F495785

General Info

Members Datasets Scaffolds Average Seq Length
1818 554 1769 80

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0204446|Ga0466963_0204446_662_943
Length 93
Sequence VLEEALEHLVKGIVDHPDDVRVDARSPRRGRGGPRGQGGRGSGEKLLEVRVHPDDLGKIIGRQGRTAKALRTVMSAIGGKGVRVDLVDTDHLR

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
4 2643221548 Streptomyces sp. Root55 Isolate Unclassified
5 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
6 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
7 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
8 2643221670 Streptomyces sp. Root431 Isolate Unclassified
9 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
12 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
13 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
14 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
15 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
16 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
17 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
18 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
19 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
20 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
21 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
22 2808606394 Promicromonospora sp. C35 Isolate Unclassified
23 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
24 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
25 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
26 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
27 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
28 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
29 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
30 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
31 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
32 2862574272 Streptomyces sp. AcE210 Isolate Nodule
33 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
34 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
35 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
36 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
37 2891562705 Microbispora tritici MT50 Isolate Unclassified
38 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
39 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
40 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
41 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
42 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
43 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
47 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
49 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
83 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
127 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
143 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
144 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
160 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
163 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
164 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
165 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
166 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
167 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
168 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
194 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
195 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
196 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
197 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
266 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
267 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
268 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
269 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
270 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
274 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
275 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
276 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
277 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
280 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
281 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
282 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
283 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
286 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
287 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
288 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
289 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
290 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
291 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
292 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
293 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
294 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
299 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
300 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
301 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
307 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
308 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
309 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
310 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
311 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
312 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
313 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
314 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
315 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
317 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
318 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
319 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
320 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
321 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
322 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
323 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
324 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
325 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
326 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
327 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
328 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
329 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
332 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
333 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
334 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
335 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
339 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
346 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
347 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
348 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
349 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
350 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
351 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
352 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
353 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
354 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
355 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
356 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
357 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
358 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
359 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
360 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
361 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
362 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
363 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
364 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
365 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
366 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
367 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
368 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
369 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
370 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
371 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
372 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
373 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
374 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
375 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
376 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
377 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
378 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
379 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
380 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
381 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
382 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
383 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
384 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
385 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
386 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
387 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
388 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
389 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
390 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
391 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
395 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
396 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
397 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
398 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
399 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
400 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
401 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
402 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
403 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
404 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
405 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
406 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
407 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
408 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
409 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
410 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
411 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
412 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
413 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
414 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
415 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
416 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
417 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
418 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
419 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
420 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
421 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
422 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
423 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
424 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
425 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
426 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
427 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
428 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
429 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
430 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
431 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
432 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
433 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
434 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
435 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
436 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
437 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
438 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
439 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
440 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
441 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
442 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
443 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
444 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
445 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
446 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
447 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
448 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
449 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
450 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
451 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
452 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
453 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
454 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
455 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
456 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
457 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
458 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
459 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
460 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
461 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
462 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
463 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
464 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
465 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
466 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
467 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
468 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
469 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
508 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
509 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
510 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
511 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
512 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
513 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
514 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
515 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
516 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
517 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
518 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
519 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
520 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
521 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
522 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
523 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
524 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
527 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
528 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
529 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
530 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
531 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
532 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
533 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
534 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
535 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
536 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
537 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
538 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
539 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
540 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
541 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
542 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
543 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
544 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
545 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
546 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
547 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
548 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
549 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
550 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
551 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
552 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
553 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
554 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.27
Metatranscriptomes 8.03
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0.06
Rhizoplane 7.21
Rhizosphere 87.02
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008768 3300000549 Bacteria 1225
2 JGI24740J21852_10172225 3300001979 Bacteria 537
3 JGI24739J22299_10187509 3300001989 Bacteria 608
4 Ga0006778J45830_1036778 3300003162 Bacteria 888
5 JGI25407J50210_10001000 3300003373 Bacteria 6146
6 Ga0007416J51690_1022952 3300003577 Bacteria 790
7 JGI25404J52841_10009628 3300003659 Bacteria 2068
8 JGI25405J52794_10104979 3300003911 Bacteria 632
9 Ga0058862_12780929 3300004803 Bacteria 692
10 Ga0070658_10038020 3300005327 Bacteria 3881
11 Ga0070658_10212732 3300005327 Bacteria 1633
12 Ga0070658_10229206 3300005327 Bacteria 1573
13 Ga0070658_10370562 3300005327 Bacteria 1228
14 Ga0070658_11477038 3300005327 Bacteria 590
15 Ga0070658_11724640 3300005327 Bacteria 542
16 Ga0070676_10099782 3300005328 Bacteria 1792
17 Ga0070683_100003580 3300005329 Bacteria 12644
18 Ga0070683_100043475 3300005329 Bacteria 4140
19 Ga0070683_100114533 3300005329 Bacteria 2545
20 Ga0070683_100310326 3300005329 Bacteria 1501
21 Ga0070683_100519773 3300005329 Bacteria 1137
22 Ga0070683_101136041 3300005329 Bacteria 750
23 Ga0070683_101680121 3300005329 Bacteria 611
24 Ga0070690_100146940 3300005330 Bacteria 1605
25 Ga0070690_100243197 3300005330 Bacteria 1270
26 Ga0070690_101682143 3300005330 Bacteria 516
27 Ga0070670_100265893 3300005331 Bacteria 1496
28 Ga0068869_100403521 3300005334 Bacteria 1125
29 Ga0068869_100697216 3300005334 Bacteria 866
30 Ga0070666_10732580 3300005335 Bacteria 726
31 Ga0070680_100511432 3300005336 Bacteria 1028
32 Ga0070680_101335031 3300005336 Bacteria 621
33 Ga0070682_100230828 3300005337 Bacteria 1323
34 Ga0070682_100256881 3300005337 Bacteria 1263
35 Ga0070682_100341989 3300005337 Bacteria 1112
36 Ga0070682_100418554 3300005337 Bacteria 1018
37 Ga0070682_100544045 3300005337 Bacteria 907
38 Ga0070682_100645277 3300005337 Bacteria 842
39 Ga0070682_101627486 3300005337 Unclassified 559
40 Ga0068868_100076178 3300005338 Bacteria 2682
41 Ga0068868_100374149 3300005338 Bacteria 1224
42 Ga0068868_101248586 3300005338 Bacteria 688
43 Ga0068868_101297454 3300005338 Bacteria 676
44 Ga0068868_102171389 3300005338 Bacteria 529
45 Ga0070660_100006248 3300005339 Bacteria 8247
46 Ga0070660_100189051 3300005339 Bacteria 1668
47 Ga0070660_100318322 3300005339 Bacteria 1277
48 Ga0070660_100688723 3300005339 Bacteria 857
49 Ga0070660_100806802 3300005339 Bacteria 789
50 Ga0070660_100867520 3300005339 Bacteria 760
51 Ga0070660_101148297 3300005339 Bacteria 658
52 Ga0070689_101530656 3300005340 Bacteria 605
53 Ga0070691_10078072 3300005341 Bacteria 1617
54 Ga0070687_100031880 3300005343 Bacteria 2589
55 Ga0070687_100805480 3300005343 Bacteria 666
56 Ga0070661_100148179 3300005344 Bacteria 1773
57 Ga0070661_100166674 3300005344 Bacteria 1671
58 Ga0070661_100854966 3300005344 Bacteria 749
59 Ga0070661_101628064 3300005344 Bacteria 546
60 Ga0070692_10017840 3300005345 Bacteria 3402
61 Ga0070692_10216951 3300005345 Bacteria 1129
62 Ga0070692_10564365 3300005345 Bacteria 748
63 Ga0070668_100189810 3300005347 Bacteria 1683
64 Ga0070668_100277165 3300005347 Bacteria 1399
65 Ga0070668_101590702 3300005347 Bacteria 599
66 Ga0070668_101691198 3300005347 Bacteria 581
67 Ga0070668_101916412 3300005347 Bacteria 546
68 Ga0070669_100990835 3300005353 Bacteria 721
69 Ga0070675_100682728 3300005354 Bacteria 935
70 Ga0070675_101902367 3300005354 Bacteria 549
71 Ga0070675_102019882 3300005354 Bacteria 532
72 Ga0070671_100868000 3300005355 Bacteria 787
73 Ga0070671_100950276 3300005355 Bacteria 752
74 Ga0070671_101288634 3300005355 Bacteria 644
75 Ga0070671_101482929 3300005355 Bacteria 600
76 Ga0070674_100261489 3300005356 Bacteria 1364
77 Ga0070674_101610245 3300005356 Bacteria 586
78 Ga0070673_101458699 3300005364 Bacteria 645
79 Ga0070673_101893203 3300005364 Bacteria 566
80 Ga0070659_100221789 3300005366 Bacteria 1561
81 Ga0070659_100290788 3300005366 Bacteria 1361
82 Ga0070659_101646271 3300005366 Bacteria 573
83 Ga0070659_101811214 3300005366 Bacteria 547
84 Ga0070667_100082365 3300005367 Bacteria 2755
85 Ga0070667_100903242 3300005367 Bacteria 822
86 Ga0070667_101324242 3300005367 Bacteria 675
87 Ga0070709_10017293 3300005434 Bacteria 4134
88 Ga0070709_10205039 3300005434 Bacteria 1398
89 Ga0070709_10701456 3300005434 Bacteria 787
90 Ga0070714_100000837 3300005435 Bacteria 21788
91 Ga0070714_100001737 3300005435 Bacteria 15889
92 Ga0070714_100067079 3300005435 Bacteria 3093
93 Ga0070714_100117452 3300005435 Bacteria 2363
94 Ga0070714_100170715 3300005435 Bacteria 1973
95 Ga0070714_100258685 3300005435 Bacteria 1611
96 Ga0070714_100385589 3300005435 Bacteria 1322
97 Ga0070714_100557363 3300005435 Bacteria 1098
98 Ga0070714_100659866 3300005435 Bacteria 1007
99 Ga0070714_100683724 3300005435 Bacteria 989
100 Ga0070714_101247530 3300005435 Bacteria 725
101 Ga0070714_101616639 3300005435 Bacteria 633
102 Ga0070714_102419933 3300005435 Bacteria 510
103 Ga0070713_100017964 3300005436 Bacteria 5367
104 Ga0070713_100757032 3300005436 Bacteria 929
105 Ga0070713_101104447 3300005436 Bacteria 766
106 Ga0070713_101754073 3300005436 Bacteria 602
107 Ga0070713_101822155 3300005436 Bacteria 590
108 Ga0070713_101875890 3300005436 Bacteria 581
109 Ga0070710_10016642 3300005437 Bacteria 3747
110 Ga0070710_10537394 3300005437 Bacteria 805
111 Ga0070710_11272655 3300005437 Bacteria 546
112 Ga0070701_10754216 3300005438 Bacteria 660
113 Ga0070701_11420117 3300005438 Bacteria 500
114 Ga0070711_100551335 3300005439 Bacteria 956
115 Ga0070711_100587626 3300005439 Bacteria 928
116 Ga0070711_100728706 3300005439 Bacteria 836
117 Ga0070700_100118012 3300005441 Bacteria 1773
118 Ga0070700_100282155 3300005441 Bacteria 1205
119 Ga0070700_101334162 3300005441 Bacteria 604
120 Ga0070700_101980121 3300005441 Bacteria 505
121 Ga0070694_100618691 3300005444 Bacteria 874
122 Ga0070708_100029256 3300005445 Bacteria 4749
123 Ga0070708_100032733 3300005445 Bacteria 4512
124 Ga0070708_100104481 3300005445 Bacteria 2598
125 Ga0070708_100230269 3300005445 Bacteria 1739
126 Ga0070708_100534867 3300005445 Bacteria 1105
127 Ga0070708_100585632 3300005445 Bacteria 1052
128 Ga0070708_100638436 3300005445 Bacteria 1003
129 Ga0070663_100034319 3300005455 Bacteria 3513
130 Ga0070663_100447898 3300005455 Bacteria 1064
131 Ga0070663_101325085 3300005455 Bacteria 636
132 Ga0070678_100248154 3300005456 Bacteria 1491
133 Ga0070678_100746749 3300005456 Bacteria 885
134 Ga0070678_100880738 3300005456 Bacteria 817
135 Ga0070678_101082339 3300005456 Bacteria 740
136 Ga0070662_100317445 3300005457 Bacteria 1270
137 Ga0070662_100651178 3300005457 Bacteria 889
138 Ga0070662_101705621 3300005457 Bacteria 544
139 Ga0070681_10285854 3300005458 Bacteria 1560
140 Ga0070681_10630571 3300005458 Bacteria 987
141 Ga0070681_11219011 3300005458 Bacteria 674
142 Ga0068867_101163020 3300005459 Bacteria 707
143 Ga0068867_101645305 3300005459 Bacteria 601
144 Ga0070706_100163935 3300005467 Bacteria 2075
145 Ga0070706_100169477 3300005467 Bacteria 2038
146 Ga0070706_100535516 3300005467 Bacteria 1089
147 Ga0070706_100573083 3300005467 Bacteria 1050
148 Ga0070706_100822281 3300005467 Bacteria 859
149 Ga0070706_100829283 3300005467 Bacteria 855
150 Ga0070706_100857601 3300005467 Bacteria 840
151 Ga0070707_100043336 3300005468 Bacteria 4307
152 Ga0070707_100054682 3300005468 Bacteria 3828
153 Ga0070707_100168788 3300005468 Bacteria 2132
154 Ga0070707_100238658 3300005468 Bacteria 1769
155 Ga0070707_100810806 3300005468 Bacteria 900
156 Ga0070698_100002179 3300005471 Bacteria 21723
157 Ga0070698_100009870 3300005471 Bacteria 10206
158 Ga0070698_100018226 3300005471 Bacteria 7393
159 Ga0070698_100036981 3300005471 Bacteria 5035
160 Ga0070698_100554434 3300005471 Bacteria 1089
161 Ga0070698_100611549 3300005471 Bacteria 1030
162 Ga0070698_102077273 3300005471 Bacteria 522
163 Ga0070699_100003081 3300005518 Bacteria 14777
164 Ga0070699_100644918 3300005518 Bacteria 966
165 Ga0070679_100037489 3300005530 Bacteria 4817
166 Ga0070679_100455734 3300005530 Bacteria 1223
167 Ga0070679_100602426 3300005530 Bacteria 1042
168 Ga0070684_100003060 3300005535 Bacteria 12483
169 Ga0070684_100307288 3300005535 Bacteria 1456
170 Ga0070684_101194923 3300005535 Bacteria 715
171 Ga0070684_101450513 3300005535 Bacteria 646
172 Ga0070697_100047896 3300005536 Bacteria 3465
173 Ga0070697_100050393 3300005536 Bacteria 3379
174 Ga0070697_100540059 3300005536 Bacteria 1022
175 Ga0070697_100818273 3300005536 Bacteria 824
176 Ga0068853_101293359 3300005539 Bacteria 705
177 Ga0068853_101872684 3300005539 Bacteria 582
178 Ga0070672_101166800 3300005543 Bacteria 686
179 Ga0070672_102046914 3300005543 Bacteria 516
180 Ga0070686_100367656 3300005544 Bacteria 1085
181 Ga0070686_100972548 3300005544 Bacteria 695
182 Ga0070696_100265661 3300005546 Bacteria 1303
183 Ga0070696_101170814 3300005546 Bacteria 648
184 Ga0070693_100936571 3300005547 Bacteria 651
185 Ga0070693_101058367 3300005547 Bacteria 617
186 Ga0070693_101147483 3300005547 Bacteria 594
187 Ga0070665_100161733 3300005548 Bacteria 2241
188 Ga0070665_100934457 3300005548 Bacteria 880
189 Ga0070665_101014715 3300005548 Bacteria 842
190 Ga0070665_101251061 3300005548 Bacteria 753
191 Ga0070665_101993615 3300005548 Bacteria 586
192 Ga0070704_101023027 3300005549 Bacteria 748
193 Ga0068855_100020818 3300005563 Bacteria 7864
194 Ga0068855_100317844 3300005563 Bacteria 1722
195 Ga0068855_100413460 3300005563 Bacteria 1476
196 Ga0068855_100540258 3300005563 Bacteria 1263
197 Ga0068855_100727731 3300005563 Bacteria 1060
198 Ga0068855_101490791 3300005563 Bacteria 695
199 Ga0070664_100255678 3300005564 Bacteria 1575
200 Ga0070664_100756686 3300005564 Bacteria 907
201 Ga0070664_100897570 3300005564 Bacteria 831
202 Ga0070664_101529333 3300005564 Bacteria 632
203 Ga0070664_101748626 3300005564 Bacteria 590
204 Ga0068857_100011758 3300005577 Bacteria 7611
205 Ga0068857_100164259 3300005577 Bacteria 2016
206 Ga0068857_100171638 3300005577 Bacteria 1971
207 Ga0068857_100825643 3300005577 Bacteria 886
208 Ga0068854_100681575 3300005578 Bacteria 885
209 Ga0068856_100105300 3300005614 Bacteria 2815
210 Ga0068856_100149911 3300005614 Bacteria 2341
211 Ga0068856_100236300 3300005614 Bacteria 1843
212 Ga0068856_100299529 3300005614 Bacteria 1625
213 Ga0068856_101641343 3300005614 Bacteria 656
214 Ga0068856_101970948 3300005614 Bacteria 594
215 Ga0068856_101987539 3300005614 Bacteria 592
216 Ga0068856_102103747 3300005614 Bacteria 574
217 Ga0068856_102612852 3300005614 Bacteria 511
218 Ga0068856_102644804 3300005614 Bacteria 507
219 Ga0070702_100059169 3300005615 Bacteria 2222
220 Ga0070702_100164324 3300005615 Bacteria 1438
221 Ga0070702_100557580 3300005615 Bacteria 852
222 Ga0070702_100638626 3300005615 Bacteria 803
223 Ga0070702_100785237 3300005615 Bacteria 735
224 Ga0070702_100951855 3300005615 Bacteria 676
225 Ga0068852_100037221 3300005616 Bacteria 4078
226 Ga0068852_100737947 3300005616 Bacteria 996
227 Ga0068852_101823314 3300005616 Unclassified 631
228 Ga0068859_100538282 3300005617 Bacteria 1262
229 Ga0068859_102441837 3300005617 Bacteria 576
230 Ga0068864_100029864 3300005618 Bacteria 4620
231 Ga0068864_100317505 3300005618 Bacteria 1462
232 Ga0068864_100738818 3300005618 Bacteria 964
233 Ga0068864_101933837 3300005618 Bacteria 596
234 Ga0068864_102372987 3300005618 Bacteria 537
235 Ga0068866_10312160 3300005718 Bacteria 986
236 Ga0068866_10543705 3300005718 Bacteria 776
237 Ga0068861_100094365 3300005719 Bacteria 2367
238 Ga0068861_100584359 3300005719 Bacteria 1023
239 Ga0068851_10149924 3300005834 Bacteria 1274
240 Ga0068851_10690007 3300005834 Bacteria 628
241 Ga0068851_10911638 3300005834 Bacteria 551
242 Ga0068870_10033181 3300005840 Bacteria 2632
243 Ga0068863_100155904 3300005841 Bacteria 2186
244 Ga0068863_100559307 3300005841 Bacteria 1130
245 Ga0068863_100789267 3300005841 Bacteria 947
246 Ga0068863_102068372 3300005841 Bacteria 579
247 Ga0068858_101077687 3300005842 Bacteria 788
248 Ga0068858_102042614 3300005842 Bacteria 567
249 Ga0068860_100513555 3300005843 Bacteria 1197
250 Ga0068860_100636978 3300005843 Bacteria 1073
251 Ga0068860_102491083 3300005843 Bacteria 537
252 Ga0068862_100782389 3300005844 Bacteria 930
253 Ga0081455_10001385 3300005937 Bacteria 29923
254 Ga0081455_10014949 3300005937 Bacteria 7561
255 Ga0081455_10222575 3300005937 Bacteria 1397
256 Ga0081455_10295754 3300005937 Bacteria 1164
257 Ga0081538_10000156 3300005981 Bacteria 71178
258 Ga0081538_10002379 3300005981 Bacteria 18466
259 Ga0081538_10064741 3300005981 Bacteria 2065
260 Ga0081540_1002410 3300005983 Bacteria 15234
261 Ga0081540_1017068 3300005983 Bacteria 4511
262 Ga0070717_10111860 3300006028 Bacteria 2330
263 Ga0070717_10141370 3300006028 Bacteria 2076
264 Ga0070717_10307690 3300006028 Bacteria 1410
265 Ga0070717_10359253 3300006028 Bacteria 1303
266 Ga0070717_10361770 3300006028 Bacteria 1299
267 Ga0070717_10473329 3300006028 Bacteria 1131
268 Ga0070717_11196929 3300006028 Bacteria 691
269 Ga0070717_11306196 3300006028 Bacteria 659
270 Ga0070717_11317101 3300006028 Bacteria 656
271 Ga0070717_11898151 3300006028 Bacteria 537
272 Ga0070717_11961153 3300006028 Bacteria 528
273 Ga0075365_10123768 3300006038 Bacteria 1786
274 Ga0075365_10854134 3300006038 Bacteria 642
275 Ga0075365_11221351 3300006038 Bacteria 529
276 Ga0075432_10058515 3300006058 Bacteria 1369
277 Ga0070715_10171700 3300006163 Bacteria 1080
278 Ga0070715_10254865 3300006163 Bacteria 919
279 Ga0070715_10653654 3300006163 Bacteria 623
280 Ga0070715_11006439 3300006163 Bacteria 519
281 Ga0070716_100040375 3300006173 Bacteria 2595
282 Ga0070716_101143342 3300006173 Bacteria 623
283 Ga0070712_100151278 3300006175 Bacteria 1782
284 Ga0070712_100397191 3300006175 Bacteria 1138
285 Ga0070712_100422911 3300006175 Bacteria 1104
286 Ga0070712_100585994 3300006175 Bacteria 943
287 Ga0070712_100661083 3300006175 Bacteria 888
288 Ga0070712_100815917 3300006175 Bacteria 801
289 Ga0070712_100880730 3300006175 Bacteria 771
290 Ga0070712_101285105 3300006175 Bacteria 637
291 Ga0097621_100253380 3300006237 Bacteria 1542
292 Ga0097621_100357889 3300006237 Bacteria 1299
293 Ga0097621_101930766 3300006237 Bacteria 563
294 Ga0097621_101969868 3300006237 Bacteria 558
295 Ga0075370_10335718 3300006353 Bacteria 901
296 Ga0068871_100041320 3300006358 Bacteria 3697
297 Ga0068871_100545333 3300006358 Bacteria 1050
298 Ga0068871_101654676 3300006358 Bacteria 607
299 Ga0068871_102259697 3300006358 Bacteria 518
300 Ga0075428_100260732 3300006844 Bacteria 1866
301 Ga0075430_100148149 3300006846 Bacteria 1954
302 Ga0075430_100938843 3300006846 Bacteria 713
303 Ga0075431_100001420 3300006847 Bacteria 21998
304 Ga0075431_100017445 3300006847 Bacteria 7295
305 Ga0075433_11752968 3300006852 Bacteria 534
306 Ga0075434_100130981 3300006871 Bacteria 2527
307 Ga0075434_100425288 3300006871 Bacteria 1349
308 Ga0075434_100614881 3300006871 Bacteria 1105
309 Ga0075434_102398766 3300006871 Bacteria 530
310 Ga0075429_100013829 3300006880 Bacteria 6999
311 Ga0068865_101985366 3300006881 Bacteria 528
312 Ga0075436_100035391 3300006914 Bacteria 3446
313 Ga0075436_100129693 3300006914 Bacteria 1768
314 Ga0075436_100484356 3300006914 Unclassified 903
315 Ga0097620_100538305 3300006931 Bacteria 1262
316 Ga0097620_102442641 3300006931 Bacteria 576
317 Ga0075435_100742753 3300007076 Bacteria 854
318 Ga0075435_100904352 3300007076 Bacteria 770
319 Ga0075435_101150912 3300007076 Bacteria 678
320 Ga0075435_101600012 3300007076 Bacteria 572
321 Ga0099794_10356685 3300007265 Bacteria 761
322 Ga0099795_10123158 3300007788 Bacteria 1039
323 Ga0105251_10105211 3300009011 Bacteria 1288
324 Ga0105251_10314998 3300009011 Bacteria 710
325 Ga0105250_10311026 3300009092 Bacteria 683
326 Ga0105240_10585110 3300009093 Bacteria 1231
327 Ga0105240_10824332 3300009093 Bacteria 1003
328 Ga0105240_10898614 3300009093 Bacteria 953
329 Ga0105240_12062768 3300009093 Bacteria 592
330 Ga0105240_12713997 3300009093 Bacteria 511
331 Ga0111539_10784410 3300009094 Bacteria 1109
332 Ga0111539_11574955 3300009094 Bacteria 762
333 Ga0105245_10046775 3300009098 Bacteria 3866
334 Ga0105245_10058568 3300009098 Bacteria 3468
335 Ga0105245_10418683 3300009098 Bacteria 1342
336 Ga0105245_10491011 3300009098 Bacteria 1242
337 Ga0105245_10788387 3300009098 Bacteria 988
338 Ga0105245_11233005 3300009098 Bacteria 796
339 Ga0105245_11439837 3300009098 Bacteria 739
340 Ga0105245_11908295 3300009098 Bacteria 647
341 Ga0105247_10043221 3300009101 Bacteria 2760
342 Ga0105247_10579340 3300009101 Bacteria 829
343 Ga0105247_11651907 3300009101 Bacteria 528
344 Ga0114129_10193466 3300009147 Bacteria 2760
345 Ga0105243_10085019 3300009148 Bacteria 2592
346 Ga0105243_10085773 3300009148 Bacteria 2581
347 Ga0105243_11153432 3300009148 Unclassified 786
348 Ga0105243_11703000 3300009148 Bacteria 659
349 Ga0105243_12736907 3300009148 Bacteria 534
350 Ga0105243_13135888 3300009148 Bacteria 500
351 Ga0105241_10356473 3300009174 Bacteria 1271
352 Ga0105241_11263129 3300009174 Bacteria 702
353 Ga0105242_10384252 3300009176 Bacteria 1306
354 Ga0105242_11322351 3300009176 Bacteria 745
355 Ga0105242_11933403 3300009176 Bacteria 631
356 Ga0105248_10011539 3300009177 Bacteria 9737
357 Ga0105248_10119534 3300009177 Bacteria 2972
358 Ga0105248_10254018 3300009177 Bacteria 1978
359 Ga0105248_10649446 3300009177 Bacteria 1190
360 Ga0105248_10824247 3300009177 Bacteria 1047
361 Ga0105248_10974510 3300009177 Bacteria 958
362 Ga0105248_12382544 3300009177 Bacteria 603
363 Ga0105248_12740508 3300009177 Bacteria 562
364 Ga0105248_13433905 3300009177 Bacteria 503
365 Ga0105237_10110585 3300009545 Bacteria 2739
366 Ga0105237_10242167 3300009545 Bacteria 1805
367 Ga0105237_10451223 3300009545 Bacteria 1292
368 Ga0105237_10495605 3300009545 Bacteria 1228
369 Ga0105238_10214112 3300009551 Bacteria 1903
370 Ga0105238_10317211 3300009551 Bacteria 1544
371 Ga0105238_10403536 3300009551 Bacteria 1360
372 Ga0105238_10673635 3300009551 Bacteria 1045
373 Ga0105238_11011449 3300009551 Bacteria 852
374 Ga0105238_12181192 3300009551 Bacteria 589
375 Ga0105249_10410671 3300009553 Bacteria 1386
376 Ga0105249_10979119 3300009553 Bacteria 914
377 Ga0105249_12010065 3300009553 Bacteria 651
378 Ga0105249_12375758 3300009553 Bacteria 603
379 Ga0105249_12940914 3300009553 Bacteria 547
380 Ga0105028_114948 3300009993 Bacteria 826
381 Ga0099796_10331834 3300010159 Bacteria 651
382 Ga0105239_10053532 3300010375 Bacteria 4427
383 Ga0105239_10150145 3300010375 Bacteria 2600
384 Ga0105239_10258308 3300010375 Bacteria 1957
385 Ga0105239_12135338 3300010375 Bacteria 651
386 Ga0105239_12228427 3300010375 Bacteria 637
387 Ga0105239_13132228 3300010375 Bacteria 539
388 Ga0105246_10004996 3300011119 Bacteria 8069
389 Ga0105246_10776065 3300011119 Bacteria 848
390 Ga0105246_10810555 3300011119 Bacteria 831
391 Ga0105246_12021206 3300011119 Bacteria 556
392 Ga0105246_12131647 3300011119 Bacteria 544
393 Ga0157320_1027533 3300012481 Bacteria 556
394 Ga0157345_1028760 3300012498 Bacteria 611
395 Ga0157342_1049281 3300012507 Unclassified 588
396 Ga0157315_1028385 3300012508 Bacteria 640
397 Ga0157326_1074097 3300012513 Bacteria 545
398 Ga0157338_1004940 3300012515 Bacteria 1177
399 Ga0157373_10436672 3300013100 Bacteria 941
400 Ga0157371_10260697 3300013102 Bacteria 1250
401 Ga0157371_10326493 3300013102 Bacteria 1114
402 Ga0157371_11128032 3300013102 Bacteria 602
403 Ga0157371_11221387 3300013102 Bacteria 580
404 Ga0157370_10164943 3300013104 Bacteria 2060
405 Ga0157370_10183307 3300013104 Bacteria 1945
406 Ga0157370_10625665 3300013104 Bacteria 985
407 Ga0157370_10768720 3300013104 Bacteria 877
408 Ga0157370_12025922 3300013104 Bacteria 516
409 Ga0157369_10128379 3300013105 Bacteria 2687
410 Ga0157369_10165905 3300013105 Bacteria 2329
411 Ga0157369_10319872 3300013105 Bacteria 1613
412 Ga0157369_10564775 3300013105 Bacteria 1175
413 Ga0157369_10861088 3300013105 Bacteria 930
414 Ga0157369_10969231 3300013105 Bacteria 871
415 Ga0157369_11247764 3300013105 Bacteria 758
416 Ga0157369_12178061 3300013105 Bacteria 562
417 Ga0157369_12589960 3300013105 Bacteria 513
418 Ga0157374_10114003 3300013296 Bacteria 2602
419 Ga0157374_10167931 3300013296 Bacteria 2139
420 Ga0157374_10485506 3300013296 Bacteria 1239
421 Ga0157374_10824825 3300013296 Bacteria 944
422 Ga0157374_11130950 3300013296 Bacteria 804
423 Ga0157374_12839450 3300013296 Bacteria 512
424 Ga0157378_10545471 3300013297 Bacteria 1164
425 Ga0157378_10766541 3300013297 Bacteria 988
426 Ga0157378_11094700 3300013297 Bacteria 834
427 Ga0157378_11574212 3300013297 Bacteria 703
428 Ga0163162_10645873 3300013306 Bacteria 1182
429 Ga0163162_10773324 3300013306 Bacteria 1079
430 Ga0163162_11200102 3300013306 Bacteria 861
431 Ga0163162_12510274 3300013306 Bacteria 593
432 Ga0163162_12667954 3300013306 Bacteria 575
433 Ga0163162_13078114 3300013306 Bacteria 536
434 Ga0163162_13380748 3300013306 Bacteria 510
435 Ga0157372_10114354 3300013307 Bacteria 3094
436 Ga0157372_10926630 3300013307 Bacteria 1010
437 Ga0157372_10982399 3300013307 Bacteria 978
438 Ga0157372_11024239 3300013307 Bacteria 956
439 Ga0157372_11125833 3300013307 Bacteria 908
440 Ga0157372_11910052 3300013307 Bacteria 682
441 Ga0157372_12282772 3300013307 Bacteria 621
442 Ga0157372_12642796 3300013307 Bacteria 576
443 Ga0157372_12743933 3300013307 Bacteria 565
444 Ga0157375_10200880 3300013308 Bacteria 2149
445 Ga0157375_10336494 3300013308 Bacteria 1675
446 Ga0157375_10386074 3300013308 Bacteria 1567
447 Ga0157375_10433855 3300013308 Bacteria 1480
448 Ga0157375_10511529 3300013308 Bacteria 1364
449 Ga0157375_10727864 3300013308 Bacteria 1144
450 Ga0157375_10991468 3300013308 Bacteria 980
451 Ga0157375_11093618 3300013308 Bacteria 933
452 Ga0157375_11102108 3300013308 Bacteria 929
453 Ga0157375_11144954 3300013308 Bacteria 911
454 Ga0157375_11567124 3300013308 Bacteria 778
455 Ga0157375_12467777 3300013308 Bacteria 621
456 Ga0163163_10009665 3300014325 Bacteria 8628
457 Ga0163163_10030640 3300014325 Bacteria 5185
458 Ga0163163_10446364 3300014325 Bacteria 1353
459 Ga0163163_10499576 3300014325 Bacteria 1278
460 Ga0163163_10767719 3300014325 Bacteria 1027
461 Ga0163163_10790140 3300014325 Bacteria 1012
462 Ga0163163_11092274 3300014325 Bacteria 861
463 Ga0163163_11117714 3300014325 Bacteria 851
464 Ga0163163_11189736 3300014325 Bacteria 825
465 Ga0163163_11200393 3300014325 Bacteria 821
466 Ga0163163_11360051 3300014325 Bacteria 772
467 Ga0163163_11732387 3300014325 Bacteria 685
468 Ga0157380_10252908 3300014326 Bacteria 1596
469 Ga0157380_11562862 3300014326 Bacteria 714
470 Ga0157380_11870395 3300014326 Bacteria 660
471 Ga0157380_12237232 3300014326 Bacteria 611
472 Ga0157380_12505349 3300014326 Bacteria 582
473 Ga0182008_10011342 3300014497 Bacteria 4744
474 Ga0182008_10107536 3300014497 Bacteria 1381
475 Ga0157377_10096561 3300014745 Bacteria 1753
476 Ga0157377_10251284 3300014745 Bacteria 1146
477 Ga0157377_10922782 3300014745 Bacteria 655
478 Ga0157377_11352686 3300014745 Bacteria 559
479 Ga0157379_10000007 3300014968 Bacteria 142402
480 Ga0157379_10011378 3300014968 Bacteria 7761
481 Ga0157379_10014493 3300014968 Bacteria 6917
482 Ga0157379_10599039 3300014968 Bacteria 1029
483 Ga0157379_10932526 3300014968 Bacteria 825
484 Ga0157379_11096733 3300014968 Bacteria 762
485 Ga0157379_11674044 3300014968 Bacteria 623
486 Ga0157379_11878224 3300014968 Unclassified 590
487 Ga0157379_12643410 3300014968 Bacteria 503
488 Ga0157376_10034896 3300014969 Bacteria 4064
489 Ga0157376_10340843 3300014969 Bacteria 1431
490 Ga0157376_11182079 3300014969 Bacteria 793
491 Ga0157376_11677021 3300014969 Bacteria 671
492 Ga0157376_11695806 3300014969 Bacteria 667
493 Ga0163161_10034448 3300017792 Bacteria 3623
494 Ga0163161_10136498 3300017792 Bacteria 1854
495 Ga0163161_10393745 3300017792 Bacteria 1110
496 Ga0197907_10053421 3300020069 Bacteria 932
497 Ga0197907_10156609 3300020069 Bacteria 589
498 Ga0197907_10212106 3300020069 Bacteria 1053
499 Ga0197907_10386202 3300020069 Bacteria 616
500 Ga0197907_10564122 3300020069 Bacteria 986
501 Ga0197907_11063525 3300020069 Bacteria 803
502 Ga0197907_11505362 3300020069 Bacteria 610
503 Ga0206356_10650374 3300020070 Bacteria 627
504 Ga0206356_10742932 3300020070 Bacteria 1804
505 Ga0206356_11264804 3300020070 Bacteria 731
506 Ga0206356_11295048 3300020070 Bacteria 1374
507 Ga0206356_11638757 3300020070 Bacteria 1063
508 Ga0206356_11705021 3300020070 Bacteria 728
509 Ga0206356_11722896 3300020070 Bacteria 1139
510 Ga0206349_1041801 3300020075 Bacteria 1175
511 Ga0206349_1871719 3300020075 Bacteria 983
512 Ga0206349_1943292 3300020075 Bacteria 811
513 Ga0206351_10118548 3300020077 Bacteria 1267
514 Ga0206351_10934351 3300020077 Bacteria 1204
515 Ga0206352_10130022 3300020078 Bacteria 1026
516 Ga0206352_10419581 3300020078 Bacteria 554
517 Ga0206352_10716620 3300020078 Bacteria 1097
518 Ga0206352_10719731 3300020078 Bacteria 926
519 Ga0206350_10580633 3300020080 Bacteria 1421
520 Ga0206354_10067004 3300020081 Bacteria 797
521 Ga0206354_10234352 3300020081 Bacteria 521
522 Ga0206354_10551101 3300020081 Bacteria 556
523 Ga0206354_10803405 3300020081 Bacteria 641
524 Ga0206354_11356021 3300020081 Bacteria 568
525 Ga0206354_11404719 3300020081 Bacteria 534
526 Ga0206354_11421471 3300020081 Bacteria 972
527 Ga0206354_11429718 3300020081 Bacteria 550
528 Ga0206353_10086586 3300020082 Bacteria 1579
529 Ga0206353_10302179 3300020082 Bacteria 805
530 Ga0206353_10369752 3300020082 Bacteria 664
531 Ga0206353_10750906 3300020082 Bacteria 679
532 Ga0206353_10912418 3300020082 Bacteria 1862
533 Ga0206353_11232208 3300020082 Bacteria 613
534 Ga0206353_11892921 3300020082 Bacteria 622
535 Ga0206353_11993930 3300020082 Bacteria 1673
536 Ga0213873_10032308 3300021358 Bacteria 1307
537 Ga0213874_10047662 3300021377 Bacteria 1305
538 Ga0213874_10250567 3300021377 Bacteria 652
539 Ga0213874_10396169 3300021377 Bacteria 536
540 Ga0213876_10161285 3300021384 Bacteria 1193
541 Ga0213876_10194400 3300021384 Bacteria 1079
542 Ga0213875_10000442 3300021388 Bacteria 36242
543 Ga0213875_10051946 3300021388 Bacteria 1920
544 Ga0213875_10054565 3300021388 Bacteria 1872
545 Ga0213875_10136261 3300021388 Bacteria 1148
546 Ga0213875_10358308 3300021388 Bacteria 693
547 Ga0224712_10205997 3300022467 Bacteria 895
548 Ga0224712_10214239 3300022467 Bacteria 879
549 Ga0224712_10264915 3300022467 Bacteria 797
550 Ga0224712_10315569 3300022467 Bacteria 734
551 Ga0224712_10332802 3300022467 Bacteria 715
552 Ga0224572_1016852 3300024225 Bacteria 1401
553 Ga0224572_1095898 3300024225 Bacteria 547
554 Ga0207656_10476639 3300025321 Bacteria 632
555 Ga0207656_10487292 3300025321 Bacteria 625
556 Ga0207653_10006683 3300025885 Bacteria 3603
557 Ga0207692_10110146 3300025898 Bacteria 1526
558 Ga0207692_10251894 3300025898 Bacteria 1058
559 Ga0207692_10453956 3300025898 Bacteria 807
560 Ga0207692_10721091 3300025898 Bacteria 648
561 Ga0207692_11104735 3300025898 Bacteria 525
562 Ga0207642_10494133 3300025899 Bacteria 748
563 Ga0207642_10892685 3300025899 Bacteria 569
564 Ga0207710_10456697 3300025900 Bacteria 660
565 Ga0207688_10065579 3300025901 Bacteria 2052
566 Ga0207688_10158653 3300025901 Bacteria 1340
567 Ga0207688_10357523 3300025901 Bacteria 900
568 Ga0207688_10444102 3300025901 Bacteria 808
569 Ga0207688_10557129 3300025901 Bacteria 721
570 Ga0207688_11040995 3300025901 Bacteria 517
571 Ga0207680_11036440 3300025903 Bacteria 587
572 Ga0207647_10012411 3300025904 Bacteria 5930
573 Ga0207647_10109266 3300025904 Bacteria 1636
574 Ga0207685_10060242 3300025905 Bacteria 1500
575 Ga0207685_10065108 3300025905 Bacteria 1458
576 Ga0207699_10041313 3300025906 Bacteria 2663
577 Ga0207699_10074713 3300025906 Bacteria 2083
578 Ga0207699_10239811 3300025906 Bacteria 1245
579 Ga0207699_10246344 3300025906 Bacteria 1230
580 Ga0207699_10560682 3300025906 Bacteria 829
581 Ga0207643_10452912 3300025908 Bacteria 817
582 Ga0207705_10232827 3300025909 Bacteria 1402
583 Ga0207705_10241424 3300025909 Bacteria 1376
584 Ga0207705_10342674 3300025909 Bacteria 1151
585 Ga0207705_10581807 3300025909 Bacteria 870
586 Ga0207705_10681412 3300025909 Bacteria 799
587 Ga0207684_10051051 3300025910 Bacteria 3508
588 Ga0207684_10056071 3300025910 Bacteria 3342
589 Ga0207684_10505184 3300025910 Bacteria 1036
590 Ga0207684_10646445 3300025910 Bacteria 901
591 Ga0207684_10685981 3300025910 Bacteria 871
592 Ga0207684_11224947 3300025910 Bacteria 621
593 Ga0207654_10226659 3300025911 Bacteria 1242
594 Ga0207707_10367108 3300025912 Bacteria 1239
595 Ga0207707_10438196 3300025912 Bacteria 1119
596 Ga0207707_10857932 3300025912 Bacteria 753
597 Ga0207707_11159154 3300025912 Bacteria 627
598 Ga0207695_11049236 3300025913 Bacteria 695
599 Ga0207695_11101672 3300025913 Bacteria 674
600 Ga0207671_10063722 3300025914 Bacteria 2739
601 Ga0207671_10096071 3300025914 Bacteria 2239
602 Ga0207671_10196339 3300025914 Bacteria 1575
603 Ga0207693_10055852 3300025915 Bacteria 3097
604 Ga0207693_10071025 3300025915 Bacteria 2724
605 Ga0207693_10097545 3300025915 Bacteria 2305
606 Ga0207693_10266418 3300025915 Bacteria 1343
607 Ga0207693_10628532 3300025915 Bacteria 835
608 Ga0207693_10698031 3300025915 Bacteria 786
609 Ga0207663_10053465 3300025916 Bacteria 2523
610 Ga0207663_10323747 3300025916 Bacteria 1159
611 Ga0207663_10558958 3300025916 Bacteria 895
612 Ga0207663_10576962 3300025916 Bacteria 882
613 Ga0207660_10647622 3300025917 Bacteria 861
614 Ga0207660_10823849 3300025917 Bacteria 757
615 Ga0207660_11259763 3300025917 Bacteria 601
616 Ga0207660_11431634 3300025917 Unclassified 559
617 Ga0207660_11488730 3300025917 Bacteria 547
618 Ga0207662_10011623 3300025918 Bacteria 4889
619 Ga0207662_10159916 3300025918 Bacteria 1438
620 Ga0207657_10021242 3300025919 Bacteria 6115
621 Ga0207657_10251402 3300025919 Bacteria 1409
622 Ga0207657_10324411 3300025919 Bacteria 1217
623 Ga0207657_10575228 3300025919 Bacteria 880
624 Ga0207657_10590249 3300025919 Bacteria 867
625 Ga0207649_10630925 3300025920 Bacteria 826
626 Ga0207652_10114525 3300025921 Bacteria 2394
627 Ga0207652_10360330 3300025921 Bacteria 1312
628 Ga0207652_10568555 3300025921 Bacteria 1018
629 Ga0207652_10849200 3300025921 Bacteria 809
630 Ga0207652_11399964 3300025921 Bacteria 603
631 Ga0207652_11465094 3300025921 Bacteria 586
632 Ga0207646_10077781 3300025922 Bacteria 2965
633 Ga0207646_10102096 3300025922 Bacteria 2571
634 Ga0207646_10193729 3300025922 Bacteria 1836
635 Ga0207646_10204104 3300025922 Bacteria 1785
636 Ga0207646_10215113 3300025922 Bacteria 1736
637 Ga0207646_10823718 3300025922 Bacteria 826
638 Ga0207694_10191392 3300025924 Bacteria 1662
639 Ga0207694_10221496 3300025924 Bacteria 1544
640 Ga0207694_10487730 3300025924 Bacteria 1031
641 Ga0207694_11011442 3300025924 Bacteria 703
642 Ga0207650_11069097 3300025925 Bacteria 687
643 Ga0207687_10196095 3300025927 Bacteria 1575
644 Ga0207687_10244041 3300025927 Bacteria 1425
645 Ga0207687_10497057 3300025927 Bacteria 1017
646 Ga0207687_10617692 3300025927 Bacteria 915
647 Ga0207687_10733421 3300025927 Bacteria 840
648 Ga0207687_11618749 3300025927 Bacteria 556
649 Ga0207700_10045791 3300025928 Bacteria 3231
650 Ga0207700_10064442 3300025928 Bacteria 2791
651 Ga0207700_10718552 3300025928 Bacteria 892
652 Ga0207664_10005963 3300025929 Bacteria 8339
653 Ga0207664_10007336 3300025929 Bacteria 7641
654 Ga0207664_10145045 3300025929 Bacteria 2012
655 Ga0207664_10145229 3300025929 Bacteria 2011
656 Ga0207664_10148225 3300025929 Bacteria 1991
657 Ga0207664_10170350 3300025929 Bacteria 1863
658 Ga0207664_10359163 3300025929 Bacteria 1290
659 Ga0207664_10448603 3300025929 Bacteria 1151
660 Ga0207664_10815411 3300025929 Bacteria 839
661 Ga0207664_11217560 3300025929 Bacteria 671
662 Ga0207664_11554382 3300025929 Bacteria 583
663 Ga0207664_11878107 3300025929 Bacteria 522
664 Ga0207644_10404174 3300025931 Bacteria 1117
665 Ga0207644_10527147 3300025931 Bacteria 976
666 Ga0207690_10463562 3300025932 Bacteria 1020
667 Ga0207690_10545319 3300025932 Bacteria 942
668 Ga0207690_10592406 3300025932 Bacteria 904
669 Ga0207690_10812600 3300025932 Bacteria 773
670 Ga0207706_10060278 3300025933 Bacteria 3341
671 Ga0207706_10310204 3300025933 Bacteria 1374
672 Ga0207706_10757739 3300025933 Bacteria 827
673 Ga0207686_10225498 3300025934 Bacteria 1356
674 Ga0207686_10286433 3300025934 Bacteria 1218
675 Ga0207686_10349137 3300025934 Bacteria 1113
676 Ga0207686_10389922 3300025934 Bacteria 1058
677 Ga0207686_11802969 3300025934 Bacteria 506
678 Ga0207709_10020178 3300025935 Bacteria 3756
679 Ga0207709_10727133 3300025935 Bacteria 796
680 Ga0207709_11160868 3300025935 Bacteria 635
681 Ga0207709_11454502 3300025935 Bacteria 568
682 Ga0207670_11293391 3300025936 Bacteria 618
683 Ga0207670_11598788 3300025936 Bacteria 554
684 Ga0207669_10297721 3300025937 Bacteria 1225
685 Ga0207669_10304381 3300025937 Bacteria 1213
686 Ga0207704_10243846 3300025938 Bacteria 1344
687 Ga0207665_10025013 3300025939 Bacteria 3937
688 Ga0207665_10180576 3300025939 Bacteria 1528
689 Ga0207665_11077447 3300025939 Bacteria 640
690 Ga0207665_11264436 3300025939 Bacteria 589
691 Ga0207691_10460084 3300025940 Bacteria 1082
692 Ga0207691_11028536 3300025940 Bacteria 687
693 Ga0207691_11267776 3300025940 Bacteria 609
694 Ga0207691_11376008 3300025940 Bacteria 581
695 Ga0207711_10007114 3300025941 Bacteria 9376
696 Ga0207711_10850522 3300025941 Bacteria 849
697 Ga0207711_10855942 3300025941 Bacteria 846
698 Ga0207711_11705965 3300025941 Bacteria 573
699 Ga0207711_11868747 3300025941 Bacteria 543
700 Ga0207689_10009376 3300025942 Bacteria 8460
701 Ga0207689_10638504 3300025942 Bacteria 897
702 Ga0207689_10826497 3300025942 Bacteria 782
703 Ga0207689_11175564 3300025942 Bacteria 646
704 Ga0207661_10289214 3300025944 Bacteria 1466
705 Ga0207661_10413095 3300025944 Bacteria 1225
706 Ga0207661_10584890 3300025944 Bacteria 1024
707 Ga0207661_10588787 3300025944 Bacteria 1021
708 Ga0207661_10630818 3300025944 Bacteria 985
709 Ga0207661_11021991 3300025944 Bacteria 761
710 Ga0207661_11024831 3300025944 Bacteria 760
711 Ga0207661_11254330 3300025944 Bacteria 681
712 Ga0207661_11437755 3300025944 Bacteria 632
713 Ga0207661_11618613 3300025944 Bacteria 592
714 Ga0207661_11800235 3300025944 Bacteria 558
715 Ga0207679_10074680 3300025945 Bacteria 2569
716 Ga0207679_10128478 3300025945 Bacteria 2029
717 Ga0207679_11751532 3300025945 Bacteria 568
718 Ga0207667_10103254 3300025949 Bacteria 2940
719 Ga0207667_10483215 3300025949 Bacteria 1257
720 Ga0207667_10856898 3300025949 Bacteria 902
721 Ga0207667_10885695 3300025949 Bacteria 885
722 Ga0207667_11011075 3300025949 Bacteria 818
723 Ga0207667_11901925 3300025949 Bacteria 557
724 Ga0207667_11902518 3300025949 Bacteria 557
725 Ga0207712_11746936 3300025961 Bacteria 558
726 Ga0207668_10347756 3300025972 Bacteria 1239
727 Ga0207668_11230799 3300025972 Bacteria 673
728 Ga0207640_10999629 3300025981 Bacteria 736
729 Ga0207640_11081184 3300025981 Bacteria 709
730 Ga0207640_11468663 3300025981 Bacteria 612
731 Ga0207658_10293712 3300025986 Bacteria 1398
732 Ga0207658_10434574 3300025986 Bacteria 1160
733 Ga0207677_10247174 3300026023 Bacteria 1447
734 Ga0207677_10278380 3300026023 Bacteria 1372
735 Ga0207677_10692215 3300026023 Bacteria 904
736 Ga0207677_10878008 3300026023 Bacteria 807
737 Ga0207677_11972233 3300026023 Bacteria 543
738 Ga0207703_10000001 3300026035 Bacteria 822925
739 Ga0207703_10351173 3300026035 Bacteria 1358
740 Ga0207639_10484893 3300026041 Bacteria 1127
741 Ga0207639_11043328 3300026041 Bacteria 766
742 Ga0207639_11916417 3300026041 Bacteria 554
743 Ga0207678_10048863 3300026067 Bacteria 3656
744 Ga0207678_10356363 3300026067 Bacteria 1262
745 Ga0207678_10449839 3300026067 Bacteria 1119
746 Ga0207678_10518444 3300026067 Bacteria 1040
747 Ga0207678_10577081 3300026067 Bacteria 985
748 Ga0207678_11271338 3300026067 Bacteria 651
749 Ga0207678_11336716 3300026067 Bacteria 634
750 Ga0207708_10180362 3300026075 Bacteria 1676
751 Ga0207708_10218617 3300026075 Bacteria 1526
752 Ga0207708_10439488 3300026075 Bacteria 1085
753 Ga0207702_10097309 3300026078 Bacteria 2590
754 Ga0207702_10135638 3300026078 Bacteria 2220
755 Ga0207702_10212346 3300026078 Bacteria 1800
756 Ga0207702_10381120 3300026078 Bacteria 1356
757 Ga0207702_10408739 3300026078 Bacteria 1310
758 Ga0207702_10439488 3300026078 Bacteria 1264
759 Ga0207702_10746221 3300026078 Bacteria 966
760 Ga0207702_11253947 3300026078 Bacteria 735
761 Ga0207702_11982367 3300026078 Bacteria 573
762 Ga0207641_10322775 3300026088 Bacteria 1465
763 Ga0207641_11498878 3300026088 Bacteria 676
764 Ga0207648_10535224 3300026089 Bacteria 1075
765 Ga0207648_11297114 3300026089 Bacteria 684
766 Ga0207648_12263249 3300026089 Bacteria 504
767 Ga0207676_10032703 3300026095 Bacteria 3923
768 Ga0207676_10759772 3300026095 Bacteria 943
769 Ga0207676_11371894 3300026095 Bacteria 702
770 Ga0207676_11884848 3300026095 Bacteria 596
771 Ga0207674_10036829 3300026116 Bacteria 5093
772 Ga0207674_10098691 3300026116 Bacteria 2904
773 Ga0207674_10318484 3300026116 Bacteria 1505
774 Ga0207674_10853440 3300026116 Bacteria 878
775 Ga0207675_100111372 3300026118 Bacteria 2583
776 Ga0207675_100200744 3300026118 Bacteria 1915
777 Ga0207675_102167295 3300026118 Bacteria 571
778 Ga0207683_10301171 3300026121 Bacteria 1467
779 Ga0207683_10345388 3300026121 Bacteria 1365
780 Ga0207683_10385657 3300026121 Bacteria 1288
781 Ga0207683_10620957 3300026121 Bacteria 1001
782 Ga0207683_10759645 3300026121 Bacteria 899
783 Ga0207683_11080304 3300026121 Bacteria 744
784 Ga0207698_10026848 3300026142 Bacteria 4079
785 Ga0207698_10282883 3300026142 Bacteria 1535
786 Ga0207698_10659816 3300026142 Bacteria 1037
787 Ga0207698_11799003 3300026142 Bacteria 628
788 Ga0207428_10014416 3300027907 Bacteria 6869
789 Ga0268266_10960969 3300028379 Bacteria 827
790 Ga0268266_11767160 3300028379 Bacteria 593
791 Ga0268265_10413517 3300028380 Bacteria 1250
792 Ga0268265_11493899 3300028380 Bacteria 679
793 Ga0268264_10493157 3300028381 Bacteria 1193
794 Ga0268264_10613051 3300028381 Bacteria 1074
795 Ga0268264_10670846 3300028381 Bacteria 1027
796 Ga0316177_1018223 3300030731 Bacteria 954
797 Ga0316176_1007850 3300030732 Bacteria 1731
798 Ga0316179_1017591 3300030734 Bacteria 858
799 Ga0316181_1095944 3300030744 Bacteria 747
800 Ga0316182_1258570 3300030745 Bacteria 1356
801 Ga0265762_1069869 3300030760 Unclassified 735
802 Ga0265767_100946 3300030836 Bacteria 1334
803 Ga0265760_10175190 3300031090 Bacteria 714
804 Ga0265320_10038206 3300031240 Bacteria 2411
805 Ga0265325_10054458 3300031241 Bacteria 2047
806 Ga0265325_10057167 3300031241 Bacteria 1990
807 Ga0265340_10011790 3300031247 Bacteria 4635
808 Ga0265340_10260894 3300031247 Bacteria 771
809 Ga0265339_10146840 3300031249 Bacteria 1195
810 Ga0265331_10451403 3300031250 Bacteria 578
811 Ga0265316_10163349 3300031344 Bacteria 1664
812 Ga0307408_100257514 3300031548 Bacteria 1442
813 Ga0265313_10267188 3300031595 Bacteria 694
814 Ga0307508_10905283 3300031616 Bacteria 509
815 Ga0316575_10002327 3300031665 Bacteria 6359
816 Ga0316579_10002430 3300031691 Bacteria 7034
817 Ga0265314_10430039 3300031711 Bacteria 707
818 Ga0316576_10002441 3300031727 Bacteria 10575
819 Ga0316576_10007831 3300031727 Bacteria 6751
820 Ga0316576_10101633 3300031727 Bacteria 2149
821 Ga0316578_10008542 3300031728 Bacteria 5218
822 Ga0316578_10077915 3300031728 Bacteria 1969
823 Ga0316578_10593650 3300031728 Bacteria 649
824 Ga0307405_10168145 3300031731 Bacteria 1561
825 Ga0307405_10692954 3300031731 Bacteria 843
826 Ga0307405_10897408 3300031731 Bacteria 749
827 Ga0316577_10401542 3300031733 Bacteria 778
828 Ga0316577_10622184 3300031733 Bacteria 614
829 Ga0307413_10218428 3300031824 Bacteria 1390
830 Ga0307413_10374520 3300031824 Bacteria 1107
831 Ga0307413_10617840 3300031824 Bacteria 889
832 Ga0307413_11071051 3300031824 Bacteria 695
833 Ga0307413_11787325 3300031824 Bacteria 550
834 Ga0307410_10127812 3300031852 Bacteria 1863
835 Ga0307410_10242845 3300031852 Bacteria 1396
836 Ga0307410_10661966 3300031852 Bacteria 877
837 Ga0307410_10761354 3300031852 Bacteria 821
838 Ga0326468_10008544 3300031889 Bacteria 993
839 Ga0307406_10032902 3300031901 Bacteria 3169
840 Ga0307406_10035116 3300031901 Bacteria 3081
841 Ga0307406_10213296 3300031901 Bacteria 1430
842 Ga0307406_10289293 3300031901 Bacteria 1253
843 Ga0307406_10953069 3300031901 Bacteria 733
844 Ga0307406_11191447 3300031901 Bacteria 661
845 Ga0307407_10116276 3300031903 Bacteria 1687
846 Ga0307407_10547156 3300031903 Bacteria 855
847 Ga0307407_10842203 3300031903 Bacteria 700
848 Ga0307407_11022376 3300031903 Bacteria 639
849 Ga0307407_11123493 3300031903 Bacteria 611
850 Ga0307407_11479910 3300031903 Bacteria 537
851 Ga0307412_10219923 3300031911 Bacteria 1455
852 Ga0307412_10691129 3300031911 Bacteria 875
853 Ga0307412_11545607 3300031911 Bacteria 604
854 Ga0307409_100030729 3300031995 Bacteria 3864
855 Ga0307409_100094112 3300031995 Bacteria 2464
856 Ga0307409_100100470 3300031995 Bacteria 2398
857 Ga0307409_100173422 3300031995 Bacteria 1901
858 Ga0307409_100269816 3300031995 Bacteria 1566
859 Ga0307409_100887342 3300031995 Bacteria 904
860 Ga0307409_101227649 3300031995 Bacteria 773
861 Ga0307409_102874903 3300031995 Bacteria 509
862 Ga0307416_100009883 3300032002 Bacteria 6275
863 Ga0307416_100128930 3300032002 Bacteria 2272
864 Ga0307416_100374058 3300032002 Bacteria 1452
865 Ga0307416_100620027 3300032002 Bacteria 1163
866 Ga0307416_101764749 3300032002 Bacteria 723
867 Ga0307416_102448108 3300032002 Bacteria 621
868 Ga0307416_102612723 3300032002 Bacteria 602
869 Ga0307416_103359694 3300032002 Bacteria 535
870 Ga0307416_103377172 3300032002 Bacteria 534
871 Ga0307416_103546332 3300032002 Bacteria 522
872 Ga0307416_103559025 3300032002 Bacteria 521
873 Ga0307414_10369459 3300032004 Bacteria 1237
874 Ga0307414_10573668 3300032004 Bacteria 1008
875 Ga0307415_100021230 3300032126 Bacteria 3986
876 Ga0307415_100062327 3300032126 Bacteria 2586
877 Ga0307415_100071541 3300032126 Bacteria 2439
878 Ga0307415_100809110 3300032126 Bacteria 856
879 Ga0307415_102584202 3300032126 Bacteria 501
880 Ga0316585_10001057 3300032137 Bacteria 7142
881 Ga0316580_10003992 3300032139 Bacteria 4246
882 Ga0316593_10029265 3300032168 Bacteria 1781
883 Ga0316593_10039697 3300032168 Bacteria 1562
884 Ga0316593_10081292 3300032168 Bacteria 1131
885 Ga0316592_1018909 3300033524 Bacteria 1455
886 Ga0316592_1038181 3300033524 Bacteria 1058
887 Ga0316592_1040830 3300033524 Bacteria 1027
888 Ga0316586_1020752 3300033527 Bacteria 1081
889 Ga0316588_1022546 3300033528 Bacteria 1439
890 Ga0316588_1141850 3300033528 Bacteria 614
891 Ga0316588_1179551 3300033528 Unclassified 549
892 Ga0316596_1020836 3300033541 Bacteria 1669
893 Ga0316596_1072706 3300033541 Bacteria 921
894 Ga0373930_0154462 3300034816 Bacteria 577
895 Ga0373959_0027729 3300034820 Bacteria 1127
896 Ga0373926_0005903 3300035083 Bacteria 4049
897 Ga0373926_0009018 3300035083 Bacteria 3326
898 Ga0373926_0040846 3300035083 Bacteria 1656
899 Ga0373926_0106667 3300035083 Bacteria 1050
900 Ga0373926_0264050 3300035083 Bacteria 669
901 Ga0373929_0004837 3300035085 Bacteria 2414
902 Ga0373934_0053041 3300035086 Bacteria 1608
903 Ga0373934_0268948 3300035086 Bacteria 705
904 Ga0373940_0327806 3300035088 Bacteria 533
905 Ga0373944_0020913 3300035089 Bacteria 1889
906 Ga0373944_0169863 3300035089 Bacteria 777
907 Ga0373944_0302973 3300035089 Bacteria 600
908 Ga0373951_0010130 3300035091 Bacteria 2116
909 Ga0373952_0081350 3300035092 Bacteria 827
910 Ga0373952_0188355 3300035092 Bacteria 599
911 Ga0373923_0004349 3300035111 Bacteria 4694
912 Ga0373923_0032636 3300035111 Bacteria 2104
913 Ga0373923_0103050 3300035111 Bacteria 1260
914 Ga0373923_0215810 3300035111 Bacteria 890
915 Ga0373932_0042604 3300035112 Bacteria 1317
916 Ga0373936_0004565 3300035113 Bacteria 5240
917 Ga0373936_0011868 3300035113 Bacteria 3305
918 Ga0373936_0046070 3300035113 Bacteria 1757
919 Ga0373936_0240596 3300035113 Bacteria 806
920 Ga0373936_0253441 3300035113 Bacteria 786
921 Ga0373945_0000309 3300035116 Bacteria 13946
922 Ga0373945_0004376 3300035116 Bacteria 4486
923 Ga0373945_0007892 3300035116 Bacteria 3454
924 Ga0373945_0218463 3300035116 Bacteria 796
925 Ga0373953_0084608 3300035117 Bacteria 1322
926 Ga0373953_0085832 3300035117 Bacteria 1313
927 Ga0373953_0141637 3300035117 Bacteria 1028
928 Ga0373953_0173590 3300035117 Bacteria 928
929 Ga0373953_0250602 3300035117 Bacteria 769
930 Ga0373954_0128346 3300035118 Bacteria 1233
931 Ga0373954_0444906 3300035118 Bacteria 641
932 Ga0373954_0480472 3300035118 Bacteria 615
933 Ga0373956_0160145 3300035119 Bacteria 1060
934 Ga0373956_0271143 3300035119 Bacteria 807
935 Ga0373957_0044728 3300035120 Bacteria 1676
936 Ga0373957_0072771 3300035120 Bacteria 1346
937 Ga0373957_0276620 3300035120 Bacteria 709
938 Ga0373960_0039794 3300035121 Bacteria 1354
939 Ga0373943_0013584 3300035170 Bacteria 3679
940 Ga0373943_0020179 3300035170 Bacteria 3070
941 Ga0373943_0493834 3300035170 Bacteria 715
942 Ga0373943_0509294 3300035170 Bacteria 704
943 Ga0373946_0000043 3300035171 Bacteria 32721
944 Ga0373946_0002808 3300035171 Bacteria 6157
945 Ga0373946_0151088 3300035171 Bacteria 1083
946 Ga0373946_0492926 3300035171 Bacteria 628
947 Ga0373955_0040244 3300035172 Bacteria 2498
948 Ga0373955_0063120 3300035172 Bacteria 2050
949 Ga0373955_0347950 3300035172 Bacteria 897
950 Ga0373955_0362018 3300035172 Bacteria 879
951 Ga0373942_0052106 3300035207 Bacteria 1150
952 Ga0373942_0199229 3300035207 Bacteria 663
953 Ga0373961_0087424 3300035241 Bacteria 990
954 Ga0316574_0107026 3300035398 Bacteria 1791
955 Ga0373924_0012478 3300035410 Bacteria 3175
956 Ga0373924_0072158 3300035410 Bacteria 1458
957 Ga0373924_0125212 3300035410 Bacteria 1116
958 Ga0373931_0035669 3300035691 Bacteria 2587
959 Ga0373931_0388950 3300035691 Bacteria 881
960 Ga0373931_0431283 3300035691 Bacteria 840
961 Ga0373935_0001846 3300035692 Bacteria 11884
962 Ga0373935_0013386 3300035692 Bacteria 4948
963 Ga0373935_0497719 3300035692 Bacteria 884
964 Ga0373935_0607312 3300035692 Bacteria 800
965 Ga0373935_0707379 3300035692 Bacteria 741
966 Ga0373935_0826256 3300035692 Bacteria 685
967 Ga0373935_0930360 3300035692 Bacteria 644
968 Ga0373927_0005796 3300035695 Bacteria 8477
969 Ga0373927_0084033 3300035695 Bacteria 2064
970 Ga0373927_0651776 3300035695 Bacteria 696
971 Ga0373933_0012227 3300035724 Bacteria 4742
972 Ga0373933_0054222 3300035724 Bacteria 2402
973 Ga0373933_0167429 3300035724 Unclassified 1397
974 Ga0373933_0267187 3300035724 Bacteria 1103
975 Ga0373933_0893608 3300035724 Bacteria 585
976 Ga0373933_1154201 3300035724 Bacteria 510
977 Ga0373947_0000269 3300035725 Bacteria 29502
978 Ga0373947_0020050 3300035725 Bacteria 3858
979 Ga0373947_1155479 3300035725 Bacteria 527
980 Ga0373947_1164958 3300035725 Bacteria 525
981 Ga0373947_1264208 3300035725 Bacteria 502
982 Ga0373937_0188708 3300036401 Bacteria 1936
983 Ga0373937_0367660 3300036401 Bacteria 1363
984 Ga0373937_0499758 3300036401 Bacteria 1155
985 Ga0373937_1775041 3300036401 Bacteria 563
986 Ga0265778_064684 3300036457 Bacteria 514
987 Ga0316582_0001069 3300036647 Bacteria 11524
988 Ga0316582_0790934 3300036647 Unclassified 650
989 Ga0316584_0000247 3300036712 Bacteria 27169
990 Ga0316584_0388054 3300036712 Bacteria 997
991 Ga0316584_0448546 3300036712 Bacteria 913
992 Ga0373925_0120452 3300037068 Bacteria 2036
993 Ga0373925_0232305 3300037068 Bacteria 1475
994 Ga0373925_1366732 3300037068 Bacteria 580
995 Ga0395899_0057763 3300037312 Bacteria 2863
996 Ga0395899_0151554 3300037312 Bacteria 1643
997 Ga0395900_0103460 3300037418 Bacteria 2925
998 Ga0395900_0228929 3300037418 Bacteria 1870
999 Ga0395898_0002525 3300037466 Bacteria 21479
1000 Ga0395898_0004699 3300037466 Bacteria 14867
1001 Ga0395898_0502338 3300037466 Bacteria 1153
1002 Ga0395905_0230702 3300037471 Bacteria 1731
1003 Ga0316581_0000044 3300037588 Bacteria 13864
1004 Ga0436364_0029165 3300037853 Bacteria 38556
1005 Ga0436364_0186331 3300037853 Bacteria 1600
1006 Ga0436364_0196375 3300037853 Bacteria 815
1007 Ga0436364_0233317 3300037853 Bacteria 2365
1008 Ga0436364_0235261 3300037853 Bacteria 527
1009 Ga0436364_0341511 3300037853 Bacteria 649
1010 Ga0436364_0390589 3300037853 Bacteria 24470
1011 Ga0436364_0752011 3300037853 Bacteria 2298
1012 Ga0436364_0813081 3300037853 Bacteria 3925
1013 Ga0436364_1120314 3300037853 Bacteria 1552
1014 Ga0436364_1187624 3300037853 Bacteria 2053
1015 Ga0436364_1307130 3300037853 Bacteria 1118
1016 Ga0436364_1427907 3300037853 Bacteria 1462
1017 Ga0395901_0006572 3300038443 Bacteria 11751
1018 Ga0395901_0016439 3300038443 Bacteria 7537
1019 Ga0395901_0067639 3300038443 Bacteria 3721
1020 Ga0395901_0191216 3300038443 Bacteria 2146
1021 Ga0400485_10675 3300038735 Bacteria 47112
1022 Ga0400488_07578 3300038741 Bacteria 5463
1023 Ga0400486_19892 3300038742 Bacteria 77946
1024 Ga0436365_0202876 3300039437 Bacteria 609
1025 Ga0436365_0951027 3300039437 Bacteria 3018
1026 Ga0436365_1036213 3300039437 Bacteria 1136
1027 Ga0436363_0326680 3300039450 Bacteria 1869
1028 Ga0436363_0377735 3300039450 Bacteria 630
1029 Ga0436363_0403742 3300039450 Bacteria 614
1030 Ga0436363_0956449 3300039450 Bacteria 824
1031 Ga0436363_1029895 3300039450 Bacteria 1239
1032 Ga0436363_1704859 3300039450 Bacteria 1008
1033 Ga0436362_0118329 3300039453 Bacteria 746
1034 Ga0436362_1138355 3300039453 Bacteria 517
1035 Ga0436362_1242332 3300039453 Bacteria 551
1036 Ga0451789_1006507 3300041443 Bacteria 861
1037 Ga0451791_0654865 3300041451 Bacteria 1602
1038 Ga0451791_0882259 3300041451 Bacteria 810
1039 Ga0451793_0144127 3300041452 Bacteria 522
1040 Ga0451793_0423370 3300041452 Bacteria 18589
1041 Ga0451793_1904655 3300041452 Bacteria 1444
1042 Ga0451797_0095207 3300041453 Bacteria 939
1043 Ga0451797_1404612 3300041453 Bacteria 1123
1044 Ga0451795_0074536 3300041456 Bacteria 630
1045 Ga0451795_0078095 3300041456 Bacteria 1109
1046 Ga0451795_1151956 3300041456 Bacteria 691
1047 Ga0451795_1365640 3300041456 Bacteria 1472
1048 Ga0451798_0554323 3300041458 Bacteria 507
1049 Ga0451802_0709529 3300041460 Bacteria 515
1050 Ga0451802_1025007 3300041460 Bacteria 749
1051 Ga0451835_0881598 3300041492 Bacteria 952
1052 Ga0451837_0111929 3300041494 Bacteria 1361
1053 Ga0451839_0313739 3300041496 Bacteria 637
1054 Ga0451839_1490633 3300041496 Bacteria 1063
1055 Ga0451841_0024026 3300041498 Bacteria 806
1056 Ga0451849_0563512 3300041505 Bacteria 707
1057 Ga0451849_1306778 3300041505 Bacteria 589
1058 Ga0451843_0958715 3300041509 Bacteria 8331
1059 Ga0451843_1206275 3300041509 Bacteria 578
1060 Ga0451855_0494061 3300041511 Bacteria 646
1061 Ga0451853_1486237 3300041512 Bacteria 4271
1062 Ga0451853_2446506 3300041512 Bacteria 979
1063 Ga0451853_2963819 3300041512 Bacteria 575
1064 Ga0451853_4037286 3300041512 Bacteria 691
1065 Ga0439431_0043469 3300041997 Bacteria 1150
1066 Ga0450923_082169 3300042125 Bacteria 726
1067 Ga0466969_0019444 3300044656 Bacteria 3531
1068 Ga0466969_0043226 3300044656 Bacteria 2246
1069 Ga0466969_0603499 3300044656 Bacteria 504
1070 Ga0466972_0269369 3300044658 Bacteria 796
1071 Ga0466972_0379039 3300044658 Bacteria 662
1072 Ga0466965_0021080 3300044683 Bacteria 3136
1073 Ga0466966_0002271 3300044684 Bacteria 12524
1074 Ga0466966_0016320 3300044684 Bacteria 4910
1075 Ga0466966_0068435 3300044684 Bacteria 2229
1076 Ga0466966_0094230 3300044684 Bacteria 1856
1077 Ga0466966_0185119 3300044684 Bacteria 1263
1078 Ga0466966_0296559 3300044684 Bacteria 972
1079 Ga0466966_0393496 3300044684 Bacteria 833
1080 Ga0466966_0730503 3300044684 Bacteria 597
1081 Ga0466961_0007227 3300044693 Bacteria 7066
1082 Ga0466961_0009205 3300044693 Bacteria 6288
1083 Ga0466961_0064230 3300044693 Bacteria 2333
1084 Ga0466961_0074815 3300044693 Bacteria 2147
1085 Ga0466961_0084894 3300044693 Bacteria 2002
1086 Ga0466961_0295957 3300044693 Bacteria 989
1087 Ga0466961_0326258 3300044693 Bacteria 936
1088 Ga0466961_0919055 3300044693 Bacteria 521
1089 Ga0466961_0929617 3300044693 Bacteria 517
1090 Ga0466963_0014526 3300044694 Bacteria 4857
1091 Ga0466963_0035545 3300044694 Bacteria 3246
1092 Ga0466963_0070759 3300044694 Bacteria 2347
1093 Ga0466963_0130109 3300044694 Bacteria 1738
1094 Ga0466963_0175489 3300044694 Bacteria 1495
1095 Ga0466963_0203694 3300044694 Bacteria 1384
1096 Ga0466963_0204446 3300044694 Bacteria 1381
1097 Ga0466963_0243562 3300044694 Bacteria 1261
1098 Ga0466963_0279801 3300044694 Bacteria 1173
1099 Ga0466963_0298575 3300044694 Bacteria 1133
1100 Ga0466963_0324670 3300044694 Bacteria 1083
1101 Ga0466963_0367807 3300044694 Bacteria 1013
1102 Ga0466963_0381929 3300044694 Bacteria 993
1103 Ga0466963_0426645 3300044694 Bacteria 935
1104 Ga0466963_0448366 3300044694 Bacteria 910
1105 Ga0466963_0786047 3300044694 Bacteria 671
1106 Ga0466963_0793509 3300044694 Bacteria 668
1107 Ga0466963_1268044 3300044694 Bacteria 517
1108 Ga0466963_1304994 3300044694 Bacteria 509
1109 Ga0466964_0005201 3300044706 Bacteria 4823
1110 Ga0466964_0045111 3300044706 Bacteria 1793
1111 Ga0466964_0137846 3300044706 Bacteria 1118
1112 Ga0466971_0002276 3300044719 Bacteria 8137
1113 Ga0466971_0014156 3300044719 Bacteria 3507
1114 Ga0466971_0044778 3300044719 Bacteria 1987
1115 Ga0466971_0051996 3300044719 Bacteria 1845
1116 Ga0466971_0235789 3300044719 Bacteria 869
1117 Ga0466971_0555642 3300044719 Bacteria 570
1118 Ga0466968_0116639 3300044735 Bacteria 1205
1119 Ga0466968_0252581 3300044735 Bacteria 838
1120 Ga0466968_0479737 3300044735 Bacteria 618
1121 Ga0466970_0026035 3300044765 Bacteria 3065
1122 Ga0466970_0250685 3300044765 Bacteria 992
1123 Ga0466970_0338679 3300044765 Bacteria 852
1124 Ga0466970_0599046 3300044765 Bacteria 639
1125 Ga0466957_0016967 3300044842 Bacteria 4260
1126 Ga0466957_0045922 3300044842 Bacteria 2650
1127 Ga0466957_0056681 3300044842 Bacteria 2396
1128 Ga0466957_0175020 3300044842 Bacteria 1399
1129 Ga0466957_0268635 3300044842 Bacteria 1138
1130 Ga0466957_0320887 3300044842 Bacteria 1045
1131 Ga0466957_0330370 3300044842 Bacteria 1030
1132 Ga0466957_0570196 3300044842 Bacteria 790
1133 Ga0466957_1008021 3300044842 Bacteria 598
1134 Ga0466957_1159979 3300044842 Bacteria 558
1135 Ga0466960_0085198 3300044901 Bacteria 1600
1136 Ga0466960_0157988 3300044901 Bacteria 1216
1137 Ga0466960_0354602 3300044901 Bacteria 837
1138 Ga0466960_0408831 3300044901 Bacteria 783
1139 Ga0466960_0453047 3300044901 Bacteria 746
1140 Ga0466960_0465873 3300044901 Bacteria 736
1141 Ga0466960_0720797 3300044901 Bacteria 599
1142 Ga0466959_0025174 3300045049 Bacteria 4408
1143 Ga0466959_0038875 3300045049 Bacteria 3516
1144 Ga0466959_0170202 3300045049 Bacteria 1528
1145 Ga0466959_0258694 3300045049 Bacteria 1199
1146 Ga0466959_0298197 3300045049 Bacteria 1104
1147 Ga0466959_1094963 3300045049 Bacteria 530
1148 Ga0451576_0149961 3300045051 Bacteria 2432
1149 Ga0466958_0001921 3300045836 Bacteria 10169
1150 Ga0466958_0033018 3300045836 Bacteria 3082
1151 Ga0466958_0043030 3300045836 Bacteria 2719
1152 Ga0466958_0140968 3300045836 Bacteria 1517
1153 Ga0466958_0259835 3300045836 Bacteria 1111
1154 Ga0466958_0429709 3300045836 Bacteria 854
1155 Ga0466967_0006558 3300045976 Bacteria 8258
1156 Ga0466967_0018985 3300045976 Bacteria 5516
1157 Ga0466967_0034344 3300045976 Bacteria 4303
1158 Ga0466967_0037772 3300045976 Bacteria 4136
1159 Ga0466967_0040657 3300045976 Bacteria 4004
1160 Ga0466967_0047621 3300045976 Bacteria 3738
1161 Ga0466967_0055083 3300045976 Bacteria 3503
1162 Ga0466967_0069729 3300045976 Bacteria 3143
1163 Ga0466967_0097768 3300045976 Bacteria 2679
1164 Ga0466967_0124108 3300045976 Bacteria 2390
1165 Ga0466967_0124514 3300045976 Bacteria 2386
1166 Ga0466967_0133975 3300045976 Bacteria 2303
1167 Ga0466967_0134611 3300045976 Bacteria 2297
1168 Ga0466967_0169614 3300045976 Bacteria 2053
1169 Ga0466967_0174146 3300045976 Bacteria 2026
1170 Ga0466967_0194336 3300045976 Bacteria 1919
1171 Ga0466967_0249715 3300045976 Bacteria 1694
1172 Ga0466967_0362035 3300045976 Bacteria 1405
1173 Ga0466967_0378156 3300045976 Bacteria 1375
1174 Ga0466967_0520696 3300045976 Bacteria 1168
1175 Ga0466967_0651071 3300045976 Bacteria 1042
1176 Ga0466967_0685085 3300045976 Bacteria 1015
1177 Ga0466967_0796382 3300045976 Bacteria 938
1178 Ga0466967_1169369 3300045976 Bacteria 766
1179 Ga0466967_1325915 3300045976 Bacteria 717
1180 Ga0466967_1407393 3300045976 Bacteria 694
1181 Ga0466967_1547739 3300045976 Bacteria 660
1182 Ga0466967_1579762 3300045976 Bacteria 653
1183 Ga0466967_1658085 3300045976 Bacteria 637
1184 Ga0466967_2064550 3300045976 Bacteria 566
1185 Ga0466967_2166790 3300045976 Unclassified 552
1186 Ga0466967_2242082 3300045976 Bacteria 542
1187 Ga0466967_2428185 3300045976 Bacteria 519
1188 Ga0495627_005895 3300046453 Bacteria 4869
1189 Ga0495592_0004050 3300046454 Bacteria 10656
1190 Ga0495592_0130591 3300046454 Bacteria 1757
1191 Ga0495592_0504550 3300046454 Bacteria 750
1192 Ga0495592_0766057 3300046454 Bacteria 576
1193 Ga0495603_0002150 3300046455 Bacteria 11591
1194 Ga0495603_0118373 3300046455 Bacteria 1544
1195 Ga0495603_0390619 3300046455 Bacteria 798
1196 Ga0495629_0070231 3300046459 Bacteria 2443
1197 Ga0495629_0423940 3300046459 Bacteria 903
1198 Ga0495629_0539538 3300046459 Bacteria 784
1199 Ga0495629_0778027 3300046459 Bacteria 632
1200 Ga0495641_0007009 3300046461 Bacteria 7156
1201 Ga0495641_0074505 3300046461 Bacteria 1522
1202 Ga0495641_0111128 3300046461 Bacteria 1223
1203 Ga0495641_0120527 3300046461 Bacteria 1170
1204 Ga0495641_0378156 3300046461 Bacteria 642
1205 Ga0495641_0538300 3300046461 Bacteria 533
1206 Ga0495651_0031212 3300046462 Bacteria 4156
1207 Ga0495651_0072366 3300046462 Bacteria 2618
1208 Ga0495651_0078639 3300046462 Bacteria 2494
1209 Ga0495651_0322398 3300046462 Bacteria 1029
1210 Ga0495651_0339312 3300046462 Bacteria 996
1211 Ga0495653_0014087 3300046463 Bacteria 6519
1212 Ga0495653_0073908 3300046463 Bacteria 2542
1213 Ga0495653_0272788 3300046463 Bacteria 1113
1214 Ga0495653_0566802 3300046463 Bacteria 701
1215 Ga0495653_0613389 3300046463 Bacteria 668
1216 Ga0495580_0322240 3300046472 Bacteria 1050
1217 Ga0495582_0019291 3300046473 Bacteria 3729
1218 Ga0495582_0036036 3300046473 Bacteria 2721
1219 Ga0495582_0597047 3300046473 Bacteria 639
1220 Ga0495605_0221464 3300046474 Bacteria 818
1221 Ga0495639_0003514 3300046475 Bacteria 6763
1222 Ga0495639_0114841 3300046475 Bacteria 1280
1223 Ga0495639_0251189 3300046475 Bacteria 874
1224 Ga0495662_0001681 3300046476 Bacteria 11037
1225 Ga0495662_0090399 3300046476 Bacteria 1493
1226 Ga0495662_0095393 3300046476 Bacteria 1453
1227 Ga0495662_0166030 3300046476 Bacteria 1088
1228 Ga0495662_0403286 3300046476 Bacteria 671
1229 Ga0495664_0001236 3300046477 Bacteria 13369
1230 Ga0495664_0011092 3300046477 Bacteria 5070
1231 Ga0495664_0676626 3300046477 Bacteria 611
1232 Ga0495584_0329618 3300046491 Bacteria 775
1233 Ga0495594_0475355 3300046499 Bacteria 710
1234 Ga0495596_0042409 3300046500 Bacteria 1793
1235 Ga0495608_0020590 3300046511 Bacteria 4533
1236 Ga0495608_0063065 3300046511 Bacteria 2433
1237 Ga0495608_0121399 3300046511 Bacteria 1675
1238 Ga0495608_0162326 3300046511 Bacteria 1420
1239 Ga0495608_0440258 3300046511 Bacteria 794
1240 Ga0495608_0706270 3300046511 Bacteria 600
1241 Ga0495616_0393831 3300046513 Bacteria 570
1242 Ga0495618_0005033 3300046514 Bacteria 8072
1243 Ga0495618_0027019 3300046514 Bacteria 3572
1244 Ga0495618_0136024 3300046514 Bacteria 1572
1245 Ga0495618_0195175 3300046514 Bacteria 1282
1246 Ga0495618_0233137 3300046514 Bacteria 1158
1247 Ga0495618_0248451 3300046514 Bacteria 1116
1248 Ga0495628_0644172 3300046516 Bacteria 753
1249 Ga0495630_0008015 3300046517 Bacteria 7589
1250 Ga0495630_0114406 3300046517 Bacteria 2044
1251 Ga0495630_0123494 3300046517 Bacteria 1964
1252 Ga0495630_0438356 3300046517 Bacteria 1001
1253 Ga0495631_0389220 3300046518 Bacteria 593
1254 Ga0495644_0076994 3300046523 Bacteria 1257
1255 Ga0495663_0080415 3300046525 Bacteria 1049
1256 Ga0495663_0280199 3300046525 Bacteria 597
1257 Ga0495666_0010911 3300046526 Bacteria 4530
1258 Ga0495666_0176903 3300046526 Bacteria 986
1259 Ga0495652_0026425 3300046529 Bacteria 5130
1260 Ga0495652_0074158 3300046529 Bacteria 2830
1261 Ga0495652_0804679 3300046529 Bacteria 625
1262 Ga0495652_0995578 3300046529 Bacteria 548
1263 Ga0495654_0157436 3300046530 Bacteria 1000
1264 Ga0495665_0006066 3300046531 Bacteria 6519
1265 Ga0495665_0326349 3300046531 Bacteria 783
1266 Ga0495665_0381970 3300046531 Bacteria 715
1267 Ga0495665_0404124 3300046531 Bacteria 693
1268 Ga0495665_0422101 3300046531 Bacteria 675
1269 Ga0495640_0002357 3300046533 Bacteria 15142
1270 Ga0495640_0611716 3300046533 Bacteria 657
1271 Ga0495640_0718440 3300046533 Bacteria 599
1272 Ga0495640_0959171 3300046533 Bacteria 505
1273 Ga0495586_0081561 3300046535 Bacteria 1777
1274 Ga0495586_0320837 3300046535 Bacteria 888
1275 Ga0495587_0027514 3300046536 Bacteria 3462
1276 Ga0495587_0040506 3300046536 Bacteria 2784
1277 Ga0495587_0095679 3300046536 Bacteria 1714
1278 Ga0495587_0113294 3300046536 Bacteria 1556
1279 Ga0495645_0077238 3300046543 Bacteria 2394
1280 Ga0495645_0150373 3300046543 Bacteria 1618
1281 Ga0495645_0244786 3300046543 Bacteria 1194
1282 Ga0495645_0338115 3300046543 Bacteria 973
1283 Ga0495645_0941443 3300046543 Bacteria 511
1284 Ga0495622_0408415 3300046557 Bacteria 584
1285 Ga0495667_0004440 3300046559 Bacteria 9464
1286 Ga0495667_0064217 3300046559 Bacteria 2401
1287 Ga0495667_0110085 3300046559 Bacteria 1779
1288 Ga0495667_0929295 3300046559 Bacteria 532
1289 Ga0495667_0941437 3300046559 Bacteria 528
1290 Ga0495634_0208614 3300046642 Bacteria 1210
1291 Ga0495634_0220341 3300046642 Bacteria 1171
1292 Ga0495634_0261944 3300046642 Bacteria 1054
1293 Ga0495634_0324227 3300046642 Bacteria 927
1294 Ga0495634_0372345 3300046642 Bacteria 852
1295 Ga0495635_0008824 3300046663 Bacteria 7040
1296 Ga0495635_0013490 3300046663 Bacteria 5717
1297 Ga0495635_0035505 3300046663 Bacteria 3456
1298 Ga0495635_0256313 3300046663 Bacteria 1178
1299 Ga0495635_0684628 3300046663 Bacteria 666
1300 Ga0495635_1044190 3300046663 Bacteria 519
1301 Ga0495588_0228027 3300046674 Bacteria 983
1302 Ga0495657_0061303 3300046675 Bacteria 2488
1303 Ga0495657_0103365 3300046675 Bacteria 1812
1304 Ga0495657_0156800 3300046675 Bacteria 1410
1305 Ga0495599_0031739 3300046678 Bacteria 3315
1306 Ga0495599_0101766 3300046678 Bacteria 1790
1307 Ga0495599_0168390 3300046678 Bacteria 1352
1308 Ga0495599_0250486 3300046678 Bacteria 1078
1309 Ga0495599_0435956 3300046678 Bacteria 777
1310 Ga0495623_0019745 3300046679 Bacteria 4356
1311 Ga0495623_0272867 3300046679 Bacteria 944
1312 Ga0495646_0003156 3300046680 Bacteria 10228
1313 Ga0495646_0090515 3300046680 Bacteria 1768
1314 Ga0495646_0129987 3300046680 Bacteria 1418
1315 Ga0495646_0438555 3300046680 Bacteria 675
1316 Ga0495646_0669293 3300046680 Bacteria 524
1317 Ga0495647_0010925 3300046681 Bacteria 3102
1318 Ga0495647_0047918 3300046681 Bacteria 1651
1319 Ga0495647_0350825 3300046681 Bacteria 672
1320 Ga0495658_0001644 3300046683 Bacteria 11615
1321 Ga0495658_0103659 3300046683 Bacteria 1702
1322 Ga0495658_0154124 3300046683 Bacteria 1413
1323 Ga0495658_1044602 3300046683 Bacteria 521
1324 Ga0495624_0004179 3300046690 Bacteria 10612
1325 Ga0495624_0023935 3300046690 Bacteria 4023
1326 Ga0495670_0099032 3300046691 Bacteria 1500
1327 Ga0495600_0018968 3300046809 Bacteria 4390
1328 Ga0495600_0049307 3300046809 Bacteria 2747
1329 Ga0495600_0088071 3300046809 Bacteria 2025
1330 Ga0495600_0160457 3300046809 Unclassified 1453
1331 Ga0495600_0485621 3300046809 Bacteria 760
1332 Ga0495581_0011512 3300047315 Bacteria 5118
1333 Ga0495581_0015606 3300047315 Bacteria 4408
1334 Ga0495581_0146935 3300047315 Bacteria 1376
1335 Ga0495581_0715006 3300047315 Bacteria 577
1336 Ga0495604_0069523 3300047317 Bacteria 2668
1337 Ga0495604_0226889 3300047317 Bacteria 1283
1338 Ga0495604_0441381 3300047317 Bacteria 851
1339 Ga0495674_0026901 3300047319 Bacteria 5261
1340 Ga0495674_0137470 3300047319 Bacteria 2055
1341 Ga0495674_0336004 3300047319 Bacteria 1228
1342 Ga0495674_0343040 3300047319 Bacteria 1214
1343 Ga0495674_0344995 3300047319 Bacteria 1209
1344 Ga0495674_0433599 3300047319 Bacteria 1057
1345 Ga0495674_0844406 3300047319 Bacteria 710
1346 Ga0495676_0004841 3300047321 Bacteria 12350
1347 Ga0495676_0041953 3300047321 Bacteria 3761
1348 Ga0495676_0082166 3300047321 Bacteria 2439
1349 Ga0495676_0310957 3300047321 Bacteria 1060
1350 Ga0495676_1012517 3300047321 Bacteria 530
1351 Ga0495680_0003883 3300047322 Bacteria 14463
1352 Ga0495680_0032643 3300047322 Bacteria 4223
1353 Ga0495680_0037880 3300047322 Bacteria 3859
1354 Ga0495680_0081250 3300047322 Bacteria 2447
1355 Ga0495675_0152589 3300047444 Bacteria 1426
1356 Ga0495685_205909 3300047447 Bacteria 630
1357 Ga0495684_0000810 3300047471 Bacteria 25298
1358 Ga0495684_0007677 3300047471 Bacteria 8345
1359 Ga0495684_0017316 3300047471 Bacteria 5547
1360 Ga0495684_0075255 3300047471 Bacteria 2565
1361 Ga0495686_0140397 3300047472 Bacteria 1426
1362 Ga0495593_0063967 3300047673 Bacteria 1921
1363 Ga0495593_0099097 3300047673 Bacteria 1496
1364 Ga0495593_0368254 3300047673 Bacteria 718
1365 Ga0495602_0069438 3300048088 Bacteria 3020
1366 Ga0495602_0225719 3300048088 Bacteria 1410
1367 Ga0495602_0250193 3300048088 Bacteria 1321
1368 Ga0495602_0497986 3300048088 Bacteria 852
1369 Ga0495602_0588749 3300048088 Bacteria 766
1370 Ga0495614_0012710 3300048089 Bacteria 3693
1371 Ga0495615_0065999 3300048090 Bacteria 966
1372 Ga0495615_0220708 3300048090 Bacteria 591
1373 Ga0496100_0158533 3300048903 Bacteria 1620
1374 Ga0496100_0247619 3300048903 Bacteria 1317
1375 Ga0496100_0325405 3300048903 Bacteria 1156
1376 Ga0496100_0473245 3300048903 Bacteria 963
1377 Ga0496100_1288464 3300048903 Bacteria 577
1378 Ga0496100_1545456 3300048903 Bacteria 524
1379 Ga0496100_1601104 3300048903 Bacteria 515
1380 Ga0496101_0147634 3300048904 Bacteria 1796
1381 Ga0496101_0323829 3300048904 Bacteria 1209
1382 Ga0496101_0335713 3300048904 Bacteria 1187
1383 Ga0496101_0506204 3300048904 Bacteria 954
1384 Ga0496101_0755991 3300048904 Bacteria 767
1385 Ga0496102_0000639 3300048905 Bacteria 35597
1386 Ga0496102_0024100 3300048905 Bacteria 5408
1387 Ga0496102_0028959 3300048905 Bacteria 4951
1388 Ga0496102_0056942 3300048905 Bacteria 3567
1389 Ga0496102_0124907 3300048905 Bacteria 2405
1390 Ga0496102_0143314 3300048905 Bacteria 2241
1391 Ga0496102_0299487 3300048905 Bacteria 1515
1392 Ga0496102_0408201 3300048905 Bacteria 1276
1393 Ga0496102_1093821 3300048905 Bacteria 717
1394 Ga0496102_1400670 3300048905 Bacteria 618
1395 Ga0496103_0020693 3300048906 Bacteria 3955
1396 Ga0496103_0038165 3300048906 Bacteria 2946
1397 Ga0496103_0082833 3300048906 Bacteria 2019
1398 Ga0496103_0425225 3300048906 Bacteria 853
1399 Ga0496103_0558539 3300048906 Bacteria 730
1400 Ga0496104_0007413 3300048907 Bacteria 9694
1401 Ga0496104_0017502 3300048907 Bacteria 6528
1402 Ga0496104_0020648 3300048907 Bacteria 6040
1403 Ga0496104_0142687 3300048907 Bacteria 2301
1404 Ga0496104_0333584 3300048907 Bacteria 1429
1405 Ga0496104_0646186 3300048907 Bacteria 967
1406 Ga0496104_1170781 3300048907 Bacteria 672
1407 Ga0496105_0024124 3300048908 Bacteria 4939
1408 Ga0496105_0034279 3300048908 Bacteria 4174
1409 Ga0496105_0141044 3300048908 Bacteria 1983
1410 Ga0496105_0172232 3300048908 Bacteria 1774
1411 Ga0496105_0184309 3300048908 Bacteria 1708
1412 Ga0496105_0307326 3300048908 Bacteria 1274
1413 Ga0496105_0413815 3300048908 Bacteria 1068
1414 Ga0496105_0431835 3300048908 Bacteria 1042
1415 Ga0496105_0824036 3300048908 Bacteria 704
1416 Ga0496106_0181361 3300048909 Bacteria 1671
1417 Ga0496106_0578881 3300048909 Bacteria 900
1418 Ga0496106_1102481 3300048909 Bacteria 622
1419 Ga0496107_0102922 3300048910 Bacteria 2094
1420 Ga0496107_0180682 3300048910 Bacteria 1566
1421 Ga0496107_0225973 3300048910 Bacteria 1393
1422 Ga0496107_0565311 3300048910 Bacteria 842
1423 Ga0496107_0685383 3300048910 Bacteria 754
1424 Ga0496108_0005787 3300048911 Bacteria 10017
1425 Ga0496108_0037841 3300048911 Bacteria 4019
1426 Ga0496108_0234943 3300048911 Bacteria 1594
1427 Ga0496108_0348371 3300048911 Bacteria 1292
1428 Ga0496108_0527723 3300048911 Bacteria 1031
1429 Ga0496108_0842174 3300048911 Bacteria 789
1430 Ga0496108_0853965 3300048911 Bacteria 783
1431 Ga0496108_1188763 3300048911 Bacteria 645
1432 Ga0496109_0014020 3300048912 Bacteria 6967
1433 Ga0496109_0021762 3300048912 Bacteria 5675
1434 Ga0496109_0045334 3300048912 Bacteria 3989
1435 Ga0496109_0078536 3300048912 Bacteria 3039
1436 Ga0496109_0103527 3300048912 Bacteria 2642
1437 Ga0496109_0216005 3300048912 Bacteria 1803
1438 Ga0496109_0317305 3300048912 Bacteria 1470
1439 Ga0496109_1031630 3300048912 Bacteria 760
1440 Ga0496109_1216212 3300048912 Bacteria 690
1441 Ga0496109_1592761 3300048912 Bacteria 587
1442 Ga0496110_0006310 3300048913 Bacteria 9362
1443 Ga0496110_0009984 3300048913 Bacteria 7701
1444 Ga0496110_0048862 3300048913 Bacteria 3710
1445 Ga0496110_0102588 3300048913 Bacteria 2565
1446 Ga0496110_0385388 3300048913 Bacteria 1277
1447 Ga0496110_0387700 3300048913 Bacteria 1273
1448 Ga0496110_0686810 3300048913 Bacteria 925
1449 Ga0496110_0920458 3300048913 Bacteria 781
1450 Ga0496110_1397968 3300048913 Bacteria 609
1451 Ga0496110_1592914 3300048913 Bacteria 563
1452 Ga0496111_0002234 3300048914 Bacteria 11621
1453 Ga0496111_0018031 3300048914 Bacteria 4883
1454 Ga0496111_0094504 3300048914 Bacteria 2192
1455 Ga0496111_0218670 3300048914 Bacteria 1415
1456 Ga0496111_0745167 3300048914 Bacteria 711
1457 Ga0496111_1040400 3300048914 Bacteria 585
1458 Ga0496112_0166221 3300048915 Bacteria 2172
1459 Ga0496112_0208240 3300048915 Bacteria 1913
1460 Ga0496112_0233193 3300048915 Bacteria 1795
1461 Ga0496112_0376667 3300048915 Bacteria 1360
1462 Ga0496112_0395113 3300048915 Bacteria 1323
1463 Ga0496112_0946686 3300048915 Bacteria 782
1464 Ga0496113_0193378 3300048916 Bacteria 1615
1465 Ga0496113_0314692 3300048916 Bacteria 1254
1466 Ga0496113_0514667 3300048916 Bacteria 961
1467 Ga0496113_1064713 3300048916 Bacteria 635
1468 Ga0496114_0002509 3300048917 Bacteria 14018
1469 Ga0496114_0005878 3300048917 Bacteria 9644
1470 Ga0496114_0081218 3300048917 Bacteria 2738
1471 Ga0496114_0185137 3300048917 Bacteria 1820
1472 Ga0496114_0390435 3300048917 Bacteria 1232
1473 Ga0496114_0443620 3300048917 Bacteria 1149
1474 Ga0496114_0548901 3300048917 Bacteria 1021
1475 Ga0496114_0556208 3300048917 Bacteria 1013
1476 Ga0496114_0699036 3300048917 Unclassified 889
1477 Ga0496114_0700484 3300048917 Bacteria 888
1478 Ga0496114_1371015 3300048917 Bacteria 594
1479 Ga0496114_1386151 3300048917 Bacteria 590
1480 Ga0496114_1431978 3300048917 Bacteria 578
1481 Ga0496114_1559761 3300048917 Bacteria 548
1482 Ga0496115_0021174 3300048918 Bacteria 5019
1483 Ga0496115_0144316 3300048918 Bacteria 1964
1484 Ga0496115_0439853 3300048918 Bacteria 1054
1485 Ga0496115_0462089 3300048918 Bacteria 1024
1486 Ga0496115_0515445 3300048918 Bacteria 959
1487 Ga0496115_1138366 3300048918 Bacteria 589
1488 Ga0496119_0000055 3300048922 Bacteria 180121
1489 Ga0496120_0011486 3300048923 Bacteria 6087
1490 Ga0496122_0001865 3300048925 Bacteria 32090
1491 Ga0496123_0001160 3300048926 Bacteria 39065
1492 Ga0496123_0123539 3300048926 Bacteria 1450
1493 Ga0496124_0001713 3300048927 Bacteria 30915
1494 Ga0496124_0770751 3300048927 Bacteria 600
1495 Ga0496125_0001974 3300048928 Bacteria 27884
1496 Ga0496125_0229937 3300048928 Bacteria 1187
1497 Ga0496125_0509855 3300048928 Bacteria 675
1498 Ga0496126_0000465 3300048929 Bacteria 80501
1499 Ga0496126_0021107 3300048929 Bacteria 6368
1500 Ga0496126_0919940 3300048929 Bacteria 662
1501 Ga0501306_007586 3300049127 Bacteria 1302
1502 Ga0501306_015382 3300049127 Bacteria 1018
1503 Ga0501308_012673 3300049128 Bacteria 966
1504 Ga0501308_016897 3300049128 Bacteria 878
1505 Ga0501308_018721 3300049128 Bacteria 849
1506 Ga0501308_074039 3300049128 Bacteria 533
1507 Ga0501309_020436 3300049129 Bacteria 926
1508 Ga0501309_051569 3300049129 Bacteria 647
1509 Ga0501309_066738 3300049129 Bacteria 586
1510 Ga0501310_009270 3300049130 Bacteria 1082
1511 Ga0501310_011114 3300049130 Bacteria 1015
1512 Ga0501310_012651 3300049130 Bacteria 970
1513 Ga0501310_012754 3300049130 Bacteria 967
1514 Ga0501310_043538 3300049130 Bacteria 632
1515 Ga0501305_061095 3300049161 Bacteria 648
1516 Ga0501305_084456 3300049161 Bacteria 574
1517 Ga0501305_086778 3300049161 Bacteria 568
1518 Ga0501307_005425 3300049162 Bacteria 1343
1519 Ga0501307_017598 3300049162 Bacteria 902
1520 Ga0501307_063498 3300049162 Bacteria 577
1521 Ga0501311_015741 3300049527 Bacteria 979
1522 Ga0501311_015924 3300049527 Bacteria 975
1523 Ga0501311_019885 3300049527 Bacteria 904
1524 Ga0501311_024743 3300049527 Bacteria 838
1525 Ga0501312_121652 3300049528 Bacteria 505
1526 Ga0501313_012595 3300049529 Bacteria 987
1527 Ga0501313_049903 3300049529 Bacteria 577
1528 Ga0501314_001584 3300049530 Bacteria 1664
1529 Ga0501314_047162 3300049530 Bacteria 514
1530 Ga0501315_022403 3300049531 Bacteria 861
1531 Ga0501315_059816 3300049531 Bacteria 614
1532 Ga0501315_090607 3300049531 Bacteria 529
1533 Ga0501316_002928 3300049532 Bacteria 1622
1534 Ga0501316_016739 3300049532 Bacteria 894
1535 Ga0501316_023080 3300049532 Bacteria 796
1536 Ga0501316_029591 3300049532 Bacteria 728
1537 Ga0501316_061104 3300049532 Bacteria 557
1538 Ga0501316_079590 3300049532 Bacteria 506
1539 Ga0501317_009765 3300049533 Bacteria 1133
1540 Ga0501317_012594 3300049533 Bacteria 1046
1541 Ga0501317_013556 3300049533 Bacteria 1021
1542 Ga0501317_016030 3300049533 Bacteria 967
1543 Ga0501317_018792 3300049533 Bacteria 917
1544 Ga0501317_033038 3300049533 Bacteria 760
1545 Ga0501317_035520 3300049533 Bacteria 742
1546 Ga0501317_035891 3300049533 Bacteria 739
1547 Ga0501317_060080 3300049533 Bacteria 622
1548 Ga0501317_091219 3300049533 Bacteria 539
1549 Ga0501318_006518 3300049534 Bacteria 1194
1550 Ga0501318_007966 3300049534 Bacteria 1121
1551 Ga0501318_015573 3300049534 Bacteria 910
1552 Ga0501318_019001 3300049534 Bacteria 854
1553 Ga0501318_035644 3300049534 Bacteria 694
1554 Ga0501318_036325 3300049534 Bacteria 689
1555 Ga0501318_039564 3300049534 Bacteria 670
1556 Ga0501318_062985 3300049534 Bacteria 573
1557 Ga0501319_028954 3300049535 Bacteria 527
1558 Ga0501319_030300 3300049535 Bacteria 518
1559 Ga0501320_007576 3300049536 Bacteria 1048
1560 Ga0501320_021758 3300049536 Bacteria 747
1561 Ga0501320_025692 3300049536 Bacteria 707
1562 Ga0501321_005376 3300049537 Bacteria 1263
1563 Ga0501321_006089 3300049537 Bacteria 1215
1564 Ga0501321_011349 3300049537 Bacteria 992
1565 Ga0501321_032616 3300049537 Bacteria 703
1566 Ga0501321_071318 3300049537 Bacteria 541
1567 Ga0501322_003101 3300049538 Bacteria 1060
1568 Ga0501322_003822 3300049538 Bacteria 991
1569 Ga0501322_026028 3300049538 Bacteria 535
1570 Ga0501322_028331 3300049538 Bacteria 520
1571 Ga0501323_015893 3300049539 Bacteria 954
1572 Ga0501323_054118 3300049539 Bacteria 615
1573 Ga0501323_057741 3300049539 Bacteria 601
1574 Ga0501324_007233 3300049540 Bacteria 954
1575 Ga0501324_007721 3300049540 Bacteria 934
1576 Ga0501324_009100 3300049540 Bacteria 886
1577 Ga0501324_023054 3300049540 Bacteria 647
1578 Ga0501325_003288 3300049541 Bacteria 1168
1579 Ga0501325_006900 3300049541 Bacteria 948
1580 Ga0501325_057322 3300049541 Bacteria 508
1581 Ga0501333_018596 3300049549 Bacteria 544
1582 Ga0501340_022122 3300049556 Bacteria 539
1583 Ga0501031_0018443 3300049568 Bacteria 4540
1584 Ga0501031_0056846 3300049568 Bacteria 2549
1585 Ga0501031_0079126 3300049568 Bacteria 2142
1586 Ga0501031_0091990 3300049568 Bacteria 1979
1587 Ga0501031_0125152 3300049568 Bacteria 1679
1588 Ga0501032_0106821 3300049569 Bacteria 1854
1589 Ga0501032_0309537 3300049569 Bacteria 1020
1590 Ga0501033_0030645 3300049570 Bacteria 4041
1591 Ga0501033_0667054 3300049570 Bacteria 709
1592 Ga0501034_0013302 3300049571 Bacteria 8480
1593 Ga0501034_1254483 3300049571 Bacteria 619
1594 Ga0501036_0011799 3300049572 Bacteria 7242
1595 Ga0501036_0043720 3300049572 Bacteria 3794
1596 Ga0501036_0140325 3300049572 Bacteria 2039
1597 Ga0501037_0073699 3300049573 Bacteria 2482
1598 Ga0501037_0099230 3300049573 Bacteria 2103
1599 Ga0501037_0319474 3300049573 Bacteria 1075
1600 Ga0501037_0402308 3300049573 Bacteria 939
1601 Ga0501037_0418991 3300049573 Bacteria 917
1602 Ga0501038_0007476 3300049574 Bacteria 10078
1603 Ga0501038_0025207 3300049574 Bacteria 5301
1604 Ga0501038_0390664 3300049574 Bacteria 1078
1605 Ga0501039_0003111 3300049575 Bacteria 12404
1606 Ga0501039_0037432 3300049575 Bacteria 3744
1607 Ga0501039_0045870 3300049575 Bacteria 3377
1608 Ga0501039_0345782 3300049575 Bacteria 1169
1609 Ga0501039_0523985 3300049575 Bacteria 930
1610 Ga0501040_0010782 3300049576 Bacteria 5973
1611 Ga0501040_0022834 3300049576 Bacteria 4192
1612 Ga0501040_0028056 3300049576 Bacteria 3793
1613 Ga0501040_0031230 3300049576 Bacteria 3598
1614 Ga0501041_0016110 3300049577 Bacteria 4439
1615 Ga0501041_0018859 3300049577 Bacteria 4109
1616 Ga0501041_0105568 3300049577 Bacteria 1746
1617 Ga0501041_0931405 3300049577 Bacteria 558
1618 Ga0501042_0000760 3300049578 Bacteria 17549
1619 Ga0501042_0001973 3300049578 Bacteria 12360
1620 Ga0501042_0008755 3300049578 Bacteria 6710
1621 Ga0501042_0222342 3300049578 Bacteria 1362
1622 Ga0501042_1205579 3300049578 Bacteria 552
1623 Ga0501043_0007270 3300049579 Bacteria 8791
1624 Ga0501043_0092816 3300049579 Bacteria 2373
1625 Ga0501043_0857184 3300049579 Bacteria 654
1626 Ga0501043_0901924 3300049579 Bacteria 634
1627 Ga0501046_0002518 3300049580 Bacteria 17153
1628 Ga0501047_0007134 3300049581 Bacteria 10497
1629 Ga0501047_0386171 3300049581 Bacteria 1234
1630 Ga0501048_0000773 3300049582 Bacteria 23433
1631 Ga0501048_0005324 3300049582 Bacteria 9795
1632 Ga0501048_0009642 3300049582 Bacteria 7245
1633 Ga0501048_0140593 3300049582 Bacteria 1707
1634 Ga0501048_0544741 3300049582 Bacteria 832
1635 Ga0501048_0821024 3300049582 Bacteria 668
1636 Ga0501068_0268265 3300049584 Bacteria 1090
1637 Ga0501069_0054768 3300049585 Bacteria 2221
1638 Ga0501069_0073955 3300049585 Bacteria 1911
1639 Ga0501069_0117562 3300049585 Bacteria 1517
1640 Ga0501069_0429465 3300049585 Bacteria 784
1641 Ga0501070_0005342 3300049586 Bacteria 10957
1642 Ga0501070_0007227 3300049586 Bacteria 9429
1643 Ga0501070_0022496 3300049586 Bacteria 5280
1644 Ga0501070_0177912 3300049586 Bacteria 1751
1645 Ga0501070_0329385 3300049586 Bacteria 1241
1646 Ga0501070_0469399 3300049586 Bacteria 1013
1647 Ga0501070_0799125 3300049586 Bacteria 741
1648 Ga0501070_1196765 3300049586 Bacteria 583
1649 Ga0501070_1477125 3300049586 Bacteria 515
1650 Ga0501070_1493014 3300049586 Bacteria 512
1651 Ga0501071_0009752 3300049587 Bacteria 6407
1652 Ga0501071_0031864 3300049587 Bacteria 3740
1653 Ga0501071_0158485 3300049587 Bacteria 1691
1654 Ga0501071_0170141 3300049587 Bacteria 1631
1655 Ga0501071_0655328 3300049587 Bacteria 808
1656 Ga0501072_0028390 3300049588 Bacteria 4369
1657 Ga0501072_1498787 3300049588 Bacteria 521
1658 Ga0501073_0089752 3300049589 Bacteria 2137
1659 Ga0501073_0256193 3300049589 Bacteria 1208
1660 Ga0501073_0468976 3300049589 Bacteria 870
1661 Ga0501073_0518400 3300049589 Bacteria 824
1662 Ga0501073_0644000 3300049589 Bacteria 732
1663 Ga0501074_0001689 3300049590 Bacteria 15028
1664 Ga0501074_0012879 3300049590 Bacteria 6082
1665 Ga0501074_0013279 3300049590 Bacteria 5989
1666 Ga0501074_0024804 3300049590 Bacteria 4356
1667 Ga0501074_0227657 3300049590 Bacteria 1327
1668 Ga0501074_0314721 3300049590 Bacteria 1112
1669 Ga0501074_0631874 3300049590 Bacteria 757
1670 Ga0501074_0749296 3300049590 Bacteria 689
1671 Ga0501074_1288514 3300049590 Bacteria 512
1672 Ga0501075_0026360 3300049591 Bacteria 4278
1673 Ga0501075_0067655 3300049591 Bacteria 2697
1674 Ga0501075_0532538 3300049591 Bacteria 896
1675 Ga0501075_0824971 3300049591 Bacteria 706
1676 Ga0501076_0002612 3300049592 Bacteria 12405
1677 Ga0501076_0003546 3300049592 Bacteria 10966
1678 Ga0501076_0086651 3300049592 Bacteria 2517
1679 Ga0501077_0003884 3300049593 Bacteria 8998
1680 Ga0501202_018845 3300049652 Bacteria 1359
1681 Ga0501206_097335 3300049653 Bacteria 530
1682 Ga0501242_065667 3300049674 Bacteria 560
1683 Ga0501225_0256882 3300049705 Bacteria 577
1684 Ga0501079_0029582 3300049741 Bacteria 4206
1685 Ga0501079_0052326 3300049741 Bacteria 3151
1686 Ga0501079_0370600 3300049741 Bacteria 1122
1687 Ga0501079_0650803 3300049741 Bacteria 830
1688 Ga0501079_0893503 3300049741 Bacteria 700
1689 Ga0501079_1037049 3300049741 Bacteria 646
1690 Ga0501080_0037276 3300049742 Bacteria 4540
1691 Ga0501080_0059585 3300049742 Bacteria 3552
1692 Ga0501080_0097264 3300049742 Bacteria 2733
1693 Ga0501080_0423395 3300049742 Bacteria 1196
1694 Ga0501080_1784946 3300049742 Bacteria 517
1695 Ga0501081_0006710 3300049743 Bacteria 7485
1696 Ga0501081_0322063 3300049743 Bacteria 1136
1697 Ga0501081_0589611 3300049743 Bacteria 832
1698 Ga0501081_1444800 3300049743 Bacteria 522
1699 Ga0501035_0066327 3300049822 Bacteria 3203
1700 Ga0501035_0177968 3300049822 Bacteria 1834
1701 Ga0501035_0283806 3300049822 Bacteria 1399
1702 Ga0501035_0289133 3300049822 Bacteria 1383
1703 Ga0501035_1076409 3300049822 Bacteria 629
1704 Ga0501044_0027438 3300049823 Bacteria 6019
1705 Ga0501044_0127867 3300049823 Bacteria 2537
1706 Ga0501044_0140509 3300049823 Bacteria 2404
1707 Ga0501044_0234054 3300049823 Bacteria 1783
1708 Ga0501044_0894249 3300049823 Bacteria 763
1709 Ga0501044_1381444 3300049823 Bacteria 570
1710 Ga0501045_0014824 3300049824 Bacteria 5528
1711 Ga0501045_0016664 3300049824 Bacteria 5220
1712 Ga0501045_0308702 3300049824 Bacteria 1177
1713 Ga0501045_1124352 3300049824 Bacteria 574
1714 nmdc:mga0yw44_103203_c1 3300050492 Bacteria 1818
1715 nmdc:mga0yw44_609027_c1 3300050492 Bacteria 742
1716 nmdc:mga0yw44_880752_c1 3300050492 Bacteria 607
1717 nmdc:mga05p37_934_c1 3300050507 Bacteria 32898
1718 nmdc:mga09592_241_c1 3300050508 Bacteria 39617
1719 nmdc:mga0qj67_4073_c1 3300050509 Bacteria 10603
1720 nmdc:mga06r32_283_c1 3300050510 Bacteria 42355
1721 nmdc:mga06r32_5722_c1 3300050510 Bacteria 11194
1722 nmdc:mga08y16_1833589_c1 3300050511 Bacteria 559
1723 nmdc:mga08y16_474525_c1 3300050511 Bacteria 1273
1724 nmdc:mga08y16_6314_c1 3300050511 Bacteria 12429
1725 nmdc:mga0n895_194027_c1 3300050512 Bacteria 2062
1726 nmdc:mga0n895_2159087_c1 3300050512 Bacteria 513
1727 nmdc:mga0rr50_1563603_c1 3300050513 Bacteria 557
1728 nmdc:mga0rr50_202812_c1 3300050513 Bacteria 1630
1729 nmdc:mga0rr50_713024_c1 3300050513 Bacteria 856
1730 nmdc:mga0rr50_812381_c1 3300050513 Bacteria 798
1731 nmdc:mga08x19_288167_c1 3300050514 Bacteria 1139
1732 nmdc:mga08x19_318293_c1 3300050514 Bacteria 1082
1733 nmdc:mga08x19_487253_c1 3300050514 Bacteria 870
1734 Ga0495601_0005798 3300053077 Bacteria 7199
1735 Ga0495601_0926941 3300053077 Bacteria 549
1736 Ga0495601_1055450 3300053077 Bacteria 509
1737 Ga0495612_0067698 3300053078 Bacteria 1485
1738 Ga0495612_0355308 3300053078 Bacteria 662
1739 Ga0495595_0056129 3300053084 Bacteria 1835
1740 Ga0495595_0073097 3300053084 Bacteria 1623
1741 Ga0495595_0081867 3300053084 Bacteria 1539
1742 Ga0495595_0115594 3300053084 Bacteria 1304
1743 Ga0495619_0005002 3300053085 Bacteria 8418
1744 Ga0495619_0064065 3300053085 Bacteria 2450
1745 Ga0495619_0090021 3300053085 Bacteria 2077
1746 Ga0495619_0335862 3300053085 Bacteria 1046
1747 Ga0495619_1076932 3300053085 Bacteria 535
1748 Ga0500641_0113799 3300053096 Bacteria 1165
1749 Ga0500568_0115591 3300053139 Bacteria 1001
1750 Ga0500620_047352 3300053155 Bacteria 1431
1751 Ga0500587_038060 3300053739 Bacteria 681
1752 Ga0501084_0058250 3300054114 Bacteria 3232
1753 Ga0501084_0180999 3300054114 Bacteria 1779
1754 Ga0501084_1598358 3300054114 Bacteria 545
1755 Ga0501082_0003303 3300060353 Bacteria 14077
1756 Ga0501082_0524829 3300060353 Bacteria 1035
1757 Ga0501082_0772059 3300060353 Bacteria 841
1758 Ga0466962_0003253 3300061719 Bacteria 7717
1759 Ga0466962_0018364 3300061719 Bacteria 3364
1760 Ga0466962_0028220 3300061719 Bacteria 2689
1761 Ga0466962_0101024 3300061719 Bacteria 1385
1762 Ga0466962_0187474 3300061719 Bacteria 1009
1763 Ga0466962_0585183 3300061719 Bacteria 568
1764 Ga0466962_0591031 3300061719 Bacteria 565
1765 Ga0466962_0610545 3300061719 Bacteria 556
1766 Ga0466962_0641460 3300061719 Bacteria 543
1767 Ga0530510_0006437 3300061734 Bacteria 8181
1768 Ga0530510_0766047 3300061734 Bacteria 736
1769 Ga0530510_0883080 3300061734 Bacteria 683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030760 Ga0265762_1069869 Ga0265762_10698692 69
2 3300025917 Ga0207660_10647622 Ga0207660_106476222 70
3 3300025940 Ga0207691_11376008 Ga0207691_113760081 71
4 3300045976 Ga0466967_0047621 Ga0466967_0047621_2746_2967 73
5 3300061719 Ga0466962_0641460 Ga0466962_0641460_29_250 73
6 3300003373 JGI25407J50210_10001000 JGI25407J50210_100010003 74
7 3300005339 Ga0070660_100867520 Ga0070660_1008675201 74
8 3300005563 Ga0068855_100727731 Ga0068855_1007277311 74
9 3300005614 Ga0068856_102644804 Ga0068856_1026448042 74
10 3300005981 Ga0081538_10000156 Ga0081538_1000015676 74
11 3300009093 Ga0105240_10898614 Ga0105240_108986142 74
12 3300009551 Ga0105238_10317211 Ga0105238_103172113 74
13 3300013102 Ga0157371_11128032 Ga0157371_111280322 74
14 3300014968 Ga0157379_11878224 Ga0157379_118782241 74
15 3300025913 Ga0207695_11049236 Ga0207695_110492361 74
16 3300025919 Ga0207657_10575228 Ga0207657_105752282 74
17 3300025924 Ga0207694_10221496 Ga0207694_102214963 74
18 3300025949 Ga0207667_11902518 Ga0207667_119025182 74
19 3300026078 Ga0207702_11982367 Ga0207702_119823672 74
20 3300026121 Ga0207683_10301171 Ga0207683_103011712 74
21 3300028379 Ga0268266_10960969 Ga0268266_109609692 74
22 3300044684 Ga0466966_0730503 Ga0466966_0730503_182_418 74
23 3300044693 Ga0466961_0295957 Ga0466961_0295957_249_473 74
24 3300044694 Ga0466963_0070759 Ga0466963_0070759_2045_2269 74
25 3300044694 Ga0466963_0367807 Ga0466963_0367807_690_914 74
26 3300044719 Ga0466971_0014156 Ga0466971_0014156_1904_2128 74
27 3300044735 Ga0466968_0116639 Ga0466968_0116639_139_363 74
28 3300044842 Ga0466957_0016967 Ga0466957_0016967_3136_3360 74
29 3300045836 Ga0466958_0001921 Ga0466958_0001921_3423_3647 74
30 3300045976 Ga0466967_0069729 Ga0466967_0069729_1312_1536 74
31 3300045976 Ga0466967_0133975 Ga0466967_0133975_1030_1254 74
32 3300045976 Ga0466967_0651071 Ga0466967_0651071_611_835 74
33 3300049586 Ga0501070_0005342 Ga0501070_0005342_769_1020 74
34 3300049586 Ga0501070_1493014 Ga0501070_1493014_10_243 74
35 3300049590 Ga0501074_0227657 Ga0501074_0227657_45_296 74
36 3300049823 Ga0501044_0894249 Ga0501044_0894249_499_750 74
37 3300061719 Ga0466962_0018364 Ga0466962_0018364_210_434 74
38 iso_pu_bacteria 2643221690 2644506614 74
39 iso_pu_bacteria 2643221694 2644526474 74
40 iso_pu_bacteria 2643221722 2644671140 74
41 iso_pu_bacteria 2728369276 2729905601 74
42 iso_pu_bacteria 2738541272 2738692496 74
43 iso_pu_bacteria 2738543027 2739323586 74
44 iso_pu_bacteria 2739367654 2739608938 74
45 iso_pu_bacteria 2758568522 2760303611 74
46 iso_pu_bacteria 2758568621 2760622530 74
47 iso_pu_bacteria 2808606394 2809027275 74
48 iso_pu_bacteria 2839986021 2839989289 74
49 iso_pu_bacteria 2932431166 2932434625 74
50 iso_pu_bacteria 8056579771 8056584016 74
51 iso_pu_bacteria 2554235005 2554256031 75
52 iso_pu_bacteria 2582581312 2585297454 75
53 iso_pu_bacteria 2616644941 2616903781 75
54 iso_pu_bacteria 2643221548 2643761511 75
55 iso_pu_bacteria 2643221587 2643943658 75
56 iso_pu_bacteria 2643221601 2644015892 75
57 iso_pu_bacteria 2643221631 2644176427 75
58 iso_pu_bacteria 2643221670 2644387136 75
59 iso_pu_bacteria 2643221677 2644434083 75
60 iso_pu_bacteria 2643221682 2644458787 75
61 iso_pu_bacteria 2791355406 2793977140 75
62 iso_pu_bacteria 2808606365 2808873435 75
63 iso_pu_bacteria 2808606982 2811844143 75
64 iso_pu_bacteria 2818991318 2819426815 75
65 iso_pu_bacteria 2818991463 2819698960 75
66 iso_pu_bacteria 2848551377 2848551828 75
67 iso_pu_bacteria 2856741275 2856744351 75
68 iso_pu_bacteria 2862178590 2862181767 75
69 iso_pu_bacteria 2862290372 2862292301 75
70 iso_pu_bacteria 2862574272 2862577240 75
71 iso_pu_bacteria 2873151551 2873153832 75
72 iso_pu_bacteria 2873314349 2873321546 75
73 iso_pu_bacteria 2891395885 2891400906 75
74 iso_pu_bacteria 2891554331 2891558582 75
75 iso_pu_bacteria 2891562705 2891569210 75
76 iso_pu_bacteria 2912723979 2912729932 75
77 iso_pu_bacteria 2919446982 2919449722 75
78 iso_pu_bacteria 2966598605 2966600616 75
79 iso_pu_bacteria 3001889506 3001890956 75
80 iso_pu_bacteria 8047893842 8047895832 75
81 iso_pu_bacteria 8048356638 8048363102 75
82 iso_pu_bacteria 8048369669 8048372856 75
83 iso_pu_bacteria 8048379754 8048381790 75
84 iso_pu_bacteria 8055066027 8055073234 75
85 iso_pu_bacteria 8055172936 8055173680 75
86 3300013306 Ga0163162_11200102 Ga0163162_112001022 76
87 iso_pu_bacteria 2855386786 2855387617 76
88 3300005334 Ga0068869_100403521 Ga0068869_1004035212 77
89 3300005337 Ga0070682_100418554 Ga0070682_1004185542 77
90 3300005337 Ga0070682_100544045 Ga0070682_1005440452 77
91 3300005338 Ga0068868_101248586 Ga0068868_1012485861 77
92 3300005338 Ga0068868_102171389 Ga0068868_1021713892 77
93 3300005343 Ga0070687_100805480 Ga0070687_1008054802 77
94 3300005347 Ga0070668_101916412 Ga0070668_1019164122 77
95 3300005354 Ga0070675_101902367 Ga0070675_1019023672 77
96 3300005356 Ga0070674_100261489 Ga0070674_1002614893 77
97 3300005367 Ga0070667_101324242 Ga0070667_1013242422 77
98 3300005455 Ga0070663_100034319 Ga0070663_1000343192 77
99 3300005539 Ga0068853_101293359 Ga0068853_1012933592 77
100 3300005543 Ga0070672_102046914 Ga0070672_1020469142 77
101 3300005548 Ga0070665_101251061 Ga0070665_1012510612 77
102 3300005548 Ga0070665_101993615 Ga0070665_1019936152 77
103 3300005614 Ga0068856_101987539 Ga0068856_1019875392 77
104 3300005614 Ga0068856_102612852 Ga0068856_1026128521 77
105 3300005615 Ga0070702_100785237 Ga0070702_1007852372 77
106 3300005617 Ga0068859_102441837 Ga0068859_1024418372 77
107 3300005618 Ga0068864_101933837 Ga0068864_1019338372 77
108 3300005718 Ga0068866_10543705 Ga0068866_105437052 77
109 3300005834 Ga0068851_10149924 Ga0068851_101499242 77
110 3300005834 Ga0068851_10690007 Ga0068851_106900071 77
111 3300005842 Ga0068858_102042614 Ga0068858_1020426142 77
112 3300006173 Ga0070716_101143342 Ga0070716_1011433422 77
113 3300006237 Ga0097621_100357889 Ga0097621_1003578892 77
114 3300006358 Ga0068871_101654676 Ga0068871_1016546762 77
115 3300006931 Ga0097620_102442641 Ga0097620_1024426412 77
116 3300009098 Ga0105245_10058568 Ga0105245_100585685 77
117 3300009098 Ga0105245_10418683 Ga0105245_104186833 77
118 3300009101 Ga0105247_11651907 Ga0105247_116519071 77
119 3300009174 Ga0105241_11263129 Ga0105241_112631292 77
120 3300009176 Ga0105242_11322351 Ga0105242_113223512 77
121 3300009177 Ga0105248_10649446 Ga0105248_106494461 77
122 3300009177 Ga0105248_12382544 Ga0105248_123825442 77
123 3300009553 Ga0105249_10410671 Ga0105249_104106713 77
124 3300009993 Ga0105028_114948 Ga0105028_1149482 77
125 3300013105 Ga0157369_11247764 Ga0157369_112477642 77
126 3300013105 Ga0157369_12178061 Ga0157369_121780612 77
127 3300013296 Ga0157374_10167931 Ga0157374_101679314 77
128 3300013297 Ga0157378_10545471 Ga0157378_105454713 77
129 3300013306 Ga0163162_10645873 Ga0163162_106458731 77
130 3300013306 Ga0163162_13380748 Ga0163162_133807482 77
131 3300013307 Ga0157372_10926630 Ga0157372_109266302 77
132 3300013307 Ga0157372_11125833 Ga0157372_111258332 77
133 3300013308 Ga0157375_10336494 Ga0157375_103364943 77
134 3300013308 Ga0157375_11567124 Ga0157375_115671241 77
135 3300014325 Ga0163163_10499576 Ga0163163_104995762 77
136 3300014325 Ga0163163_10767719 Ga0163163_107677192 77
137 3300014325 Ga0163163_11189736 Ga0163163_111897362 77
138 3300014326 Ga0157380_12505349 Ga0157380_125053491 77
139 3300014745 Ga0157377_11352686 Ga0157377_113526862 77
140 3300017792 Ga0163161_10136498 Ga0163161_101364982 77
141 3300020078 Ga0206352_10716620 Ga0206352_107166202 77
142 3300025899 Ga0207642_10494133 Ga0207642_104941331 77
143 3300025901 Ga0207688_10158653 Ga0207688_101586533 77
144 3300025901 Ga0207688_10557129 Ga0207688_105571292 77
145 3300025901 Ga0207688_11040995 Ga0207688_110409952 77
146 3300025917 Ga0207660_10823849 Ga0207660_108238492 77
147 3300025918 Ga0207662_10159916 Ga0207662_101599162 77
148 3300025925 Ga0207650_11069097 Ga0207650_110690971 77
149 3300025927 Ga0207687_10196095 Ga0207687_101960953 77
150 3300025927 Ga0207687_10733421 Ga0207687_107334212 77
151 3300025927 Ga0207687_11618749 Ga0207687_116187492 77
152 3300025934 Ga0207686_10286433 Ga0207686_102864332 77
153 3300025935 Ga0207709_10727133 Ga0207709_107271332 77
154 3300025938 Ga0207704_10243846 Ga0207704_102438462 77
155 3300025939 Ga0207665_11077447 Ga0207665_110774472 77
156 3300025940 Ga0207691_11028536 Ga0207691_110285362 77
157 3300025941 Ga0207711_11868747 Ga0207711_118687472 77
158 3300025942 Ga0207689_10826497 Ga0207689_108264972 77
159 3300026023 Ga0207677_10692215 Ga0207677_106922153 77
160 3300026023 Ga0207677_10878008 Ga0207677_108780082 77
161 3300026067 Ga0207678_10449839 Ga0207678_104498392 77
162 3300026067 Ga0207678_10577081 Ga0207678_105770812 77
163 3300026088 Ga0207641_10322775 Ga0207641_103227752 77
164 3300026089 Ga0207648_10535224 Ga0207648_105352243 77
165 3300026118 Ga0207675_102167295 Ga0207675_1021672952 77
166 3300026121 Ga0207683_10345388 Ga0207683_103453882 77
167 3300028381 Ga0268264_10493157 Ga0268264_104931573 77
168 3300031727 Ga0316576_10002441 Ga0316576_1000244110 77
169 3300031727 Ga0316576_10101633 Ga0316576_101016333 77
170 3300031728 Ga0316578_10077915 Ga0316578_100779153 77
171 3300031728 Ga0316578_10593650 Ga0316578_105936502 77
172 3300031733 Ga0316577_10622184 Ga0316577_106221842 77
173 3300031901 Ga0307406_11191447 Ga0307406_111914472 77
174 3300032168 Ga0316593_10029265 Ga0316593_100292653 77
175 3300032168 Ga0316593_10039697 Ga0316593_100396972 77
176 3300033524 Ga0316592_1038181 Ga0316592_10381812 77
177 3300033524 Ga0316592_1040830 Ga0316592_10408302 77
178 3300033528 Ga0316588_1141850 Ga0316588_11418502 77
179 3300033528 Ga0316588_1179551 Ga0316588_11795512 77
180 3300033541 Ga0316596_1072706 Ga0316596_10727062 77
181 3300035088 Ga0373940_0327806 Ga0373940_0327806_123_362 77
182 3300035092 Ga0373952_0188355 Ga0373952_0188355_159_398 77
183 3300036647 Ga0316582_0790934 Ga0316582_0790934_282_521 77
184 3300036712 Ga0316584_0448546 Ga0316584_0448546_288_527 77
185 3300041443 Ga0451789_1006507 Ga0451789_1006507_273_512 77
186 3300041451 Ga0451791_0654865 Ga0451791_0654865_198_437 77
187 3300041452 Ga0451793_0144127 Ga0451793_0144127_149_382 77
188 3300041452 Ga0451793_0423370 Ga0451793_0423370_15658_15897 77
189 3300041453 Ga0451797_1404612 Ga0451797_1404612_610_849 77
190 3300041456 Ga0451795_0078095 Ga0451795_0078095_186_425 77
191 3300041458 Ga0451798_0554323 Ga0451798_0554323_22_261 77
192 3300041460 Ga0451802_1025007 Ga0451802_1025007_232_471 77
193 3300041492 Ga0451835_0881598 Ga0451835_0881598_421_654 77
194 3300041494 Ga0451837_0111929 Ga0451837_0111929_386_625 77
195 3300041496 Ga0451839_1490633 Ga0451839_1490633_75_314 77
196 3300041498 Ga0451841_0024026 Ga0451841_0024026_368_607 77
197 3300041505 Ga0451849_0563512 Ga0451849_0563512_365_604 77
198 3300041509 Ga0451843_0958715 Ga0451843_0958715_1067_1306 77
199 3300041512 Ga0451853_1486237 Ga0451853_1486237_2471_2710 77
200 3300046455 Ga0495603_0390619 Ga0495603_0390619_41_280 77
201 3300046461 Ga0495641_0111128 Ga0495641_0111128_532_765 77
202 3300046463 Ga0495653_0566802 Ga0495653_0566802_159_398 77
203 3300046463 Ga0495653_0613389 Ga0495653_0613389_417_650 77
204 3300046473 Ga0495582_0597047 Ga0495582_0597047_294_533 77
205 3300046476 Ga0495662_0166030 Ga0495662_0166030_11_250 77
206 3300046477 Ga0495664_0676626 Ga0495664_0676626_73_312 77
207 3300046511 Ga0495608_0162326 Ga0495608_0162326_562_801 77
208 3300046511 Ga0495608_0706270 Ga0495608_0706270_25_258 77
209 3300046531 Ga0495665_0404124 Ga0495665_0404124_400_633 77
210 3300046531 Ga0495665_0422101 Ga0495665_0422101_299_538 77
211 3300046533 Ga0495640_0718440 Ga0495640_0718440_336_575 77
212 3300046642 Ga0495634_0324227 Ga0495634_0324227_675_914 77
213 3300046674 Ga0495588_0228027 Ga0495588_0228027_113_352 77
214 3300046679 Ga0495623_0272867 Ga0495623_0272867_652_885 77
215 3300046680 Ga0495646_0669293 Ga0495646_0669293_79_312 77
216 3300046681 Ga0495647_0350825 Ga0495647_0350825_123_362 77
217 3300046683 Ga0495658_0103659 Ga0495658_0103659_385_624 77
218 3300047315 Ga0495581_0715006 Ga0495581_0715006_38_277 77
219 3300047319 Ga0495674_0844406 Ga0495674_0844406_372_605 77
220 3300047321 Ga0495676_1012517 Ga0495676_1012517_235_474 77
221 3300047472 Ga0495686_0140397 Ga0495686_0140397_663_899 77
222 3300047673 Ga0495593_0368254 Ga0495593_0368254_114_353 77
223 3300048088 Ga0495602_0497986 Ga0495602_0497986_194_427 77
224 3300048090 Ga0495615_0065999 Ga0495615_0065999_585_824 77
225 3300048903 Ga0496100_0325405 Ga0496100_0325405_892_1131 77
226 3300048903 Ga0496100_0473245 Ga0496100_0473245_174_413 77
227 3300048903 Ga0496100_1601104 Ga0496100_1601104_12_254 77
228 3300048905 Ga0496102_0056942 Ga0496102_0056942_79_318 77
229 3300048905 Ga0496102_0143314 Ga0496102_0143314_783_1022 77
230 3300048905 Ga0496102_0408201 Ga0496102_0408201_313_552 77
231 3300048906 Ga0496103_0425225 Ga0496103_0425225_581_820 77
232 3300048907 Ga0496104_0017502 Ga0496104_0017502_4120_4359 77
233 3300048907 Ga0496104_1170781 Ga0496104_1170781_228_467 77
234 3300048908 Ga0496105_0034279 Ga0496105_0034279_3908_4147 77
235 3300048908 Ga0496105_0431835 Ga0496105_0431835_55_294 77
236 3300048909 Ga0496106_0578881 Ga0496106_0578881_125_364 77
237 3300048909 Ga0496106_1102481 Ga0496106_1102481_207_446 77
238 3300048910 Ga0496107_0685383 Ga0496107_0685383_66_305 77
239 3300048911 Ga0496108_0005787 Ga0496108_0005787_1945_2184 77
240 3300048911 Ga0496108_0348371 Ga0496108_0348371_140_379 77
241 3300048911 Ga0496108_0527723 Ga0496108_0527723_281_514 77
242 3300048911 Ga0496108_0853965 Ga0496108_0853965_514_753 77
243 3300048912 Ga0496109_0078536 Ga0496109_0078536_1485_1724 77
244 3300048912 Ga0496109_1592761 Ga0496109_1592761_56_295 77
245 3300048913 Ga0496110_0006310 Ga0496110_0006310_1615_1854 77
246 3300048913 Ga0496110_0920458 Ga0496110_0920458_143_376 77
247 3300048914 Ga0496111_0002234 Ga0496111_0002234_1792_2031 77
248 3300048915 Ga0496112_0233193 Ga0496112_0233193_1505_1744 77
249 3300048916 Ga0496113_0193378 Ga0496113_0193378_885_1124 77
250 3300048917 Ga0496114_0002509 Ga0496114_0002509_3809_4042 77
251 3300048917 Ga0496114_0390435 Ga0496114_0390435_298_537 77
252 3300048917 Ga0496114_0443620 Ga0496114_0443620_107_346 77
253 3300048917 Ga0496114_0556208 Ga0496114_0556208_159_401 77
254 3300048917 Ga0496114_1386151 Ga0496114_1386151_157_390 77
255 3300048917 Ga0496114_1431978 Ga0496114_1431978_280_519 77
256 3300048917 Ga0496114_1559761 Ga0496114_1559761_222_455 77
257 3300048918 Ga0496115_1138366 Ga0496115_1138366_142_381 77
258 3300048926 Ga0496123_0123539 Ga0496123_0123539_602_838 77
259 3300048927 Ga0496124_0770751 Ga0496124_0770751_143_382 77
260 3300053078 Ga0495612_0355308 Ga0495612_0355308_127_366 77
261 3300053084 Ga0495595_0115594 Ga0495595_0115594_420_659 77
262 3300005327 Ga0070658_10370562 Ga0070658_103705622 78
263 3300005329 Ga0070683_100519773 Ga0070683_1005197732 78
264 3300005336 Ga0070680_100511432 Ga0070680_1005114322 78
265 3300005338 Ga0068868_101297454 Ga0068868_1012974542 78
266 3300005344 Ga0070661_100854966 Ga0070661_1008549662 78
267 3300005345 Ga0070692_10216951 Ga0070692_102169511 78
268 3300005347 Ga0070668_101691198 Ga0070668_1016911981 78
269 3300005355 Ga0070671_101482929 Ga0070671_1014829292 78
270 3300005364 Ga0070673_101893203 Ga0070673_1018932032 78
271 3300005366 Ga0070659_101811214 Ga0070659_1018112141 78
272 3300005435 Ga0070714_100258685 Ga0070714_1002586853 78
273 3300005435 Ga0070714_100385589 Ga0070714_1003855891 78
274 3300005435 Ga0070714_100557363 Ga0070714_1005573632 78
275 3300005435 Ga0070714_102419933 Ga0070714_1024199332 78
276 3300005439 Ga0070711_100587626 Ga0070711_1005876262 78
277 3300005441 Ga0070700_101334162 Ga0070700_1013341621 78
278 3300005441 Ga0070700_101980121 Ga0070700_1019801211 78
279 3300005455 Ga0070663_100447898 Ga0070663_1004478982 78
280 3300005457 Ga0070662_101705621 Ga0070662_1017056212 78
281 3300005458 Ga0070681_10285854 Ga0070681_102858543 78
282 3300005530 Ga0070679_100455734 Ga0070679_1004557342 78
283 3300005535 Ga0070684_101194923 Ga0070684_1011949232 78
284 3300005539 Ga0068853_101872684 Ga0068853_1018726841 78
285 3300005543 Ga0070672_101166800 Ga0070672_1011668002 78
286 3300005548 Ga0070665_100934457 Ga0070665_1009344572 78
287 3300005548 Ga0070665_101014715 Ga0070665_1010147151 78
288 3300005563 Ga0068855_100020818 Ga0068855_10002081810 78
289 3300005563 Ga0068855_100317844 Ga0068855_1003178442 78
290 3300005564 Ga0070664_100756686 Ga0070664_1007566862 78
291 3300005577 Ga0068857_100825643 Ga0068857_1008256432 78
292 3300005614 Ga0068856_100149911 Ga0068856_1001499112 78
293 3300005614 Ga0068856_100236300 Ga0068856_1002363003 78
294 3300005614 Ga0068856_101641343 Ga0068856_1016413432 78
295 3300005615 Ga0070702_100059169 Ga0070702_1000591694 78
296 3300005616 Ga0068852_100037221 Ga0068852_1000372214 78
297 3300005834 Ga0068851_10911638 Ga0068851_109116382 78
298 3300006028 Ga0070717_10361770 Ga0070717_103617702 78
299 3300006028 Ga0070717_11961153 Ga0070717_119611532 78
300 3300006038 Ga0075365_10854134 Ga0075365_108541342 78
301 3300006175 Ga0070712_100880730 Ga0070712_1008807302 78
302 3300006353 Ga0075370_10335718 Ga0075370_103357183 78
303 3300009093 Ga0105240_10585110 Ga0105240_105851102 78
304 3300009093 Ga0105240_10824332 Ga0105240_108243322 78
305 3300009098 Ga0105245_10788387 Ga0105245_107883872 78
306 3300009098 Ga0105245_11439837 Ga0105245_114398372 78
307 3300009148 Ga0105243_12736907 Ga0105243_127369072 78
308 3300009176 Ga0105242_11933403 Ga0105242_119334032 78
309 3300009177 Ga0105248_10974510 Ga0105248_109745102 78
310 3300009177 Ga0105248_12740508 Ga0105248_127405082 78
311 3300009177 Ga0105248_13433905 Ga0105248_134339052 78
312 3300009545 Ga0105237_10110585 Ga0105237_101105853 78
313 3300009545 Ga0105237_10495605 Ga0105237_104956052 78
314 3300009551 Ga0105238_10673635 Ga0105238_106736353 78
315 3300009551 Ga0105238_12181192 Ga0105238_121811922 78
316 3300009553 Ga0105249_12010065 Ga0105249_120100652 78
317 3300010375 Ga0105239_10150145 Ga0105239_101501453 78
318 3300010375 Ga0105239_12135338 Ga0105239_121353382 78
319 3300011119 Ga0105246_10810555 Ga0105246_108105551 78
320 3300011119 Ga0105246_12131647 Ga0105246_121316472 78
321 3300013102 Ga0157371_11221387 Ga0157371_112213871 78
322 3300013104 Ga0157370_10164943 Ga0157370_101649433 78
323 3300013104 Ga0157370_10183307 Ga0157370_101833073 78
324 3300013104 Ga0157370_12025922 Ga0157370_120259222 78
325 3300013105 Ga0157369_10165905 Ga0157369_101659053 78
326 3300013105 Ga0157369_10969231 Ga0157369_109692312 78
327 3300013296 Ga0157374_10824825 Ga0157374_108248252 78
328 3300013296 Ga0157374_12839450 Ga0157374_128394501 78
329 3300013306 Ga0163162_10773324 Ga0163162_107733242 78
330 3300013306 Ga0163162_12510274 Ga0163162_125102742 78
331 3300013308 Ga0157375_10386074 Ga0157375_103860743 78
332 3300013308 Ga0157375_10433855 Ga0157375_104338552 78
333 3300013308 Ga0157375_10727864 Ga0157375_107278643 78
334 3300013308 Ga0157375_12467777 Ga0157375_124677771 78
335 3300014325 Ga0163163_10446364 Ga0163163_104463642 78
336 3300014325 Ga0163163_10790140 Ga0163163_107901401 78
337 3300014326 Ga0157380_11562862 Ga0157380_115628622 78
338 3300014326 Ga0157380_12237232 Ga0157380_122372321 78
339 3300014745 Ga0157377_10251284 Ga0157377_102512842 78
340 3300014968 Ga0157379_11096733 Ga0157379_110967332 78
341 3300014968 Ga0157379_12643410 Ga0157379_126434101 78
342 3300014969 Ga0157376_11677021 Ga0157376_116770212 78
343 3300014969 Ga0157376_11695806 Ga0157376_116958062 78
344 3300017792 Ga0163161_10393745 Ga0163161_103937452 78
345 3300020069 Ga0197907_10212106 Ga0197907_102121062 78
346 3300020069 Ga0197907_10564122 Ga0197907_105641222 78
347 3300020069 Ga0197907_11505362 Ga0197907_115053622 78
348 3300020070 Ga0206356_10742932 Ga0206356_107429321 78
349 3300020070 Ga0206356_11638757 Ga0206356_116387572 78
350 3300020075 Ga0206349_1041801 Ga0206349_10418012 78
351 3300020077 Ga0206351_10118548 Ga0206351_101185482 78
352 3300020077 Ga0206351_10934351 Ga0206351_109343512 78
353 3300020078 Ga0206352_10130022 Ga0206352_101300222 78
354 3300020078 Ga0206352_10419581 Ga0206352_104195811 78
355 3300020080 Ga0206350_10580633 Ga0206350_105806332 78
356 3300020081 Ga0206354_10067004 Ga0206354_100670042 78
357 3300020081 Ga0206354_10234352 Ga0206354_102343522 78
358 3300020081 Ga0206354_11404719 Ga0206354_114047191 78
359 3300020082 Ga0206353_10086586 Ga0206353_100865862 78
360 3300020082 Ga0206353_10750906 Ga0206353_107509062 78
361 3300020082 Ga0206353_10912418 Ga0206353_109124182 78
362 3300020082 Ga0206353_11892921 Ga0206353_118929212 78
363 3300020082 Ga0206353_11993930 Ga0206353_119939302 78
364 3300022467 Ga0224712_10214239 Ga0224712_102142392 78
365 3300022467 Ga0224712_10264915 Ga0224712_102649152 78
366 3300022467 Ga0224712_10315569 Ga0224712_103155692 78
367 3300025321 Ga0207656_10476639 Ga0207656_104766392 78
368 3300025911 Ga0207654_10226659 Ga0207654_102266592 78
369 3300025912 Ga0207707_10438196 Ga0207707_104381962 78
370 3300025913 Ga0207695_11101672 Ga0207695_111016721 78
371 3300025914 Ga0207671_10063722 Ga0207671_100637222 78
372 3300025915 Ga0207693_10698031 Ga0207693_106980312 78
373 3300025921 Ga0207652_10568555 Ga0207652_105685552 78
374 3300025921 Ga0207652_11465094 Ga0207652_114650941 78
375 3300025924 Ga0207694_11011442 Ga0207694_110114422 78
376 3300025927 Ga0207687_10497057 Ga0207687_104970572 78
377 3300025929 Ga0207664_10448603 Ga0207664_104486032 78
378 3300025929 Ga0207664_11554382 Ga0207664_115543822 78
379 3300025929 Ga0207664_11878107 Ga0207664_118781071 78
380 3300025933 Ga0207706_10757739 Ga0207706_107577392 78
381 3300025937 Ga0207669_10297721 Ga0207669_102977212 78
382 3300025941 Ga0207711_10850522 Ga0207711_108505222 78
383 3300025944 Ga0207661_10588787 Ga0207661_105887873 78
384 3300025944 Ga0207661_11024831 Ga0207661_110248312 78
385 3300025945 Ga0207679_11751532 Ga0207679_117515322 78
386 3300025949 Ga0207667_10103254 Ga0207667_101032543 78
387 3300025949 Ga0207667_11901925 Ga0207667_119019251 78
388 3300025972 Ga0207668_11230799 Ga0207668_112307992 78
389 3300025981 Ga0207640_11081184 Ga0207640_110811842 78
390 3300026041 Ga0207639_11043328 Ga0207639_110433282 78
391 3300026067 Ga0207678_10356363 Ga0207678_103563632 78
392 3300026067 Ga0207678_10518444 Ga0207678_105184442 78
393 3300026067 Ga0207678_11271338 Ga0207678_112713382 78
394 3300026067 Ga0207678_11336716 Ga0207678_113367162 78
395 3300026075 Ga0207708_10180362 Ga0207708_101803622 78
396 3300026078 Ga0207702_10097309 Ga0207702_100973093 78
397 3300026078 Ga0207702_11253947 Ga0207702_112539472 78
398 3300026089 Ga0207648_12263249 Ga0207648_122632492 78
399 3300026116 Ga0207674_10853440 Ga0207674_108534402 78
400 3300026121 Ga0207683_11080304 Ga0207683_110803042 78
401 3300026142 Ga0207698_10026848 Ga0207698_100268483 78
402 3300026142 Ga0207698_10659816 Ga0207698_106598162 78
403 3300028379 Ga0268266_11767160 Ga0268266_117671601 78
404 3300028380 Ga0268265_10413517 Ga0268265_104135171 78
405 3300030731 Ga0316177_1018223 Ga0316177_10182232 78
406 3300030732 Ga0316176_1007850 Ga0316176_10078503 78
407 3300030734 Ga0316179_1017591 Ga0316179_10175911 78
408 3300030744 Ga0316181_1095944 Ga0316181_10959441 78
409 3300030745 Ga0316182_1258570 Ga0316182_12585703 78
410 3300031548 Ga0307408_100257514 Ga0307408_1002575141 78
411 3300031731 Ga0307405_10692954 Ga0307405_106929542 78
412 3300031731 Ga0307405_10897408 Ga0307405_108974082 78
413 3300031824 Ga0307413_10218428 Ga0307413_102184283 78
414 3300031824 Ga0307413_10374520 Ga0307413_103745202 78
415 3300031824 Ga0307413_10617840 Ga0307413_106178401 78
416 3300031824 Ga0307413_11071051 Ga0307413_110710511 78
417 3300031824 Ga0307413_11787325 Ga0307413_117873251 78
418 3300031852 Ga0307410_10242845 Ga0307410_102428453 78
419 3300031889 Ga0326468_10008544 Ga0326468_100085441 78
420 3300031901 Ga0307406_10032902 Ga0307406_100329022 78
421 3300031901 Ga0307406_10289293 Ga0307406_102892932 78
422 3300031901 Ga0307406_10953069 Ga0307406_109530691 78
423 3300031903 Ga0307407_10116276 Ga0307407_101162763 78
424 3300031903 Ga0307407_10547156 Ga0307407_105471561 78
425 3300031903 Ga0307407_10842203 Ga0307407_108422032 78
426 3300031903 Ga0307407_11123493 Ga0307407_111234932 78
427 3300031903 Ga0307407_11479910 Ga0307407_114799101 78
428 3300031911 Ga0307412_10691129 Ga0307412_106911292 78
429 3300031911 Ga0307412_11545607 Ga0307412_115456071 78
430 3300031995 Ga0307409_100030729 Ga0307409_1000307296 78
431 3300031995 Ga0307409_100887342 Ga0307409_1008873422 78
432 3300031995 Ga0307409_101227649 Ga0307409_1012276491 78
433 3300032002 Ga0307416_100374058 Ga0307416_1003740583 78
434 3300032002 Ga0307416_100620027 Ga0307416_1006200272 78
435 3300032002 Ga0307416_102448108 Ga0307416_1024481082 78
436 3300032002 Ga0307416_103559025 Ga0307416_1035590252 78
437 3300032004 Ga0307414_10573668 Ga0307414_105736682 78
438 3300032126 Ga0307415_100809110 Ga0307415_1008091102 78
439 3300035207 Ga0373942_0052106 Ga0373942_0052106_96_344 78
440 3300039437 Ga0436365_0951027 Ga0436365_0951027_2324_2560 78
441 3300041451 Ga0451791_0882259 Ga0451791_0882259_175_414 78
442 3300041452 Ga0451793_1904655 Ga0451793_1904655_428_667 78
443 3300041453 Ga0451797_0095207 Ga0451797_0095207_540_779 78
444 3300041456 Ga0451795_1365640 Ga0451795_1365640_656_895 78
445 3300041460 Ga0451802_0709529 Ga0451802_0709529_36_275 78
446 3300041509 Ga0451843_1206275 Ga0451843_1206275_180_419 78
447 3300041511 Ga0451855_0494061 Ga0451855_0494061_168_407 78
448 3300041512 Ga0451853_2446506 Ga0451853_2446506_605_844 78
449 3300041997 Ga0439431_0043469 Ga0439431_0043469_270_509 78
450 3300042125 Ga0450923_082169 Ga0450923_082169_54_293 78
451 3300044656 Ga0466969_0043226 Ga0466969_0043226_1923_2159 78
452 3300044658 Ga0466972_0269369 Ga0466972_0269369_471_707 78
453 3300044684 Ga0466966_0016320 Ga0466966_0016320_3904_4140 78
454 3300044684 Ga0466966_0068435 Ga0466966_0068435_1404_1640 78
455 3300044684 Ga0466966_0094230 Ga0466966_0094230_1573_1821 78
456 3300044684 Ga0466966_0185119 Ga0466966_0185119_1015_1251 78
457 3300044693 Ga0466961_0007227 Ga0466961_0007227_5916_6152 78
458 3300044693 Ga0466961_0009205 Ga0466961_0009205_5219_5467 78
459 3300044693 Ga0466961_0064230 Ga0466961_0064230_540_776 78
460 3300044693 Ga0466961_0326258 Ga0466961_0326258_322_558 78
461 3300044693 Ga0466961_0919055 Ga0466961_0919055_204_440 78
462 3300044693 Ga0466961_0929617 Ga0466961_0929617_230_478 78
463 3300044694 Ga0466963_0014526 Ga0466963_0014526_1317_1565 78
464 3300044694 Ga0466963_0035545 Ga0466963_0035545_504_797 78
465 3300044694 Ga0466963_0130109 Ga0466963_0130109_1441_1689 78
466 3300044694 Ga0466963_0175489 Ga0466963_0175489_1005_1274 78
467 3300044694 Ga0466963_0203694 Ga0466963_0203694_840_1088 78
468 3300044694 Ga0466963_0279801 Ga0466963_0279801_348_584 78
469 3300044694 Ga0466963_0381929 Ga0466963_0381929_230_466 78
470 3300044694 Ga0466963_0793509 Ga0466963_0793509_267_515 78
471 3300044694 Ga0466963_1268044 Ga0466963_1268044_42_278 78
472 3300044706 Ga0466964_0005201 Ga0466964_0005201_3166_3402 78
473 3300044706 Ga0466964_0137846 Ga0466964_0137846_59_307 78
474 3300044719 Ga0466971_0044778 Ga0466971_0044778_549_797 78
475 3300044719 Ga0466971_0051996 Ga0466971_0051996_1344_1580 78
476 3300044719 Ga0466971_0555642 Ga0466971_0555642_20_256 78
477 3300044735 Ga0466968_0252581 Ga0466968_0252581_59_307 78
478 3300044765 Ga0466970_0250685 Ga0466970_0250685_278_517 78
479 3300044765 Ga0466970_0599046 Ga0466970_0599046_284_520 78
480 3300044842 Ga0466957_0268635 Ga0466957_0268635_729_977 78
481 3300044842 Ga0466957_0320887 Ga0466957_0320887_36_272 78
482 3300044842 Ga0466957_1159979 Ga0466957_1159979_145_381 78
483 3300044901 Ga0466960_0085198 Ga0466960_0085198_542_790 78
484 3300044901 Ga0466960_0354602 Ga0466960_0354602_502_738 78
485 3300044901 Ga0466960_0465873 Ga0466960_0465873_323_559 78
486 3300045049 Ga0466959_0038875 Ga0466959_0038875_1417_1665 78
487 3300045049 Ga0466959_0170202 Ga0466959_0170202_350_586 78
488 3300045049 Ga0466959_0298197 Ga0466959_0298197_176_412 78
489 3300045049 Ga0466959_1094963 Ga0466959_1094963_144_380 78
490 3300045836 Ga0466958_0033018 Ga0466958_0033018_1099_1347 78
491 3300045836 Ga0466958_0259835 Ga0466958_0259835_700_936 78
492 3300045976 Ga0466967_0006558 Ga0466967_0006558_539_775 78
493 3300045976 Ga0466967_0018985 Ga0466967_0018985_3285_3533 78
494 3300045976 Ga0466967_0034344 Ga0466967_0034344_2101_2337 78
495 3300045976 Ga0466967_0037772 Ga0466967_0037772_393_629 78
496 3300045976 Ga0466967_0055083 Ga0466967_0055083_2397_2633 78
497 3300045976 Ga0466967_0124108 Ga0466967_0124108_1137_1385 78
498 3300045976 Ga0466967_0124514 Ga0466967_0124514_192_428 78
499 3300045976 Ga0466967_0169614 Ga0466967_0169614_475_711 78
500 3300045976 Ga0466967_0174146 Ga0466967_0174146_852_1088 78
501 3300045976 Ga0466967_0796382 Ga0466967_0796382_350_586 78
502 3300045976 Ga0466967_1169369 Ga0466967_1169369_320_556 78
503 3300045976 Ga0466967_1658085 Ga0466967_1658085_274_510 78
504 3300045976 Ga0466967_2064550 Ga0466967_2064550_225_461 78
505 3300045976 Ga0466967_2428185 Ga0466967_2428185_31_267 78
506 3300046453 Ga0495627_005895 Ga0495627_005895_1431_1670 78
507 3300046459 Ga0495629_0423940 Ga0495629_0423940_427_666 78
508 3300046461 Ga0495641_0378156 Ga0495641_0378156_105_347 78
509 3300046474 Ga0495605_0221464 Ga0495605_0221464_482_718 78
510 3300046500 Ga0495596_0042409 Ga0495596_0042409_751_987 78
511 3300046513 Ga0495616_0393831 Ga0495616_0393831_255_491 78
512 3300046518 Ga0495631_0389220 Ga0495631_0389220_247_483 78
513 3300046523 Ga0495644_0076994 Ga0495644_0076994_949_1185 78
514 3300046525 Ga0495663_0080415 Ga0495663_0080415_426_662 78
515 3300046530 Ga0495654_0157436 Ga0495654_0157436_125_361 78
516 3300046663 Ga0495635_0684628 Ga0495635_0684628_344_583 78
517 3300046681 Ga0495647_0047918 Ga0495647_0047918_36_278 78
518 3300046683 Ga0495658_0154124 Ga0495658_0154124_478_720 78
519 3300046691 Ga0495670_0099032 Ga0495670_0099032_1141_1377 78
520 3300047321 Ga0495676_0082166 Ga0495676_0082166_556_798 78
521 3300047447 Ga0495685_205909 Ga0495685_205909_39_275 78
522 3300048090 Ga0495615_0220708 Ga0495615_0220708_93_329 78
523 3300048904 Ga0496101_0335713 Ga0496101_0335713_484_723 78
524 3300048905 Ga0496102_0000639 Ga0496102_0000639_3451_3687 78
525 3300048905 Ga0496102_0124907 Ga0496102_0124907_597_833 78
526 3300048905 Ga0496102_1093821 Ga0496102_1093821_425_661 78
527 3300048906 Ga0496103_0082833 Ga0496103_0082833_1661_1897 78
528 3300048907 Ga0496104_0142687 Ga0496104_0142687_640_876 78
529 3300048908 Ga0496105_0141044 Ga0496105_0141044_189_425 78
530 3300048908 Ga0496105_0172232 Ga0496105_0172232_1117_1353 78
531 3300048908 Ga0496105_0307326 Ga0496105_0307326_603_842 78
532 3300048908 Ga0496105_0824036 Ga0496105_0824036_316_561 78
533 3300048911 Ga0496108_0037841 Ga0496108_0037841_2003_2239 78
534 3300048912 Ga0496109_0014020 Ga0496109_0014020_4541_4777 78
535 3300048912 Ga0496109_1031630 Ga0496109_1031630_331_570 78
536 3300048913 Ga0496110_0048862 Ga0496110_0048862_1134_1370 78
537 3300048913 Ga0496110_0385388 Ga0496110_0385388_22_258 78
538 3300048913 Ga0496110_0686810 Ga0496110_0686810_336_575 78
539 3300048913 Ga0496110_1397968 Ga0496110_1397968_141_380 78
540 3300048914 Ga0496111_0745167 Ga0496111_0745167_176_415 78
541 3300048915 Ga0496112_0208240 Ga0496112_0208240_1439_1675 78
542 3300048915 Ga0496112_0395113 Ga0496112_0395113_1029_1280 78
543 3300048916 Ga0496113_1064713 Ga0496113_1064713_302_538 78
544 3300048917 Ga0496114_0548901 Ga0496114_0548901_323_559 78
545 3300048917 Ga0496114_0700484 Ga0496114_0700484_439_678 78
546 3300048918 Ga0496115_0515445 Ga0496115_0515445_499_735 78
547 3300048922 Ga0496119_0000055 Ga0496119_0000055_92883_93119 78
548 3300048923 Ga0496120_0011486 Ga0496120_0011486_5839_6075 78
549 3300048925 Ga0496122_0001865 Ga0496122_0001865_20592_20831 78
550 3300048926 Ga0496123_0001160 Ga0496123_0001160_20597_20836 78
551 3300048927 Ga0496124_0001713 Ga0496124_0001713_12694_12933 78
552 3300048928 Ga0496125_0001974 Ga0496125_0001974_18559_18798 78
553 3300048928 Ga0496125_0229937 Ga0496125_0229937_221_472 78
554 3300048928 Ga0496125_0509855 Ga0496125_0509855_249_485 78
555 3300048929 Ga0496126_0000465 Ga0496126_0000465_48107_48343 78
556 3300048929 Ga0496126_0021107 Ga0496126_0021107_707_946 78
557 3300048929 Ga0496126_0919940 Ga0496126_0919940_44_280 78
558 3300049130 Ga0501310_043538 Ga0501310_043538_190_426 78
559 3300049161 Ga0501305_061095 Ga0501305_061095_77_313 78
560 3300049531 Ga0501315_090607 Ga0501315_090607_254_490 78
561 3300049532 Ga0501316_029591 Ga0501316_029591_338_574 78
562 3300049532 Ga0501316_061104 Ga0501316_061104_117_353 78
563 3300049533 Ga0501317_016030 Ga0501317_016030_455_691 78
564 3300049533 Ga0501317_035520 Ga0501317_035520_99_335 78
565 3300049534 Ga0501318_015573 Ga0501318_015573_470_706 78
566 3300049534 Ga0501318_036325 Ga0501318_036325_416_652 78
567 3300049534 Ga0501318_039564 Ga0501318_039564_67_303 78
568 3300049535 Ga0501319_028954 Ga0501319_028954_23_259 78
569 3300049536 Ga0501320_021758 Ga0501320_021758_332_568 78
570 3300049536 Ga0501320_025692 Ga0501320_025692_326_562 78
571 3300049537 Ga0501321_032616 Ga0501321_032616_147_383 78
572 3300049537 Ga0501321_071318 Ga0501321_071318_240_476 78
573 3300049539 Ga0501323_057741 Ga0501323_057741_144_380 78
574 3300049540 Ga0501324_023054 Ga0501324_023054_172_408 78
575 3300049541 Ga0501325_057322 Ga0501325_057322_117_353 78
576 3300049581 Ga0501047_0386171 Ga0501047_0386171_819_1067 78
577 3300049585 Ga0501069_0429465 Ga0501069_0429465_365_601 78
578 3300049586 Ga0501070_0177912 Ga0501070_0177912_182_430 78
579 3300049586 Ga0501070_0799125 Ga0501070_0799125_311_547 78
580 3300049586 Ga0501070_1196765 Ga0501070_1196765_332_568 78
581 3300049652 Ga0501202_018845 Ga0501202_018845_888_1124 78
582 3300049653 Ga0501206_097335 Ga0501206_097335_22_258 78
583 3300049674 Ga0501242_065667 Ga0501242_065667_72_308 78
584 3300049822 Ga0501035_0289133 Ga0501035_0289133_340_588 78
585 3300050492 nmdc:mga0yw44_880752_c1 nmdc:mga0yw44_880752_c1_188_427 78
586 3300053139 Ga0500568_0115591 Ga0500568_0115591_649_888 78
587 3300053739 Ga0500587_038060 Ga0500587_038060_364_600 78
588 3300061719 Ga0466962_0101024 Ga0466962_0101024_260_508 78
589 3300061719 Ga0466962_0187474 Ga0466962_0187474_271_507 78
590 3300061719 Ga0466962_0585183 Ga0466962_0585183_93_329 78
591 3300061719 Ga0466962_0591031 Ga0466962_0591031_175_423 78
592 3300061719 Ga0466962_0610545 Ga0466962_0610545_18_254 78
593 3300003577 Ga0007416J51690_1022952 Ga0007416J51690_10229522 79
594 3300003659 JGI25404J52841_10009628 JGI25404J52841_100096282 79
595 3300004803 Ga0058862_12780929 Ga0058862_127809292 79
596 3300005327 Ga0070658_10038020 Ga0070658_100380203 79
597 3300005327 Ga0070658_10229206 Ga0070658_102292061 79
598 3300005327 Ga0070658_11477038 Ga0070658_114770382 79
599 3300005327 Ga0070658_11724640 Ga0070658_117246401 79
600 3300005328 Ga0070676_10099782 Ga0070676_100997822 79
601 3300005329 Ga0070683_100043475 Ga0070683_1000434754 79
602 3300005329 Ga0070683_101136041 Ga0070683_1011360411 79
603 3300005329 Ga0070683_101680121 Ga0070683_1016801212 79
604 3300005330 Ga0070690_100146940 Ga0070690_1001469402 79
605 3300005330 Ga0070690_101682143 Ga0070690_1016821432 79
606 3300005331 Ga0070670_100265893 Ga0070670_1002658932 79
607 3300005335 Ga0070666_10732580 Ga0070666_107325802 79
608 3300005336 Ga0070680_101335031 Ga0070680_1013350312 79
609 3300005337 Ga0070682_100341989 Ga0070682_1003419891 79
610 3300005337 Ga0070682_101627486 Ga0070682_1016274862 79
611 3300005338 Ga0068868_100076178 Ga0068868_1000761783 79
612 3300005338 Ga0068868_100374149 Ga0068868_1003741493 79
613 3300005339 Ga0070660_100318322 Ga0070660_1003183222 79
614 3300005339 Ga0070660_100688723 Ga0070660_1006887232 79
615 3300005339 Ga0070660_100806802 Ga0070660_1008068022 79
616 3300005339 Ga0070660_101148297 Ga0070660_1011482972 79
617 3300005340 Ga0070689_101530656 Ga0070689_1015306561 79
618 3300005341 Ga0070691_10078072 Ga0070691_100780722 79
619 3300005344 Ga0070661_100166674 Ga0070661_1001666742 79
620 3300005344 Ga0070661_101628064 Ga0070661_1016280641 79
621 3300005345 Ga0070692_10564365 Ga0070692_105643652 79
622 3300005347 Ga0070668_100189810 Ga0070668_1001898102 79
623 3300005347 Ga0070668_100277165 Ga0070668_1002771651 79
624 3300005353 Ga0070669_100990835 Ga0070669_1009908352 79
625 3300005354 Ga0070675_100682728 Ga0070675_1006827282 79
626 3300005354 Ga0070675_102019882 Ga0070675_1020198822 79
627 3300005355 Ga0070671_100868000 Ga0070671_1008680002 79
628 3300005355 Ga0070671_101288634 Ga0070671_1012886342 79
629 3300005364 Ga0070673_101458699 Ga0070673_1014586992 79
630 3300005366 Ga0070659_101646271 Ga0070659_1016462712 79
631 3300005367 Ga0070667_100082365 Ga0070667_1000823652 79
632 3300005367 Ga0070667_100903242 Ga0070667_1009032422 79
633 3300005434 Ga0070709_10017293 Ga0070709_100172936 79
634 3300005434 Ga0070709_10205039 Ga0070709_102050392 79
635 3300005434 Ga0070709_10701456 Ga0070709_107014562 79
636 3300005435 Ga0070714_100001737 Ga0070714_10000173716 79
637 3300005435 Ga0070714_100067079 Ga0070714_1000670795 79
638 3300005435 Ga0070714_100117452 Ga0070714_1001174522 79
639 3300005435 Ga0070714_100170715 Ga0070714_1001707154 79
640 3300005435 Ga0070714_100659866 Ga0070714_1006598662 79
641 3300005435 Ga0070714_100683724 Ga0070714_1006837242 79
642 3300005435 Ga0070714_101247530 Ga0070714_1012475301 79
643 3300005435 Ga0070714_101616639 Ga0070714_1016166392 79
644 3300005436 Ga0070713_100017964 Ga0070713_1000179647 79
645 3300005436 Ga0070713_100757032 Ga0070713_1007570322 79
646 3300005436 Ga0070713_101104447 Ga0070713_1011044472 79
647 3300005436 Ga0070713_101754073 Ga0070713_1017540731 79
648 3300005436 Ga0070713_101822155 Ga0070713_1018221551 79
649 3300005436 Ga0070713_101875890 Ga0070713_1018758901 79
650 3300005437 Ga0070710_10016642 Ga0070710_100166423 79
651 3300005437 Ga0070710_10537394 Ga0070710_105373942 79
652 3300005437 Ga0070710_11272655 Ga0070710_112726552 79
653 3300005439 Ga0070711_100551335 Ga0070711_1005513352 79
654 3300005439 Ga0070711_100728706 Ga0070711_1007287061 79
655 3300005441 Ga0070700_100282155 Ga0070700_1002821552 79
656 3300005444 Ga0070694_100618691 Ga0070694_1006186912 79
657 3300005445 Ga0070708_100029256 Ga0070708_1000292562 79
658 3300005445 Ga0070708_100032733 Ga0070708_1000327333 79
659 3300005445 Ga0070708_100104481 Ga0070708_1001044813 79
660 3300005445 Ga0070708_100230269 Ga0070708_1002302691 79
661 3300005445 Ga0070708_100534867 Ga0070708_1005348672 79
662 3300005445 Ga0070708_100585632 Ga0070708_1005856322 79
663 3300005445 Ga0070708_100638436 Ga0070708_1006384362 79
664 3300005455 Ga0070663_101325085 Ga0070663_1013250851 79
665 3300005456 Ga0070678_100248154 Ga0070678_1002481543 79
666 3300005456 Ga0070678_100880738 Ga0070678_1008807382 79
667 3300005457 Ga0070662_100651178 Ga0070662_1006511782 79
668 3300005459 Ga0068867_101163020 Ga0068867_1011630202 79
669 3300005459 Ga0068867_101645305 Ga0068867_1016453052 79
670 3300005467 Ga0070706_100163935 Ga0070706_1001639352 79
671 3300005467 Ga0070706_100169477 Ga0070706_1001694773 79
672 3300005467 Ga0070706_100535516 Ga0070706_1005355162 79
673 3300005467 Ga0070706_100573083 Ga0070706_1005730832 79
674 3300005467 Ga0070706_100822281 Ga0070706_1008222812 79
675 3300005467 Ga0070706_100829283 Ga0070706_1008292832 79
676 3300005467 Ga0070706_100857601 Ga0070706_1008576012 79
677 3300005468 Ga0070707_100043336 Ga0070707_1000433364 79
678 3300005468 Ga0070707_100054682 Ga0070707_1000546824 79
679 3300005468 Ga0070707_100168788 Ga0070707_1001687882 79
680 3300005468 Ga0070707_100238658 Ga0070707_1002386583 79
681 3300005468 Ga0070707_100810806 Ga0070707_1008108062 79
682 3300005471 Ga0070698_100002179 Ga0070698_1000021793 79
683 3300005471 Ga0070698_100009870 Ga0070698_1000098705 79
684 3300005471 Ga0070698_100018226 Ga0070698_1000182263 79
685 3300005471 Ga0070698_100036981 Ga0070698_1000369815 79
686 3300005471 Ga0070698_100554434 Ga0070698_1005544342 79
687 3300005471 Ga0070698_100611549 Ga0070698_1006115492 79
688 3300005471 Ga0070698_102077273 Ga0070698_1020772731 79
689 3300005518 Ga0070699_100003081 Ga0070699_1000030818 79
690 3300005518 Ga0070699_100644918 Ga0070699_1006449182 79
691 3300005530 Ga0070679_100602426 Ga0070679_1006024262 79
692 3300005535 Ga0070684_101450513 Ga0070684_1014505132 79
693 3300005536 Ga0070697_100047896 Ga0070697_1000478965 79
694 3300005536 Ga0070697_100050393 Ga0070697_1000503934 79
695 3300005536 Ga0070697_100540059 Ga0070697_1005400592 79
696 3300005536 Ga0070697_100818273 Ga0070697_1008182731 79
697 3300005544 Ga0070686_100367656 Ga0070686_1003676562 79
698 3300005546 Ga0070696_101170814 Ga0070696_1011708141 79
699 3300005547 Ga0070693_100936571 Ga0070693_1009365712 79
700 3300005547 Ga0070693_101147483 Ga0070693_1011474832 79
701 3300005548 Ga0070665_100161733 Ga0070665_1001617333 79
702 3300005563 Ga0068855_100413460 Ga0068855_1004134602 79
703 3300005563 Ga0068855_101490791 Ga0068855_1014907912 79
704 3300005564 Ga0070664_100255678 Ga0070664_1002556783 79
705 3300005564 Ga0070664_100897570 Ga0070664_1008975702 79
706 3300005577 Ga0068857_100164259 Ga0068857_1001642592 79
707 3300005577 Ga0068857_100171638 Ga0068857_1001716382 79
708 3300005578 Ga0068854_100681575 Ga0068854_1006815752 79
709 3300005614 Ga0068856_100299529 Ga0068856_1002995293 79
710 3300005614 Ga0068856_101970948 Ga0068856_1019709482 79
711 3300005615 Ga0070702_100638626 Ga0070702_1006386262 79
712 3300005616 Ga0068852_100737947 Ga0068852_1007379472 79
713 3300005616 Ga0068852_101823314 Ga0068852_1018233142 79
714 3300005617 Ga0068859_100538282 Ga0068859_1005382822 79
715 3300005618 Ga0068864_100317505 Ga0068864_1003175052 79
716 3300005618 Ga0068864_100738818 Ga0068864_1007388182 79
717 3300005719 Ga0068861_100094365 Ga0068861_1000943655 79
718 3300005840 Ga0068870_10033181 Ga0068870_100331815 79
719 3300005841 Ga0068863_100155904 Ga0068863_1001559044 79
720 3300005841 Ga0068863_100789267 Ga0068863_1007892673 79
721 3300005841 Ga0068863_102068372 Ga0068863_1020683722 79
722 3300005842 Ga0068858_101077687 Ga0068858_1010776872 79
723 3300005843 Ga0068860_100636978 Ga0068860_1006369782 79
724 3300005843 Ga0068860_102491083 Ga0068860_1024910832 79
725 3300005844 Ga0068862_100782389 Ga0068862_1007823892 79
726 3300005937 Ga0081455_10014949 Ga0081455_100149498 79
727 3300005937 Ga0081455_10295754 Ga0081455_102957541 79
728 3300005983 Ga0081540_1002410 Ga0081540_100241015 79
729 3300005983 Ga0081540_1017068 Ga0081540_10170683 79
730 3300006028 Ga0070717_10111860 Ga0070717_101118602 79
731 3300006028 Ga0070717_10141370 Ga0070717_101413703 79
732 3300006028 Ga0070717_10307690 Ga0070717_103076902 79
733 3300006028 Ga0070717_10359253 Ga0070717_103592533 79
734 3300006028 Ga0070717_10473329 Ga0070717_104733292 79
735 3300006028 Ga0070717_11196929 Ga0070717_111969292 79
736 3300006028 Ga0070717_11306196 Ga0070717_113061962 79
737 3300006028 Ga0070717_11317101 Ga0070717_113171011 79
738 3300006028 Ga0070717_11898151 Ga0070717_118981512 79
739 3300006163 Ga0070715_10171700 Ga0070715_101717002 79
740 3300006163 Ga0070715_10254865 Ga0070715_102548652 79
741 3300006163 Ga0070715_10653654 Ga0070715_106536542 79
742 3300006163 Ga0070715_11006439 Ga0070715_110064392 79
743 3300006173 Ga0070716_100040375 Ga0070716_1000403752 79
744 3300006175 Ga0070712_100151278 Ga0070712_1001512782 79
745 3300006175 Ga0070712_100397191 Ga0070712_1003971911 79
746 3300006175 Ga0070712_100422911 Ga0070712_1004229112 79
747 3300006175 Ga0070712_100585994 Ga0070712_1005859942 79
748 3300006175 Ga0070712_100661083 Ga0070712_1006610831 79
749 3300006175 Ga0070712_100815917 Ga0070712_1008159172 79
750 3300006175 Ga0070712_101285105 Ga0070712_1012851051 79
751 3300006237 Ga0097621_101930766 Ga0097621_1019307662 79
752 3300006237 Ga0097621_101969868 Ga0097621_1019698682 79
753 3300006358 Ga0068871_100041320 Ga0068871_1000413204 79
754 3300006358 Ga0068871_102259697 Ga0068871_1022596972 79
755 3300006852 Ga0075433_11752968 Ga0075433_117529682 79
756 3300006871 Ga0075434_100425288 Ga0075434_1004252882 79
757 3300006871 Ga0075434_100614881 Ga0075434_1006148813 79
758 3300006871 Ga0075434_102398766 Ga0075434_1023987662 79
759 3300006881 Ga0068865_101985366 Ga0068865_1019853662 79
760 3300006914 Ga0075436_100035391 Ga0075436_1000353913 79
761 3300006914 Ga0075436_100129693 Ga0075436_1001296932 79
762 3300006914 Ga0075436_100484356 Ga0075436_1004843562 79
763 3300006931 Ga0097620_100538305 Ga0097620_1005383052 79
764 3300007076 Ga0075435_100742753 Ga0075435_1007427532 79
765 3300007076 Ga0075435_100904352 Ga0075435_1009043522 79
766 3300007076 Ga0075435_101150912 Ga0075435_1011509122 79
767 3300007076 Ga0075435_101600012 Ga0075435_1016000122 79
768 3300007265 Ga0099794_10356685 Ga0099794_103566852 79
769 3300007788 Ga0099795_10123158 Ga0099795_101231582 79
770 3300009011 Ga0105251_10105211 Ga0105251_101052112 79
771 3300009011 Ga0105251_10314998 Ga0105251_103149982 79
772 3300009092 Ga0105250_10311026 Ga0105250_103110262 79
773 3300009093 Ga0105240_12062768 Ga0105240_120627681 79
774 3300009093 Ga0105240_12713997 Ga0105240_127139972 79
775 3300009094 Ga0111539_10784410 Ga0111539_107844102 79
776 3300009098 Ga0105245_10491011 Ga0105245_104910112 79
777 3300009101 Ga0105247_10043221 Ga0105247_100432213 79
778 3300009101 Ga0105247_10579340 Ga0105247_105793402 79
779 3300009148 Ga0105243_10085773 Ga0105243_100857732 79
780 3300009148 Ga0105243_11153432 Ga0105243_111534322 79
781 3300009174 Ga0105241_10356473 Ga0105241_103564732 79
782 3300009177 Ga0105248_10011539 Ga0105248_100115394 79
783 3300009177 Ga0105248_10119534 Ga0105248_101195342 79
784 3300009177 Ga0105248_10824247 Ga0105248_108242472 79
785 3300009545 Ga0105237_10242167 Ga0105237_102421673 79
786 3300009551 Ga0105238_10214112 Ga0105238_102141123 79
787 3300009551 Ga0105238_10403536 Ga0105238_104035362 79
788 3300009551 Ga0105238_11011449 Ga0105238_110114492 79
789 3300009553 Ga0105249_12375758 Ga0105249_123757582 79
790 3300009553 Ga0105249_12940914 Ga0105249_129409142 79
791 3300010159 Ga0099796_10331834 Ga0099796_103318342 79
792 3300010375 Ga0105239_10053532 Ga0105239_100535322 79
793 3300010375 Ga0105239_13132228 Ga0105239_131322282 79
794 3300011119 Ga0105246_12021206 Ga0105246_120212062 79
795 3300012481 Ga0157320_1027533 Ga0157320_10275332 79
796 3300012498 Ga0157345_1028760 Ga0157345_10287601 79
797 3300012507 Ga0157342_1049281 Ga0157342_10492812 79
798 3300012508 Ga0157315_1028385 Ga0157315_10283852 79
799 3300012513 Ga0157326_1074097 Ga0157326_10740971 79
800 3300012515 Ga0157338_1004940 Ga0157338_10049402 79
801 3300013100 Ga0157373_10436672 Ga0157373_104366722 79
802 3300013102 Ga0157371_10326493 Ga0157371_103264932 79
803 3300013104 Ga0157370_10768720 Ga0157370_107687202 79
804 3300013105 Ga0157369_10319872 Ga0157369_103198723 79
805 3300013105 Ga0157369_10564775 Ga0157369_105647751 79
806 3300013105 Ga0157369_10861088 Ga0157369_108610882 79
807 3300013296 Ga0157374_10114003 Ga0157374_101140035 79
808 3300013296 Ga0157374_11130950 Ga0157374_111309502 79
809 3300013297 Ga0157378_10766541 Ga0157378_107665412 79
810 3300013306 Ga0163162_12667954 Ga0163162_126679542 79
811 3300013307 Ga0157372_10982399 Ga0157372_109823992 79
812 3300013307 Ga0157372_12642796 Ga0157372_126427961 79
813 3300013307 Ga0157372_12743933 Ga0157372_127439332 79
814 3300013308 Ga0157375_11102108 Ga0157375_111021082 79
815 3300013308 Ga0157375_11144954 Ga0157375_111449542 79
816 3300014325 Ga0163163_10009665 Ga0163163_100096655 79
817 3300014325 Ga0163163_10030640 Ga0163163_100306405 79
818 3300014325 Ga0163163_11200393 Ga0163163_112003932 79
819 3300014326 Ga0157380_10252908 Ga0157380_102529083 79
820 3300014745 Ga0157377_10096561 Ga0157377_100965613 79
821 3300014968 Ga0157379_10000007 Ga0157379_1000000749 79
822 3300014968 Ga0157379_10014493 Ga0157379_100144936 79
823 3300014968 Ga0157379_10599039 Ga0157379_105990392 79
824 3300014968 Ga0157379_10932526 Ga0157379_109325262 79
825 3300014968 Ga0157379_11674044 Ga0157379_116740442 79
826 3300014969 Ga0157376_10034896 Ga0157376_100348962 79
827 3300017792 Ga0163161_10034448 Ga0163161_100344482 79
828 3300020069 Ga0197907_10156609 Ga0197907_101566092 79
829 3300020069 Ga0197907_10386202 Ga0197907_103862022 79
830 3300020069 Ga0197907_11063525 Ga0197907_110635252 79
831 3300020070 Ga0206356_11264804 Ga0206356_112648042 79
832 3300020070 Ga0206356_11295048 Ga0206356_112950482 79
833 3300020070 Ga0206356_11722896 Ga0206356_117228962 79
834 3300020075 Ga0206349_1871719 Ga0206349_18717192 79
835 3300020078 Ga0206352_10719731 Ga0206352_107197311 79
836 3300020081 Ga0206354_10803405 Ga0206354_108034052 79
837 3300020081 Ga0206354_11421471 Ga0206354_114214712 79
838 3300020081 Ga0206354_11429718 Ga0206354_114297182 79
839 3300020082 Ga0206353_10302179 Ga0206353_103021792 79
840 3300020082 Ga0206353_10369752 Ga0206353_103697522 79
841 3300020082 Ga0206353_11232208 Ga0206353_112322082 79
842 3300021358 Ga0213873_10032308 Ga0213873_100323082 79
843 3300021377 Ga0213874_10047662 Ga0213874_100476622 79
844 3300021377 Ga0213874_10250567 Ga0213874_102505672 79
845 3300021377 Ga0213874_10396169 Ga0213874_103961692 79
846 3300021384 Ga0213876_10161285 Ga0213876_101612852 79
847 3300021384 Ga0213876_10194400 Ga0213876_101944002 79
848 3300021388 Ga0213875_10000442 Ga0213875_1000044227 79
849 3300021388 Ga0213875_10051946 Ga0213875_100519462 79
850 3300021388 Ga0213875_10054565 Ga0213875_100545652 79
851 3300021388 Ga0213875_10136261 Ga0213875_101362612 79
852 3300021388 Ga0213875_10358308 Ga0213875_103583082 79
853 3300022467 Ga0224712_10205997 Ga0224712_102059972 79
854 3300022467 Ga0224712_10332802 Ga0224712_103328022 79
855 3300024225 Ga0224572_1016852 Ga0224572_10168523 79
856 3300024225 Ga0224572_1095898 Ga0224572_10958981 79
857 3300025885 Ga0207653_10006683 Ga0207653_100066831 79
858 3300025898 Ga0207692_10110146 Ga0207692_101101462 79
859 3300025898 Ga0207692_10251894 Ga0207692_102518942 79
860 3300025898 Ga0207692_10453956 Ga0207692_104539562 79
861 3300025898 Ga0207692_10721091 Ga0207692_107210912 79
862 3300025898 Ga0207692_11104735 Ga0207692_111047351 79
863 3300025900 Ga0207710_10456697 Ga0207710_104566972 79
864 3300025901 Ga0207688_10357523 Ga0207688_103575232 79
865 3300025903 Ga0207680_11036440 Ga0207680_110364402 79
866 3300025904 Ga0207647_10109266 Ga0207647_101092662 79
867 3300025905 Ga0207685_10060242 Ga0207685_100602423 79
868 3300025905 Ga0207685_10065108 Ga0207685_100651083 79
869 3300025906 Ga0207699_10041313 Ga0207699_100413132 79
870 3300025906 Ga0207699_10074713 Ga0207699_100747133 79
871 3300025906 Ga0207699_10239811 Ga0207699_102398111 79
872 3300025906 Ga0207699_10246344 Ga0207699_102463442 79
873 3300025906 Ga0207699_10560682 Ga0207699_105606822 79
874 3300025909 Ga0207705_10232827 Ga0207705_102328271 79
875 3300025909 Ga0207705_10241424 Ga0207705_102414242 79
876 3300025909 Ga0207705_10342674 Ga0207705_103426742 79
877 3300025909 Ga0207705_10581807 Ga0207705_105818072 79
878 3300025910 Ga0207684_10051051 Ga0207684_100510513 79
879 3300025910 Ga0207684_10056071 Ga0207684_100560715 79
880 3300025910 Ga0207684_10505184 Ga0207684_105051842 79
881 3300025910 Ga0207684_10646445 Ga0207684_106464451 79
882 3300025910 Ga0207684_10685981 Ga0207684_106859812 79
883 3300025910 Ga0207684_11224947 Ga0207684_112249472 79
884 3300025912 Ga0207707_11159154 Ga0207707_111591542 79
885 3300025914 Ga0207671_10096071 Ga0207671_100960713 79
886 3300025915 Ga0207693_10055852 Ga0207693_100558525 79
887 3300025915 Ga0207693_10071025 Ga0207693_100710254 79
888 3300025915 Ga0207693_10097545 Ga0207693_100975452 79
889 3300025915 Ga0207693_10266418 Ga0207693_102664182 79
890 3300025915 Ga0207693_10628532 Ga0207693_106285322 79
891 3300025916 Ga0207663_10053465 Ga0207663_100534654 79
892 3300025916 Ga0207663_10323747 Ga0207663_103237473 79
893 3300025916 Ga0207663_10558958 Ga0207663_105589582 79
894 3300025916 Ga0207663_10576962 Ga0207663_105769622 79
895 3300025917 Ga0207660_11259763 Ga0207660_112597632 79
896 3300025917 Ga0207660_11431634 Ga0207660_114316342 79
897 3300025918 Ga0207662_10011623 Ga0207662_100116232 79
898 3300025919 Ga0207657_10021242 Ga0207657_100212427 79
899 3300025919 Ga0207657_10324411 Ga0207657_103244113 79
900 3300025921 Ga0207652_10360330 Ga0207652_103603302 79
901 3300025921 Ga0207652_10849200 Ga0207652_108492002 79
902 3300025921 Ga0207652_11399964 Ga0207652_113999642 79
903 3300025922 Ga0207646_10077781 Ga0207646_100777813 79
904 3300025922 Ga0207646_10102096 Ga0207646_101020963 79
905 3300025922 Ga0207646_10193729 Ga0207646_101937293 79
906 3300025922 Ga0207646_10204104 Ga0207646_102041042 79
907 3300025922 Ga0207646_10215113 Ga0207646_102151131 79
908 3300025922 Ga0207646_10823718 Ga0207646_108237182 79
909 3300025924 Ga0207694_10191392 Ga0207694_101913922 79
910 3300025924 Ga0207694_10487730 Ga0207694_104877303 79
911 3300025928 Ga0207700_10045791 Ga0207700_100457912 79
912 3300025928 Ga0207700_10064442 Ga0207700_100644423 79
913 3300025928 Ga0207700_10718552 Ga0207700_107185521 79
914 3300025929 Ga0207664_10007336 Ga0207664_100073366 79
915 3300025929 Ga0207664_10145045 Ga0207664_101450452 79
916 3300025929 Ga0207664_10145229 Ga0207664_101452294 79
917 3300025929 Ga0207664_10148225 Ga0207664_101482251 79
918 3300025929 Ga0207664_10170350 Ga0207664_101703502 79
919 3300025929 Ga0207664_10359163 Ga0207664_103591632 79
920 3300025929 Ga0207664_10815411 Ga0207664_108154112 79
921 3300025929 Ga0207664_11217560 Ga0207664_112175602 79
922 3300025931 Ga0207644_10404174 Ga0207644_104041742 79
923 3300025931 Ga0207644_10527147 Ga0207644_105271472 79
924 3300025932 Ga0207690_10545319 Ga0207690_105453192 79
925 3300025933 Ga0207706_10060278 Ga0207706_100602783 79
926 3300025934 Ga0207686_10389922 Ga0207686_103899222 79
927 3300025935 Ga0207709_11454502 Ga0207709_114545022 79
928 3300025936 Ga0207670_11293391 Ga0207670_112933912 79
929 3300025939 Ga0207665_10025013 Ga0207665_100250134 79
930 3300025939 Ga0207665_10180576 Ga0207665_101805762 79
931 3300025939 Ga0207665_11264436 Ga0207665_112644361 79
932 3300025940 Ga0207691_10460084 Ga0207691_104600842 79
933 3300025941 Ga0207711_10007114 Ga0207711_1000711410 79
934 3300025941 Ga0207711_10855942 Ga0207711_108559422 79
935 3300025941 Ga0207711_11705965 Ga0207711_117059651 79
936 3300025942 Ga0207689_10009376 Ga0207689_100093768 79
937 3300025944 Ga0207661_11021991 Ga0207661_110219912 79
938 3300025944 Ga0207661_11254330 Ga0207661_112543302 79
939 3300025944 Ga0207661_11800235 Ga0207661_118002351 79
940 3300025945 Ga0207679_10128478 Ga0207679_101284781 79
941 3300025949 Ga0207667_10856898 Ga0207667_108568982 79
942 3300025949 Ga0207667_10885695 Ga0207667_108856952 79
943 3300025949 Ga0207667_11011075 Ga0207667_110110752 79
944 3300025961 Ga0207712_11746936 Ga0207712_117469362 79
945 3300025972 Ga0207668_10347756 Ga0207668_103477562 79
946 3300025981 Ga0207640_10999629 Ga0207640_109996292 79
947 3300025981 Ga0207640_11468663 Ga0207640_114686632 79
948 3300025986 Ga0207658_10293712 Ga0207658_102937123 79
949 3300026023 Ga0207677_10247174 Ga0207677_102471742 79
950 3300026023 Ga0207677_11972233 Ga0207677_119722332 79
951 3300026035 Ga0207703_10000001 Ga0207703_10000001511 79
952 3300026041 Ga0207639_10484893 Ga0207639_104848932 79
953 3300026067 Ga0207678_10048863 Ga0207678_100488632 79
954 3300026075 Ga0207708_10439488 Ga0207708_104394882 79
955 3300026078 Ga0207702_10135638 Ga0207702_101356382 79
956 3300026078 Ga0207702_10381120 Ga0207702_103811203 79
957 3300026078 Ga0207702_10408739 Ga0207702_104087392 79
958 3300026078 Ga0207702_10746221 Ga0207702_107462212 79
959 3300026095 Ga0207676_11371894 Ga0207676_113718942 79
960 3300026095 Ga0207676_11884848 Ga0207676_118848482 79
961 3300026116 Ga0207674_10098691 Ga0207674_100986915 79
962 3300026116 Ga0207674_10318484 Ga0207674_103184842 79
963 3300026118 Ga0207675_100111372 Ga0207675_1001113722 79
964 3300026121 Ga0207683_10385657 Ga0207683_103856573 79
965 3300026121 Ga0207683_10620957 Ga0207683_106209572 79
966 3300028380 Ga0268265_11493899 Ga0268265_114938992 79
967 3300028381 Ga0268264_10670846 Ga0268264_106708462 79
968 3300030836 Ga0265767_100946 Ga0265767_1009462 79
969 3300031090 Ga0265760_10175190 Ga0265760_101751902 79
970 3300031240 Ga0265320_10038206 Ga0265320_100382062 79
971 3300031241 Ga0265325_10054458 Ga0265325_100544582 79
972 3300031241 Ga0265325_10057167 Ga0265325_100571673 79
973 3300031247 Ga0265340_10011790 Ga0265340_100117907 79
974 3300031247 Ga0265340_10260894 Ga0265340_102608942 79
975 3300031249 Ga0265339_10146840 Ga0265339_101468402 79
976 3300031250 Ga0265331_10451403 Ga0265331_104514032 79
977 3300031344 Ga0265316_10163349 Ga0265316_101633492 79
978 3300031595 Ga0265313_10267188 Ga0265313_102671882 79
979 3300031616 Ga0307508_10905283 Ga0307508_109052832 79
980 3300031665 Ga0316575_10002327 Ga0316575_1000232710 79
981 3300031691 Ga0316579_10002430 Ga0316579_100024307 79
982 3300031711 Ga0265314_10430039 Ga0265314_104300392 79
983 3300031727 Ga0316576_10007831 Ga0316576_1000783111 79
984 3300031728 Ga0316578_10008542 Ga0316578_100085422 79
985 3300031733 Ga0316577_10401542 Ga0316577_104015422 79
986 3300031852 Ga0307410_10661966 Ga0307410_106619662 79
987 3300031995 Ga0307409_100173422 Ga0307409_1001734223 79
988 3300032002 Ga0307416_101764749 Ga0307416_1017647491 79
989 3300032002 Ga0307416_103377172 Ga0307416_1033771721 79
990 3300032137 Ga0316585_10001057 Ga0316585_100010577 79
991 3300032139 Ga0316580_10003992 Ga0316580_100039923 79
992 3300032168 Ga0316593_10081292 Ga0316593_100812922 79
993 3300033524 Ga0316592_1018909 Ga0316592_10189092 79
994 3300033527 Ga0316586_1020752 Ga0316586_10207522 79
995 3300033528 Ga0316588_1022546 Ga0316588_10225462 79
996 3300033541 Ga0316596_1020836 Ga0316596_10208362 79
997 3300034816 Ga0373930_0154462 Ga0373930_0154462_119_361 79
998 3300034820 Ga0373959_0027729 Ga0373959_0027729_605_847 79
999 3300035083 Ga0373926_0005903 Ga0373926_0005903_3654_3896 79
1000 3300035083 Ga0373926_0009018 Ga0373926_0009018_3061_3303 79
1001 3300035083 Ga0373926_0040846 Ga0373926_0040846_1356_1598 79
1002 3300035083 Ga0373926_0106667 Ga0373926_0106667_561_803 79
1003 3300035083 Ga0373926_0264050 Ga0373926_0264050_416_658 79
1004 3300035085 Ga0373929_0004837 Ga0373929_0004837_392_634 79
1005 3300035086 Ga0373934_0053041 Ga0373934_0053041_363_605 79
1006 3300035086 Ga0373934_0268948 Ga0373934_0268948_99_341 79
1007 3300035089 Ga0373944_0020913 Ga0373944_0020913_331_573 79
1008 3300035089 Ga0373944_0169863 Ga0373944_0169863_109_351 79
1009 3300035089 Ga0373944_0302973 Ga0373944_0302973_91_333 79
1010 3300035091 Ga0373951_0010130 Ga0373951_0010130_49_291 79
1011 3300035092 Ga0373952_0081350 Ga0373952_0081350_289_531 79
1012 3300035111 Ga0373923_0004349 Ga0373923_0004349_3639_3881 79
1013 3300035111 Ga0373923_0032636 Ga0373923_0032636_1238_1480 79
1014 3300035111 Ga0373923_0103050 Ga0373923_0103050_771_1013 79
1015 3300035111 Ga0373923_0215810 Ga0373923_0215810_361_603 79
1016 3300035112 Ga0373932_0042604 Ga0373932_0042604_1047_1289 79
1017 3300035113 Ga0373936_0004565 Ga0373936_0004565_2246_2488 79
1018 3300035113 Ga0373936_0011868 Ga0373936_0011868_1281_1523 79
1019 3300035113 Ga0373936_0046070 Ga0373936_0046070_152_394 79
1020 3300035113 Ga0373936_0240596 Ga0373936_0240596_218_460 79
1021 3300035113 Ga0373936_0253441 Ga0373936_0253441_59_301 79
1022 3300035116 Ga0373945_0000309 Ga0373945_0000309_12342_12584 79
1023 3300035116 Ga0373945_0004376 Ga0373945_0004376_106_348 79
1024 3300035116 Ga0373945_0007892 Ga0373945_0007892_2634_2876 79
1025 3300035116 Ga0373945_0218463 Ga0373945_0218463_297_539 79
1026 3300035117 Ga0373953_0084608 Ga0373953_0084608_106_348 79
1027 3300035117 Ga0373953_0085832 Ga0373953_0085832_253_495 79
1028 3300035117 Ga0373953_0141637 Ga0373953_0141637_75_317 79
1029 3300035117 Ga0373953_0173590 Ga0373953_0173590_231_473 79
1030 3300035117 Ga0373953_0250602 Ga0373953_0250602_139_381 79
1031 3300035118 Ga0373954_0128346 Ga0373954_0128346_853_1095 79
1032 3300035118 Ga0373954_0444906 Ga0373954_0444906_257_499 79
1033 3300035118 Ga0373954_0480472 Ga0373954_0480472_113_355 79
1034 3300035119 Ga0373956_0160145 Ga0373956_0160145_562_804 79
1035 3300035119 Ga0373956_0271143 Ga0373956_0271143_451_693 79
1036 3300035120 Ga0373957_0044728 Ga0373957_0044728_1266_1508 79
1037 3300035120 Ga0373957_0072771 Ga0373957_0072771_443_685 79
1038 3300035120 Ga0373957_0276620 Ga0373957_0276620_228_470 79
1039 3300035121 Ga0373960_0039794 Ga0373960_0039794_972_1214 79
1040 3300035170 Ga0373943_0013584 Ga0373943_0013584_352_594 79
1041 3300035170 Ga0373943_0020179 Ga0373943_0020179_1566_1808 79
1042 3300035170 Ga0373943_0509294 Ga0373943_0509294_277_519 79
1043 3300035171 Ga0373946_0000043 Ga0373946_0000043_15550_15792 79
1044 3300035171 Ga0373946_0002808 Ga0373946_0002808_4372_4614 79
1045 3300035171 Ga0373946_0151088 Ga0373946_0151088_231_473 79
1046 3300035171 Ga0373946_0492926 Ga0373946_0492926_60_302 79
1047 3300035172 Ga0373955_0040244 Ga0373955_0040244_291_533 79
1048 3300035172 Ga0373955_0063120 Ga0373955_0063120_1606_1848 79
1049 3300035172 Ga0373955_0347950 Ga0373955_0347950_404_646 79
1050 3300035172 Ga0373955_0362018 Ga0373955_0362018_351_593 79
1051 3300035207 Ga0373942_0199229 Ga0373942_0199229_318_560 79
1052 3300035241 Ga0373961_0087424 Ga0373961_0087424_688_930 79
1053 3300035398 Ga0316574_0107026 Ga0316574_0107026_160_399 79
1054 3300035410 Ga0373924_0012478 Ga0373924_0012478_2052_2294 79
1055 3300035410 Ga0373924_0072158 Ga0373924_0072158_129_371 79
1056 3300035410 Ga0373924_0125212 Ga0373924_0125212_634_876 79
1057 3300035691 Ga0373931_0035669 Ga0373931_0035669_400_642 79
1058 3300035691 Ga0373931_0388950 Ga0373931_0388950_280_522 79
1059 3300035691 Ga0373931_0431283 Ga0373931_0431283_299_541 79
1060 3300035692 Ga0373935_0001846 Ga0373935_0001846_167_409 79
1061 3300035692 Ga0373935_0013386 Ga0373935_0013386_1352_1594 79
1062 3300035692 Ga0373935_0497719 Ga0373935_0497719_574_816 79
1063 3300035692 Ga0373935_0607312 Ga0373935_0607312_539_781 79
1064 3300035692 Ga0373935_0707379 Ga0373935_0707379_384_626 79
1065 3300035692 Ga0373935_0826256 Ga0373935_0826256_332_574 79
1066 3300035692 Ga0373935_0930360 Ga0373935_0930360_311_553 79
1067 3300035695 Ga0373927_0005796 Ga0373927_0005796_7872_8114 79
1068 3300035695 Ga0373927_0084033 Ga0373927_0084033_1566_1808 79
1069 3300035695 Ga0373927_0651776 Ga0373927_0651776_187_429 79
1070 3300035724 Ga0373933_0012227 Ga0373933_0012227_3088_3330 79
1071 3300035724 Ga0373933_0054222 Ga0373933_0054222_1011_1253 79
1072 3300035724 Ga0373933_0167429 Ga0373933_0167429_302_544 79
1073 3300035724 Ga0373933_0267187 Ga0373933_0267187_529_771 79
1074 3300035724 Ga0373933_0893608 Ga0373933_0893608_190_432 79
1075 3300035724 Ga0373933_1154201 Ga0373933_1154201_152_394 79
1076 3300035725 Ga0373947_0000269 Ga0373947_0000269_6632_6874 79
1077 3300035725 Ga0373947_0020050 Ga0373947_0020050_3267_3509 79
1078 3300035725 Ga0373947_1155479 Ga0373947_1155479_241_483 79
1079 3300035725 Ga0373947_1164958 Ga0373947_1164958_134_376 79
1080 3300035725 Ga0373947_1264208 Ga0373947_1264208_243_485 79
1081 3300036401 Ga0373937_0188708 Ga0373937_0188708_863_1105 79
1082 3300036401 Ga0373937_0367660 Ga0373937_0367660_857_1099 79
1083 3300036401 Ga0373937_0499758 Ga0373937_0499758_537_779 79
1084 3300036401 Ga0373937_1775041 Ga0373937_1775041_85_327 79
1085 3300036457 Ga0265778_064684 Ga0265778_064684_210_452 79
1086 3300036647 Ga0316582_0001069 Ga0316582_0001069_6546_6785 79
1087 3300036712 Ga0316584_0000247 Ga0316584_0000247_21943_22182 79
1088 3300036712 Ga0316584_0388054 Ga0316584_0388054_500_742 79
1089 3300037068 Ga0373925_0120452 Ga0373925_0120452_1641_1883 79
1090 3300037068 Ga0373925_0232305 Ga0373925_0232305_229_471 79
1091 3300037068 Ga0373925_1366732 Ga0373925_1366732_137_379 79
1092 3300037312 Ga0395899_0057763 Ga0395899_0057763_2591_2833 79
1093 3300037312 Ga0395899_0151554 Ga0395899_0151554_584_826 79
1094 3300037418 Ga0395900_0228929 Ga0395900_0228929_1191_1433 79
1095 3300037466 Ga0395898_0002525 Ga0395898_0002525_7054_7296 79
1096 3300037466 Ga0395898_0502338 Ga0395898_0502338_56_298 79
1097 3300037471 Ga0395905_0230702 Ga0395905_0230702_1125_1367 79
1098 3300037588 Ga0316581_0000044 Ga0316581_0000044_294_533 79
1099 3300037853 Ga0436364_0029165 Ga0436364_0029165_7699_7941 79
1100 3300037853 Ga0436364_0186331 Ga0436364_0186331_655_906 79
1101 3300037853 Ga0436364_0196375 Ga0436364_0196375_413_655 79
1102 3300037853 Ga0436364_0233317 Ga0436364_0233317_201_443 79
1103 3300037853 Ga0436364_0235261 Ga0436364_0235261_202_453 79
1104 3300037853 Ga0436364_0341511 Ga0436364_0341511_61_303 79
1105 3300037853 Ga0436364_0390589 Ga0436364_0390589_19210_19452 79
1106 3300037853 Ga0436364_0752011 Ga0436364_0752011_1257_1508 79
1107 3300037853 Ga0436364_0813081 Ga0436364_0813081_2392_2634 79
1108 3300037853 Ga0436364_1120314 Ga0436364_1120314_1127_1369 79
1109 3300037853 Ga0436364_1187624 Ga0436364_1187624_1774_2016 79
1110 3300037853 Ga0436364_1307130 Ga0436364_1307130_786_1037 79
1111 3300037853 Ga0436364_1427907 Ga0436364_1427907_667_918 79
1112 3300038443 Ga0395901_0006572 Ga0395901_0006572_1070_1312 79
1113 3300038443 Ga0395901_0016439 Ga0395901_0016439_174_416 79
1114 3300038443 Ga0395901_0067639 Ga0395901_0067639_1847_2089 79
1115 3300038735 Ga0400485_10675 Ga0400485_10675_45078_45320 79
1116 3300038741 Ga0400488_07578 Ga0400488_07578_208_450 79
1117 3300038742 Ga0400486_19892 Ga0400486_19892_34520_34762 79
1118 3300039437 Ga0436365_0202876 Ga0436365_0202876_189_431 79
1119 3300039437 Ga0436365_1036213 Ga0436365_1036213_198_440 79
1120 3300039450 Ga0436363_0326680 Ga0436363_0326680_1440_1682 79
1121 3300039450 Ga0436363_0377735 Ga0436363_0377735_62_328 79
1122 3300039450 Ga0436363_0403742 Ga0436363_0403742_92_334 79
1123 3300039450 Ga0436363_0956449 Ga0436363_0956449_362_604 79
1124 3300039450 Ga0436363_1029895 Ga0436363_1029895_600_842 79
1125 3300039450 Ga0436363_1704859 Ga0436363_1704859_185_427 79
1126 3300039453 Ga0436362_0118329 Ga0436362_0118329_136_378 79
1127 3300039453 Ga0436362_1138355 Ga0436362_1138355_157_399 79
1128 3300039453 Ga0436362_1242332 Ga0436362_1242332_244_486 79
1129 3300041456 Ga0451795_1151956 Ga0451795_1151956_226_468 79
1130 3300041496 Ga0451839_0313739 Ga0451839_0313739_185_427 79
1131 3300041505 Ga0451849_1306778 Ga0451849_1306778_166_408 79
1132 3300041512 Ga0451853_2963819 Ga0451853_2963819_185_427 79
1133 3300044656 Ga0466969_0603499 Ga0466969_0603499_226_468 79
1134 3300044684 Ga0466966_0393496 Ga0466966_0393496_552_806 79
1135 3300044694 Ga0466963_0204446 Ga0466963_0204446_662_943 79
1136 3300044694 Ga0466963_0298575 Ga0466963_0298575_746_988 79
1137 3300044694 Ga0466963_0426645 Ga0466963_0426645_613_852 79
1138 3300044694 Ga0466963_0786047 Ga0466963_0786047_335_619 79
1139 3300044694 Ga0466963_1304994 Ga0466963_1304994_66_308 79
1140 3300044719 Ga0466971_0235789 Ga0466971_0235789_322_603 79
1141 3300044735 Ga0466968_0479737 Ga0466968_0479737_121_363 79
1142 3300044842 Ga0466957_0045922 Ga0466957_0045922_1979_2221 79
1143 3300044842 Ga0466957_0175020 Ga0466957_0175020_1020_1259 79
1144 3300044842 Ga0466957_0330370 Ga0466957_0330370_81_362 79
1145 3300044901 Ga0466960_0408831 Ga0466960_0408831_306_545 79
1146 3300045049 Ga0466959_0258694 Ga0466959_0258694_128_409 79
1147 3300045836 Ga0466958_0043030 Ga0466958_0043030_584_865 79
1148 3300045976 Ga0466967_0378156 Ga0466967_0378156_256_498 79
1149 3300045976 Ga0466967_1325915 Ga0466967_1325915_131_373 79
1150 3300045976 Ga0466967_1407393 Ga0466967_1407393_441_683 79
1151 3300045976 Ga0466967_1547739 Ga0466967_1547739_228_512 79
1152 3300045976 Ga0466967_2166790 Ga0466967_2166790_293_535 79
1153 3300045976 Ga0466967_2242082 Ga0466967_2242082_211_453 79
1154 3300046454 Ga0495592_0004050 Ga0495592_0004050_10077_10319 79
1155 3300046454 Ga0495592_0130591 Ga0495592_0130591_1364_1606 79
1156 3300046454 Ga0495592_0504550 Ga0495592_0504550_125_367 79
1157 3300046454 Ga0495592_0766057 Ga0495592_0766057_259_501 79
1158 3300046455 Ga0495603_0002150 Ga0495603_0002150_9769_10011 79
1159 3300046459 Ga0495629_0070231 Ga0495629_0070231_1506_1748 79
1160 3300046459 Ga0495629_0778027 Ga0495629_0778027_101_343 79
1161 3300046461 Ga0495641_0007009 Ga0495641_0007009_1504_1746 79
1162 3300046461 Ga0495641_0074505 Ga0495641_0074505_656_898 79
1163 3300046461 Ga0495641_0120527 Ga0495641_0120527_366_608 79
1164 3300046462 Ga0495651_0031212 Ga0495651_0031212_1830_2072 79
1165 3300046462 Ga0495651_0072366 Ga0495651_0072366_2329_2571 79
1166 3300046462 Ga0495651_0078639 Ga0495651_0078639_824_1066 79
1167 3300046462 Ga0495651_0322398 Ga0495651_0322398_555_797 79
1168 3300046462 Ga0495651_0339312 Ga0495651_0339312_328_570 79
1169 3300046463 Ga0495653_0014087 Ga0495653_0014087_5834_6076 79
1170 3300046463 Ga0495653_0073908 Ga0495653_0073908_2200_2442 79
1171 3300046463 Ga0495653_0272788 Ga0495653_0272788_305_547 79
1172 3300046472 Ga0495580_0322240 Ga0495580_0322240_281_523 79
1173 3300046473 Ga0495582_0019291 Ga0495582_0019291_293_535 79
1174 3300046473 Ga0495582_0036036 Ga0495582_0036036_1154_1396 79
1175 3300046475 Ga0495639_0003514 Ga0495639_0003514_1915_2157 79
1176 3300046475 Ga0495639_0114841 Ga0495639_0114841_235_477 79
1177 3300046475 Ga0495639_0251189 Ga0495639_0251189_263_505 79
1178 3300046476 Ga0495662_0001681 Ga0495662_0001681_4088_4330 79
1179 3300046476 Ga0495662_0090399 Ga0495662_0090399_1086_1328 79
1180 3300046476 Ga0495662_0095393 Ga0495662_0095393_942_1184 79
1181 3300046476 Ga0495662_0403286 Ga0495662_0403286_367_606 79
1182 3300046477 Ga0495664_0001236 Ga0495664_0001236_289_531 79
1183 3300046477 Ga0495664_0011092 Ga0495664_0011092_3664_3906 79
1184 3300046491 Ga0495584_0329618 Ga0495584_0329618_145_387 79
1185 3300046499 Ga0495594_0475355 Ga0495594_0475355_285_527 79
1186 3300046511 Ga0495608_0020590 Ga0495608_0020590_3468_3710 79
1187 3300046511 Ga0495608_0063065 Ga0495608_0063065_1041_1283 79
1188 3300046511 Ga0495608_0121399 Ga0495608_0121399_1173_1415 79
1189 3300046511 Ga0495608_0440258 Ga0495608_0440258_211_453 79
1190 3300046514 Ga0495618_0005033 Ga0495618_0005033_6467_6709 79
1191 3300046514 Ga0495618_0027019 Ga0495618_0027019_1125_1367 79
1192 3300046514 Ga0495618_0136024 Ga0495618_0136024_554_796 79
1193 3300046514 Ga0495618_0195175 Ga0495618_0195175_746_988 79
1194 3300046514 Ga0495618_0233137 Ga0495618_0233137_633_875 79
1195 3300046514 Ga0495618_0248451 Ga0495618_0248451_61_303 79
1196 3300046516 Ga0495628_0644172 Ga0495628_0644172_189_431 79
1197 3300046517 Ga0495630_0008015 Ga0495630_0008015_6606_6848 79
1198 3300046517 Ga0495630_0114406 Ga0495630_0114406_1600_1842 79
1199 3300046517 Ga0495630_0123494 Ga0495630_0123494_1458_1700 79
1200 3300046517 Ga0495630_0438356 Ga0495630_0438356_732_974 79
1201 3300046526 Ga0495666_0010911 Ga0495666_0010911_2246_2488 79
1202 3300046526 Ga0495666_0176903 Ga0495666_0176903_641_883 79
1203 3300046529 Ga0495652_0026425 Ga0495652_0026425_4494_4736 79
1204 3300046529 Ga0495652_0074158 Ga0495652_0074158_1011_1253 79
1205 3300046529 Ga0495652_0804679 Ga0495652_0804679_253_495 79
1206 3300046529 Ga0495652_0995578 Ga0495652_0995578_68_310 79
1207 3300046531 Ga0495665_0006066 Ga0495665_0006066_1570_1812 79
1208 3300046531 Ga0495665_0326349 Ga0495665_0326349_355_597 79
1209 3300046531 Ga0495665_0381970 Ga0495665_0381970_254_496 79
1210 3300046533 Ga0495640_0002357 Ga0495640_0002357_6056_6298 79
1211 3300046533 Ga0495640_0611716 Ga0495640_0611716_64_306 79
1212 3300046533 Ga0495640_0959171 Ga0495640_0959171_100_342 79
1213 3300046535 Ga0495586_0081561 Ga0495586_0081561_370_612 79
1214 3300046535 Ga0495586_0320837 Ga0495586_0320837_337_579 79
1215 3300046536 Ga0495587_0027514 Ga0495587_0027514_2336_2578 79
1216 3300046536 Ga0495587_0040506 Ga0495587_0040506_242_484 79
1217 3300046536 Ga0495587_0095679 Ga0495587_0095679_384_626 79
1218 3300046536 Ga0495587_0113294 Ga0495587_0113294_492_734 79
1219 3300046543 Ga0495645_0077238 Ga0495645_0077238_140_382 79
1220 3300046543 Ga0495645_0150373 Ga0495645_0150373_910_1152 79
1221 3300046543 Ga0495645_0244786 Ga0495645_0244786_257_499 79
1222 3300046543 Ga0495645_0338115 Ga0495645_0338115_716_958 79
1223 3300046543 Ga0495645_0941443 Ga0495645_0941443_33_275 79
1224 3300046557 Ga0495622_0408415 Ga0495622_0408415_162_404 79
1225 3300046559 Ga0495667_0004440 Ga0495667_0004440_3227_3469 79
1226 3300046559 Ga0495667_0064217 Ga0495667_0064217_1998_2240 79
1227 3300046559 Ga0495667_0110085 Ga0495667_0110085_478_720 79
1228 3300046559 Ga0495667_0929295 Ga0495667_0929295_139_381 79
1229 3300046559 Ga0495667_0941437 Ga0495667_0941437_24_266 79
1230 3300046642 Ga0495634_0208614 Ga0495634_0208614_301_543 79
1231 3300046642 Ga0495634_0220341 Ga0495634_0220341_562_804 79
1232 3300046642 Ga0495634_0261944 Ga0495634_0261944_369_611 79
1233 3300046642 Ga0495634_0372345 Ga0495634_0372345_509_751 79
1234 3300046663 Ga0495635_0008824 Ga0495635_0008824_1364_1606 79
1235 3300046663 Ga0495635_0013490 Ga0495635_0013490_332_574 79
1236 3300046663 Ga0495635_0035505 Ga0495635_0035505_1381_1623 79
1237 3300046663 Ga0495635_0256313 Ga0495635_0256313_770_1012 79
1238 3300046663 Ga0495635_1044190 Ga0495635_1044190_26_268 79
1239 3300046675 Ga0495657_0061303 Ga0495657_0061303_1095_1337 79
1240 3300046675 Ga0495657_0103365 Ga0495657_0103365_1419_1661 79
1241 3300046675 Ga0495657_0156800 Ga0495657_0156800_340_582 79
1242 3300046678 Ga0495599_0031739 Ga0495599_0031739_70_312 79
1243 3300046678 Ga0495599_0101766 Ga0495599_0101766_853_1095 79
1244 3300046678 Ga0495599_0168390 Ga0495599_0168390_113_355 79
1245 3300046678 Ga0495599_0250486 Ga0495599_0250486_785_1027 79
1246 3300046678 Ga0495599_0435956 Ga0495599_0435956_394_636 79
1247 3300046679 Ga0495623_0019745 Ga0495623_0019745_1524_1766 79
1248 3300046680 Ga0495646_0003156 Ga0495646_0003156_9149_9391 79
1249 3300046680 Ga0495646_0090515 Ga0495646_0090515_485_727 79
1250 3300046680 Ga0495646_0129987 Ga0495646_0129987_370_612 79
1251 3300046680 Ga0495646_0438555 Ga0495646_0438555_230_472 79
1252 3300046681 Ga0495647_0010925 Ga0495647_0010925_1551_1793 79
1253 3300046683 Ga0495658_0001644 Ga0495658_0001644_3471_3713 79
1254 3300046683 Ga0495658_1044602 Ga0495658_1044602_202_444 79
1255 3300046690 Ga0495624_0004179 Ga0495624_0004179_2825_3067 79
1256 3300046690 Ga0495624_0023935 Ga0495624_0023935_2456_2698 79
1257 3300046809 Ga0495600_0018968 Ga0495600_0018968_2919_3161 79
1258 3300046809 Ga0495600_0049307 Ga0495600_0049307_1333_1575 79
1259 3300046809 Ga0495600_0088071 Ga0495600_0088071_796_1038 79
1260 3300046809 Ga0495600_0160457 Ga0495600_0160457_745_987 79
1261 3300046809 Ga0495600_0485621 Ga0495600_0485621_368_610 79
1262 3300047315 Ga0495581_0011512 Ga0495581_0011512_1419_1661 79
1263 3300047315 Ga0495581_0015606 Ga0495581_0015606_3813_4055 79
1264 3300047315 Ga0495581_0146935 Ga0495581_0146935_808_1050 79
1265 3300047317 Ga0495604_0069523 Ga0495604_0069523_882_1124 79
1266 3300047317 Ga0495604_0226889 Ga0495604_0226889_806_1048 79
1267 3300047317 Ga0495604_0441381 Ga0495604_0441381_269_511 79
1268 3300047319 Ga0495674_0026901 Ga0495674_0026901_225_467 79
1269 3300047319 Ga0495674_0137470 Ga0495674_0137470_1261_1503 79
1270 3300047319 Ga0495674_0336004 Ga0495674_0336004_402_644 79
1271 3300047319 Ga0495674_0343040 Ga0495674_0343040_407_649 79
1272 3300047319 Ga0495674_0344995 Ga0495674_0344995_272_514 79
1273 3300047319 Ga0495674_0433599 Ga0495674_0433599_668_910 79
1274 3300047321 Ga0495676_0004841 Ga0495676_0004841_3294_3536 79
1275 3300047321 Ga0495676_0041953 Ga0495676_0041953_287_529 79
1276 3300047321 Ga0495676_0310957 Ga0495676_0310957_555_797 79
1277 3300047322 Ga0495680_0003883 Ga0495680_0003883_9781_10023 79
1278 3300047322 Ga0495680_0032643 Ga0495680_0032643_289_531 79
1279 3300047322 Ga0495680_0037880 Ga0495680_0037880_1566_1808 79
1280 3300047322 Ga0495680_0081250 Ga0495680_0081250_952_1194 79
1281 3300047444 Ga0495675_0152589 Ga0495675_0152589_100_342 79
1282 3300047471 Ga0495684_0000810 Ga0495684_0000810_22266_22508 79
1283 3300047471 Ga0495684_0007677 Ga0495684_0007677_2669_2911 79
1284 3300047471 Ga0495684_0017316 Ga0495684_0017316_911_1153 79
1285 3300047471 Ga0495684_0075255 Ga0495684_0075255_1052_1294 79
1286 3300047673 Ga0495593_0063967 Ga0495593_0063967_104_346 79
1287 3300047673 Ga0495593_0099097 Ga0495593_0099097_66_308 79
1288 3300048088 Ga0495602_0069438 Ga0495602_0069438_1029_1271 79
1289 3300048088 Ga0495602_0225719 Ga0495602_0225719_894_1136 79
1290 3300048088 Ga0495602_0250193 Ga0495602_0250193_914_1156 79
1291 3300048088 Ga0495602_0588749 Ga0495602_0588749_280_522 79
1292 3300048089 Ga0495614_0012710 Ga0495614_0012710_1231_1473 79
1293 3300048903 Ga0496100_0158533 Ga0496100_0158533_192_434 79
1294 3300048904 Ga0496101_0147634 Ga0496101_0147634_112_354 79
1295 3300048905 Ga0496102_0299487 Ga0496102_0299487_23_265 79
1296 3300048906 Ga0496103_0558539 Ga0496103_0558539_254_496 79
1297 3300048907 Ga0496104_0007413 Ga0496104_0007413_1909_2151 79
1298 3300048907 Ga0496104_0333584 Ga0496104_0333584_308_550 79
1299 3300048907 Ga0496104_0646186 Ga0496104_0646186_137_379 79
1300 3300048908 Ga0496105_0184309 Ga0496105_0184309_1236_1478 79
1301 3300048908 Ga0496105_0413815 Ga0496105_0413815_404_646 79
1302 3300048909 Ga0496106_0181361 Ga0496106_0181361_269_511 79
1303 3300048910 Ga0496107_0102922 Ga0496107_0102922_261_503 79
1304 3300048911 Ga0496108_0234943 Ga0496108_0234943_237_479 79
1305 3300048911 Ga0496108_0842174 Ga0496108_0842174_378_620 79
1306 3300048911 Ga0496108_1188763 Ga0496108_1188763_81_323 79
1307 3300048912 Ga0496109_0103527 Ga0496109_0103527_228_470 79
1308 3300048912 Ga0496109_0317305 Ga0496109_0317305_255_497 79
1309 3300048913 Ga0496110_0009984 Ga0496110_0009984_2443_2685 79
1310 3300048913 Ga0496110_0102588 Ga0496110_0102588_165_407 79
1311 3300048913 Ga0496110_1592914 Ga0496110_1592914_225_467 79
1312 3300048914 Ga0496111_0018031 Ga0496111_0018031_4444_4686 79
1313 3300048914 Ga0496111_0094504 Ga0496111_0094504_1692_1934 79
1314 3300048915 Ga0496112_0166221 Ga0496112_0166221_250_492 79
1315 3300048915 Ga0496112_0376667 Ga0496112_0376667_643_885 79
1316 3300048915 Ga0496112_0946686 Ga0496112_0946686_236_478 79
1317 3300048916 Ga0496113_0314692 Ga0496113_0314692_415_657 79
1318 3300048917 Ga0496114_0699036 Ga0496114_0699036_357_599 79
1319 3300048917 Ga0496114_1371015 Ga0496114_1371015_242_484 79
1320 3300048918 Ga0496115_0144316 Ga0496115_0144316_1506_1748 79
1321 3300048918 Ga0496115_0462089 Ga0496115_0462089_696_938 79
1322 3300049568 Ga0501031_0018443 Ga0501031_0018443_2936_3178 79
1323 3300049568 Ga0501031_0091990 Ga0501031_0091990_676_915 79
1324 3300049569 Ga0501032_0106821 Ga0501032_0106821_875_1117 79
1325 3300049569 Ga0501032_0309537 Ga0501032_0309537_648_887 79
1326 3300049570 Ga0501033_0030645 Ga0501033_0030645_1315_1557 79
1327 3300049571 Ga0501034_0013302 Ga0501034_0013302_5490_5732 79
1328 3300049571 Ga0501034_1254483 Ga0501034_1254483_141_383 79
1329 3300049572 Ga0501036_0011799 Ga0501036_0011799_2261_2503 79
1330 3300049572 Ga0501036_0043720 Ga0501036_0043720_544_786 79
1331 3300049573 Ga0501037_0099230 Ga0501037_0099230_1294_1536 79
1332 3300049573 Ga0501037_0319474 Ga0501037_0319474_236_478 79
1333 3300049573 Ga0501037_0402308 Ga0501037_0402308_683_922 79
1334 3300049574 Ga0501038_0007476 Ga0501038_0007476_4611_4853 79
1335 3300049574 Ga0501038_0025207 Ga0501038_0025207_2883_3125 79
1336 3300049575 Ga0501039_0003111 Ga0501039_0003111_9111_9353 79
1337 3300049575 Ga0501039_0045870 Ga0501039_0045870_2400_2642 79
1338 3300049576 Ga0501040_0022834 Ga0501040_0022834_2168_2407 79
1339 3300049576 Ga0501040_0028056 Ga0501040_0028056_502_744 79
1340 3300049577 Ga0501041_0016110 Ga0501041_0016110_1209_1451 79
1341 3300049577 Ga0501041_0105568 Ga0501041_0105568_177_416 79
1342 3300049577 Ga0501041_0931405 Ga0501041_0931405_295_537 79
1343 3300049578 Ga0501042_0000760 Ga0501042_0000760_8102_8344 79
1344 3300049578 Ga0501042_0008755 Ga0501042_0008755_79_321 79
1345 3300049578 Ga0501042_0222342 Ga0501042_0222342_1009_1248 79
1346 3300049578 Ga0501042_1205579 Ga0501042_1205579_169_408 79
1347 3300049579 Ga0501043_0007270 Ga0501043_0007270_2694_2936 79
1348 3300049579 Ga0501043_0092816 Ga0501043_0092816_1262_1504 79
1349 3300049579 Ga0501043_0857184 Ga0501043_0857184_323_562 79
1350 3300049580 Ga0501046_0002518 Ga0501046_0002518_10968_11210 79
1351 3300049581 Ga0501047_0007134 Ga0501047_0007134_4978_5220 79
1352 3300049582 Ga0501048_0000773 Ga0501048_0000773_10081_10323 79
1353 3300049582 Ga0501048_0005324 Ga0501048_0005324_4225_4467 79
1354 3300049582 Ga0501048_0140593 Ga0501048_0140593_184_423 79
1355 3300049584 Ga0501068_0268265 Ga0501068_0268265_622_864 79
1356 3300049585 Ga0501069_0054768 Ga0501069_0054768_362_622 79
1357 3300049585 Ga0501069_0117562 Ga0501069_0117562_449_691 79
1358 3300049586 Ga0501070_0022496 Ga0501070_0022496_4744_5004 79
1359 3300049586 Ga0501070_0469399 Ga0501070_0469399_216_458 79
1360 3300049586 Ga0501070_1477125 Ga0501070_1477125_127_366 79
1361 3300049587 Ga0501071_0009752 Ga0501071_0009752_3985_4227 79
1362 3300049587 Ga0501071_0158485 Ga0501071_0158485_993_1253 79
1363 3300049587 Ga0501071_0170141 Ga0501071_0170141_492_731 79
1364 3300049588 Ga0501072_0028390 Ga0501072_0028390_2728_2970 79
1365 3300049589 Ga0501073_0089752 Ga0501073_0089752_456_698 79
1366 3300049589 Ga0501073_0468976 Ga0501073_0468976_562_804 79
1367 3300049589 Ga0501073_0518400 Ga0501073_0518400_94_354 79
1368 3300049590 Ga0501074_0001689 Ga0501074_0001689_11509_11751 79
1369 3300049590 Ga0501074_0012879 Ga0501074_0012879_2825_3067 79
1370 3300049590 Ga0501074_0631874 Ga0501074_0631874_404_664 79
1371 3300049591 Ga0501075_0026360 Ga0501075_0026360_2874_3116 79
1372 3300049591 Ga0501075_0532538 Ga0501075_0532538_391_630 79
1373 3300049592 Ga0501076_0003546 Ga0501076_0003546_2196_2438 79
1374 3300049592 Ga0501076_0086651 Ga0501076_0086651_251_490 79
1375 3300049593 Ga0501077_0003884 Ga0501077_0003884_7315_7557 79
1376 3300049705 Ga0501225_0256882 Ga0501225_0256882_230_472 79
1377 3300049741 Ga0501079_0052326 Ga0501079_0052326_1351_1593 79
1378 3300049741 Ga0501079_0650803 Ga0501079_0650803_437_676 79
1379 3300049742 Ga0501080_0059585 Ga0501080_0059585_338_580 79
1380 3300049742 Ga0501080_0097264 Ga0501080_0097264_2200_2460 79
1381 3300049742 Ga0501080_0423395 Ga0501080_0423395_905_1147 79
1382 3300049743 Ga0501081_0006710 Ga0501081_0006710_2887_3129 79
1383 3300049822 Ga0501035_0066327 Ga0501035_0066327_1084_1326 79
1384 3300049822 Ga0501035_0283806 Ga0501035_0283806_1013_1252 79
1385 3300049823 Ga0501044_0027438 Ga0501044_0027438_3393_3635 79
1386 3300049823 Ga0501044_0127867 Ga0501044_0127867_249_491 79
1387 3300049823 Ga0501044_0140509 Ga0501044_0140509_1937_2179 79
1388 3300049823 Ga0501044_0234054 Ga0501044_0234054_277_516 79
1389 3300049823 Ga0501044_1381444 Ga0501044_1381444_17_256 79
1390 3300049824 Ga0501045_0014824 Ga0501045_0014824_3026_3268 79
1391 3300049824 Ga0501045_1124352 Ga0501045_1124352_276_518 79
1392 3300050511 nmdc:mga08y16_1833589_c1 nmdc:mga08y16_1833589_c1_179_418 79
1393 3300050512 nmdc:mga0n895_2159087_c1 nmdc:mga0n895_2159087_c1_218_460 79
1394 3300050513 nmdc:mga0rr50_1563603_c1 nmdc:mga0rr50_1563603_c1_302_544 79
1395 3300050513 nmdc:mga0rr50_202812_c1 nmdc:mga0rr50_202812_c1_1251_1493 79
1396 3300050513 nmdc:mga0rr50_713024_c1 nmdc:mga0rr50_713024_c1_219_461 79
1397 3300050513 nmdc:mga0rr50_812381_c1 nmdc:mga0rr50_812381_c1_271_513 79
1398 3300050514 nmdc:mga08x19_288167_c1 nmdc:mga08x19_288167_c1_169_411 79
1399 3300050514 nmdc:mga08x19_318293_c1 nmdc:mga08x19_318293_c1_531_773 79
1400 3300050514 nmdc:mga08x19_487253_c1 nmdc:mga08x19_487253_c1_393_635 79
1401 3300053077 Ga0495601_0005798 Ga0495601_0005798_1364_1606 79
1402 3300053077 Ga0495601_0926941 Ga0495601_0926941_284_526 79
1403 3300053077 Ga0495601_1055450 Ga0495601_1055450_216_458 79
1404 3300053078 Ga0495612_0067698 Ga0495612_0067698_273_515 79
1405 3300053084 Ga0495595_0073097 Ga0495595_0073097_152_394 79
1406 3300053084 Ga0495595_0081867 Ga0495595_0081867_471_713 79
1407 3300053085 Ga0495619_0005002 Ga0495619_0005002_7942_8184 79
1408 3300053085 Ga0495619_0064065 Ga0495619_0064065_1720_1962 79
1409 3300053085 Ga0495619_0090021 Ga0495619_0090021_167_409 79
1410 3300053085 Ga0495619_1076932 Ga0495619_1076932_30_272 79
1411 3300053096 Ga0500641_0113799 Ga0500641_0113799_412_654 79
1412 3300054114 Ga0501084_0058250 Ga0501084_0058250_606_848 79
1413 3300054114 Ga0501084_1598358 Ga0501084_1598358_39_278 79
1414 3300060353 Ga0501082_0003303 Ga0501082_0003303_12150_12392 79
1415 3300061734 Ga0530510_0006437 Ga0530510_0006437_5000_5242 79
1416 3300061734 Ga0530510_0766047 Ga0530510_0766047_102_341 79
1417 3300000549 LJQas_1008768 LJQas_10087681 80
1418 3300001979 JGI24740J21852_10172225 JGI24740J21852_101722252 80
1419 3300001989 JGI24739J22299_10187509 JGI24739J22299_101875093 80
1420 3300003162 Ga0006778J45830_1036778 Ga0006778J45830_10367782 80
1421 3300003911 JGI25405J52794_10104979 JGI25405J52794_101049792 80
1422 3300005327 Ga0070658_10212732 Ga0070658_102127323 80
1423 3300005329 Ga0070683_100003580 Ga0070683_1000035808 80
1424 3300005329 Ga0070683_100114533 Ga0070683_1001145333 80
1425 3300005329 Ga0070683_100310326 Ga0070683_1003103262 80
1426 3300005330 Ga0070690_100243197 Ga0070690_1002431972 80
1427 3300005334 Ga0068869_100697216 Ga0068869_1006972162 80
1428 3300005337 Ga0070682_100230828 Ga0070682_1002308282 80
1429 3300005337 Ga0070682_100256881 Ga0070682_1002568812 80
1430 3300005337 Ga0070682_100645277 Ga0070682_1006452772 80
1431 3300005339 Ga0070660_100006248 Ga0070660_1000062487 80
1432 3300005339 Ga0070660_100189051 Ga0070660_1001890512 80
1433 3300005343 Ga0070687_100031880 Ga0070687_1000318802 80
1434 3300005344 Ga0070661_100148179 Ga0070661_1001481792 80
1435 3300005345 Ga0070692_10017840 Ga0070692_100178405 80
1436 3300005347 Ga0070668_101590702 Ga0070668_1015907021 80
1437 3300005355 Ga0070671_100950276 Ga0070671_1009502762 80
1438 3300005356 Ga0070674_101610245 Ga0070674_1016102451 80
1439 3300005366 Ga0070659_100221789 Ga0070659_1002217893 80
1440 3300005366 Ga0070659_100290788 Ga0070659_1002907882 80
1441 3300005435 Ga0070714_100000837 Ga0070714_10000083720 80
1442 3300005438 Ga0070701_10754216 Ga0070701_107542162 80
1443 3300005438 Ga0070701_11420117 Ga0070701_114201171 80
1444 3300005441 Ga0070700_100118012 Ga0070700_1001180123 80
1445 3300005456 Ga0070678_100746749 Ga0070678_1007467492 80
1446 3300005456 Ga0070678_101082339 Ga0070678_1010823392 80
1447 3300005457 Ga0070662_100317445 Ga0070662_1003174452 80
1448 3300005458 Ga0070681_10630571 Ga0070681_106305711 80
1449 3300005458 Ga0070681_11219011 Ga0070681_112190111 80
1450 3300005530 Ga0070679_100037489 Ga0070679_1000374896 80
1451 3300005535 Ga0070684_100003060 Ga0070684_10000306011 80
1452 3300005535 Ga0070684_100307288 Ga0070684_1003072882 80
1453 3300005544 Ga0070686_100972548 Ga0070686_1009725481 80
1454 3300005546 Ga0070696_100265661 Ga0070696_1002656612 80
1455 3300005547 Ga0070693_101058367 Ga0070693_1010583671 80
1456 3300005549 Ga0070704_101023027 Ga0070704_1010230272 80
1457 3300005563 Ga0068855_100540258 Ga0068855_1005402582 80
1458 3300005564 Ga0070664_101529333 Ga0070664_1015293332 80
1459 3300005564 Ga0070664_101748626 Ga0070664_1017486261 80
1460 3300005577 Ga0068857_100011758 Ga0068857_1000117586 80
1461 3300005614 Ga0068856_100105300 Ga0068856_1001053003 80
1462 3300005614 Ga0068856_102103747 Ga0068856_1021037472 80
1463 3300005615 Ga0070702_100164324 Ga0070702_1001643242 80
1464 3300005615 Ga0070702_100557580 Ga0070702_1005575802 80
1465 3300005615 Ga0070702_100951855 Ga0070702_1009518551 80
1466 3300005618 Ga0068864_100029864 Ga0068864_1000298643 80
1467 3300005618 Ga0068864_102372987 Ga0068864_1023729872 80
1468 3300005718 Ga0068866_10312160 Ga0068866_103121602 80
1469 3300005719 Ga0068861_100584359 Ga0068861_1005843592 80
1470 3300005841 Ga0068863_100559307 Ga0068863_1005593072 80
1471 3300005843 Ga0068860_100513555 Ga0068860_1005135552 80
1472 3300005937 Ga0081455_10001385 Ga0081455_1000138521 80
1473 3300005937 Ga0081455_10222575 Ga0081455_102225753 80
1474 3300005981 Ga0081538_10002379 Ga0081538_1000237910 80
1475 3300005981 Ga0081538_10064741 Ga0081538_100647413 80
1476 3300006038 Ga0075365_10123768 Ga0075365_101237683 80
1477 3300006038 Ga0075365_11221351 Ga0075365_112213511 80
1478 3300006058 Ga0075432_10058515 Ga0075432_100585153 80
1479 3300006237 Ga0097621_100253380 Ga0097621_1002533802 80
1480 3300006358 Ga0068871_100545333 Ga0068871_1005453332 80
1481 3300006844 Ga0075428_100260732 Ga0075428_1002607323 80
1482 3300006846 Ga0075430_100148149 Ga0075430_1001481492 80
1483 3300006846 Ga0075430_100938843 Ga0075430_1009388432 80
1484 3300006847 Ga0075431_100001420 Ga0075431_10000142016 80
1485 3300006847 Ga0075431_100017445 Ga0075431_1000174452 80
1486 3300006871 Ga0075434_100130981 Ga0075434_1001309812 80
1487 3300006880 Ga0075429_100013829 Ga0075429_1000138297 80
1488 3300009094 Ga0111539_11574955 Ga0111539_115749552 80
1489 3300009098 Ga0105245_10046775 Ga0105245_100467752 80
1490 3300009098 Ga0105245_11233005 Ga0105245_112330052 80
1491 3300009098 Ga0105245_11908295 Ga0105245_119082951 80
1492 3300009147 Ga0114129_10193466 Ga0114129_101934665 80
1493 3300009148 Ga0105243_10085019 Ga0105243_100850193 80
1494 3300009148 Ga0105243_11703000 Ga0105243_117030002 80
1495 3300009148 Ga0105243_13135888 Ga0105243_131358882 80
1496 3300009176 Ga0105242_10384252 Ga0105242_103842522 80
1497 3300009177 Ga0105248_10254018 Ga0105248_102540183 80
1498 3300009545 Ga0105237_10451223 Ga0105237_104512232 80
1499 3300009553 Ga0105249_10979119 Ga0105249_109791192 80
1500 3300010375 Ga0105239_10258308 Ga0105239_102583082 80
1501 3300010375 Ga0105239_12228427 Ga0105239_122284272 80
1502 3300011119 Ga0105246_10004996 Ga0105246_1000499610 80
1503 3300011119 Ga0105246_10776065 Ga0105246_107760652 80
1504 3300013102 Ga0157371_10260697 Ga0157371_102606971 80
1505 3300013104 Ga0157370_10625665 Ga0157370_106256652 80
1506 3300013105 Ga0157369_10128379 Ga0157369_101283792 80
1507 3300013105 Ga0157369_12589960 Ga0157369_125899602 80
1508 3300013296 Ga0157374_10485506 Ga0157374_104855061 80
1509 3300013297 Ga0157378_11094700 Ga0157378_110947002 80
1510 3300013297 Ga0157378_11574212 Ga0157378_115742123 80
1511 3300013306 Ga0163162_13078114 Ga0163162_130781142 80
1512 3300013307 Ga0157372_10114354 Ga0157372_101143542 80
1513 3300013307 Ga0157372_11024239 Ga0157372_110242392 80
1514 3300013307 Ga0157372_11910052 Ga0157372_119100522 80
1515 3300013307 Ga0157372_12282772 Ga0157372_122827722 80
1516 3300013308 Ga0157375_10200880 Ga0157375_102008802 80
1517 3300013308 Ga0157375_10511529 Ga0157375_105115292 80
1518 3300013308 Ga0157375_10991468 Ga0157375_109914682 80
1519 3300013308 Ga0157375_11093618 Ga0157375_110936182 80
1520 3300014325 Ga0163163_11092274 Ga0163163_110922741 80
1521 3300014325 Ga0163163_11117714 Ga0163163_111177142 80
1522 3300014325 Ga0163163_11360051 Ga0163163_113600511 80
1523 3300014325 Ga0163163_11732387 Ga0163163_117323872 80
1524 3300014326 Ga0157380_11870395 Ga0157380_118703951 80
1525 3300014497 Ga0182008_10011342 Ga0182008_100113422 80
1526 3300014497 Ga0182008_10107536 Ga0182008_101075361 80
1527 3300014745 Ga0157377_10922782 Ga0157377_109227822 80
1528 3300014968 Ga0157379_10011378 Ga0157379_100113786 80
1529 3300014969 Ga0157376_10340843 Ga0157376_103408433 80
1530 3300014969 Ga0157376_11182079 Ga0157376_111820792 80
1531 3300020069 Ga0197907_10053421 Ga0197907_100534212 80
1532 3300020070 Ga0206356_10650374 Ga0206356_106503741 80
1533 3300020070 Ga0206356_11705021 Ga0206356_117050212 80
1534 3300020075 Ga0206349_1943292 Ga0206349_19432922 80
1535 3300020081 Ga0206354_10551101 Ga0206354_105511012 80
1536 3300020081 Ga0206354_11356021 Ga0206354_113560211 80
1537 3300025321 Ga0207656_10487292 Ga0207656_104872921 80
1538 3300025899 Ga0207642_10892685 Ga0207642_108926851 80
1539 3300025901 Ga0207688_10065579 Ga0207688_100655793 80
1540 3300025901 Ga0207688_10444102 Ga0207688_104441022 80
1541 3300025904 Ga0207647_10012411 Ga0207647_100124113 80
1542 3300025908 Ga0207643_10452912 Ga0207643_104529122 80
1543 3300025909 Ga0207705_10681412 Ga0207705_106814122 80
1544 3300025912 Ga0207707_10367108 Ga0207707_103671082 80
1545 3300025912 Ga0207707_10857932 Ga0207707_108579322 80
1546 3300025914 Ga0207671_10196339 Ga0207671_101963392 80
1547 3300025917 Ga0207660_11488730 Ga0207660_114887302 80
1548 3300025919 Ga0207657_10251402 Ga0207657_102514022 80
1549 3300025919 Ga0207657_10590249 Ga0207657_105902492 80
1550 3300025920 Ga0207649_10630925 Ga0207649_106309252 80
1551 3300025921 Ga0207652_10114525 Ga0207652_101145252 80
1552 3300025927 Ga0207687_10244041 Ga0207687_102440412 80
1553 3300025927 Ga0207687_10617692 Ga0207687_106176922 80
1554 3300025929 Ga0207664_10005963 Ga0207664_100059635 80
1555 3300025932 Ga0207690_10463562 Ga0207690_104635622 80
1556 3300025932 Ga0207690_10592406 Ga0207690_105924062 80
1557 3300025932 Ga0207690_10812600 Ga0207690_108126002 80
1558 3300025933 Ga0207706_10310204 Ga0207706_103102042 80
1559 3300025934 Ga0207686_10225498 Ga0207686_102254982 80
1560 3300025934 Ga0207686_10349137 Ga0207686_103491373 80
1561 3300025934 Ga0207686_11802969 Ga0207686_118029691 80
1562 3300025935 Ga0207709_10020178 Ga0207709_100201785 80
1563 3300025935 Ga0207709_11160868 Ga0207709_111608682 80
1564 3300025936 Ga0207670_11598788 Ga0207670_115987882 80
1565 3300025937 Ga0207669_10304381 Ga0207669_103043812 80
1566 3300025940 Ga0207691_11267776 Ga0207691_112677762 80
1567 3300025942 Ga0207689_10638504 Ga0207689_106385042 80
1568 3300025942 Ga0207689_11175564 Ga0207689_111755642 80
1569 3300025944 Ga0207661_10289214 Ga0207661_102892142 80
1570 3300025944 Ga0207661_10413095 Ga0207661_104130952 80
1571 3300025944 Ga0207661_10584890 Ga0207661_105848902 80
1572 3300025944 Ga0207661_10630818 Ga0207661_106308182 80
1573 3300025944 Ga0207661_11437755 Ga0207661_114377552 80
1574 3300025944 Ga0207661_11618613 Ga0207661_116186131 80
1575 3300025945 Ga0207679_10074680 Ga0207679_100746802 80
1576 3300025949 Ga0207667_10483215 Ga0207667_104832152 80
1577 3300025986 Ga0207658_10434574 Ga0207658_104345742 80
1578 3300026023 Ga0207677_10278380 Ga0207677_102783802 80
1579 3300026035 Ga0207703_10351173 Ga0207703_103511732 80
1580 3300026041 Ga0207639_11916417 Ga0207639_119164171 80
1581 3300026075 Ga0207708_10218617 Ga0207708_102186172 80
1582 3300026078 Ga0207702_10212346 Ga0207702_102123462 80
1583 3300026078 Ga0207702_10439488 Ga0207702_104394883 80
1584 3300026088 Ga0207641_11498878 Ga0207641_114988782 80
1585 3300026089 Ga0207648_11297114 Ga0207648_112971141 80
1586 3300026095 Ga0207676_10032703 Ga0207676_100327033 80
1587 3300026095 Ga0207676_10759772 Ga0207676_107597722 80
1588 3300026116 Ga0207674_10036829 Ga0207674_100368296 80
1589 3300026118 Ga0207675_100200744 Ga0207675_1002007442 80
1590 3300026121 Ga0207683_10759645 Ga0207683_107596452 80
1591 3300026142 Ga0207698_10282883 Ga0207698_102828832 80
1592 3300026142 Ga0207698_11799003 Ga0207698_117990032 80
1593 3300027907 Ga0207428_10014416 Ga0207428_100144166 80
1594 3300028381 Ga0268264_10613051 Ga0268264_106130512 80
1595 3300031731 Ga0307405_10168145 Ga0307405_101681453 80
1596 3300031852 Ga0307410_10127812 Ga0307410_101278123 80
1597 3300031852 Ga0307410_10761354 Ga0307410_107613542 80
1598 3300031901 Ga0307406_10035116 Ga0307406_100351163 80
1599 3300031901 Ga0307406_10213296 Ga0307406_102132963 80
1600 3300031903 Ga0307407_11022376 Ga0307407_110223761 80
1601 3300031911 Ga0307412_10219923 Ga0307412_102199233 80
1602 3300031995 Ga0307409_100094112 Ga0307409_1000941122 80
1603 3300031995 Ga0307409_100100470 Ga0307409_1001004702 80
1604 3300031995 Ga0307409_100269816 Ga0307409_1002698163 80
1605 3300031995 Ga0307409_102874903 Ga0307409_1028749031 80
1606 3300032002 Ga0307416_100009883 Ga0307416_1000098834 80
1607 3300032002 Ga0307416_100128930 Ga0307416_1001289303 80
1608 3300032002 Ga0307416_102612723 Ga0307416_1026127232 80
1609 3300032002 Ga0307416_103359694 Ga0307416_1033596942 80
1610 3300032002 Ga0307416_103546332 Ga0307416_1035463321 80
1611 3300032004 Ga0307414_10369459 Ga0307414_103694592 80
1612 3300032126 Ga0307415_100021230 Ga0307415_1000212302 80
1613 3300032126 Ga0307415_100062327 Ga0307415_1000623273 80
1614 3300032126 Ga0307415_100071541 Ga0307415_1000715413 80
1615 3300032126 Ga0307415_102584202 Ga0307415_1025842021 80
1616 3300035170 Ga0373943_0493834 Ga0373943_0493834_377_619 80
1617 3300037418 Ga0395900_0103460 Ga0395900_0103460_1504_1746 80
1618 3300037466 Ga0395898_0004699 Ga0395898_0004699_6193_6435 80
1619 3300038443 Ga0395901_0191216 Ga0395901_0191216_1112_1354 80
1620 3300041456 Ga0451795_0074536 Ga0451795_0074536_216_458 80
1621 3300041512 Ga0451853_4037286 Ga0451853_4037286_112_354 80
1622 3300044656 Ga0466969_0019444 Ga0466969_0019444_1072_1314 80
1623 3300044658 Ga0466972_0379039 Ga0466972_0379039_318_560 80
1624 3300044683 Ga0466965_0021080 Ga0466965_0021080_183_425 80
1625 3300044684 Ga0466966_0002271 Ga0466966_0002271_1032_1274 80
1626 3300044684 Ga0466966_0296559 Ga0466966_0296559_511_753 80
1627 3300044693 Ga0466961_0074815 Ga0466961_0074815_951_1193 80
1628 3300044693 Ga0466961_0084894 Ga0466961_0084894_266_508 80
1629 3300044694 Ga0466963_0243562 Ga0466963_0243562_86_328 80
1630 3300044694 Ga0466963_0324670 Ga0466963_0324670_216_458 80
1631 3300044694 Ga0466963_0448366 Ga0466963_0448366_580_822 80
1632 3300044706 Ga0466964_0045111 Ga0466964_0045111_186_428 80
1633 3300044719 Ga0466971_0002276 Ga0466971_0002276_6776_7018 80
1634 3300044765 Ga0466970_0026035 Ga0466970_0026035_1025_1267 80
1635 3300044765 Ga0466970_0338679 Ga0466970_0338679_599_841 80
1636 3300044842 Ga0466957_0056681 Ga0466957_0056681_1044_1286 80
1637 3300044842 Ga0466957_0570196 Ga0466957_0570196_536_778 80
1638 3300044842 Ga0466957_1008021 Ga0466957_1008021_203_445 80
1639 3300044901 Ga0466960_0157988 Ga0466960_0157988_307_549 80
1640 3300044901 Ga0466960_0453047 Ga0466960_0453047_394_636 80
1641 3300044901 Ga0466960_0720797 Ga0466960_0720797_97_339 80
1642 3300045049 Ga0466959_0025174 Ga0466959_0025174_1005_1247 80
1643 3300045051 Ga0451576_0149961 Ga0451576_0149961_1705_1947 80
1644 3300045836 Ga0466958_0140968 Ga0466958_0140968_1133_1375 80
1645 3300045836 Ga0466958_0429709 Ga0466958_0429709_233_475 80
1646 3300045976 Ga0466967_0040657 Ga0466967_0040657_2677_2919 80
1647 3300045976 Ga0466967_0097768 Ga0466967_0097768_2147_2389 80
1648 3300045976 Ga0466967_0134611 Ga0466967_0134611_946_1188 80
1649 3300045976 Ga0466967_0194336 Ga0466967_0194336_1053_1295 80
1650 3300045976 Ga0466967_0249715 Ga0466967_0249715_1248_1490 80
1651 3300045976 Ga0466967_0362035 Ga0466967_0362035_948_1190 80
1652 3300045976 Ga0466967_0520696 Ga0466967_0520696_583_825 80
1653 3300045976 Ga0466967_0685085 Ga0466967_0685085_502_744 80
1654 3300045976 Ga0466967_1579762 Ga0466967_1579762_383_625 80
1655 3300046455 Ga0495603_0118373 Ga0495603_0118373_159_401 80
1656 3300046459 Ga0495629_0539538 Ga0495629_0539538_523_765 80
1657 3300046461 Ga0495641_0538300 Ga0495641_0538300_182_424 80
1658 3300046525 Ga0495663_0280199 Ga0495663_0280199_72_314 80
1659 3300048903 Ga0496100_0247619 Ga0496100_0247619_893_1135 80
1660 3300048903 Ga0496100_1288464 Ga0496100_1288464_141_383 80
1661 3300048903 Ga0496100_1545456 Ga0496100_1545456_101_343 80
1662 3300048904 Ga0496101_0323829 Ga0496101_0323829_431_673 80
1663 3300048904 Ga0496101_0506204 Ga0496101_0506204_118_360 80
1664 3300048904 Ga0496101_0755991 Ga0496101_0755991_318_560 80
1665 3300048905 Ga0496102_0024100 Ga0496102_0024100_4995_5237 80
1666 3300048905 Ga0496102_0028959 Ga0496102_0028959_555_797 80
1667 3300048905 Ga0496102_1400670 Ga0496102_1400670_317_559 80
1668 3300048906 Ga0496103_0020693 Ga0496103_0020693_1154_1396 80
1669 3300048906 Ga0496103_0038165 Ga0496103_0038165_236_478 80
1670 3300048907 Ga0496104_0020648 Ga0496104_0020648_277_519 80
1671 3300048908 Ga0496105_0024124 Ga0496105_0024124_4426_4668 80
1672 3300048910 Ga0496107_0180682 Ga0496107_0180682_631_873 80
1673 3300048910 Ga0496107_0225973 Ga0496107_0225973_683_925 80
1674 3300048910 Ga0496107_0565311 Ga0496107_0565311_189_431 80
1675 3300048912 Ga0496109_0021762 Ga0496109_0021762_4597_4839 80
1676 3300048912 Ga0496109_0045334 Ga0496109_0045334_3218_3460 80
1677 3300048912 Ga0496109_0216005 Ga0496109_0216005_984_1226 80
1678 3300048912 Ga0496109_1216212 Ga0496109_1216212_279_521 80
1679 3300048913 Ga0496110_0387700 Ga0496110_0387700_849_1091 80
1680 3300048914 Ga0496111_0218670 Ga0496111_0218670_463_705 80
1681 3300048914 Ga0496111_1040400 Ga0496111_1040400_86_328 80
1682 3300048916 Ga0496113_0514667 Ga0496113_0514667_339_581 80
1683 3300048917 Ga0496114_0005878 Ga0496114_0005878_1764_2006 80
1684 3300048917 Ga0496114_0081218 Ga0496114_0081218_1385_1627 80
1685 3300048917 Ga0496114_0185137 Ga0496114_0185137_1466_1708 80
1686 3300048918 Ga0496115_0021174 Ga0496115_0021174_222_464 80
1687 3300048918 Ga0496115_0439853 Ga0496115_0439853_166_408 80
1688 3300049127 Ga0501306_007586 Ga0501306_007586_511_753 80
1689 3300049127 Ga0501306_015382 Ga0501306_015382_62_304 80
1690 3300049128 Ga0501308_012673 Ga0501308_012673_644_886 80
1691 3300049128 Ga0501308_016897 Ga0501308_016897_82_324 80
1692 3300049128 Ga0501308_018721 Ga0501308_018721_171_413 80
1693 3300049128 Ga0501308_074039 Ga0501308_074039_30_272 80
1694 3300049129 Ga0501309_020436 Ga0501309_020436_420_662 80
1695 3300049129 Ga0501309_051569 Ga0501309_051569_334_576 80
1696 3300049129 Ga0501309_066738 Ga0501309_066738_264_506 80
1697 3300049130 Ga0501310_009270 Ga0501310_009270_443_685 80
1698 3300049130 Ga0501310_011114 Ga0501310_011114_719_961 80
1699 3300049130 Ga0501310_012651 Ga0501310_012651_243_485 80
1700 3300049130 Ga0501310_012754 Ga0501310_012754_26_268 80
1701 3300049161 Ga0501305_084456 Ga0501305_084456_271_513 80
1702 3300049161 Ga0501305_086778 Ga0501305_086778_264_506 80
1703 3300049162 Ga0501307_005425 Ga0501307_005425_918_1160 80
1704 3300049162 Ga0501307_017598 Ga0501307_017598_419_661 80
1705 3300049162 Ga0501307_063498 Ga0501307_063498_27_269 80
1706 3300049527 Ga0501311_015741 Ga0501311_015741_632_874 80
1707 3300049527 Ga0501311_015924 Ga0501311_015924_706_948 80
1708 3300049527 Ga0501311_019885 Ga0501311_019885_405_647 80
1709 3300049527 Ga0501311_024743 Ga0501311_024743_504_746 80
1710 3300049528 Ga0501312_121652 Ga0501312_121652_68_310 80
1711 3300049529 Ga0501313_012595 Ga0501313_012595_76_318 80
1712 3300049529 Ga0501313_049903 Ga0501313_049903_92_334 80
1713 3300049530 Ga0501314_001584 Ga0501314_001584_689_931 80
1714 3300049530 Ga0501314_047162 Ga0501314_047162_93_335 80
1715 3300049531 Ga0501315_022403 Ga0501315_022403_553_795 80
1716 3300049531 Ga0501315_059816 Ga0501315_059816_280_522 80
1717 3300049532 Ga0501316_002928 Ga0501316_002928_779_1021 80
1718 3300049532 Ga0501316_016739 Ga0501316_016739_629_871 80
1719 3300049532 Ga0501316_023080 Ga0501316_023080_486_728 80
1720 3300049532 Ga0501316_079590 Ga0501316_079590_100_342 80
1721 3300049533 Ga0501317_009765 Ga0501317_009765_414_656 80
1722 3300049533 Ga0501317_012594 Ga0501317_012594_85_327 80
1723 3300049533 Ga0501317_013556 Ga0501317_013556_641_883 80
1724 3300049533 Ga0501317_018792 Ga0501317_018792_665_907 80
1725 3300049533 Ga0501317_033038 Ga0501317_033038_45_287 80
1726 3300049533 Ga0501317_035891 Ga0501317_035891_191_433 80
1727 3300049533 Ga0501317_060080 Ga0501317_060080_91_333 80
1728 3300049533 Ga0501317_091219 Ga0501317_091219_25_267 80
1729 3300049534 Ga0501318_006518 Ga0501318_006518_74_316 80
1730 3300049534 Ga0501318_007966 Ga0501318_007966_736_978 80
1731 3300049534 Ga0501318_019001 Ga0501318_019001_565_807 80
1732 3300049534 Ga0501318_035644 Ga0501318_035644_268_510 80
1733 3300049534 Ga0501318_062985 Ga0501318_062985_307_549 80
1734 3300049535 Ga0501319_030300 Ga0501319_030300_62_304 80
1735 3300049536 Ga0501320_007576 Ga0501320_007576_354_596 80
1736 3300049537 Ga0501321_005376 Ga0501321_005376_740_982 80
1737 3300049537 Ga0501321_006089 Ga0501321_006089_835_1077 80
1738 3300049537 Ga0501321_011349 Ga0501321_011349_314_556 80
1739 3300049538 Ga0501322_003101 Ga0501322_003101_92_334 80
1740 3300049538 Ga0501322_003822 Ga0501322_003822_226_468 80
1741 3300049538 Ga0501322_026028 Ga0501322_026028_275_517 80
1742 3300049538 Ga0501322_028331 Ga0501322_028331_192_434 80
1743 3300049539 Ga0501323_015893 Ga0501323_015893_627_869 80
1744 3300049539 Ga0501323_054118 Ga0501323_054118_79_321 80
1745 3300049540 Ga0501324_007233 Ga0501324_007233_652_894 80
1746 3300049540 Ga0501324_007721 Ga0501324_007721_202_444 80
1747 3300049540 Ga0501324_009100 Ga0501324_009100_634_876 80
1748 3300049541 Ga0501325_003288 Ga0501325_003288_764_1006 80
1749 3300049541 Ga0501325_006900 Ga0501325_006900_83_325 80
1750 3300049549 Ga0501333_018596 Ga0501333_018596_246_488 80
1751 3300049556 Ga0501340_022122 Ga0501340_022122_30_272 80
1752 3300049568 Ga0501031_0056846 Ga0501031_0056846_351_593 80
1753 3300049568 Ga0501031_0079126 Ga0501031_0079126_513_755 80
1754 3300049568 Ga0501031_0125152 Ga0501031_0125152_532_774 80
1755 3300049570 Ga0501033_0667054 Ga0501033_0667054_136_378 80
1756 3300049572 Ga0501036_0140325 Ga0501036_0140325_1083_1325 80
1757 3300049573 Ga0501037_0073699 Ga0501037_0073699_195_437 80
1758 3300049573 Ga0501037_0418991 Ga0501037_0418991_269_511 80
1759 3300049574 Ga0501038_0390664 Ga0501038_0390664_406_648 80
1760 3300049575 Ga0501039_0037432 Ga0501039_0037432_2734_2976 80
1761 3300049575 Ga0501039_0345782 Ga0501039_0345782_86_328 80
1762 3300049575 Ga0501039_0523985 Ga0501039_0523985_67_309 80
1763 3300049576 Ga0501040_0010782 Ga0501040_0010782_2604_2846 80
1764 3300049576 Ga0501040_0031230 Ga0501040_0031230_427_669 80
1765 3300049577 Ga0501041_0018859 Ga0501041_0018859_514_756 80
1766 3300049578 Ga0501042_0001973 Ga0501042_0001973_11556_11798 80
1767 3300049579 Ga0501043_0901924 Ga0501043_0901924_260_502 80
1768 3300049582 Ga0501048_0009642 Ga0501048_0009642_2839_3081 80
1769 3300049582 Ga0501048_0544741 Ga0501048_0544741_368_610 80
1770 3300049582 Ga0501048_0821024 Ga0501048_0821024_58_300 80
1771 3300049585 Ga0501069_0073955 Ga0501069_0073955_1450_1692 80
1772 3300049586 Ga0501070_0007227 Ga0501070_0007227_7615_7857 80
1773 3300049586 Ga0501070_0329385 Ga0501070_0329385_887_1129 80
1774 3300049587 Ga0501071_0031864 Ga0501071_0031864_195_437 80
1775 3300049587 Ga0501071_0655328 Ga0501071_0655328_123_365 80
1776 3300049588 Ga0501072_1498787 Ga0501072_1498787_93_335 80
1777 3300049589 Ga0501073_0256193 Ga0501073_0256193_512_754 80
1778 3300049589 Ga0501073_0644000 Ga0501073_0644000_78_320 80
1779 3300049590 Ga0501074_0013279 Ga0501074_0013279_3622_3864 80
1780 3300049590 Ga0501074_0024804 Ga0501074_0024804_2170_2412 80
1781 3300049590 Ga0501074_0314721 Ga0501074_0314721_167_409 80
1782 3300049590 Ga0501074_0749296 Ga0501074_0749296_11_253 80
1783 3300049590 Ga0501074_1288514 Ga0501074_1288514_70_312 80
1784 3300049591 Ga0501075_0067655 Ga0501075_0067655_601_843 80
1785 3300049591 Ga0501075_0824971 Ga0501075_0824971_95_337 80
1786 3300049592 Ga0501076_0002612 Ga0501076_0002612_10981_11223 80
1787 3300049741 Ga0501079_0029582 Ga0501079_0029582_586_828 80
1788 3300049741 Ga0501079_0370600 Ga0501079_0370600_531_773 80
1789 3300049741 Ga0501079_0893503 Ga0501079_0893503_44_286 80
1790 3300049741 Ga0501079_1037049 Ga0501079_1037049_189_431 80
1791 3300049742 Ga0501080_0037276 Ga0501080_0037276_1641_1883 80
1792 3300049742 Ga0501080_1784946 Ga0501080_1784946_121_363 80
1793 3300049743 Ga0501081_0322063 Ga0501081_0322063_816_1058 80
1794 3300049743 Ga0501081_0589611 Ga0501081_0589611_497_739 80
1795 3300049743 Ga0501081_1444800 Ga0501081_1444800_235_477 80
1796 3300049822 Ga0501035_0177968 Ga0501035_0177968_494_736 80
1797 3300049822 Ga0501035_1076409 Ga0501035_1076409_27_269 80
1798 3300049824 Ga0501045_0016664 Ga0501045_0016664_856_1098 80
1799 3300049824 Ga0501045_0308702 Ga0501045_0308702_165_407 80
1800 3300050492 nmdc:mga0yw44_103203_c1 nmdc:mga0yw44_103203_c1_242_484 80
1801 3300050492 nmdc:mga0yw44_609027_c1 nmdc:mga0yw44_609027_c1_203_445 80
1802 3300050507 nmdc:mga05p37_934_c1 nmdc:mga05p37_934_c1_12938_13180 80
1803 3300050508 nmdc:mga09592_241_c1 nmdc:mga09592_241_c1_3143_3385 80
1804 3300050509 nmdc:mga0qj67_4073_c1 nmdc:mga0qj67_4073_c1_9612_9854 80
1805 3300050510 nmdc:mga06r32_283_c1 nmdc:mga06r32_283_c1_12147_12389 80
1806 3300050510 nmdc:mga06r32_5722_c1 nmdc:mga06r32_5722_c1_9591_9833 80
1807 3300050511 nmdc:mga08y16_474525_c1 nmdc:mga08y16_474525_c1_103_345 80
1808 3300050511 nmdc:mga08y16_6314_c1 nmdc:mga08y16_6314_c1_12132_12374 80
1809 3300050512 nmdc:mga0n895_194027_c1 nmdc:mga0n895_194027_c1_233_475 80
1810 3300053084 Ga0495595_0056129 Ga0495595_0056129_862_1104 80
1811 3300053085 Ga0495619_0335862 Ga0495619_0335862_43_285 80
1812 3300053155 Ga0500620_047352 Ga0500620_047352_539_781 80
1813 3300054114 Ga0501084_0180999 Ga0501084_0180999_963_1205 80
1814 3300060353 Ga0501082_0524829 Ga0501082_0524829_717_959 80
1815 3300060353 Ga0501082_0772059 Ga0501082_0772059_387_629 80
1816 3300061719 Ga0466962_0003253 Ga0466962_0003253_1837_2079 80
1817 3300061719 Ga0466962_0028220 Ga0466962_0028220_1398_1640 80
1818 3300061734 Ga0530510_0883080 Ga0530510_0883080_383_625 80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

37

86

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iqr-assembly1.cif.gz_h error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8229 2 77
8crx-assembly1.cif.gz_G cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.8209 2 77
7unu-assembly1.cif.gz_c pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.7986 4 78
7bge-assembly1.cif.gz_c staphylococcus aureus 30s ribosomal subunit in presence of spermidine (head only) 0.798 4 78
7n1p-assembly1.cif.gz_SC elongating 70s ribosome complex in a classical pre-translocation (pre-c) conformation 0.7948 2 78
ID Description Score Start End Superfamily
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9764 7 75 3.30.300.20
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.949 7 75 3.30.300.20
af_Q2FW12_17_106_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8361 2 75 3.30.300.20
af_Q58447_73_141_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8045 5 74 3.30.300.20
5xxuD01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7653 4 77 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7X6NU24-F1-model_v4 RNA-binding protein 0.9923 1 59 GO:0003723
AF-A0A562VAG7-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9776 1 75 GO:0003723
GO:0005737
AF-A0A7X0FR18-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.976 1 74 GO:0003723
GO:0005737
AF-A0A1G7D2G2-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9755 1 75 GO:0003723
GO:0005737
AF-A0A6N7GEQ5-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9742 2 75 GO:0003723
GO:0005737

Feature Viewer

pLDDT pTM Quality
91.97 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map