022976 | |||
| 2475 | Ga0207684_10199408 | |||
| 2476 | Ga0207684_10321730 | |||
| 2477 | Ga0207684_10460484 | |||
| 2478 | Ga0207684_10466072 | |||
| 2479 | Ga0207684_11038716 | |||
| 2480 | Ga0207654_10028743 | |||
| 2481 | Ga0207707_10004257 | |||
| 2482 | Ga0207707_10020853 | |||
| 2483 | Ga0207707_10041250 | |||
| 2484 | Ga0207707_10068861 | |||
| 2485 | Ga0207707_10075446 | |||
| 2486 | Ga0207707_10097923 | |||
| 2487 | Ga0207707_10627301 | |||
| 2488 | Ga0207707_10784898 | |||
| 2489 | Ga0207707_10861232 | |||
| 2490 | Ga0207707_11104162 | |||
| 2491 | Ga0207695_10004617 | |||
| 2492 | Ga0207695_10013424 | |||
| 2493 | Ga0207695_10070341 | |||
| 2494 | Ga0207695_10226195 | |||
| 2495 | Ga0207671_10127670 | |||
| 2496 | Ga0207671_11569578 | |||
| 2497 | Ga0207693_10130240 | |||
| 2498 | Ga0207693_10177031 | |||
| 2499 | Ga0207693_10182171 | |||
| 2500 | Ga0207693_10361372 | |||
| 2501 | Ga0207693_10440034 | |||
| 2502 | Ga0207693_10488937 | |||
| 2503 | Ga0207663_10008487 | |||
| 2504 | Ga0207663_10073763 | |||
| 2505 | Ga0207663_10511946 | |||
| 2506 | Ga0207663_10892089 | |||
| 2507 | Ga0207660_10004139 | |||
| 2508 | Ga0207660_10032435 | |||
| 2509 | Ga0207660_10044376 | |||
| 2510 | Ga0207660_10046045 | |||
| 2511 | Ga0207660_10088243 | |||
| 2512 | Ga0207660_10097907 | |||
| 2513 | Ga0207660_10168557 | |||
| 2514 | Ga0207660_10478573 | |||
| 2515 | Ga0207660_10681750 | |||
| 2516 | Ga0207660_11266911 | |||
| 2517 | Ga0207662_10007104 | |||
| 2518 | Ga0207662_10037541 | |||
| 2519 | Ga0207662_10185746 | |||
| 2520 | Ga0207662_10247582 | |||
| 2521 | Ga0207662_10304538 | |||
| 2522 | Ga0207662_10722687 | |||
| 2523 | Ga0207657_10001138 | |||
| 2524 | Ga0207657_10047239 | |||
| 2525 | Ga0207657_10133641 | |||
| 2526 | Ga0207657_10281579 | |||
| 2527 | Ga0207657_10553571 | |||
| 2528 | Ga0207649_10025188 | |||
| 2529 | Ga0207649_10032190 | |||
| 2530 | Ga0207649_10058649 | |||
| 2531 | Ga0207649_10118913 | |||
| 2532 | Ga0207649_10167119 | |||
| 2533 | Ga0207649_10178625 | |||
| 2534 | Ga0207649_10525517 | |||
| 2535 | Ga0207649_10526993 | |||
| 2536 | Ga0207649_11091551 | |||
| 2537 | Ga0207652_10011077 | |||
| 2538 | Ga0207652_10012004 | |||
| 2539 | Ga0207652_10042922 | |||
| 2540 | Ga0207652_10065009 | |||
| 2541 | Ga0207652_10093206 | |||
| 2542 | Ga0207652_10180913 | |||
| 2543 | Ga0207652_10261717 | |||
| 2544 | Ga0207652_10261985 | |||
| 2545 | Ga0207652_10324641 | |||
| 2546 | Ga0207652_10444285 | |||
| 2547 | Ga0207652_10539114 | |||
| 2548 | Ga0207652_10917515 | |||
| 2549 | Ga0207652_10968089 | |||
| 2550 | Ga0207646_10019243 | |||
| 2551 | Ga0207646_10035672 | |||
| 2552 | Ga0207646_10103586 | |||
| 2553 | Ga0207646_10409012 | |||
| 2554 | Ga0207646_10473825 | |||
| 2555 | Ga0207646_10536794 | |||
| 2556 | Ga0207646_11799240 | |||
| 2557 | Ga0207681_10068781 | |||
| 2558 | Ga0207681_10085457 | |||
| 2559 | Ga0207681_10205225 | |||
| 2560 | Ga0207681_10544386 | |||
| 2561 | Ga0207681_10545758 | |||
| 2562 | Ga0207694_10026946 | |||
| 2563 | Ga0207694_10248765 | |||
| 2564 | Ga0207694_10275749 | |||
| 2565 | Ga0207694_10843780 | |||
| 2566 | Ga0207650_10010393 | |||
| 2567 | Ga0207650_10249865 | |||
| 2568 | Ga0207650_11374444 | |||
| 2569 | Ga0207659_10022346 | |||
| 2570 | Ga0207659_10208752 | |||
| 2571 | Ga0207659_10218655 | |||
| 2572 | Ga0207659_10497834 | |||
| 2573 | Ga0207659_11195230 | |||
| 2574 | Ga0207659_11694803 | |||
| 2575 | Ga0207687_10075869 | |||
| 2576 | Ga0207687_10136950 | |||
| 2577 | Ga0207687_10400629 | |||
| 2578 | Ga0207687_11183420 | |||
| 2579 | Ga0207687_11722786 | |||
| 2580 | Ga0207700_10087723 | |||
| 2581 | Ga0207700_10483316 | |||
| 2582 | Ga0207664_10000099 | |||
| 2583 | Ga0207664_10012437 | |||
| 2584 | Ga0207664_10420601 | |||
| 2585 | Ga0207664_11970421 | |||
| 2586 | Ga0207644_10227703 | |||
| 2587 | Ga0207644_10490086 | |||
| 2588 | Ga0207644_10860658 | |||
| 2589 | Ga0207644_11627165 | |||
| 2590 | Ga0207690_10070701 | |||
| 2591 | Ga0207690_10076401 | |||
| 2592 | Ga0207690_10207916 | |||
| 2593 | Ga0207706_10075992 | |||
| 2594 | Ga0207706_10150224 | |||
| 2595 | Ga0207706_10535245 | |||
| 2596 | Ga0207706_10556469 | |||
| 2597 | Ga0207706_11007915 | |||
| 2598 | Ga0207706_11353459 | |||
| 2599 | Ga0207686_10060773 | |||
| 2600 | Ga0207686_11131820 | |||
| 2601 | Ga0207686_11331536 | |||
| 2602 | Ga0207709_10081832 | |||
| 2603 | Ga0207709_11327797 | |||
| 2604 | Ga0207670_10004353 | |||
| 2605 | Ga0207670_10018648 | |||
| 2606 | Ga0207670_10107499 | |||
| 2607 | Ga0207670_10301182 | |||
| 2608 | Ga0207670_11139326 | |||
| 2609 | Ga0207670_11928134 | |||
| 2610 | Ga0207669_10346609 | |||
| 2611 | Ga0207669_10350187 | |||
| 2612 | Ga0207669_11052314 | |||
| 2613 | Ga0207704_10040337 | |||
| 2614 | Ga0207704_11302836 | |||
| 2615 | Ga0207704_11365406 | |||
| 2616 | Ga0207665_10021871 | |||
| 2617 | Ga0207665_10024947 | |||
| 2618 | Ga0207665_10097926 | |||
| 2619 | Ga0207665_10197621 | |||
| 2620 | Ga0207665_11293580 | |||
| 2621 | Ga0207691_10032808 | |||
| 2622 | Ga0207691_10046795 | |||
| 2623 | Ga0207691_10153386 | |||
| 2624 | Ga0207691_10322355 | |||
| 2625 | Ga0207711_10183645 | |||
| 2626 | Ga0207711_11200148 | |||
| 2627 | Ga0207711_11895670 | |||
| 2628 | Ga0207711_12060576 | |||
| 2629 | Ga0207689_10019641 | |||
| 2630 | Ga0207689_10053633 | |||
| 2631 | Ga0207689_10123876 | |||
| 2632 | Ga0207661_10001907 | |||
| 2633 | Ga0207661_10004866 | |||
| 2634 | Ga0207661_10047859 | |||
| 2635 | Ga0207661_10179812 | |||
| 2636 | Ga0207661_11788099 | |||
| 2637 | Ga0207679_10002650 | |||
| 2638 | Ga0207679_10192419 | |||
| 2639 | Ga0207679_10218788 | |||
| 2640 | Ga0207679_10314992 | |||
| 2641 | Ga0207679_10316793 | |||
| 2642 | Ga0207679_10741175 | |||
| 2643 | Ga0207679_10752364 | |||
| 2644 | Ga0207679_10822952 | |||
| 2645 | Ga0207679_10872568 | |||
| 2646 | Ga0207679_11249370 | |||
| 2647 | Ga0207679_11269312 | |||
| 2648 | Ga0207679_12086469 | |||
| 2649 | Ga0207679_12138210 | |||
| 2650 | Ga0207667_10034763 | |||
| 2651 | Ga0207667_10658021 | |||
| 2652 | Ga0207667_11478457 | |||
| 2653 | Ga0207667_12081101 | |||
| 2654 | Ga0207651_10021908 | |||
| 2655 | Ga0207651_10036217 | |||
| 2656 | Ga0207651_10071067 | |||
| 2657 | Ga0207651_10128156 | |||
| 2658 | Ga0207651_10173474 | |||
| 2659 | Ga0207712_10675161 | |||
| 2660 | Ga0207668_10281849 | |||
| 2661 | Ga0207668_10808508 | |||
| 2662 | Ga0207640_10001854 | |||
| 2663 | Ga0207640_10129033 | |||
| 2664 | Ga0207640_10238690 | |||
| 2665 | Ga0207640_10280376 | |||
| 2666 | Ga0207640_10583783 | |||
| 2667 | Ga0207640_10719024 | |||
| 2668 | Ga0207658_11026684 | |||
| 2669 | Ga0207658_12005943 | |||
| 2670 | Ga0207677_10012623 | |||
| 2671 | Ga0207677_10058774 | |||
| 2672 | Ga0207677_10092972 | |||
| 2673 | Ga0207677_10216912 | |||
| 2674 | Ga0207677_10287200 | |||
| 2675 | Ga0207677_10416302 | |||
| 2676 | Ga0207703_11017431 | |||
| 2677 | Ga0207703_12206895 | |||
| 2678 | Ga0207639_10002689 | |||
| 2679 | Ga0207639_10051893 | |||
| 2680 | Ga0207639_10204557 | |||
| 2681 | Ga0207639_10217878 | |||
| 2682 | Ga0207639_10798015 | |||
| 2683 | Ga0207639_11176347 | |||
| 2684 | Ga0207639_11760032 | |||
| 2685 | Ga0207678_10012023 | |||
| 2686 | Ga0207678_10076305 | |||
| 2687 | Ga0207678_11960182 | |||
| 2688 | Ga0207708_10112088 | |||
| 2689 | Ga0207708_10156616 | |||
| 2690 | Ga0207708_10614938 | |||
| 2691 | Ga0207708_10795262 | |||
| 2692 | Ga0207708_11220680 | |||
| 2693 | Ga0207708_12019120 | |||
| 2694 | Ga0207702_10036288 | |||
| 2695 | Ga0207702_10086091 | |||
| 2696 | Ga0207702_10249947 | |||
| 2697 | Ga0207702_10868485 | |||
| 2698 | Ga0207702_11628407 | |||
| 2699 | Ga0207641_10070450 | |||
| 2700 | Ga0207641_10281147 | |||
| 2701 | Ga0207641_10464731 | |||
| 2702 | Ga0207641_10611440 | |||
| 2703 | Ga0207641_11270260 | |||
| 2704 | Ga0207648_10048391 | |||
| 2705 | Ga0207648_10097740 | |||
| 2706 | Ga0207648_10203821 | |||
| 2707 | Ga0207648_10306254 | |||
| 2708 | Ga0207648_10654520 | |||
| 2709 | Ga0207676_10180609 | |||
| 2710 | Ga0207676_10297097 | |||
| 2711 | Ga0207676_11001064 | |||
| 2712 | Ga0207676_11162364 | |||
| 2713 | Ga0207676_11353882 | |||
| 2714 | Ga0207674_10048180 | |||
| 2715 | Ga0207674_10082972 | |||
| 2716 | Ga0207674_10100870 | |||
| 2717 | Ga0207674_10101100 | |||
| 2718 | Ga0207674_10168287 | |||
| 2719 | Ga0207674_10268372 | |||
| 2720 | Ga0207674_11749475 | |||
| 2721 | Ga0207675_100316888 | |||
| 2722 | Ga0207683_10028596 | |||
| 2723 | Ga0207683_10035142 | |||
| 2724 | Ga0207683_10127379 | |||
| 2725 | Ga0207683_10618670 | |||
| 2726 | Ga0207698_10038152 | |||
| 2727 | Ga0207698_10046102 | |||
| 2728 | Ga0207698_10601353 | |||
| 2729 | Ga0207698_11574528 | |||
| 2730 | Ga0207698_11688725 | |||
| 2731 | Ga0207698_12636717 | |||
| 2732 | Ga0209973_1018244 | |||
| 2733 | Ga0209973_1021955 | |||
| 2734 | Ga0209967_1084390 | |||
| 2735 | Ga0209984_1013486 | |||
| 2736 | Ga0209984_1054251 | |||
| 2737 | Ga0209995_1003150 | |||
| 2738 | Ga0209995_1009325 | |||
| 2739 | Ga0209968_1003096 | |||
| 2740 | Ga0209999_1002599 | |||
| 2741 | Ga0209999_1091843 | |||
| 2742 | Ga0209999_1124806 | |||
| 2743 | Ga0209982_1017982 | |||
| 2744 | Ga0209970_1024737 | |||
| 2745 | Ga0209970_1052785 | |||
| 2746 | Ga0210002_1043222 | |||
| 2747 | Ga0210002_1082987 | |||
| 2748 | Ga0209983_1000810 | |||
| 2749 | Ga0209983_1018496 | |||
| 2750 | Ga0209983_1019830 | |||
| 2751 | Ga0209971_1020116 | |||
| 2752 | Ga0209966_1000982 | |||
| 2753 | Ga0209966_1108664 | |||
| 2754 | Ga0209998_10003458 | |||
| 2755 | Ga0209998_10080529 | |||
| 2756 | Ga0209974_10007380 | |||
| 2757 | Ga0209974_10007508 | |||
| 2758 | Ga0207428_10011903 | |||
| 2759 | Ga0207428_10193964 | |||
| 2760 | Ga0207428_10276111 | |||
| 2761 | Ga0207428_10401508 | |||
| 2762 | Ga0268266_10142482 | |||
| 2763 | Ga0268266_10237157 | |||
| 2764 | Ga0268265_10067252 | |||
| 2765 | Ga0268265_10415410 | |||
| 2766 | Ga0268265_10574631 | |||
| 2767 | Ga0268265_10859804 | |||
| 2768 | Ga0268265_11001979 | |||
| 2769 | Ga0268264_10221374 | |||
| 2770 | Ga0268264_10630454 | |||
| 2771 | Ga0265323_10056890 | |||
| 2772 | Ga0265338_10051633 | |||
| 2773 | Ga0316182_1255157 | |||
| 2774 | Ga0265320_10064432 | |||
| 2775 | Ga0265327_10087014 | |||
| 2776 | Ga0265316_10934161 | |||
| 2777 | Ga0307408_100016817 | |||
| 2778 | Ga0307408_100019763 | |||
| 2779 | Ga0307408_100046769 | |||
| 2780 | Ga0307408_100052712 | |||
| 2781 | Ga0307408_100062503 | |||
| 2782 | Ga0307408_100099262 | |||
| 2783 | Ga0307408_100153960 | |||
| 2784 | Ga0307408_100223526 | |||
| 2785 | Ga0307408_100406940 | |||
| 2786 | Ga0307408_100424859 | |||
| 2787 | Ga0307408_100713907 | |||
| 2788 | Ga0307408_100864679 | |||
| 2789 | Ga0307408_101332649 | |||
| 2790 | Ga0265313_10145536 | |||
| 2791 | Ga0316575_10039695 | |||
| 2792 | Ga0316575_10385885 | |||
| 2793 | Ga0316579_10001157 | |||
| 2794 | Ga0265314_10001956 | |||
| 2795 | Ga0265342_10633398 | |||
| 2796 | Ga0316576_10004863 | |||
| 2797 | Ga0316576_10044118 | |||
| 2798 | Ga0316578_10001113 | |||
| 2799 | Ga0307405_10003326 | |||
| 2800 | Ga0307405_10004504 | |||
| 2801 | Ga0307405_10081500 | |||
| 2802 | Ga0307405_10083760 | |||
| 2803 | Ga0307405_10100967 | |||
| 2804 | Ga0307405_10107686 | |||
| 2805 | Ga0307405_10116149 | |||
| 2806 | Ga0307405_10152371 | |||
| 2807 | Ga0307405_10250335 | |||
| 2808 | Ga0307405_11012285 | |||
| 2809 | Ga0307405_11208907 | |||
| 2810 | Ga0307405_11333273 | |||
| 2811 | Ga0316577_10008737 | |||
| 2812 | Ga0316577_10076737 | |||
| 2813 | Ga0307413_10001842 | |||
| 2814 | Ga0307413_10002091 | |||
| 2815 | Ga0307413_10006358 | |||
| 2816 | Ga0307413_10031527 | |||
| 2817 | Ga0307413_10055726 | |||
| 2818 | Ga0307413_10067122 | |||
| 2819 | Ga0307413_10074613 | |||
| 2820 | Ga0307413_10079652 | |||
| 2821 | Ga0307413_10203183 | |||
| 2822 | Ga0307413_10316330 | |||
| 2823 | Ga0307413_10701827 | |||
| 2824 | Ga0307413_10760750 | |||
| 2825 | Ga0307413_10957308 | |||
| 2826 | Ga0307413_11250943 | |||
| 2827 | Ga0307413_11340826 | |||
| 2828 | Ga0307413_11758549 | |||
| 2829 | Ga0307410_10000285 | |||
| 2830 | Ga0307410_10000967 | |||
| 2831 | Ga0307410_10022252 | |||
| 2832 | Ga0307410_10022355 | |||
| 2833 | Ga0307410_10054575 | |||
| 2834 | Ga0307410_10057005 | |||
| 2835 | Ga0307410_10067694 | |||
| 2836 | Ga0307410_10109480 | |||
| 2837 | Ga0307410_10126427 | |||
| 2838 | Ga0307410_10654568 | |||
| 2839 | Ga0307410_10712613 | |||
| 2840 | Ga0307410_10869233 | |||
| 2841 | Ga0307410_10958461 | |||
| 2842 | Ga0307410_11030798 | |||
| 2843 | Ga0307406_10009039 | |||
| 2844 | Ga0307406_10030981 | |||
| 2845 | Ga0307406_10074742 | |||
| 2846 | Ga0307406_10102636 | |||
| 2847 | Ga0307406_10139031 | |||
| 2848 | Ga0307406_10208490 | |||
| 2849 | Ga0307406_10257460 | |||
| 2850 | Ga0307406_10392032 | |||
| 2851 | Ga0307406_10824787 | |||
| 2852 | Ga0307406_11310203 | |||
| 2853 | Ga0307406_11468420 | |||
| 2854 | Ga0307407_10005111 | |||
| 2855 | Ga0307407_10005124 | |||
| 2856 | Ga0307407_10044520 | |||
| 2857 | Ga0307407_10122956 | |||
| 2858 | Ga0307407_10241220 | |||
| 2859 | Ga0307407_10500819 | |||
| 2860 | Ga0307407_10543982 | |||
| 2861 | Ga0307407_10568148 | |||
| 2862 | Ga0307407_10942719 | |||
| 2863 | Ga0307407_10954127 | |||
| 2864 | Ga0307407_11254962 | |||
| 2865 | Ga0307412_10005885 | |||
| 2866 | Ga0307412_10007821 | |||
| 2867 | Ga0307412_10016367 | |||
| 2868 | Ga0307412_10060199 | |||
| 2869 | Ga0307412_10075320 | |||
| 2870 | Ga0307412_10094473 | |||
| 2871 | Ga0307412_10139932 | |||
| 2872 | Ga0307412_10202806 | |||
| 2873 | Ga0307412_10361947 | |||
| 2874 | Ga0307412_10791122 | |||
| 2875 | Ga0307412_10863760 | |||
| 2876 | Ga0307412_11152646 | |||
| 2877 | Ga0307412_11837595 | |||
| 2878 | Ga0307409_100005454 | |||
| 2879 | Ga0307409_100008795 | |||
| 2880 | Ga0307409_100032235 | |||
| 2881 | Ga0307409_100047584 | |||
| 2882 | Ga0307409_100055663 | |||
| 2883 | Ga0307409_100079063 | |||
| 2884 | Ga0307409_100079067 | |||
| 2885 | Ga0307409_100172626 | |||
| 2886 | Ga0307409_100487723 | |||
| 2887 | Ga0307409_100541231 | |||
| 2888 | Ga0307409_100655432 | |||
| 2889 | Ga0307409_100810599 | |||
| 2890 | Ga0307409_101036773 | |||
| 2891 | Ga0307409_101214543 | |||
| 2892 | Ga0307409_101843172 | |||
| 2893 | Ga0307409_102131522 | |||
| 2894 | Ga0307416_100003682 | |||
| 2895 | Ga0307416_100009003 | |||
| 2896 | Ga0307416_100016074 | |||
| 2897 | Ga0307416_100092060 | |||
| 2898 | Ga0307416_100113896 | |||
| 2899 | Ga0307416_100116989 | |||
| 2900 | Ga0307416_100118263 | |||
| 2901 | Ga0307416_100417503 | |||
| 2902 | Ga0307416_100491460 | |||
| 2903 | Ga0307416_100535955 | |||
| 2904 | Ga0307416_100538135 | |||
| 2905 | Ga0307416_100612039 | |||
| 2906 | Ga0307416_100650942 | |||
| 2907 | Ga0307416_100833658 | |||
| 2908 | Ga0307416_101065588 | |||
| 2909 | Ga0307416_101526866 | |||
| 2910 | Ga0307416_102777375 | |||
| 2911 | Ga0307414_10036134 | |||
| 2912 | Ga0307414_10074656 | |||
| 2913 | Ga0307414_10180246 | |||
| 2914 | Ga0307414_10726338 | |||
| 2915 | Ga0307414_10756896 | |||
| 2916 | Ga0307414_10956519 | |||
| 2917 | Ga0307414_10986856 | |||
| 2918 | Ga0307411_10000568 | |||
| 2919 | Ga0307411_10005072 | |||
| 2920 | Ga0307411_10012793 | |||
| 2921 | Ga0307411_10020764 | |||
| 2922 | Ga0307411_10114848 | |||
| 2923 | Ga0307411_10118769 | |||
| 2924 | Ga0307411_10209710 | |||
| 2925 | Ga0307411_10336063 | |||
| 2926 | Ga0307411_10347332 | |||
| 2927 | Ga0307411_10825064 | |||
| 2928 | Ga0307411_10889294 | |||
| 2929 | Ga0307415_100004310 | |||
| 2930 | Ga0307415_100004471 | |||
| 2931 | Ga0307415_100006886 | |||
| 2932 | Ga0307415_100017495 | |||
| 2933 | Ga0307415_100073037 | |||
| 2934 | Ga0307415_100077926 | |||
| 2935 | Ga0307415_100116777 | |||
| 2936 | Ga0307415_100232082 | |||
| 2937 | Ga0307415_100238109 | |||
| 2938 | Ga0307415_100315483 | |||
| 2939 | Ga0307415_100443838 | |||
| 2940 | Ga0307415_101090887 | |||
| 2941 | Ga0316583_10001183 | |||
| 2942 | Ga0316583_10017879 | |||
| 2943 | Ga0316583_10084259 | |||
| 2944 | Ga0316585_10001668 | |||
| 2945 | Ga0316580_10001460 | |||
| 2946 | Ga0316592_1120642 | |||
| 2947 | Ga0316588_1148391 | |||
| 2948 | Ga0316596_1039349 | |||
| 2949 | Ga0373930_0074044 | |||
| 2950 | Ga0373948_0059906 | |||
| 2951 | Ga0373950_0080083 | |||
| 2952 | Ga0373958_0022561 | |||
| 2953 | Ga0373958_0094801 | |||
| 2954 | Ga0373959_0006266 | |||
| 2955 | Ga0373959_0013525 | |||
| 2956 | Ga0373959_0078539 | |||
| 2957 | Ga0373938_0034724 | |||
| 2958 | Ga0373938_0246200 | |||
| 2959 | Ga0373926_0269996 | |||
| 2960 | Ga0373928_0033370 | |||
| 2961 | Ga0373928_0062653 | |||
| 2962 | Ga0373928_0154152 | |||
| 2963 | Ga0373929_0026783 | |||
| 2964 | Ga0373929_0029820 | |||
| 2965 | Ga0373929_0056692 | |||
| 2966 | Ga0373934_0141970 | |||
| 2967 | Ga0373934_0454027 | |||
| 2968 | Ga0373940_0074398 | |||
| 2969 | Ga0373944_0057368 | |||
| 2970 | Ga0373949_0250311 | |||
| 2971 | Ga0373952_0021650 | |||
| 2972 | Ga0373952_0022759 | |||
| 2973 | Ga0373952_0044807 | |||
| 2974 | Ga0373923_0036974 | |||
| 2975 | Ga0373932_0170684 | |||
| 2976 | Ga0373939_0067213 | |||
| 2977 | Ga0373939_0254051 | |||
| 2978 | Ga0373941_0017581 | |||
| 2979 | Ga0373941_0232439 | |||
| 2980 | Ga0373945_0397345 | |||
| 2981 | Ga0373953_0014696 | |||
| 2982 | Ga0373954_0236932 | |||
| 2983 | Ga0373956_0149048 | |||
| 2984 | Ga0373956_0345775 | |||
| 2985 | Ga0373957_0106980 | |||
| 2986 | Ga0373960_0040013 | |||
| 2987 | Ga0373960_0121692 | |||
| 2988 | Ga0373960_0200705 | |||
| 2989 | Ga0373943_0015892 | |||
| 2990 | Ga0373943_0407194 | |||
| 2991 | Ga0373946_0276367 | |||
| 2992 | Ga0373946_0676961 | |||
| 2993 | Ga0373955_0088617 | |||
| 2994 | Ga0373942_0037456 | |||
| 2995 | Ga0373942_0199256 | |||
| 2996 | Ga0373961_0000555 | |||
| 2997 | Ga0373961_0036950 | |||
| 2998 | Ga0373961_0314891 | |||
| 2999 | Ga0373962_0259282 | |||
| 3000 | Ga0316574_0007172 | |||
| 3001 | Ga0316574_0331037 | |||
| 3002 | Ga0316574_0355322 | |||
| 3003 | Ga0373924_0040307 | |||
| 3004 | Ga0373931_0065790 | |||
| 3005 | Ga0373931_0113587 | |||
| 3006 | Ga0373931_0233081 | |||
| 3007 | Ga0373931_0424587 | |||
| 3008 | Ga0373931_0856974 | |||
| 3009 | Ga0373935_0058549 | |||
| 3010 | Ga0373933_0002765 | |||
| 3011 | Ga0373937_0001688 | |||
| 3012 | Ga0373937_0063603 | |||
| 3013 | Ga0373937_0245517 | |||
| 3014 | Ga0373937_0517704 | |||
| 3015 | Ga0373937_1029058 | |||
| 3016 | Ga0373937_1128300 | |||
| 3017 | Ga0373937_1565581 | |||
| 3018 | Ga0316582_0015599 | |||
| 3019 | Ga0316582_0945318 | |||
| 3020 | Ga0316584_0007216 | |||
| 3021 | Ga0373925_0078483 | |||
| 3022 | Ga0373925_0176928 | |||
| 3023 | Ga0373925_0292667 | |||
| 3024 | Ga0373925_0487257 | |||
| 3025 | Ga0395899_0151372 | |||
| 3026 | Ga0395900_0024491 | |||
| 3027 | Ga0395898_1598012 | |||
| 3028 | Ga0395905_0025260 | |||
| 3029 | Ga0395905_0067530 | |||
| 3030 | Ga0395905_1312912 | |||
| 3031 | Ga0395905_1736610 | |||
| 3032 | Ga0436364_0100568 | |||
| 3033 | Ga0436364_0390676 | |||
| 3034 | Ga0436364_1537478 | |||
| 3035 | Ga0395901_0001770 | |||
| 3036 | Ga0242419_003585 | |||
| 3037 | Ga0242420_050187 | |||
| 3038 | Ga0436365_0223155 | |||
| 3039 | Ga0436365_0234011 | |||
| 3040 | Ga0436365_0408308 | |||
| 3041 | Ga0436365_1264253 | |||
| 3042 | Ga0436365_1424311 | |||
| 3043 | Ga0436365_1599614 | |||
| 3044 | Ga0439439_0048325 | |||
| 3045 | Ga0439439_0178061 | |||
| 3046 | Ga0439453_0097394 | |||
| 3047 | Ga0451793_0749803 | |||
| 3048 | Ga0451795_1463064 | |||
| 3049 | Ga0451802_1318879 | |||
| 3050 | Ga0451807_0674211 | |||
| 3051 | Ga0451807_1934356 | |||
| 3052 | Ga0451807_2773123 | |||
| 3053 | Ga0451839_1015318 | |||
| 3054 | Ga0451845_0267143 | |||
| 3055 | Ga0451853_2480235 | |||
| 3056 | Ga0451853_2725406 | |||
| 3057 | Ga0439433_0143812 | |||
| 3058 | Ga0439432_163717 | |||
| 3059 | Ga0439449_0103716 | |||
| 3060 | Ga0439455_0022797 | |||
| 3061 | Ga0439456_080993 | |||
| 3062 | Ga0439446_0049325 | |||
| 3063 | Ga0439446_0053270 | |||
| 3064 | Ga0439446_0174111 | |||
| 3065 | Ga0439446_0346855 | |||
| 3066 | Ga0439434_0081628 | |||
| 3067 | Ga0439434_0157571 | |||
| 3068 | Ga0439459_0037912 | |||
| 3069 | Ga0451577_0049852 | |||
| 3070 | Ga0451577_0208168 | |||
| 3071 | Ga0451577_0391595 | |||
| 3072 | Ga0453683_0012099 | |||
| 3073 | Ga0453683_0182841 | |||
| 3074 | Ga0453683_0714274 | |||
| 3075 | Ga0453683_0746648 | |||
| 3076 | Ga0466965_0134875 | |||
| 3077 | Ga0466965_0435969 | |||
| 3078 | Ga0466961_0216372 | |||
| 3079 | Ga0466963_0055834 | |||
| 3080 | Ga0466964_0133383 | |||
| 3081 | Ga0453684_0062783 | |||
| 3082 | Ga0453684_0532052 | |||
| 3083 | Ga0453684_0714362 | |||
| 3084 | Ga0453684_1371210 | |||
| 3085 | Ga0453684_1964546 | |||
| 3086 | Ga0453684_2365960 | |||
| 3087 | Ga0466970_0649912 | |||
| 3088 | Ga0466957_0209596 | |||
| 3089 | Ga0466960_0145973 | |||
| 3090 | Ga0466960_0176826 | |||
| 3091 | Ga0466959_0772507 | |||
| 3092 | Ga0466959_1022370 | |||
| 3093 | Ga0451576_0032102 | |||
| 3094 | Ga0451576_0153457 | |||
| 3095 | Ga0451576_0237355 | |||
| 3096 | Ga0451576_0252033 | |||
| 3097 | Ga0451576_0297024 | |||
| 3098 | Ga0451576_0308436 | |||
| 3099 | Ga0451576_0388486 | |||
| 3100 | Ga0466958_0198001 | |||
| 3101 | Ga0466958_0629169 | |||
| 3102 | Ga0466967_0277810 | |||
| 3103 | Ga0466967_1060643 | |||
| 3104 | Ga0466967_1139939 | |||
| 3105 | Ga0495592_0402576 | |||
| 3106 | Ga0495592_0498975 | |||
| 3107 | Ga0495603_0021202 | |||
| 3108 | Ga0495603_0043390 | |||
| 3109 | Ga0495590_0238336 | |||
| 3110 | Ga0495629_0048696 | |||
| 3111 | Ga0495629_0073936 | |||
| 3112 | Ga0495629_0077215 | |||
| 3113 | Ga0495629_0615914 | |||
| 3114 | Ga0495629_0678831 | |||
| 3115 | Ga0495651_0017188 | |||
| 3116 | Ga0495651_0084014 | |||
| 3117 | Ga0495651_0243225 | |||
| 3118 | Ga0495653_0026437 | |||
| 3119 | Ga0495580_0016230 | |||
| 3120 | Ga0495580_0076246 | |||
| 3121 | Ga0495580_0087356 | |||
| 3122 | Ga0495580_0113415 | |||
| 3123 | Ga0495582_0010686 | |||
| 3124 | Ga0495582_0014832 | |||
| 3125 | Ga0495582_0109507 | |||
| 3126 | Ga0495582_0197880 | |||
| 3127 | Ga0495605_0283024 | |||
| 3128 | Ga0495605_0494223 | |||
| 3129 | Ga0495639_0004714 | |||
| 3130 | Ga0495639_0067391 | |||
| 3131 | Ga0495662_0097571 | |||
| 3132 | Ga0495662_0117049 | |||
| 3133 | Ga0495664_0463726 | |||
| 3134 | Ga0495584_0592649 | |||
| 3135 | Ga0495594_0005611 | |||
| 3136 | Ga0495594_0069873 | |||
| 3137 | Ga0495594_0118996 | |||
| 3138 | Ga0495596_0010087 | |||
| 3139 | Ga0495583_0164843 | |||
| 3140 | Ga0495608_0033181 | |||
| 3141 | Ga0495608_0103342 | |||
| 3142 | Ga0495608_0266708 | |||
| 3143 | Ga0495608_0501057 | |||
| 3144 | Ga0495618_0000743 | |||
| 3145 | Ga0495618_0036169 | |||
| 3146 | Ga0495618_0422616 | |||
| 3147 | Ga0495618_0821398 | |||
| 3148 | Ga0495628_0214703 | |||
| 3149 | Ga0495628_0229371 | |||
| 3150 | Ga0495630_0094702 | |||
| 3151 | Ga0495630_0176568 | |||
| 3152 | Ga0495630_0462261 | |||
| 3153 | Ga0495630_0559980 | |||
| 3154 | Ga0495630_0814085 | |||
| 3155 | Ga0495630_0953767 | |||
| 3156 | Ga0495643_0072184 | |||
| 3157 | Ga0495663_0020324 | |||
| 3158 | Ga0495663_0020379 | |||
| 3159 | Ga0495666_0012771 | |||
| 3160 | Ga0495642_0053960 | |||
| 3161 | Ga0495652_0123654 | |||
| 3162 | Ga0495652_0156344 | |||
| 3163 | Ga0495665_0014539 | |||
| 3164 | Ga0495665_0028776 | |||
| 3165 | Ga0495665_0250977 | |||
| 3166 | Ga0495640_0156834 | |||
| 3167 | Ga0495640_0185177 | |||
| 3168 | Ga0495640_0629692 | |||
| 3169 | Ga0495586_0015359 | |||
| 3170 | Ga0495586_0126327 | |||
| 3171 | Ga0495586_0174630 | |||
| 3172 | Ga0495586_0301689 | |||
| 3173 | Ga0495586_0319161 | |||
| 3174 | Ga0495586_0508105 | |||
| 3175 | Ga0495587_0267041 | |||
| 3176 | Ga0495587_0447806 | |||
| 3177 | Ga0495587_0619377 | |||
| 3178 | Ga0495598_0268802 | |||
| 3179 | Ga0495621_0041710 | |||
| 3180 | Ga0495621_0053555 | |||
| 3181 | Ga0495645_0013239 | |||
| 3182 | Ga0495645_0238829 | |||
| 3183 | Ga0495645_0680694 | |||
| 3184 | Ga0495622_0380357 | |||
| 3185 | Ga0495667_0016331 | |||
| 3186 | Ga0495667_0063143 | |||
| 3187 | Ga0495667_0220730 | |||
| 3188 | Ga0495656_0085019 | |||
| 3189 | Ga0495634_0150620 | |||
| 3190 | Ga0495634_0171853 | |||
| 3191 | Ga0495634_0192667 | |||
| 3192 | Ga0495635_0054906 | |||
| 3193 | Ga0495635_0084340 | |||
| 3194 | Ga0495659_0249609 | |||
| 3195 | Ga0495661_0341275 | |||
| 3196 | Ga0495588_0088616 | |||
| 3197 | Ga0495657_0049025 | |||
| 3198 | Ga0495657_0113082 | |||
| 3199 | Ga0495599_0010652 | |||
| 3200 | Ga0495599_0015785 | |||
| 3201 | Ga0495599_0224563 | |||
| 3202 | Ga0495623_0017452 | |||
| 3203 | Ga0495623_0082831 | |||
| 3204 | Ga0495623_0108146 | |||
| 3205 | Ga0495646_0016342 | |||
| 3206 | Ga0495646_0626111 | |||
| 3207 | Ga0495647_0139968 | |||
| 3208 | Ga0495647_0631783 | |||
| 3209 | Ga0495658_0060006 | |||
| 3210 | Ga0495658_0110421 | |||
| 3211 | Ga0495658_0338908 | |||
| 3212 | Ga0495658_0495585 | |||
| 3213 | Ga0495669_0163695 | |||
| 3214 | Ga0495669_0640093 | |||
| 3215 | Ga0495613_0035641 | |||
| 3216 | Ga0495613_0182583 | |||
| 3217 | Ga0495613_0399046 | |||
| 3218 | Ga0495613_0467808 | |||
| 3219 | Ga0495624_0148945 | |||
| 3220 | Ga0495600_0043998 | |||
| 3221 | Ga0495581_0162192 | |||
| 3222 | Ga0495581_0661507 | |||
| 3223 | Ga0495581_0675231 | |||
| 3224 | Ga0495581_0843010 | |||
| 3225 | Ga0495604_0027250 | |||
| 3226 | Ga0495604_0104964 | |||
| 3227 | Ga0495636_0036783 | |||
| 3228 | Ga0495636_0174422 | |||
| 3229 | Ga0495674_0022976 | |||
| 3230 | Ga0495674_0260821 | |||
| 3231 | Ga0495674_0899048 | |||
| 3232 | Ga0495676_0582121 | |||
| 3233 | Ga0495680_0013035 | |||
| 3234 | Ga0495680_0091581 | |||
| 3235 | Ga0495680_0287504 | |||
| 3236 | Ga0495680_0442587 | |||
| 3237 | Ga0495680_0722849 | |||
| 3238 | Ga0495680_0893525 | |||
| 3239 | Ga0495675_0079198 | |||
| 3240 | Ga0495675_0170389 | |||
| 3241 | Ga0495677_0106504 | |||
| 3242 | Ga0495685_031250 | |||
| 3243 | Ga0495684_0071242 | |||
| 3244 | Ga0495684_0116099 | |||
| 3245 | Ga0495684_0169445 | |||
| 3246 | Ga0495684_0271682 | |||
| 3247 | Ga0495684_0288272 | |||
| 3248 | Ga0495684_0504246 | |||
| 3249 | Ga0495593_0201702 | |||
| 3250 | Ga0495602_0013466 | |||
| 3251 | Ga0495602_0100827 | |||
| 3252 | Ga0495602_0239437 | |||
| 3253 | Ga0495602_0401675 | |||
| 3254 | Ga0495602_0923954 | |||
| 3255 | Ga0495615_0252670 | |||
| 3256 | Ga0496100_0078491 | |||
| 3257 | Ga0496100_0109226 | |||
| 3258 | Ga0496100_0289027 | |||
| 3259 | Ga0496100_0800416 | |||
| 3260 | Ga0496101_0056945 | |||
| 3261 | Ga0496101_0111991 | |||
| 3262 | Ga0496101_1124416 | |||
| 3263 | Ga0496102_0172439 | |||
| 3264 | Ga0496102_0970077 | |||
| 3265 | Ga0496104_0065574 | |||
| 3266 | Ga0496104_0309521 | |||
| 3267 | Ga0496104_0399240 | |||
| 3268 | Ga0496105_0059694 | |||
| 3269 | Ga0496105_0070746 | |||
| 3270 | Ga0496105_0147782 | |||
| 3271 | Ga0496106_0027640 | |||
| 3272 | Ga0496106_0064193 | |||
| 3273 | Ga0496106_0318902 | |||
| 3274 | Ga0496106_0342753 | |||
| 3275 | Ga0496106_0578785 | |||
| 3276 | Ga0496107_0261224 | |||
| 3277 | Ga0496107_0344283 | |||
| 3278 | Ga0496107_0711641 | |||
| 3279 | Ga0496108_0035987 | |||
| 3280 | Ga0496108_0592139 | |||
| 3281 | Ga0496108_1009386 | |||
| 3282 | Ga0496109_0039889 | |||
| 3283 | Ga0496109_0042753 | |||
| 3284 | Ga0496109_0043173 | |||
| 3285 | Ga0496110_0007094 | |||
| 3286 | Ga0496110_0089104 | |||
| 3287 | Ga0496110_0151553 | |||
| 3288 | Ga0496111_0001415 | |||
| 3289 | Ga0496111_0072867 | |||
| 3290 | Ga0496111_0553796 | |||
| 3291 | Ga0496112_0002541 | |||
| 3292 | Ga0496112_0024016 | |||
| 3293 | Ga0496112_0060181 | |||
| 3294 | Ga0496112_0079427 | |||
| 3295 | Ga0496112_0104391 | |||
| 3296 | Ga0496112_0976500 | |||
| 3297 | Ga0496112_1175577 | |||
| 3298 | Ga0496113_0047161 | |||
| 3299 | Ga0496113_0075448 | |||
| 3300 | Ga0496113_0156046 | |||
| 3301 | Ga0496113_0813883 | |||
| 3302 | Ga0496113_1115274 | |||
| 3303 | Ga0496114_0000001 | |||
| 3304 | Ga0496114_0047313 | |||
| 3305 | Ga0496114_1019079 | |||
| 3306 | Ga0496115_0082370 | |||
| 3307 | Ga0501306_024127 | |||
| 3308 | Ga0501306_049510 | |||
| 3309 | Ga0501308_074347 | |||
| 3310 | Ga0501310_074323 | |||
| 3311 | Ga0501307_001003 | |||
| 3312 | Ga0501307_051693 | |||
| 3313 | Ga0501296_050298 | |||
| 3314 | Ga0501298_006514 | |||
| 3315 | Ga0501298_071487 | |||
| 3316 | Ga0501303_022268 | |||
| 3317 | Ga0501313_033044 | |||
| 3318 | Ga0501313_066371 | |||
| 3319 | Ga0501314_036139 | |||
| 3320 | Ga0501315_027200 | |||
| 3321 | Ga0501317_089645 | |||
| 3322 | Ga0501320_034979 | |||
| 3323 | Ga0501031_0115077 | |||
| 3324 | Ga0501031_0232197 | |||
| 3325 | Ga0501031_0959922 | |||
| 3326 | Ga0501032_0082763 | |||
| 3327 | Ga0501032_0670862 | |||
| 3328 | Ga0501033_0245632 | |||
| 3329 | Ga0501033_0458016 | |||
| 3330 | Ga0501033_0773273 | |||
| 3331 | Ga0501034_0000132 | |||
| 3332 | Ga0501034_0044308 | |||
| 3333 | Ga0501034_0196452 | |||
| 3334 | Ga0501034_0396995 | |||
| 3335 | Ga0501034_0762996 | |||
| 3336 | Ga0501034_0806897 | |||
| 3337 | Ga0501036_0170582 | |||
| 3338 | Ga0501036_0190593 | |||
| 3339 | Ga0501036_0297376 | |||
| 3340 | Ga0501036_0311648 | |||
| 3341 | Ga0501037_0287470 | |||
| 3342 | Ga0501037_0427947 | |||
| 3343 | Ga0501037_0451245 | |||
| 3344 | Ga0501037_0693149 | |||
| 3345 | Ga0501038_0011902 | |||
| 3346 | Ga0501038_0353513 | |||
| 3347 | Ga0501038_0513220 | |||
| 3348 | Ga0501038_1208946 | |||
| 3349 | Ga0501039_0103131 | |||
| 3350 | Ga0501039_0196869 | |||
| 3351 | Ga0501039_0663518 | |||
| 3352 | Ga0501040_0021934 | |||
| 3353 | Ga0501040_0069484 | |||
| 3354 | Ga0501041_0023985 | |||
| 3355 | Ga0501041_0117942 | |||
| 3356 | Ga0501041_0135383 | |||
| 3357 | Ga0501041_0398134 | |||
| 3358 | Ga0501042_0037878 | |||
| 3359 | Ga0501042_0215413 | |||
| 3360 | Ga0501042_0407104 | |||
| 3361 | Ga0501042_0533108 | |||
| 3362 | Ga0501043_0000829 | |||
| 3363 | Ga0501043_0047600 | |||
| 3364 | Ga0501046_0000117 | |||
| 3365 | Ga0501046_0028687 | |||
| 3366 | Ga0501046_0047535 | |||
| 3367 | Ga0501046_0102764 | |||
| 3368 | Ga0501046_0213074 | |||
| 3369 | Ga0501046_0278630 | |||
| 3370 | Ga0501046_0447386 | |||
| 3371 | Ga0501047_0029942 | |||
| 3372 | Ga0501047_0130028 | |||
| 3373 | Ga0501047_0130576 | |||
| 3374 | Ga0501048_0031361 | |||
| 3375 | Ga0501048_0118379 | |||
| 3376 | Ga0501048_0186441 | |||
| 3377 | Ga0501048_0229725 | |||
| 3378 | Ga0501048_0373847 | |||
| 3379 | Ga0501048_0473535 | |||
| 3380 | Ga0501048_0620527 | |||
| 3381 | Ga0501067_0014484 | |||
| 3382 | Ga0501067_0039490 | |||
| 3383 | Ga0501067_0060801 | |||
| 3384 | Ga0501067_0066718 | |||
| 3385 | Ga0501067_0232860 | |||
| 3386 | Ga0501067_0328662 | |||
| 3387 | Ga0501068_0001673 | |||
| 3388 | Ga0501068_0008160 | |||
| 3389 | Ga0501068_0075235 | |||
| 3390 | Ga0501068_0131811 | |||
| 3391 | Ga0501068_0335310 | |||
| 3392 | Ga0501068_1054470 | |||
| 3393 | Ga0501069_0008330 | |||
| 3394 | Ga0501069_0017995 | |||
| 3395 | Ga0501069_0074284 | |||
| 3396 | Ga0501069_0183155 | |||
| 3397 | Ga0501069_0212562 | |||
| 3398 | Ga0501069_0273842 | |||
| 3399 | Ga0501069_0772874 | |||
| 3400 | Ga0501069_0815877 | |||
| 3401 | Ga0501070_0013050 | |||
| 3402 | Ga0501070_0032011 | |||
| 3403 | Ga0501070_0063385 | |||
| 3404 | Ga0501070_0069675 | |||
| 3405 | Ga0501070_0089832 | |||
| 3406 | Ga0501070_0097328 | |||
| 3407 | Ga0501070_0171248 | |||
| 3408 | Ga0501070_0509274 | |||
| 3409 | Ga0501070_0513201 | |||
| 3410 | Ga0501071_0012801 | |||
| 3411 | Ga0501071_0238684 | |||
| 3412 | Ga0501071_0481689 | |||
| 3413 | Ga0501071_0732719 | |||
| 3414 | Ga0501071_0839822 | |||
| 3415 | Ga0501071_0919752 | |||
| 3416 | Ga0501072_0006109 | |||
| 3417 | Ga0501072_0010585 | |||
| 3418 | Ga0501072_0032455 | |||
| 3419 | Ga0501072_0053900 | |||
| 3420 | Ga0501072_0154703 | |||
| 3421 | Ga0501072_0209787 | |||
| 3422 | Ga0501072_0212282 | |||
| 3423 | Ga0501072_0234614 | |||
| 3424 | Ga0501072_0265703 | |||
| 3425 | Ga0501072_0658239 | |||
| 3426 | Ga0501072_1358210 | |||
| 3427 | Ga0501073_0170984 | |||
| 3428 | Ga0501073_0174870 | |||
| 3429 | Ga0501073_0772218 | |||
| 3430 | Ga0501074_0069510 | |||
| 3431 | Ga0501074_0084841 | |||
| 3432 | Ga0501074_0165238 | |||
| 3433 | Ga0501074_0246973 | |||
| 3434 | Ga0501075_0006664 | |||
| 3435 | Ga0501075_0029122 | |||
| 3436 | Ga0501075_0036489 | |||
| 3437 | Ga0501075_0165817 | |||
| 3438 | Ga0501075_0267549 | |||
| 3439 | Ga0501075_0319160 | |||
| 3440 | Ga0501076_0006442 | |||
| 3441 | Ga0501076_0054868 | |||
| 3442 | Ga0501076_0069214 | |||
| 3443 | Ga0501076_0219729 | |||
| 3444 | Ga0501076_0226375 | |||
| 3445 | Ga0501076_0244716 | |||
| 3446 | Ga0501076_0547773 | |||
| 3447 | Ga0501076_0949277 | |||
| 3448 | Ga0501076_1109836 | |||
| 3449 | Ga0501077_0002603 | |||
| 3450 | Ga0501077_0003447 | |||
| 3451 | Ga0501077_0048237 | |||
| 3452 | Ga0501077_0152205 | |||
| 3453 | Ga0501077_0243273 | |||
| 3454 | Ga0501077_0383412 | |||
| 3455 | Ga0501077_0619854 | |||
| 3456 | Ga0501198_152313 | |||
| 3457 | Ga0501202_033027 | |||
| 3458 | Ga0501202_053765 | |||
| 3459 | Ga0501209_004058 | |||
| 3460 | Ga0501209_143699 | |||
| 3461 | Ga0501216_009705 | |||
| 3462 | Ga0501216_046341 | |||
| 3463 | Ga0501216_067720 | |||
| 3464 | Ga0501216_174444 | |||
| 3465 | Ga0501217_119395 | |||
| 3466 | Ga0501217_189877 | |||
| 3467 | Ga0501217_243053 | |||
| 3468 | Ga0501223_008477 | |||
| 3469 | Ga0501224_001238 | |||
| 3470 | Ga0501227_018036 | |||
| 3471 | Ga0501230_009571 | |||
| 3472 | Ga0501233_004905 | |||
| 3473 | Ga0501233_101052 | |||
| 3474 | Ga0501235_007524 | |||
| 3475 | Ga0501236_051361 | |||
| 3476 | Ga0501239_013408 | |||
| 3477 | Ga0501239_025043 | |||
| 3478 | Ga0501239_027332 | |||
| 3479 | Ga0501242_033433 | |||
| 3480 | Ga0501242_052523 | |||
| 3481 | Ga0501243_004221 | |||
| 3482 | Ga0501243_012793 | |||
| 3483 | Ga0501247_010669 | |||
| 3484 | Ga0501249_018960 | |||
| 3485 | Ga0501249_172577 | |||
| 3486 | Ga0501250_041481 | |||
| 3487 | Ga0501251_076902 | |||
| 3488 | Ga0501253_078750 | |||
| 3489 | Ga0501256_042400 | |||
| 3490 | Ga0501257_008968 | |||
| 3491 | Ga0501257_118845 | |||
| 3492 | Ga0501257_123774 | |||
| 3493 | Ga0501257_166148 | |||
| 3494 | Ga0501257_166883 | |||
| 3495 | Ga0501258_012429 | |||
| 3496 | Ga0501259_084809 | |||
| 3497 | Ga0501259_143473 | |||
| 3498 | Ga0501261_045769 | |||
| 3499 | Ga0501261_050502 | |||
| 3500 | Ga0501221_065122 | |||
| 3501 | Ga0501221_111637 | |||
| 3502 | Ga0501221_237514 | |||
| 3503 | Ga0501225_0004791 | |||
| 3504 | Ga0501234_001400 | |||
| 3505 | Ga0501234_097071 | |||
| 3506 | Ga0501079_0012691 | |||
| 3507 | Ga0501079_0019559 | |||
| 3508 | Ga0501079_0035622 | |||
| 3509 | Ga0501079_0055628 | |||
| 3510 | Ga0501079_0074686 | |||
| 3511 | Ga0501079_0162200 | |||
| 3512 | Ga0501079_0202075 | |||
| 3513 | Ga0501079_0610392 | |||
| 3514 | Ga0501079_0611211 | |||
| 3515 | Ga0501079_0718441 | |||
| 3516 | Ga0501080_0002929 | |||
| 3517 | Ga0501080_0004569 | |||
| 3518 | Ga0501080_0092828 | |||
| 3519 | Ga0501080_0365132 | |||
| 3520 | Ga0501080_0404222 | |||
| 3521 | Ga0501080_0607070 | |||
| 3522 | Ga0501080_1618640 | |||
| 3523 | Ga0501081_0019645 | |||
| 3524 | Ga0501081_0084738 | |||
| 3525 | Ga0501081_0099127 | |||
| 3526 | Ga0501081_0125422 | |||
| 3527 | Ga0501081_1455032 | |||
| 3528 | Ga0501083_0000071 | |||
| 3529 | Ga0501083_0014932 | |||
| 3530 | Ga0501083_0043800 | |||
| 3531 | Ga0501083_0083137 | |||
| 3532 | Ga0501083_0212131 | |||
| 3533 | Ga0501083_0348811 | |||
| 3534 | Ga0501083_0923936 | |||
| 3535 | Ga0501232_010440 | |||
| 3536 | Ga0501262_049657 | |||
| 3537 | Ga0501263_055879 | |||
| 3538 | Ga0501265_030122 | |||
| 3539 | Ga0501266_003064 | |||
| 3540 | Ga0501267_004229 | |||
| 3541 | Ga0501267_008912 | |||
| 3542 | Ga0501268_002758 | |||
| 3543 | Ga0501268_008026 | |||
| 3544 | Ga0501268_034317 | |||
| 3545 | Ga0501268_039586 | |||
| 3546 | Ga0501268_046406 | |||
| 3547 | Ga0501268_100477 | |||
| 3548 | Ga0501268_107212 | |||
| 3549 | Ga0501270_012851 | |||
| 3550 | Ga0501270_070908 | |||
| 3551 | Ga0501270_092479 | |||
| 3552 | Ga0501270_108129 | |||
| 3553 | Ga0501271_002195 | |||
| 3554 | Ga0501272_013617 | |||
| 3555 | Ga0501273_008374 | |||
| 3556 | Ga0501273_035883 | |||
| 3557 | Ga0501273_080648 | |||
| 3558 | Ga0501274_002181 | |||
| 3559 | Ga0501275_043350 | |||
| 3560 | Ga0501283_008388 | |||
| 3561 | Ga0501035_0124162 | |||
| 3562 | Ga0501035_0186524 | |||
| 3563 | Ga0501035_0204036 | |||
| 3564 | Ga0501035_0583180 | |||
| 3565 | Ga0501035_0792784 | |||
| 3566 | Ga0501035_1113324 | |||
| 3567 | Ga0501044_0013639 | |||
| 3568 | Ga0501044_0064096 | |||
| 3569 | Ga0501044_0074963 | |||
| 3570 | Ga0501044_0431474 | |||
| 3571 | Ga0501044_0502384 | |||
| 3572 | Ga0501044_0630322 | |||
| 3573 | Ga0501045_0004175 | |||
| 3574 | Ga0501045_0032763 | |||
| 3575 | Ga0501045_0086402 | |||
| 3576 | Ga0501045_0161793 | |||
| 3577 | Ga0501045_0241244 | |||
| 3578 | Ga0501045_0330576 | |||
| 3579 | Ga0501045_0562930 | |||
| 3580 | Ga0501204_013205 | |||
| 3581 | Ga0501212_001652 | |||
| 3582 | Ga0501212_083701 | |||
| 3583 | nmdc:mga05p37_151379_c1 | |||
| 3584 | nmdc:mga05p37_429595_c1 | |||
| 3585 | nmdc:mga05p37_518028_c1 | |||
| 3586 | nmdc:mga05p37_663841_c1 | |||
| 3587 | nmdc:mga09592_311408_c1 | |||
| 3588 | nmdc:mga09592_413108_c1 | |||
| 3589 | nmdc:mga09592_759854_c1 | |||
| 3590 | nmdc:mga0qj67_339484_c1 | |||
| 3591 | nmdc:mga0qj67_77954_c1 | |||
| 3592 | nmdc:mga0qj67_793471_c1 | |||
| 3593 | nmdc:mga06r32_1497899_c1 | |||
| 3594 | nmdc:mga06r32_342365_c1 | |||
| 3595 | nmdc:mga06r32_429330_c1 | |||
| 3596 | nmdc:mga06r32_46152_c1 | |||
| 3597 | nmdc:mga06r32_6558_c1 | |||
| 3598 | nmdc:mga08y16_116742_c1 | |||
| 3599 | nmdc:mga08y16_144197_c1 | |||
| 3600 | nmdc:mga08y16_22055_c1 | |||
| 3601 | nmdc:mga08y16_281933_c1 | |||
| 3602 | nmdc:mga08y16_288511_c1 | |||
| 3603 | nmdc:mga08y16_311113_c1 | |||
| 3604 | nmdc:mga08y16_315866_c1 | |||
| 3605 | nmdc:mga08y16_699500_c1 | |||
| 3606 | nmdc:mga0n895_1181678_c1 | |||
| 3607 | nmdc:mga0n895_190360_c1 | |||
| 3608 | nmdc:mga0n895_21843_c1 | |||
| 3609 | nmdc:mga0n895_253314_c1 | |||
| 3610 | nmdc:mga0n895_358036_c1 | |||
| 3611 | nmdc:mga0n895_464171_c1 | |||
| 3612 | nmdc:mga0n895_512489_c1 | |||
| 3613 | nmdc:mga0n895_516105_c1 | |||
| 3614 | nmdc:mga0n895_573569_c1 | |||
| 3615 | nmdc:mga0rr50_11870_c2 | |||
| 3616 | nmdc:mga0rr50_1342219_c1 | |||
| 3617 | nmdc:mga0rr50_274532_c1 | |||
| 3618 | nmdc:mga0rr50_409005_c1 | |||
| 3619 | nmdc:mga0rr50_508223_c1 | |||
| 3620 | nmdc:mga0rr50_677514_c1 | |||
| 3621 | nmdc:mga08x19_145676_c1 | |||
| 3622 | nmdc:mga08x19_1503_c1 | |||
| 3623 | nmdc:mga08x19_24882_c1 | |||
| 3624 | nmdc:mga08x19_98185_c1 | |||
| 3625 | nmdc:mga0a205_26534_c1 | |||
| 3626 | nmdc:mga0a205_71485_c1 | |||
| 3627 | Ga0495601_0410362 | |||
| 3628 | Ga0495655_0204864 | |||
| 3629 | Ga0495655_0287792 | |||
| 3630 | Ga0495595_0402086 | |||
| 3631 | Ga0495595_0672761 | |||
| 3632 | Ga0495619_0033082 | |||
| 3633 | Ga0495619_0216400 | |||
| 3634 | Ga0495619_0901547 | |||
| 3635 | Ga0501084_0032504 | |||
| 3636 | Ga0501084_0040463 | |||
| 3637 | Ga0501084_0042401 | |||
| 3638 | Ga0501084_0053363 | |||
| 3639 | Ga0501084_0055496 | |||
| 3640 | Ga0501084_0060696 | |||
| 3641 | Ga0501084_0980505 | |||
| 3642 | Ga0501084_1171158 | |||
| 3643 | Ga0590071_003501 | |||
| 3644 | Ga0590071_006633 | |||
| 3645 | Ga0590071_007102 | |||
| 3646 | Ga0590071_009609 | |||
| 3647 | Ga0590071_018064 | |||
| 3648 | Ga0590074_010487 | |||
| 3649 | Ga0590074_063876 | |||
| 3650 | Ga0590075_044972 | |||
| 3651 | Ga0590077_064462 | |||
| 3652 | Ga0587084_125122 | |||
| 3653 | Ga0587066_016651 | |||
| 3654 | Ga0587073_0076206 | |||
| 3655 | Ga0587085_153754 | |||
| 3656 | Ga0587085_183001 | |||
| 3657 | Ga0587091_057781 | |||
| 3658 | Ga0587091_084500 | |||
| 3659 | Ga0587113_036215 | |||
| 3660 | Ga0587067_142955 | |||
| 3661 | Ga0587076_201833 | |||
| 3662 | Ga0587079_047120 | |||
| 3663 | Ga0587071_013833 | |||
| 3664 | Ga0587071_109511 | |||
| 3665 | Ga0501082_0004163 | |||
| 3666 | Ga0501082_0019498 | |||
| 3667 | Ga0501082_0033970 | |||
| 3668 | Ga0501082_0052165 | |||
| 3669 | Ga0501082_0061602 | |||
| 3670 | Ga0501082_0063320 | |||
| 3671 | Ga0501082_0071941 | |||
| 3672 | Ga0501082_0112785 | |||
| 3673 | Ga0501082_0226165 | |||
| 3674 | Ga0501082_0404454 | |||
| 3675 | Ga0501082_0462845 | |||
| 3676 | Ga0501082_0472839 | |||
| 3677 | Ga0501082_0898369 | |||
| 3678 | Ga0501082_1328866 | |||
| 3679 | Ga0530510_0055415 | |||
| 3680 | Ga0530510_0113500 | |||
| 3681 | Ga0530510_0155250 | |||
| 3682 | Ga0530510_0165371 | |||
| 3683 | Ga0530510_0331267 | |||
| 3684 | Ga0530510_0469868 | |||
| 3685 | Ga0530510_1158495 | |||
| 3686 | Ga0530510_1211158 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_BS | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9657 | 15 | 76 |
| 5mmm-assembly1.cif.gz_s | structure of the 70s chloroplast ribosome | 0.9441 | 8 | 83 |
| 7qv3-assembly1.cif.gz_s | bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) | 0.9377 | 4 | 80 |
| 7qv3-assembly1.cif.gz_s | bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) | 0.9262 | 4 | 80 |
| 8buu-assembly1.cif.gz_s | are-abcf vmlr2 bound to a 70s ribosome | 0.9236 | 2 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06588_1_92_3.30.860.10 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9482 | 8 | 83 | 3.30.860.10 |
| 5zeus00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9025 | 7 | 83 | 3.30.860.10 |
| 2y0uS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8973 | 4 | 81 | 3.30.860.10 |
| 4kj2S00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8925 | 3 | 81 | 3.30.860.10 |
| 2y0uS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8865 | 4 | 81 | 3.30.860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7UQP5-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9738 | 1 | 78 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7C7UQP5-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9617 | 1 | 78 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A1F4QGH0-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9374 | 1 | 82 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A661WLB4-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9309 | 1 | 83 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-H6T3U6-F1-model_v4 | Small ribosomal subunit protein uS19c (30S ribosomal protein S19, chloroplastic) | 0.93 | 7 | 85 |
GO:0000028
GO:0003735 GO:0005763 GO:0006412 GO:0009536 GO:0019843 |