metagRoot

F495760

General Info

Members	Datasets	Scaffolds	Average Seq Length
1809	614	1797	212

Family's Representative Sequence

Representative Sequence	3300025885\|Ga0207653_10072028\|Ga0207653_100720282
Length	230
Sequence	MSGMTWNGVPQIQAPGRDPQGLGLIPMVIEQSGRGERAYDIYSRLLKDRIIFLGSAIDATVANVVTAQLLYLEAEDPGRDIELYINSPGGETSAGLAIYDTAQYVRPDVRTLCVGLAASAAAVLLAAGAPGKRYALPNARIMIHQPWGQIGQGQAVDLGIQAKEFLRTKRLMEEILARHTGQPVDRVHQDTDRDYYMDPEEARTYGMIDGICTPRSKIAVTPPSPNGHGP

Samples

	Sample ID	Description	Type	Environment
1	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
2	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
3	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
4	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
5	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
6	2857553236	Duganella sp. R-74557	Isolate	Unclassified
7	2884994152	Cellulomonas sp. H30R-01	Isolate	Rhizosphere
8	2891633521	Azoarcus rhizosphaerae CC-YHH848	Isolate	Rhizosphere
9	2919476304	Duganella sp. 3397	Isolate	Unclassified
10	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
11	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
12	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
13	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
14	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
15	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
16	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
17	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
18	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
19	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
20	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
21	3300003291	Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
22	3300003300	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
23	3300003308	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
24	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
25	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
26	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
27	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
28	3300003559	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
29	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
30	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
31	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
32	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
33	3300003579	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
34	3300003611	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
35	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
36	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
37	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
38	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
39	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
40	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
41	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
42	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
43	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
44	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
45	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
46	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
47	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
48	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
49	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
50	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
51	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
52	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
53	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
54	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
55	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
56	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
57	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
58	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
59	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
60	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
61	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
62	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
63	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
64	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
65	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
66	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
67	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
68	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
69	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
70	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
71	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
72	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
73	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
74	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
75	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
76	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
77	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
78	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
79	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
80	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
81	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
82	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
83	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
84	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
85	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
86	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
87	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
88	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
89	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
90	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
91	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
92	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
93	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
94	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
95	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
96	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
97	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
98	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
99	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
100	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
101	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
102	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
103	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
104	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
105	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
106	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
107	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
108	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
109	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
110	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
111	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
112	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
113	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
114	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
115	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
116	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
117	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
118	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
119	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
120	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
121	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
122	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
123	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
124	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
125	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
126	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
127	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
128	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
129	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
130	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
131	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
132	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
133	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
134	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
135	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
136	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
137	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
138	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
139	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
140	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
141	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
142	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
143	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
144	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
145	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
146	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
147	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
148	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
149	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
150	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
151	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
152	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
153	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
154	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
155	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
156	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
157	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
158	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
159	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
160	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
161	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
162	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
163	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
164	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
165	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
166	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
167	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
168	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
169	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
170	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
171	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
172	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
173	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
174	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
175	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
176	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
177	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
178	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
179	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
180	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
181	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
182	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
183	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
184	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
185	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
186	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
187	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
188	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
189	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
190	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
191	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
192	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
193	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
194	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
195	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
198	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
200	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
204	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
205	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
206	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
207	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
208	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
209	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
210	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
211	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
212	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
213	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
214	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
215	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
216	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
217	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
218	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
219	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
220	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
221	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
222	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
223	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
224	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
289	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
293	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
295	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
296	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
300	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
301	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
302	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
303	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
304	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
305	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
306	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
307	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
308	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
309	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
310	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
311	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
312	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
313	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
314	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
315	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
316	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
317	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
318	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
319	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
320	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
321	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
322	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
323	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
324	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
325	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
326	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
327	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
328	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
329	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
330	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
331	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
332	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
333	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
334	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
335	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
336	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
337	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
338	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
339	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
340	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
341	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
342	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
343	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
344	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
345	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
346	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
347	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
348	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
349	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
350	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
351	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
352	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
353	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
354	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
355	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
356	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
357	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
358	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
359	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
360	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
361	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
362	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
363	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
364	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
365	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
366	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
367	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
368	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
369	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
370	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
371	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
372	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
373	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
374	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
375	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
376	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
377	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
378	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
379	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
380	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
381	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
382	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
383	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
384	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
385	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
386	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
387	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
388	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
389	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
390	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
391	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
392	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
393	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
394	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
395	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
396	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
397	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
398	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
399	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
400	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
401	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
402	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
403	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
404	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
405	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
406	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
407	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
408	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
409	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
410	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
411	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
412	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
413	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
414	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
415	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
416	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
417	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
418	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
419	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
420	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
421	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
422	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
423	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
424	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
425	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
426	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
427	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
428	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
429	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
430	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
431	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
432	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
433	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
434	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
435	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
436	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
437	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
438	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
439	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
440	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
441	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
442	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
443	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
444	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
445	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
446	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
447	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
448	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
449	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
450	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
451	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
452	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
453	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
454	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
455	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
456	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
457	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
458	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
459	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
460	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
461	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
462	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
463	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
464	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
465	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
466	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
467	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
468	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
469	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
470	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
471	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
472	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
473	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
474	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
475	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
476	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
477	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
478	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
479	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
480	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
481	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
482	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
483	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
484	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
485	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
486	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
487	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
488	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
489	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
490	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
491	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
492	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
493	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
494	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
495	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
496	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
497	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
498	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
499	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
500	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
501	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
502	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
503	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
504	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
505	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
506	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
507	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
508	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
509	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
510	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
511	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
512	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
513	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
514	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
515	3300049535	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
516	3300049550	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
517	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
518	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
519	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
520	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
521	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
522	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
523	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
524	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
525	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
526	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
527	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
528	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
529	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
530	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
531	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
532	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
533	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
534	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
535	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
536	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
537	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
538	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
539	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
540	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
541	3300049667	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control	Metagenome	Rhizosphere
542	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
543	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
544	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
545	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
546	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
547	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
548	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
549	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
550	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
551	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
552	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
553	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
554	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
555	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
556	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
557	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
558	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
559	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
560	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
561	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
562	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
563	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
564	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
565	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
566	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
567	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
568	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
569	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
570	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
571	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
572	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
573	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
574	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
575	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
576	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
577	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
578	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
579	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
580	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
581	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
582	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
583	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
584	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
585	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
586	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
587	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
588	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
589	3300059478	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
590	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
591	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
592	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
593	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
594	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
595	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
596	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
597	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
598	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
599	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
600	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
601	3300059626	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
602	3300059627	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
603	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
604	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
605	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
606	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
607	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
608	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
609	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
610	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
611	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
612	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
613	639633007	Azoarcus olearius BH72	Isolate	Unclassified
614	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.48
Metatranscriptomes	6.91
Isolates	0.61

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.4
Nodule	0.28
Rhizoplane	2.54
Rhizosphere	82.86
Stem	0
Stem Tuber	0
Unclassified	5.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25155J39150_1000008	3300002704	Bacteria	236146
2	JGI25155J39150_1001956	3300002704	Bacteria	1212
3	JGI25155J39150_1001968	3300002704	Bacteria	1206
4	JGI25156J39149_1000002	3300002705	Bacteria	343501
5	JGI25156J39149_1001328	3300002705	Bacteria	10658
6	JGI25156J39149_1012509	3300002705	Bacteria	1860
7	JGI25162J39368_1004947	3300002737	Bacteria	2830
8	JGI25154J39366_1000010	3300002738	Bacteria	297985
9	JGI25154J39366_1000618	3300002738	Bacteria	16914
10	JGI25154J39366_1009341	3300002738	Bacteria	1212
11	JGI25154J39366_1009392	3300002738	Bacteria	1206
12	JGI25157J39369_1000001	3300002741	Bacteria	363277
13	JGI25157J39369_1002816	3300002741	Bacteria	3950
14	JGI25157J39369_1014148	3300002741	Bacteria	995
15	JGI25150J39212_1012964	3300002774	Bacteria	1458
16	JGI25159J45721_1010313	3300002987	Bacteria	2389
17	JGI25159J45721_1010536	3300002987	Bacteria	2346
18	Ga0006759J45824_1030552	3300003163	Bacteria	6310
19	JGI25151J46595_10002355	3300003187	Bacteria	11484
20	JGI25151J46595_10030875	3300003187	Bacteria	2101
21	JGI25406J46586_10027783	3300003203	Bacteria	2164
22	JGI25165J46597_1002618	3300003214	Bacteria	5440
23	Ga0007421J48921_103704	3300003291	Bacteria	953
24	Ga0006758J48902_1032376	3300003300	Bacteria	978
25	Ga0006777J48905_1052586	3300003308	Bacteria	791
26	rootH1_10002081	3300003323	Bacteria	109125
27	rootH1_10084130	3300003323	Bacteria	9353
28	rootH1_10384712	3300003323	Bacteria	1110
29	JGI25160J50197_1000349	3300003354	Bacteria	30734
30	JGI25160J50197_1037536	3300003354	Bacteria	1159
31	JGI25161J50226_1000076	3300003374	Bacteria	84478
32	Ga0007417J51691_1014262	3300003544	Bacteria	6310
33	Ga0007417J51691_1015597	3300003544	Bacteria	6416
34	Ga0007427J51700_115684	3300003559	Bacteria	878
35	Ga0007410J51695_1015221	3300003574	Bacteria	3724
36	Ga0007410J51695_1020044	3300003574	Bacteria	6419
37	Ga0007409J51694_1008075	3300003575	Bacteria	6395
38	Ga0007416J51690_1009527	3300003577	Bacteria	6310
39	Ga0007416J51690_1050757	3300003577	Bacteria	2753
40	Ga0006562J51391_1016607	3300003578	Bacteria	2760
41	Ga0007429J51699_1033716	3300003579	Bacteria	1361
42	Ga0007429J51699_1053583	3300003579	Bacteria	939
43	Ga0007411J51799_109336	3300003611	Bacteria	2260
44	Ga0032354_1013414	3300003693	Bacteria	6323
45	Ga0055538_1000020	3300003751	Bacteria	264193
46	Ga0055539_1000025	3300003752	Bacteria	264193
47	Ga0055533_1000034	3300003756	Bacteria	264193
48	Ga0055532_1000051	3300003758	Bacteria	165365
49	Ga0055525_1000044	3300003759	Bacteria	264193
50	Ga0055529_1000060	3300003763	Bacteria	191230
51	Ga0055526_1011426	3300003771	Bacteria	3999
52	Ga0055526_1011578	3300003771	Bacteria	3955
53	Ga0055526_1012698	3300003771	Bacteria	3643
54	Ga0055526_1013519	3300003771	Bacteria	3442
55	Ga0055526_1019338	3300003771	Bacteria	2486
56	Ga0055537_1006212	3300003773	Bacteria	3069
57	Ga0055524_1000130	3300003775	Bacteria	88754
58	Ga0055524_1000675	3300003775	Bacteria	23919
59	Ga0055534_1003142	3300003784	Bacteria	5349
60	Ga0055528_1002061	3300003790	Bacteria	11227
61	Ga0055540_1000685	3300003792	Bacteria	23411
62	Ga0055531_10001278	3300003794	Bacteria	18967
63	Ga0055531_10010900	3300003794	Bacteria	4460
64	Ga0055541_1000019	3300003841	Bacteria	264193
65	Ga0055543_1000118	3300004625	Bacteria	66892
66	Ga0058863_10547931	3300004799	Bacteria	802
67	Ga0058863_11903184	3300004799	Bacteria	1096
68	Ga0058862_12694891	3300004803	Bacteria	5056
69	Ga0065165_1000072	3300005262	Bacteria	165049
70	Ga0065165_1048918	3300005262	Bacteria	1211
71	Ga0065165_1071216	3300005262	Bacteria	923
72	Ga0065714_10115854	3300005288	Bacteria	1410
73	Ga0065704_10175009	3300005289	Bacteria	1269
74	Ga0070658_10026770	3300005327	Bacteria	4630
75	Ga0070676_10002162	3300005328	Bacteria	10020
76	Ga0070676_10063812	3300005328	Bacteria	2195
77	Ga0070676_10173239	3300005328	Bacteria	1398
78	Ga0070676_10334221	3300005328	Bacteria	1037
79	Ga0070690_100276893	3300005330	Bacteria	1195
80	Ga0070690_100471761	3300005330	Bacteria	934
81	Ga0070670_100000001	3300005331	Bacteria	728788
82	Ga0070670_100245594	3300005331	Bacteria	1559
83	Ga0070670_100268694	3300005331	Bacteria	1488
84	Ga0070670_100390130	3300005331	Bacteria	1228
85	Ga0070670_100531297	3300005331	Bacteria	1048
86	Ga0070677_10000061	3300005333	Bacteria	33960
87	Ga0068869_100030734	3300005334	Bacteria	3773
88	Ga0068869_100068619	3300005334	Bacteria	2619
89	Ga0068869_100083330	3300005334	Bacteria	2391
90	Ga0068869_100160243	3300005334	Bacteria	1751
91	Ga0068869_100802477	3300005334	Bacteria	809
92	Ga0070666_10001838	3300005335	Bacteria	12937
93	Ga0070666_10001848	3300005335	Bacteria	12901
94	Ga0070666_10018466	3300005335	Bacteria	4486
95	Ga0070666_10286423	3300005335	Bacteria	1172
96	Ga0070666_10357217	3300005335	Bacteria	1046
97	Ga0070680_100332498	3300005336	Bacteria	1290
98	Ga0070680_100660421	3300005336	Bacteria	899
99	Ga0070682_100027008	3300005337	Bacteria	3442
100	Ga0070682_100085115	3300005337	Bacteria	2056
101	Ga0068868_100006042	3300005338	Bacteria	8552
102	Ga0068868_100026276	3300005338	Bacteria	4435
103	Ga0068868_100043463	3300005338	Bacteria	3510
104	Ga0068868_100059908	3300005338	Bacteria	3013
105	Ga0068868_100145370	3300005338	Bacteria	1949
106	Ga0068868_100315169	3300005338	Bacteria	1331
107	Ga0070660_100012644	3300005339	Bacteria	6032
108	Ga0070660_100537715	3300005339	Bacteria	974
109	Ga0070689_100113945	3300005340	Bacteria	2153
110	Ga0070689_100204212	3300005340	Bacteria	1615
111	Ga0070689_100290780	3300005340	Bacteria	1358
112	Ga0070689_100392548	3300005340	Bacteria	1171
113	Ga0070689_100482203	3300005340	Bacteria	1059
114	Ga0070691_10101492	3300005341	Bacteria	1429
115	Ga0070691_10255279	3300005341	Bacteria	942
116	Ga0070691_10272201	3300005341	Bacteria	916
117	Ga0070687_100034420	3300005343	Bacteria	2508
118	Ga0070687_100180529	3300005343	Bacteria	1264
119	Ga0070687_100204373	3300005343	Bacteria	1199
120	Ga0070687_100276833	3300005343	Bacteria	1054
121	Ga0070661_100001972	3300005344	Bacteria	14181
122	Ga0070661_100030263	3300005344	Bacteria	3910
123	Ga0070661_100171724	3300005344	Bacteria	1646
124	Ga0070692_10075428	3300005345	Bacteria	1806
125	Ga0070692_10154474	3300005345	Bacteria	1310
126	Ga0070668_100005777	3300005347	Bacteria	9179
127	Ga0070668_100014334	3300005347	Bacteria	5923
128	Ga0070668_100060644	3300005347	Bacteria	2930
129	Ga0070668_100092564	3300005347	Bacteria	2384
130	Ga0070668_100230780	3300005347	Bacteria	1530
131	Ga0070668_100238173	3300005347	Bacteria	1506
132	Ga0070668_100242943	3300005347	Bacteria	1492
133	Ga0070668_100268466	3300005347	Bacteria	1421
134	Ga0070668_100520004	3300005347	Bacteria	1032
135	Ga0070668_100662292	3300005347	Bacteria	918
136	Ga0070668_100891037	3300005347	Bacteria	795
137	Ga0070669_100002406	3300005353	Bacteria	13540
138	Ga0070669_100004477	3300005353	Bacteria	10070
139	Ga0070669_100011692	3300005353	Bacteria	6227
140	Ga0070669_100015401	3300005353	Bacteria	5449
141	Ga0070669_100061118	3300005353	Bacteria	2768
142	Ga0070669_100180588	3300005353	Bacteria	1650
143	Ga0070669_100370992	3300005353	Bacteria	1166
144	Ga0070669_100373591	3300005353	Bacteria	1162
145	Ga0070675_100012856	3300005354	Bacteria	6569
146	Ga0070675_100090708	3300005354	Bacteria	2559
147	Ga0070675_100155732	3300005354	Bacteria	1962
148	Ga0070675_100327763	3300005354	Bacteria	1353
149	Ga0070675_100673721	3300005354	Bacteria	941
150	Ga0070671_100000018	3300005355	Bacteria	147427
151	Ga0070671_100003757	3300005355	Bacteria	11920
152	Ga0070671_100027672	3300005355	Bacteria	4668
153	Ga0070671_100051649	3300005355	Bacteria	3419
154	Ga0070674_100004336	3300005356	Bacteria	8086
155	Ga0070674_100021687	3300005356	Bacteria	4130
156	Ga0070674_100060870	3300005356	Bacteria	2633
157	Ga0070674_100145814	3300005356	Bacteria	1782
158	Ga0070674_100332458	3300005356	Bacteria	1222
159	Ga0070674_100489279	3300005356	Bacteria	1022
160	Ga0070673_100004007	3300005364	Bacteria	9269
161	Ga0070673_100009414	3300005364	Bacteria	6556
162	Ga0070673_100031354	3300005364	Bacteria	3988
163	Ga0070673_100258404	3300005364	Bacteria	1521
164	Ga0070673_100383433	3300005364	Bacteria	1253
165	Ga0070673_100799357	3300005364	Bacteria	871
166	Ga0070688_100029238	3300005365	Bacteria	3298
167	Ga0070659_100234767	3300005366	Bacteria	1516
168	Ga0070659_100518452	3300005366	Bacteria	1017
169	Ga0070659_100973351	3300005366	Bacteria	744
170	Ga0070667_100000026	3300005367	Bacteria	183244
171	Ga0070667_100003765	3300005367	Bacteria	12882
172	Ga0070667_100018332	3300005367	Bacteria	5804
173	Ga0070667_100144099	3300005367	Bacteria	2088
174	Ga0070667_100170354	3300005367	Bacteria	1922
175	Ga0070667_100393849	3300005367	Bacteria	1260
176	Ga0070703_10023533	3300005406	Bacteria	1815
177	Ga0070709_10137422	3300005434	Bacteria	1675
178	Ga0070709_10390213	3300005434	Bacteria	1037
179	Ga0070714_100009576	3300005435	Bacteria	7624
180	Ga0070713_100001357	3300005436	Bacteria	15655
181	Ga0070710_10064406	3300005437	Bacteria	2097
182	Ga0070710_10075936	3300005437	Bacteria	1948
183	Ga0070701_10052016	3300005438	Bacteria	2126
184	Ga0070711_100000614	3300005439	Bacteria	18579
185	Ga0070711_100025904	3300005439	Bacteria	3839
186	Ga0070711_100736503	3300005439	Bacteria	832
187	Ga0070705_100000171	3300005440	Bacteria	37880
188	Ga0070705_100006894	3300005440	Bacteria	5580
189	Ga0070705_100026663	3300005440	Bacteria	3147
190	Ga0070705_100029462	3300005440	Bacteria	3019
191	Ga0070705_100090821	3300005440	Bacteria	1902
192	Ga0070705_100164983	3300005440	Bacteria	1485
193	Ga0070700_100000482	3300005441	Bacteria	19974
194	Ga0070700_100001025	3300005441	Bacteria	13799
195	Ga0070700_100306945	3300005441	Bacteria	1160
196	Ga0070700_100537006	3300005441	Bacteria	906
197	Ga0070700_100626033	3300005441	Bacteria	846
198	Ga0070694_100003250	3300005444	Bacteria	9704
199	Ga0070694_100218178	3300005444	Bacteria	1429
200	Ga0070694_100701315	3300005444	Bacteria	823
201	Ga0070663_100088355	3300005455	Bacteria	2292
202	Ga0070663_100454643	3300005455	Bacteria	1056
203	Ga0070678_100000304	3300005456	Bacteria	22827
204	Ga0070678_100001502	3300005456	Bacteria	12457
205	Ga0070678_100004959	3300005456	Bacteria	7621
206	Ga0070678_100150545	3300005456	Bacteria	1874
207	Ga0070678_100236058	3300005456	Bacteria	1527
208	Ga0070678_100306309	3300005456	Bacteria	1352
209	Ga0070678_100307870	3300005456	Bacteria	1348
210	Ga0070662_100059516	3300005457	Bacteria	2783
211	Ga0070662_100080154	3300005457	Bacteria	2430
212	Ga0070662_100361870	3300005457	Bacteria	1190
213	Ga0070662_100440770	3300005457	Bacteria	1080
214	Ga0070662_100467042	3300005457	Bacteria	1049
215	Ga0070662_100507079	3300005457	Bacteria	1007
216	Ga0070681_10001964	3300005458	Bacteria	18586
217	Ga0070681_10008051	3300005458	Bacteria	10316
218	Ga0070681_10264876	3300005458	Bacteria	1630
219	Ga0068867_100001530	3300005459	Bacteria	16047
220	Ga0068867_100004199	3300005459	Bacteria	10135
221	Ga0068867_100010922	3300005459	Bacteria	6404
222	Ga0068867_100153310	3300005459	Bacteria	1812
223	Ga0068867_100222924	3300005459	Bacteria	1520
224	Ga0068867_100263914	3300005459	Bacteria	1405
225	Ga0070685_10000007	3300005466	Bacteria	180539
226	Ga0070685_10000794	3300005466	Bacteria	17117
227	Ga0070685_10130431	3300005466	Bacteria	1571
228	Ga0070706_100067356	3300005467	Bacteria	3311
229	Ga0070706_100295902	3300005467	Bacteria	1510
230	Ga0070707_100017396	3300005468	Bacteria	6759
231	Ga0070707_100115224	3300005468	Bacteria	2608
232	Ga0070707_100263076	3300005468	Bacteria	1678
233	Ga0070707_100387861	3300005468	Bacteria	1356
234	Ga0070707_100471381	3300005468	Bacteria	1217
235	Ga0070707_100858666	3300005468	Bacteria	872
236	Ga0070699_100000167	3300005518	Bacteria	63239
237	Ga0070699_100018494	3300005518	Bacteria	5984
238	Ga0070699_100021494	3300005518	Bacteria	5565
239	Ga0070699_100094317	3300005518	Bacteria	2619
240	Ga0070699_100683925	3300005518	Bacteria	937
241	Ga0070679_100023162	3300005530	Bacteria	6076
242	Ga0070679_100234313	3300005530	Bacteria	1795
243	Ga0070679_100259657	3300005530	Bacteria	1692
244	Ga0070679_100341738	3300005530	Bacteria	1445
245	Ga0070679_100360614	3300005530	Bacteria	1401
246	Ga0070697_100009368	3300005536	Bacteria	7652
247	Ga0070697_100023319	3300005536	Bacteria	4921
248	Ga0070697_100112410	3300005536	Bacteria	2271
249	Ga0070697_100221993	3300005536	Bacteria	1611
250	Ga0068853_100028521	3300005539	Bacteria	4696
251	Ga0068853_100045569	3300005539	Bacteria	3757
252	Ga0068853_100080653	3300005539	Bacteria	2848
253	Ga0068853_100177042	3300005539	Bacteria	1932
254	Ga0068853_100187375	3300005539	Bacteria	1879
255	Ga0068853_100327164	3300005539	Bacteria	1422
256	Ga0068853_100344777	3300005539	Bacteria	1384
257	Ga0068853_100373887	3300005539	Bacteria	1330
258	Ga0068853_100558757	3300005539	Bacteria	1085
259	Ga0068853_100850470	3300005539	Bacteria	875
260	Ga0070672_100002511	3300005543	Bacteria	11678
261	Ga0070672_100006913	3300005543	Bacteria	7668
262	Ga0070672_100027021	3300005543	Bacteria	4278
263	Ga0070672_100096188	3300005543	Bacteria	2396
264	Ga0070672_100365167	3300005543	Bacteria	1233
265	Ga0070672_100476113	3300005543	Bacteria	1078
266	Ga0070672_100613774	3300005543	Bacteria	948
267	Ga0070686_100115326	3300005544	Bacteria	1837
268	Ga0070686_100119322	3300005544	Bacteria	1809
269	Ga0070686_100169840	3300005544	Bacteria	1542
270	Ga0070686_100332766	3300005544	Bacteria	1136
271	Ga0070686_100671548	3300005544	Bacteria	824
272	Ga0070695_100011249	3300005545	Bacteria	5353
273	Ga0070695_100436175	3300005545	Bacteria	1001
274	Ga0070696_100002999	3300005546	Bacteria	11209
275	Ga0070696_100013419	3300005546	Bacteria	5497
276	Ga0070696_100016400	3300005546	Bacteria	4988
277	Ga0070696_100033395	3300005546	Bacteria	3535
278	Ga0070696_100443978	3300005546	Bacteria	1022
279	Ga0070693_100000346	3300005547	Bacteria	21099
280	Ga0070693_100005600	3300005547	Bacteria	6054
281	Ga0070693_100118251	3300005547	Bacteria	1640
282	Ga0070693_100730522	3300005547	Bacteria	728
283	Ga0070665_100018491	3300005548	Bacteria	6984
284	Ga0070665_100018625	3300005548	Bacteria	6959
285	Ga0070665_100031699	3300005548	Bacteria	5319
286	Ga0070665_100050164	3300005548	Bacteria	4188
287	Ga0070665_100060972	3300005548	Bacteria	3781
288	Ga0070665_100306058	3300005548	Bacteria	1592
289	Ga0070704_100008913	3300005549	Bacteria	6042
290	Ga0070704_100017614	3300005549	Bacteria	4547
291	Ga0070704_100026289	3300005549	Bacteria	3844
292	Ga0070704_100067390	3300005549	Bacteria	2585
293	Ga0070704_100071334	3300005549	Bacteria	2523
294	Ga0070704_100085597	3300005549	Bacteria	2333
295	Ga0070704_100165380	3300005549	Bacteria	1753
296	Ga0068855_100000396	3300005563	Bacteria	53739
297	Ga0068855_100019156	3300005563	Bacteria	8224
298	Ga0068855_100056617	3300005563	Bacteria	4599
299	Ga0068855_100357108	3300005563	Bacteria	1609
300	Ga0068855_100399146	3300005563	Bacteria	1507
301	Ga0070664_100019510	3300005564	Bacteria	5578
302	Ga0070664_100034946	3300005564	Bacteria	4218
303	Ga0070664_100549439	3300005564	Bacteria	1068
304	Ga0068857_100040118	3300005577	Bacteria	4151
305	Ga0068857_100044417	3300005577	Bacteria	3941
306	Ga0068857_100182199	3300005577	Bacteria	1911
307	Ga0068857_100680343	3300005577	Bacteria	976
308	Ga0068854_100014099	3300005578	Bacteria	5261
309	Ga0068854_100036517	3300005578	Bacteria	3445
310	Ga0068854_100042796	3300005578	Bacteria	3207
311	Ga0068854_100047427	3300005578	Bacteria	3061
312	Ga0068854_100230468	3300005578	Bacteria	1470
313	Ga0068854_100281601	3300005578	Bacteria	1339
314	Ga0068854_100311368	3300005578	Bacteria	1277
315	Ga0068854_100590690	3300005578	Bacteria	947
316	Ga0068856_100042923	3300005614	Bacteria	4450
317	Ga0068856_100242288	3300005614	Bacteria	1818
318	Ga0068856_100251103	3300005614	Bacteria	1784
319	Ga0068856_100303876	3300005614	Bacteria	1613
320	Ga0070702_100017523	3300005615	Bacteria	3696
321	Ga0070702_100031902	3300005615	Bacteria	2886
322	Ga0070702_100032912	3300005615	Bacteria	2848
323	Ga0070702_100056630	3300005615	Bacteria	2265
324	Ga0068852_100003619	3300005616	Bacteria	10810
325	Ga0068852_100035921	3300005616	Bacteria	4140
326	Ga0068852_100335833	3300005616	Bacteria	1471
327	Ga0068859_100009093	3300005617	Bacteria	10031
328	Ga0068859_100018683	3300005617	Bacteria	6966
329	Ga0068859_100023812	3300005617	Bacteria	6145
330	Ga0068859_100030469	3300005617	Bacteria	5413
331	Ga0068859_100122416	3300005617	Bacteria	2669
332	Ga0068859_100181508	3300005617	Bacteria	2187
333	Ga0068859_100332816	3300005617	Bacteria	1613
334	Ga0068859_100378253	3300005617	Bacteria	1512
335	Ga0068864_100000012	3300005618	Bacteria	335070
336	Ga0068864_100006968	3300005618	Bacteria	9269
337	Ga0068864_100025773	3300005618	Bacteria	4956
338	Ga0068864_100055647	3300005618	Bacteria	3416
339	Ga0068864_100212372	3300005618	Bacteria	1782
340	Ga0068864_100222496	3300005618	Bacteria	1742
341	Ga0068866_10003595	3300005718	Bacteria	6350
342	Ga0068866_10021586	3300005718	Bacteria	2968
343	Ga0068866_10114678	3300005718	Bacteria	1509
344	Ga0068866_10556073	3300005718	Bacteria	768
345	Ga0068861_100044557	3300005719	Bacteria	3336
346	Ga0068861_100075684	3300005719	Bacteria	2621
347	Ga0068861_100146024	3300005719	Bacteria	1936
348	Ga0068851_10241133	3300005834	Bacteria	1022
349	Ga0068870_10032901	3300005840	Bacteria	2641
350	Ga0068870_10114278	3300005840	Bacteria	1546
351	Ga0068870_10136449	3300005840	Bacteria	1431
352	Ga0068870_10257566	3300005840	Bacteria	1084
353	Ga0068863_100005831	3300005841	Bacteria	12070
354	Ga0068863_100015418	3300005841	Bacteria	7347
355	Ga0068863_100026468	3300005841	Bacteria	5532
356	Ga0068863_100237040	3300005841	Bacteria	1761
357	Ga0068863_100384472	3300005841	Bacteria	1371
358	Ga0068858_100009828	3300005842	Bacteria	9101
359	Ga0068858_100055498	3300005842	Bacteria	3662
360	Ga0068858_100156277	3300005842	Bacteria	2146
361	Ga0068858_100402757	3300005842	Bacteria	1315
362	Ga0068858_100663047	3300005842	Bacteria	1014
363	Ga0068858_100798388	3300005842	Bacteria	921
364	Ga0068860_100000307	3300005843	Bacteria	67841
365	Ga0068860_100001391	3300005843	Bacteria	26220
366	Ga0068860_100070283	3300005843	Bacteria	3328
367	Ga0068860_100102195	3300005843	Bacteria	2735
368	Ga0068860_100112403	3300005843	Bacteria	2604
369	Ga0068860_100115373	3300005843	Bacteria	2568
370	Ga0068860_100120088	3300005843	Bacteria	2517
371	Ga0068862_100001330	3300005844	Bacteria	22928
372	Ga0068862_100037283	3300005844	Bacteria	4120
373	Ga0068862_100077668	3300005844	Bacteria	2875
374	Ga0068862_100129199	3300005844	Bacteria	2233
375	Ga0068862_100138751	3300005844	Bacteria	2157
376	Ga0068862_100198412	3300005844	Bacteria	1808
377	Ga0068862_100251814	3300005844	Bacteria	1610
378	Ga0068862_100351066	3300005844	Bacteria	1368
379	Ga0068862_100714966	3300005844	Bacteria	971
380	Ga0068862_100974131	3300005844	Bacteria	837
381	Ga0068862_101176494	3300005844	Bacteria	764
382	Ga0081540_1005341	3300005983	Bacteria	9611
383	Ga0081540_1083755	3300005983	Bacteria	1425
384	Ga0081539_10000496	3300005985	Bacteria	82338
385	Ga0081539_10039863	3300005985	Bacteria	2766
386	Ga0070717_10194485	3300006028	Bacteria	1774
387	Ga0070717_10559670	3300006028	Bacteria	1036
388	Ga0075365_10001324	3300006038	Bacteria	11070
389	Ga0075368_10009813	3300006042	Bacteria	3452
390	Ga0075363_100011063	3300006048	Bacteria	4309
391	Ga0075363_100192874	3300006048	Bacteria	1162
392	Ga0075364_10034190	3300006051	Bacteria	3278
393	Ga0075364_10215776	3300006051	Bacteria	1301
394	Ga0075432_10005596	3300006058	Bacteria	4277
395	Ga0075432_10121179	3300006058	Bacteria	983
396	Ga0070715_10008876	3300006163	Bacteria	3521
397	Ga0070715_10013717	3300006163	Bacteria	2983
398	Ga0070715_10071545	3300006163	Bacteria	1550
399	Ga0070716_100020863	3300006173	Bacteria	3445
400	Ga0070716_100168934	3300006173	Bacteria	1425
401	Ga0070712_100000999	3300006175	Bacteria	17019
402	Ga0070712_100052091	3300006175	Bacteria	2853
403	Ga0070712_100396470	3300006175	Bacteria	1139
404	Ga0070712_100453517	3300006175	Bacteria	1068
405	Ga0070712_100583305	3300006175	Bacteria	945
406	Ga0075362_10005300	3300006177	Bacteria	4708
407	Ga0075362_10073007	3300006177	Bacteria	1570
408	Ga0075362_10077894	3300006177	Bacteria	1524
409	Ga0075362_10116295	3300006177	Bacteria	1263
410	Ga0075362_10136155	3300006177	Bacteria	1171
411	Ga0075362_10141967	3300006177	Bacteria	1148
412	Ga0075367_10065622	3300006178	Bacteria	2174
413	Ga0075369_10000196	3300006186	Bacteria	17555
414	Ga0075427_10042848	3300006194	Bacteria	766
415	Ga0075366_10001177	3300006195	Bacteria	12968
416	Ga0075366_10075152	3300006195	Bacteria	2015
417	Ga0075366_10213729	3300006195	Bacteria	1174
418	Ga0075366_10329657	3300006195	Bacteria	936
419	Ga0075366_10348293	3300006195	Bacteria	909
420	Ga0097621_100009617	3300006237	Bacteria	7026
421	Ga0097621_100034668	3300006237	Bacteria	4027
422	Ga0097621_100078824	3300006237	Bacteria	2737
423	Ga0097621_100253025	3300006237	Bacteria	1543
424	Ga0097621_100506751	3300006237	Bacteria	1094
425	Ga0075370_10000070	3300006353	Bacteria	31239
426	Ga0075370_10017029	3300006353	Bacteria	3920
427	Ga0075370_10070408	3300006353	Bacteria	2000
428	Ga0075370_10161878	3300006353	Bacteria	1313
429	Ga0068871_100009286	3300006358	Bacteria	7118
430	Ga0068871_100019447	3300006358	Bacteria	5185
431	Ga0068871_100047889	3300006358	Bacteria	3448
432	Ga0068871_100054099	3300006358	Bacteria	3255
433	Ga0075428_100057314	3300006844	Bacteria	4265
434	Ga0075428_100197695	3300006844	Bacteria	2174
435	Ga0075428_101041446	3300006844	Bacteria	865
436	Ga0075428_101208143	3300006844	Bacteria	797
437	Ga0075430_100003425	3300006846	Bacteria	13261
438	Ga0075430_100010264	3300006846	Bacteria	7930
439	Ga0075430_100024799	3300006846	Bacteria	5101
440	Ga0075430_100061149	3300006846	Bacteria	3165
441	Ga0075430_100105842	3300006846	Bacteria	2347
442	Ga0075430_100599846	3300006846	Bacteria	909
443	Ga0075431_100006349	3300006847	Bacteria	11742
444	Ga0075431_100014586	3300006847	Bacteria	7951
445	Ga0075431_100037115	3300006847	Bacteria	5021
446	Ga0075431_100038362	3300006847	Bacteria	4933
447	Ga0075431_100940239	3300006847	Bacteria	833
448	Ga0075433_10000934	3300006852	Bacteria	20627
449	Ga0075433_10039205	3300006852	Bacteria	4095
450	Ga0075433_10278601	3300006852	Bacteria	1482
451	Ga0075433_10495410	3300006852	Bacteria	1076
452	Ga0075433_10666305	3300006852	Bacteria	912
453	Ga0075434_100010076	3300006871	Bacteria	8850
454	Ga0075434_100041114	3300006871	Bacteria	4579
455	Ga0075434_100062553	3300006871	Bacteria	3705
456	Ga0075434_100119265	3300006871	Bacteria	2652
457	Ga0075429_100005914	3300006880	Bacteria	10561
458	Ga0075429_100006874	3300006880	Bacteria	9874
459	Ga0075429_100066449	3300006880	Bacteria	3139
460	Ga0075429_100176884	3300006880	Bacteria	1870
461	Ga0075429_100471744	3300006880	Bacteria	1100
462	Ga0075429_100569478	3300006880	Bacteria	992
463	Ga0068865_100026301	3300006881	Bacteria	3836
464	Ga0068865_100028965	3300006881	Bacteria	3669
465	Ga0068865_100034410	3300006881	Bacteria	3399
466	Ga0068865_100038959	3300006881	Bacteria	3220
467	Ga0068865_100233301	3300006881	Bacteria	1445
468	Ga0068865_100550150	3300006881	Bacteria	969
469	Ga0075436_100020065	3300006914	Bacteria	4586
470	Ga0075436_100063502	3300006914	Bacteria	2552
471	Ga0075436_100259151	3300006914	Bacteria	1240
472	Ga0097620_100009093	3300006931	Bacteria	10031
473	Ga0097620_100018683	3300006931	Bacteria	6966
474	Ga0097620_100023811	3300006931	Bacteria	6145
475	Ga0097620_100030471	3300006931	Bacteria	5413
476	Ga0097620_100122422	3300006931	Bacteria	2669
477	Ga0097620_100181511	3300006931	Bacteria	2187
478	Ga0097620_100332821	3300006931	Bacteria	1613
479	Ga0097620_100378240	3300006931	Bacteria	1512
480	Ga0079104_1002636	3300006946	Bacteria	9354
481	Ga0079104_1010479	3300006946	Bacteria	3053
482	Ga0079104_1029840	3300006946	Bacteria	1369
483	Ga0079104_1035578	3300006946	Bacteria	1201
484	Ga0075435_100033420	3300007076	Bacteria	4067
485	Ga0075435_100197364	3300007076	Bacteria	1704
486	Ga0075435_100538222	3300007076	Bacteria	1011
487	Ga0075435_100897663	3300007076	Bacteria	773
488	Ga0105244_10015662	3300009036	Bacteria	4342
489	Ga0105240_10000563	3300009093	Bacteria	68687
490	Ga0105240_10031262	3300009093	Bacteria	6906
491	Ga0105240_10185432	3300009093	Bacteria	2451
492	Ga0105240_10487292	3300009093	Bacteria	1373
493	Ga0105240_10487748	3300009093	Bacteria	1372
494	Ga0111539_10012202	3300009094	Bacteria	10778
495	Ga0111539_10127301	3300009094	Bacteria	2983
496	Ga0111539_10146641	3300009094	Bacteria	2763
497	Ga0111539_10164443	3300009094	Bacteria	2595
498	Ga0111539_10236038	3300009094	Bacteria	2129
499	Ga0111539_10278981	3300009094	Bacteria	1945
500	Ga0111539_10641150	3300009094	Bacteria	1237
501	Ga0105245_10017906	3300009098	Bacteria	6186
502	Ga0105245_10017913	3300009098	Bacteria	6185
503	Ga0105245_10110655	3300009098	Bacteria	2554
504	Ga0105245_10227987	3300009098	Bacteria	1801
505	Ga0105245_10319489	3300009098	Bacteria	1529
506	Ga0105245_10505853	3300009098	Bacteria	1225
507	Ga0105245_10522408	3300009098	Bacteria	1206
508	Ga0105245_10662578	3300009098	Bacteria	1074
509	Ga0105245_11231053	3300009098	Bacteria	797
510	Ga0105247_10070752	3300009101	Bacteria	2180
511	Ga0105247_10394019	3300009101	Bacteria	985
512	Ga0114129_10018133	3300009147	Bacteria	10025
513	Ga0114129_10244889	3300009147	Bacteria	2409
514	Ga0114129_10523869	3300009147	Bacteria	1545
515	Ga0114129_10969915	3300009147	Bacteria	1072
516	Ga0105243_10008316	3300009148	Bacteria	7971
517	Ga0105243_10071400	3300009148	Bacteria	2807
518	Ga0105243_10098915	3300009148	Bacteria	2417
519	Ga0105243_10204891	3300009148	Bacteria	1733
520	Ga0105243_10220258	3300009148	Bacteria	1677
521	Ga0105243_10390861	3300009148	Bacteria	1289
522	Ga0105243_10768695	3300009148	Bacteria	946
523	Ga0105241_10089342	3300009174	Bacteria	2427
524	Ga0105241_10327739	3300009174	Bacteria	1322
525	Ga0105241_10557527	3300009174	Bacteria	1030
526	Ga0105242_10013473	3300009176	Bacteria	6322
527	Ga0105242_10018723	3300009176	Bacteria	5417
528	Ga0105242_10100102	3300009176	Bacteria	2454
529	Ga0105242_10108628	3300009176	Bacteria	2361
530	Ga0105242_10143562	3300009176	Bacteria	2074
531	Ga0105248_10008716	3300009177	Bacteria	11142
532	Ga0105248_10020084	3300009177	Bacteria	7400
533	Ga0105248_10037172	3300009177	Bacteria	5446
534	Ga0105248_10114691	3300009177	Bacteria	3039
535	Ga0105248_10158633	3300009177	Bacteria	2552
536	Ga0105248_10185132	3300009177	Bacteria	2347
537	Ga0105248_10615989	3300009177	Bacteria	1225
538	Ga0105237_10011815	3300009545	Bacteria	9236
539	Ga0105237_10045617	3300009545	Bacteria	4410
540	Ga0105237_10083264	3300009545	Bacteria	3190
541	Ga0105237_10094463	3300009545	Bacteria	2979
542	Ga0105237_10357317	3300009545	Bacteria	1465
543	Ga0105237_10521837	3300009545	Bacteria	1194
544	Ga0105237_10663719	3300009545	Bacteria	1049
545	Ga0105238_10051778	3300009551	Bacteria	4128
546	Ga0105238_10065592	3300009551	Bacteria	3632
547	Ga0105238_10170360	3300009551	Bacteria	2153
548	Ga0105238_10302941	3300009551	Bacteria	1582
549	Ga0105249_10004272	3300009553	Bacteria	12349
550	Ga0105249_10028649	3300009553	Bacteria	5027
551	Ga0105249_10029991	3300009553	Bacteria	4914
552	Ga0105249_10087899	3300009553	Bacteria	2901
553	Ga0105249_10120989	3300009553	Bacteria	2487
554	Ga0105249_10216694	3300009553	Bacteria	1882
555	Ga0105249_10242656	3300009553	Bacteria	1782
556	Ga0105249_10524406	3300009553	Bacteria	1232
557	Ga0105239_10001582	3300010375	Bacteria	30053
558	Ga0105239_10186762	3300010375	Bacteria	2320
559	Ga0105239_10226581	3300010375	Bacteria	2097
560	Ga0105239_10250577	3300010375	Bacteria	1989
561	Ga0105239_10351625	3300010375	Bacteria	1664
562	Ga0105239_10420708	3300010375	Bacteria	1513
563	Ga0105239_10574188	3300010375	Bacteria	1285
564	Ga0105239_10885064	3300010375	Bacteria	1025
565	Ga0105239_11366174	3300010375	Bacteria	818
566	Ga0105246_10041565	3300011119	Bacteria	3108
567	Ga0105246_10137864	3300011119	Bacteria	1831
568	Ga0157373_10205183	3300013100	Bacteria	1390
569	Ga0157371_10461921	3300013102	Bacteria	934
570	Ga0157369_10014134	3300013105	Bacteria	9021
571	Ga0157369_10051029	3300013105	Bacteria	4478
572	Ga0157374_10005449	3300013296	Bacteria	10693
573	Ga0157374_10008837	3300013296	Bacteria	8624
574	Ga0157374_10056204	3300013296	Bacteria	3674
575	Ga0157374_10106392	3300013296	Bacteria	2695
576	Ga0157374_10127649	3300013296	Bacteria	2459
577	Ga0157374_10196774	3300013296	Bacteria	1973
578	Ga0157374_10286429	3300013296	Bacteria	1627
579	Ga0157374_10694983	3300013296	Bacteria	1030
580	Ga0157378_10039014	3300013297	Bacteria	4211
581	Ga0157378_10051099	3300013297	Bacteria	3678
582	Ga0157378_10076604	3300013297	Bacteria	3014
583	Ga0157378_10132694	3300013297	Bacteria	2307
584	Ga0157378_10146733	3300013297	Bacteria	2195
585	Ga0157378_10376451	3300013297	Bacteria	1393
586	Ga0157378_10382540	3300013297	Bacteria	1382
587	Ga0157378_10480276	3300013297	Bacteria	1238
588	Ga0157378_10786858	3300013297	Bacteria	976
589	Ga0163162_10011365	3300013306	Bacteria	8680
590	Ga0163162_10020571	3300013306	Bacteria	6483
591	Ga0163162_10037561	3300013306	Bacteria	4833
592	Ga0163162_10198812	3300013306	Bacteria	2133
593	Ga0163162_10267807	3300013306	Bacteria	1840
594	Ga0163162_10272473	3300013306	Bacteria	1824
595	Ga0163162_10302655	3300013306	Bacteria	1731
596	Ga0163162_10453196	3300013306	Bacteria	1415
597	Ga0163162_10704802	3300013306	Bacteria	1131
598	Ga0163162_11064461	3300013306	Bacteria	916
599	Ga0157372_11046462	3300013307	Bacteria	945
600	Ga0157375_10011398	3300013308	Bacteria	7848
601	Ga0157375_10012303	3300013308	Bacteria	7588
602	Ga0157375_10023571	3300013308	Bacteria	5681
603	Ga0157375_10069520	3300013308	Bacteria	3528
604	Ga0157375_10071106	3300013308	Bacteria	3491
605	Ga0157375_10072089	3300013308	Bacteria	3470
606	Ga0157375_10075828	3300013308	Bacteria	3388
607	Ga0157375_10142050	3300013308	Bacteria	2528
608	Ga0157375_10375760	3300013308	Bacteria	1588
609	Ga0157375_10399281	3300013308	Bacteria	1541
610	Ga0157375_10684665	3300013308	Bacteria	1180
611	Ga0157375_10719457	3300013308	Bacteria	1151
612	Ga0163163_10000051	3300014325	Bacteria	128275
613	Ga0163163_10054153	3300014325	Bacteria	3963
614	Ga0163163_10063216	3300014325	Bacteria	3670
615	Ga0163163_10108090	3300014325	Bacteria	2808
616	Ga0163163_10133893	3300014325	Bacteria	2519
617	Ga0163163_10311234	3300014325	Bacteria	1628
618	Ga0163163_10354057	3300014325	Bacteria	1524
619	Ga0157380_10094964	3300014326	Bacteria	2469
620	Ga0157380_10166151	3300014326	Bacteria	1923
621	Ga0157380_10219042	3300014326	Bacteria	1702
622	Ga0157380_10381920	3300014326	Bacteria	1330
623	Ga0157380_10512693	3300014326	Bacteria	1168
624	Ga0157380_10618058	3300014326	Bacteria	1075
625	Ga0182008_10004860	3300014497	Bacteria	7764
626	Ga0182008_10063481	3300014497	Bacteria	1819
627	Ga0157377_10062558	3300014745	Bacteria	2130
628	Ga0157377_10172299	3300014745	Bacteria	1355
629	Ga0157377_10552822	3300014745	Bacteria	813
630	Ga0157379_10046029	3300014968	Bacteria	3895
631	Ga0157379_10136889	3300014968	Bacteria	2207
632	Ga0157379_10150839	3300014968	Bacteria	2096
633	Ga0157379_10243395	3300014968	Bacteria	1632
634	Ga0157379_10408546	3300014968	Bacteria	1249
635	Ga0157379_10809052	3300014968	Bacteria	885
636	Ga0157376_10013233	3300014969	Bacteria	6150
637	Ga0157376_10033062	3300014969	Bacteria	4160
638	Ga0157376_10073932	3300014969	Bacteria	2904
639	Ga0157376_10174025	3300014969	Bacteria	1963
640	Ga0157376_10392346	3300014969	Bacteria	1340
641	Ga0157376_10708219	3300014969	Bacteria	1012
642	Ga0182006_1000008	3300015261	Bacteria	449652
643	Ga0182005_1000008	3300015265	Bacteria	471394
644	Ga0163161_10026117	3300017792	Bacteria	4137
645	Ga0163161_10048577	3300017792	Bacteria	3065
646	Ga0163161_10065851	3300017792	Bacteria	2644
647	Ga0163161_10110480	3300017792	Bacteria	2055
648	Ga0163161_10317153	3300017792	Bacteria	1231
649	Ga0206351_10852300	3300020077	Bacteria	1005
650	Ga0206350_10329904	3300020080	Bacteria	1825
651	Ga0206353_11181477	3300020082	Bacteria	1991
652	Ga0213872_10003808	3300021361	Bacteria	8217
653	Ga0213872_10013437	3300021361	Bacteria	3836
654	Ga0213876_10008784	3300021384	Bacteria	5457
655	Ga0209435_100001	3300025206	Bacteria	1424171
656	Ga0209435_100028	3300025206	Bacteria	182520
657	Ga0209435_100037	3300025206	Bacteria	124928
658	Ga0209436_103684	3300025208	Bacteria	3987
659	Ga0209784_100002	3300025224	Bacteria	1753105
660	Ga0209566_100003	3300025225	Bacteria	1753105
661	Ga0209674_100004	3300025226	Bacteria	1753105
662	Ga0209147_100004	3300025229	Bacteria	1371850
663	Ga0209563_100006	3300025230	Bacteria	1753105
664	Ga0209437_100602	3300025233	Bacteria	22365
665	Ga0209437_102027	3300025233	Bacteria	4142
666	Ga0209437_106995	3300025233	Bacteria	1857
667	Ga0209258_100458	3300025242	Bacteria	44388
668	Ga0207425_1000636	3300025245	Bacteria	19796
669	Ga0207425_1019252	3300025245	Bacteria	1472
670	Ga0209646_1000001	3300025246	Bacteria	3092932
671	Ga0209646_1000021	3300025246	Bacteria	461083
672	Ga0209646_1000049	3300025246	Bacteria	301924
673	Ga0209646_1000095	3300025246	Bacteria	182520
674	Ga0209026_1000001	3300025250	Bacteria	1228671
675	Ga0209026_1014621	3300025250	Bacteria	1305
676	Ga0209677_100003	3300025253	Bacteria	1753105
677	Ga0209759_1000001	3300025256	Bacteria	2799452
678	Ga0209759_1000100	3300025256	Bacteria	156294
679	Ga0209759_1003396	3300025256	Bacteria	6381
680	Ga0209759_1009817	3300025256	Bacteria	2863
681	Ga0209129_1012297	3300025258	Bacteria	1973
682	Ga0209233_1001234	3300025261	Bacteria	10265
683	Ga0209565_1008581	3300025263	Bacteria	2654
684	Ga0209565_1009729	3300025263	Bacteria	2418
685	Ga0209565_1023540	3300025263	Bacteria	1264
686	Ga0209455_1000026	3300025272	Bacteria	653778
687	Ga0209455_1001665	3300025272	Bacteria	9602
688	Ga0209673_1000232	3300025273	Bacteria	108581
689	Ga0209673_1026132	3300025273	Bacteria	1924
690	Ga0209130_1000041	3300025284	Bacteria	261078
691	Ga0209130_1000125	3300025284	Bacteria	124425
692	Ga0209130_1003555	3300025284	Bacteria	6526
693	Ga0209675_1000128	3300025291	Bacteria	103111
694	Ga0209675_1002593	3300025291	Bacteria	9182
695	Ga0209676_1000054	3300025292	Bacteria	365890
696	Ga0209025_1000016	3300025294	Bacteria	770739
697	Ga0209025_1007544	3300025294	Bacteria	8076
698	Ga0209025_1011038	3300025294	Bacteria	6024
699	Ga0209025_1012518	3300025294	Bacteria	5428
700	Ga0209025_1017065	3300025294	Bacteria	4225
701	Ga0209025_1029337	3300025294	Bacteria	2665
702	Ga0209564_1000002	3300025295	Bacteria	1636803
703	Ga0209564_1000096	3300025295	Bacteria	232165
704	Ga0209564_1000403	3300025295	Bacteria	76834
705	Ga0209564_1019000	3300025295	Bacteria	2588
706	Ga0209564_1033897	3300025295	Bacteria	1508
707	Ga0209758_1000866	3300025297	Bacteria	41778
708	Ga0209758_1019945	3300025297	Bacteria	3201
709	Ga0209758_1056908	3300025297	Bacteria	1317
710	Ga0209050_1000066	3300025298	Bacteria	305458
711	Ga0209050_1007123	3300025298	Bacteria	6388
712	Ga0209256_1000003	3300025299	Bacteria	1661127
713	Ga0209256_1001488	3300025299	Bacteria	23889
714	Ga0207426_1000061	3300025302	Bacteria	362507
715	Ga0207426_1001601	3300025302	Bacteria	18025
716	Ga0207426_1017807	3300025302	Bacteria	2517
717	Ga0209051_1000044	3300025303	Bacteria	305458
718	Ga0209051_1038247	3300025303	Bacteria	1748
719	Ga0209257_1000082	3300025304	Bacteria	305458
720	Ga0207697_10016241	3300025315	Bacteria	3069
721	Ga0207656_10001440	3300025321	Bacteria	7891
722	Ga0207656_10032543	3300025321	Bacteria	2166
723	Ga0207655_1021569	3300025728	Bacteria	3264
724	Ga0207655_1027376	3300025728	Bacteria	2716
725	Ga0207653_10000520	3300025885	Bacteria	14672
726	Ga0207653_10072028	3300025885	Bacteria	1182
727	Ga0207682_10004319	3300025893	Bacteria	5975
728	Ga0207692_10046398	3300025898	Bacteria	2178
729	Ga0207692_10065113	3300025898	Bacteria	1900
730	Ga0207642_10017369	3300025899	Bacteria	2735
731	Ga0207642_10025415	3300025899	Bacteria	2396
732	Ga0207642_10061003	3300025899	Bacteria	1752
733	Ga0207642_10266129	3300025899	Bacteria	980
734	Ga0207710_10014240	3300025900	Bacteria	3351
735	Ga0207688_10015851	3300025901	Bacteria	4088
736	Ga0207688_10089406	3300025901	Bacteria	1767
737	Ga0207680_10004960	3300025903	Bacteria	6337
738	Ga0207680_10020947	3300025903	Bacteria	3530
739	Ga0207680_10451019	3300025903	Bacteria	913
740	Ga0207680_10713644	3300025903	Bacteria	719
741	Ga0207685_10074184	3300025905	Bacteria	1388
742	Ga0207645_10000102	3300025907	Bacteria	62531
743	Ga0207645_10000732	3300025907	Bacteria	27342
744	Ga0207645_10061985	3300025907	Bacteria	2389
745	Ga0207645_10098993	3300025907	Bacteria	1880
746	Ga0207645_10288121	3300025907	Bacteria	1092
747	Ga0207645_10311797	3300025907	Bacteria	1048
748	Ga0207643_10022253	3300025908	Bacteria	3488
749	Ga0207643_10039865	3300025908	Bacteria	2643
750	Ga0207643_10320414	3300025908	Bacteria	968
751	Ga0207705_10004379	3300025909	Bacteria	10672
752	Ga0207705_10046679	3300025909	Bacteria	3113
753	Ga0207684_10021984	3300025910	Bacteria	5447
754	Ga0207684_10384141	3300025910	Bacteria	1207
755	Ga0207654_10184673	3300025911	Bacteria	1362
756	Ga0207654_10331446	3300025911	Bacteria	1043
757	Ga0207707_10009284	3300025912	Bacteria	8528
758	Ga0207707_10010896	3300025912	Bacteria	7904
759	Ga0207707_10036624	3300025912	Bacteria	4289
760	Ga0207707_10178743	3300025912	Bacteria	1853
761	Ga0207707_10325807	3300025912	Bacteria	1326
762	Ga0207695_10000655	3300025913	Bacteria	68624
763	Ga0207695_10034866	3300025913	Bacteria	5465
764	Ga0207695_10038144	3300025913	Bacteria	5177
765	Ga0207695_10071033	3300025913	Bacteria	3556
766	Ga0207695_10133062	3300025913	Bacteria	2442
767	Ga0207671_10003123	3300025914	Bacteria	16824
768	Ga0207671_10313373	3300025914	Bacteria	1241
769	Ga0207671_10471783	3300025914	Bacteria	1000
770	Ga0207693_10003457	3300025915	Bacteria	13479
771	Ga0207693_10594881	3300025915	Bacteria	861
772	Ga0207663_10017659	3300025916	Bacteria	3981
773	Ga0207660_10006228	3300025917	Bacteria	7749
774	Ga0207660_10279610	3300025917	Bacteria	1324
775	Ga0207662_10022891	3300025918	Bacteria	3586
776	Ga0207662_10056729	3300025918	Bacteria	2340
777	Ga0207662_10101532	3300025918	Bacteria	1783
778	Ga0207657_10003726	3300025919	Bacteria	16198
779	Ga0207657_10003797	3300025919	Bacteria	16064
780	Ga0207649_10158248	3300025920	Bacteria	1567
781	Ga0207652_10089100	3300025921	Bacteria	2709
782	Ga0207652_10745048	3300025921	Bacteria	872
783	Ga0207646_10064740	3300025922	Bacteria	3263
784	Ga0207646_10361922	3300025922	Bacteria	1310
785	Ga0207646_10657121	3300025922	Bacteria	939
786	Ga0207681_10003604	3300025923	Bacteria	9636
787	Ga0207681_10003995	3300025923	Bacteria	9153
788	Ga0207681_10008813	3300025923	Bacteria	6162
789	Ga0207681_10049651	3300025923	Bacteria	2837
790	Ga0207681_10127104	3300025923	Bacteria	1879
791	Ga0207681_10576274	3300025923	Bacteria	928
792	Ga0207694_10010628	3300025924	Bacteria	6948
793	Ga0207694_10062020	3300025924	Bacteria	2910
794	Ga0207694_10234210	3300025924	Bacteria	1500
795	Ga0207650_10000002	3300025925	Bacteria	1439222
796	Ga0207650_10039594	3300025925	Bacteria	3444
797	Ga0207650_10076546	3300025925	Bacteria	2528
798	Ga0207650_10517481	3300025925	Bacteria	998
799	Ga0207650_10624089	3300025925	Bacteria	907
800	Ga0207659_10022533	3300025926	Bacteria	4194
801	Ga0207659_10034693	3300025926	Bacteria	3481
802	Ga0207659_10141942	3300025926	Bacteria	1865
803	Ga0207659_10162635	3300025926	Bacteria	1754
804	Ga0207659_10205295	3300025926	Bacteria	1576
805	Ga0207659_10284141	3300025926	Bacteria	1354
806	Ga0207659_10334645	3300025926	Bacteria	1253
807	Ga0207687_10011912	3300025927	Bacteria	5688
808	Ga0207687_10191450	3300025927	Bacteria	1592
809	Ga0207664_10000672	3300025929	Bacteria	23492
810	Ga0207664_10567971	3300025929	Bacteria	1018
811	Ga0207644_10000026	3300025931	Bacteria	147255
812	Ga0207644_10010181	3300025931	Bacteria	6195
813	Ga0207644_10015473	3300025931	Bacteria	5121
814	Ga0207690_10602612	3300025932	Bacteria	897
815	Ga0207706_10071235	3300025933	Bacteria	3057
816	Ga0207706_10103035	3300025933	Bacteria	2511
817	Ga0207706_10109541	3300025933	Bacteria	2430
818	Ga0207706_10214509	3300025933	Bacteria	1686
819	Ga0207706_10293640	3300025933	Bacteria	1417
820	Ga0207706_10402526	3300025933	Bacteria	1187
821	Ga0207686_10059661	3300025934	Bacteria	2411
822	Ga0207686_10204180	3300025934	Bacteria	1417
823	Ga0207686_10217255	3300025934	Bacteria	1378
824	Ga0207686_10323763	3300025934	Bacteria	1153
825	Ga0207686_10392980	3300025934	Bacteria	1054
826	Ga0207709_10028471	3300025935	Bacteria	3230
827	Ga0207709_10130616	3300025935	Bacteria	1711
828	Ga0207709_10207871	3300025935	Bacteria	1403
829	Ga0207709_10401639	3300025935	Bacteria	1048
830	Ga0207709_10906298	3300025935	Bacteria	717
831	Ga0207670_10123533	3300025936	Bacteria	1885
832	Ga0207670_10152192	3300025936	Bacteria	1718
833	Ga0207670_10373633	3300025936	Bacteria	1134
834	Ga0207670_10430181	3300025936	Bacteria	1061
835	Ga0207669_10015097	3300025937	Bacteria	3886
836	Ga0207669_10015427	3300025937	Bacteria	3852
837	Ga0207669_10036541	3300025937	Bacteria	2809
838	Ga0207669_10040887	3300025937	Bacteria	2693
839	Ga0207669_10101801	3300025937	Bacteria	1901
840	Ga0207704_10007850	3300025938	Bacteria	5065
841	Ga0207704_10021705	3300025938	Bacteria	3425
842	Ga0207704_10034573	3300025938	Bacteria	2885
843	Ga0207704_10068087	3300025938	Bacteria	2243
844	Ga0207704_10134482	3300025938	Bacteria	1718
845	Ga0207665_10014889	3300025939	Bacteria	5111
846	Ga0207691_10000180	3300025940	Bacteria	59800
847	Ga0207691_10003239	3300025940	Bacteria	15863
848	Ga0207691_10076490	3300025940	Bacteria	3016
849	Ga0207711_10000916	3300025941	Bacteria	28413
850	Ga0207711_10042197	3300025941	Bacteria	3887
851	Ga0207711_10045696	3300025941	Bacteria	3743
852	Ga0207711_10226317	3300025941	Bacteria	1712
853	Ga0207711_10423426	3300025941	Bacteria	1238
854	Ga0207689_10007770	3300025942	Bacteria	9383
855	Ga0207689_10077626	3300025942	Bacteria	2729
856	Ga0207689_10158247	3300025942	Bacteria	1867
857	Ga0207689_10191813	3300025942	Bacteria	1686
858	Ga0207689_10262572	3300025942	Bacteria	1429
859	Ga0207689_10366315	3300025942	Bacteria	1199
860	Ga0207689_10640772	3300025942	Bacteria	895
861	Ga0207689_10649125	3300025942	Bacteria	889
862	Ga0207667_10000032	3300025949	Bacteria	322253
863	Ga0207667_10010771	3300025949	Bacteria	10666
864	Ga0207667_10011898	3300025949	Bacteria	10078
865	Ga0207667_10030433	3300025949	Bacteria	5840
866	Ga0207667_10347806	3300025949	Bacteria	1512
867	Ga0207667_10396708	3300025949	Bacteria	1405
868	Ga0207651_10022992	3300025960	Bacteria	3825
869	Ga0207651_10028920	3300025960	Bacteria	3504
870	Ga0207651_10040598	3300025960	Bacteria	3080
871	Ga0207712_10009342	3300025961	Bacteria	6203
872	Ga0207712_10051280	3300025961	Bacteria	2885
873	Ga0207712_10250394	3300025961	Bacteria	1431
874	Ga0207712_10604070	3300025961	Bacteria	949
875	Ga0207668_10007330	3300025972	Bacteria	6555
876	Ga0207668_10012572	3300025972	Bacteria	5186
877	Ga0207668_10027166	3300025972	Bacteria	3726
878	Ga0207668_10048897	3300025972	Bacteria	2904
879	Ga0207668_10054922	3300025972	Bacteria	2766
880	Ga0207668_10078503	3300025972	Bacteria	2384
881	Ga0207668_10172472	3300025972	Bacteria	1698
882	Ga0207668_10363850	3300025972	Bacteria	1213
883	Ga0207668_10376375	3300025972	Bacteria	1194
884	Ga0207668_10524222	3300025972	Bacteria	1023
885	Ga0207668_10605878	3300025972	Bacteria	954
886	Ga0207668_10608956	3300025972	Bacteria	952
887	Ga0207640_10052448	3300025981	Bacteria	2657
888	Ga0207640_10219519	3300025981	Bacteria	1454
889	Ga0207640_10260025	3300025981	Bacteria	1352
890	Ga0207640_10350513	3300025981	Bacteria	1186
891	Ga0207658_10000001	3300025986	Bacteria	1439333
892	Ga0207658_10005886	3300025986	Bacteria	8384
893	Ga0207658_10021998	3300025986	Bacteria	4435
894	Ga0207677_10017006	3300026023	Bacteria	4322
895	Ga0207677_10029660	3300026023	Bacteria	3480
896	Ga0207677_10072358	3300026023	Bacteria	2437
897	Ga0207677_10072401	3300026023	Bacteria	2436
898	Ga0207677_10132299	3300026023	Bacteria	1896
899	Ga0207703_10039845	3300026035	Bacteria	3757
900	Ga0207703_10091652	3300026035	Bacteria	2557
901	Ga0207703_10131416	3300026035	Bacteria	2162
902	Ga0207703_10179339	3300026035	Bacteria	1869
903	Ga0207703_10314123	3300026035	Bacteria	1433
904	Ga0207703_10457713	3300026035	Bacteria	1193
905	Ga0207703_10515186	3300026035	Bacteria	1124
906	Ga0207703_10714343	3300026035	Bacteria	954
907	Ga0207703_11119368	3300026035	Bacteria	756
908	Ga0207639_10010343	3300026041	Bacteria	6461
909	Ga0207639_10038432	3300026041	Bacteria	3560
910	Ga0207639_10893277	3300026041	Bacteria	830
911	Ga0207639_10942150	3300026041	Bacteria	808
912	Ga0207678_10030882	3300026067	Bacteria	4677
913	Ga0207678_10195153	3300026067	Bacteria	1730
914	Ga0207678_10392435	3300026067	Bacteria	1201
915	Ga0207708_10000296	3300026075	Bacteria	39206
916	Ga0207708_10014170	3300026075	Bacteria	5961
917	Ga0207708_10027615	3300026075	Bacteria	4298
918	Ga0207708_10281868	3300026075	Bacteria	1347
919	Ga0207708_10331553	3300026075	Bacteria	1244
920	Ga0207708_10434486	3300026075	Bacteria	1091
921	Ga0207708_10573890	3300026075	Bacteria	953
922	Ga0207702_10036021	3300026078	Bacteria	4138
923	Ga0207641_10010824	3300026088	Bacteria	7474
924	Ga0207641_10014927	3300026088	Bacteria	6368
925	Ga0207641_10125424	3300026088	Bacteria	2298
926	Ga0207641_10144670	3300026088	Bacteria	2148
927	Ga0207641_10254236	3300026088	Bacteria	1642
928	Ga0207641_10506501	3300026088	Bacteria	1173
929	Ga0207641_10688832	3300026088	Bacteria	1006
930	Ga0207648_10000687	3300026089	Bacteria	37860
931	Ga0207648_10009360	3300026089	Bacteria	9387
932	Ga0207648_10028303	3300026089	Bacteria	4970
933	Ga0207648_10029050	3300026089	Bacteria	4902
934	Ga0207648_10068261	3300026089	Bacteria	3097
935	Ga0207648_10074053	3300026089	Bacteria	2967
936	Ga0207648_10249018	3300026089	Bacteria	1584
937	Ga0207676_10000001	3300026095	Bacteria	1439222
938	Ga0207676_10009854	3300026095	Bacteria	6797
939	Ga0207676_10133582	3300026095	Bacteria	2114
940	Ga0207676_10182579	3300026095	Bacteria	1838
941	Ga0207676_10593219	3300026095	Bacteria	1063
942	Ga0207674_10006165	3300026116	Bacteria	14155
943	Ga0207674_10044496	3300026116	Bacteria	4572
944	Ga0207674_10125546	3300026116	Bacteria	2532
945	Ga0207674_10277623	3300026116	Bacteria	1623
946	Ga0207674_10278464	3300026116	Bacteria	1620
947	Ga0207675_100051895	3300026118	Bacteria	3827
948	Ga0207675_100067433	3300026118	Bacteria	3345
949	Ga0207675_100109641	3300026118	Bacteria	2604
950	Ga0207675_100143651	3300026118	Bacteria	2268
951	Ga0207675_100156359	3300026118	Bacteria	2173
952	Ga0207675_100540607	3300026118	Bacteria	1163
953	Ga0207675_100635562	3300026118	Bacteria	1072
954	Ga0207683_10000146	3300026121	Bacteria	58543
955	Ga0207683_10000675	3300026121	Bacteria	31274
956	Ga0207683_10005534	3300026121	Bacteria	10827
957	Ga0207683_10099676	3300026121	Bacteria	2593
958	Ga0207683_10131984	3300026121	Bacteria	2247
959	Ga0207683_10165874	3300026121	Bacteria	1998
960	Ga0207683_10369352	3300026121	Bacteria	1318
961	Ga0207683_10384311	3300026121	Bacteria	1291
962	Ga0207698_10001624	3300026142	Bacteria	13092
963	Ga0207698_10066782	3300026142	Bacteria	2833
964	Ga0209281_1023531	3300027111	Bacteria	1166
965	Ga0209967_1034100	3300027364	Bacteria	766
966	Ga0209996_1003581	3300027395	Bacteria	1958
967	Ga0209971_1003818	3300027682	Bacteria	3562
968	Ga0209813_10006478	3300027866	Bacteria	2894
969	Ga0209813_10007696	3300027866	Bacteria	2692
970	Ga0209974_10043854	3300027876	Bacteria	1491
971	Ga0207428_10008338	3300027907	Bacteria	9363
972	Ga0207428_10113890	3300027907	Bacteria	2079
973	Ga0207428_10294130	3300027907	Bacteria	1203
974	Ga0207428_10360078	3300027907	Bacteria	1069
975	Ga0207428_10365023	3300027907	Bacteria	1061
976	Ga0265357_1000794	3300028023	Bacteria	2067
977	Ga0268266_10000265	3300028379	Bacteria	87871
978	Ga0268266_10012490	3300028379	Bacteria	7340
979	Ga0268266_10012716	3300028379	Bacteria	7273
980	Ga0268266_10077847	3300028379	Bacteria	2884
981	Ga0268266_10458245	3300028379	Bacteria	1213
982	Ga0268266_10459669	3300028379	Bacteria	1211
983	Ga0268266_10501150	3300028379	Bacteria	1159
984	Ga0268266_10821516	3300028379	Bacteria	898
985	Ga0268265_10001851	3300028380	Bacteria	16855
986	Ga0268265_10006237	3300028380	Bacteria	8078
987	Ga0268265_10022396	3300028380	Bacteria	4438
988	Ga0268265_10034914	3300028380	Bacteria	3669
989	Ga0268265_10050614	3300028380	Bacteria	3131
990	Ga0268265_10074451	3300028380	Bacteria	2656
991	Ga0268265_10430225	3300028380	Bacteria	1228
992	Ga0268265_10910834	3300028380	Bacteria	864
993	Ga0268264_10000061	3300028381	Bacteria	303123
994	Ga0268264_10005365	3300028381	Bacteria	10865
995	Ga0268264_10016354	3300028381	Bacteria	6075
996	Ga0268264_10049829	3300028381	Bacteria	3486
997	Ga0268264_10149636	3300028381	Bacteria	2092
998	Ga0268264_10283146	3300028381	Bacteria	1554
999	Ga0265337_1000118	3300028556	Bacteria	40488
1000	Ga0265326_10000283	3300028558	Bacteria	23176
1001	Ga0265326_10000719	3300028558	Bacteria	12236
1002	Ga0265326_10041931	3300028558	Bacteria	1299
1003	Ga0265319_1000096	3300028563	Bacteria	67662
1004	Ga0265319_1000553	3300028563	Bacteria	25349
1005	Ga0265319_1000819	3300028563	Bacteria	19860
1006	Ga0265334_10018531	3300028573	Bacteria	2870
1007	Ga0265334_10039309	3300028573	Bacteria	1857
1008	Ga0265318_10003317	3300028577	Bacteria	8152
1009	Ga0265318_10005418	3300028577	Bacteria	5992
1010	Ga0265318_10022487	3300028577	Bacteria	2520
1011	Ga0265323_10000359	3300028653	Bacteria	26221
1012	Ga0265323_10016313	3300028653	Bacteria	2902
1013	Ga0265322_10000482	3300028654	Bacteria	15681
1014	Ga0265336_10000043	3300028666	Bacteria	132135
1015	Ga0265336_10000597	3300028666	Bacteria	20233
1016	Ga0307517_10126414	3300028786	Bacteria	1863
1017	Ga0265338_10000142	3300028800	Bacteria	132135
1018	Ga0265338_10000493	3300028800	Bacteria	70460
1019	Ga0265338_10000597	3300028800	Bacteria	63672
1020	Ga0265338_10019432	3300028800	Bacteria	7210
1021	Ga0265324_10002736	3300029957	Bacteria	8761
1022	Ga0265324_10002808	3300029957	Bacteria	8594
1023	Ga0265324_10003379	3300029957	Bacteria	7625
1024	Ga0265324_10004464	3300029957	Bacteria	6303
1025	Ga0265330_10000356	3300031235	Bacteria	32258
1026	Ga0265330_10039738	3300031235	Bacteria	2090
1027	Ga0265332_10000003	3300031238	Bacteria	482849
1028	Ga0265332_10000021	3300031238	Bacteria	217090
1029	Ga0265332_10000479	3300031238	Bacteria	27656
1030	Ga0265328_10000815	3300031239	Bacteria	14408
1031	Ga0265328_10006017	3300031239	Bacteria	5165
1032	Ga0265320_10005906	3300031240	Bacteria	7790
1033	Ga0265320_10006732	3300031240	Bacteria	7218
1034	Ga0265325_10019062	3300031241	Bacteria	3798
1035	Ga0265329_10000864	3300031242	Bacteria	15294
1036	Ga0265340_10000006	3300031247	Bacteria	132135
1037	Ga0265340_10004932	3300031247	Bacteria	7421
1038	Ga0265339_10002055	3300031249	Bacteria	14784
1039	Ga0265339_10024720	3300031249	Bacteria	3457
1040	Ga0265331_10000012	3300031250	Bacteria	297201
1041	Ga0265331_10001576	3300031250	Bacteria	16682
1042	Ga0265331_10003879	3300031250	Bacteria	9457
1043	Ga0265331_10005555	3300031250	Bacteria	7595
1044	Ga0265331_10006167	3300031250	Bacteria	7120
1045	Ga0265331_10041745	3300031250	Bacteria	2228
1046	Ga0265331_10071781	3300031250	Bacteria	1618
1047	Ga0265331_10121406	3300031250	Bacteria	1195
1048	Ga0265327_10000014	3300031251	Bacteria	506288
1049	Ga0265327_10000112	3300031251	Bacteria	175878
1050	Ga0265327_10000206	3300031251	Bacteria	123199
1051	Ga0265327_10000534	3300031251	Bacteria	65455
1052	Ga0265327_10001313	3300031251	Bacteria	32413
1053	Ga0265327_10001547	3300031251	Bacteria	28328
1054	Ga0265327_10001664	3300031251	Bacteria	26733
1055	Ga0265327_10005513	3300031251	Bacteria	10524
1056	Ga0265327_10048616	3300031251	Bacteria	2230
1057	Ga0265327_10062154	3300031251	Bacteria	1902
1058	Ga0265316_10004876	3300031344	Bacteria	13217
1059	Ga0265316_10040745	3300031344	Bacteria	3722
1060	Ga0265316_10045711	3300031344	Bacteria	3474
1061	Ga0265316_10072513	3300031344	Bacteria	2653
1062	Ga0265316_10141280	3300031344	Bacteria	1808
1063	Ga0265316_10231603	3300031344	Bacteria	1360
1064	Ga0265316_10411283	3300031344	Unclassified	973
1065	Ga0265316_10466689	3300031344	Bacteria	904
1066	Ga0307513_10000021	3300031456	Bacteria	228078
1067	Ga0307509_10000053	3300031507	Bacteria	164364
1068	Ga0307408_100009944	3300031548	Bacteria	6265
1069	Ga0307408_100015741	3300031548	Bacteria	5039
1070	Ga0307408_100124346	3300031548	Bacteria	2003
1071	Ga0265313_10002931	3300031595	Bacteria	14248
1072	Ga0307508_10137763	3300031616	Bacteria	2044
1073	Ga0316575_10006294	3300031665	Bacteria	4263
1074	Ga0316575_10029247	3300031665	Bacteria	2151
1075	Ga0316579_10000051	3300031691	Bacteria	28043
1076	Ga0316579_10000784	3300031691	Bacteria	10910
1077	Ga0316579_10009517	3300031691	Bacteria	4089
1078	Ga0316579_10011358	3300031691	Bacteria	3783
1079	Ga0316579_10042684	3300031691	Bacteria	2107
1080	Ga0316579_10057182	3300031691	Bacteria	1832
1081	Ga0265314_10002775	3300031711	Bacteria	17493
1082	Ga0265342_10003252	3300031712	Bacteria	13466
1083	Ga0265342_10005848	3300031712	Bacteria	9287
1084	Ga0265342_10020488	3300031712	Bacteria	4240
1085	Ga0316576_10000113	3300031727	Bacteria	30303
1086	Ga0316576_10002850	3300031727	Bacteria	9964
1087	Ga0316576_10050681	3300031727	Bacteria	3019
1088	Ga0316578_10000266	3300031728	Bacteria	15650
1089	Ga0316578_10001016	3300031728	Bacteria	10758
1090	Ga0316578_10001109	3300031728	Bacteria	10507
1091	Ga0316578_10017288	3300031728	Bacteria	3922
1092	Ga0316578_10020950	3300031728	Bacteria	3622
1093	Ga0316578_10024677	3300031728	Bacteria	3374
1094	Ga0316578_10090077	3300031728	Bacteria	1831
1095	Ga0316578_10096747	3300031728	Bacteria	1768
1096	Ga0316578_10201099	3300031728	Bacteria	1199
1097	Ga0316577_10000110	3300031733	Bacteria	23020
1098	Ga0316577_10002403	3300031733	Bacteria	9263
1099	Ga0316577_10006251	3300031733	Bacteria	6284
1100	Ga0316577_10112457	3300031733	Bacteria	1528
1101	Ga0316577_10360847	3300031733	Bacteria	825
1102	Ga0307518_10052185	3300031838	Bacteria	2971
1103	Ga0307406_10072698	3300031901	Bacteria	2258
1104	Ga0307406_10075694	3300031901	Bacteria	2221
1105	Ga0307406_10147572	3300031901	Bacteria	1674
1106	Ga0307407_10117699	3300031903	Bacteria	1679
1107	Ga0307412_10072897	3300031911	Bacteria	2348
1108	Ga0307412_10209113	3300031911	Bacteria	1487
1109	Ga0307416_100052007	3300032002	Bacteria	3277
1110	Ga0307416_100166228	3300032002	Bacteria	2047
1111	Ga0307416_100270884	3300032002	Bacteria	1667
1112	Ga0307416_100629122	3300032002	Bacteria	1156
1113	Ga0307416_100756801	3300032002	Bacteria	1064
1114	Ga0307414_10102033	3300032004	Bacteria	2161
1115	Ga0307414_10342663	3300032004	Bacteria	1280
1116	Ga0307411_10033327	3300032005	Bacteria	3194
1117	Ga0307411_10221196	3300032005	Bacteria	1469
1118	Ga0316583_10000894	3300032133	Bacteria	9550
1119	Ga0316583_10002917	3300032133	Bacteria	6007
1120	Ga0316583_10005006	3300032133	Bacteria	4739
1121	Ga0316583_10015292	3300032133	Bacteria	2762
1122	Ga0316583_10043528	3300032133	Bacteria	1586
1123	Ga0316585_10000367	3300032137	Bacteria	10380
1124	Ga0316585_10044543	3300032137	Bacteria	1418
1125	Ga0316580_10000061	3300032139	Bacteria	18072
1126	Ga0316580_10002276	3300032139	Bacteria	5256
1127	Ga0316580_10037987	3300032139	Bacteria	1489
1128	Ga0316593_10000088	3300032168	Bacteria	11432
1129	Ga0316593_10000103	3300032168	Bacteria	11057
1130	Ga0316593_10000116	3300032168	Bacteria	10593
1131	Ga0316593_10000485	3300032168	Bacteria	7351
1132	Ga0316593_10000556	3300032168	Bacteria	6993
1133	Ga0316593_10000872	3300032168	Bacteria	6121
1134	Ga0316593_10003995	3300032168	Bacteria	3730
1135	Ga0316593_10004333	3300032168	Bacteria	3635
1136	Ga0316593_10004520	3300032168	Bacteria	3580
1137	Ga0316593_10005666	3300032168	Bacteria	3315
1138	Ga0316593_10007781	3300032168	Bacteria	2957
1139	Ga0316593_10009388	3300032168	Bacteria	2760
1140	Ga0316593_10012862	3300032168	Bacteria	2464
1141	Ga0316593_10014388	3300032168	Bacteria	2358
1142	Ga0316593_10015276	3300032168	Bacteria	2307
1143	Ga0316593_10024345	3300032168	Bacteria	1918
1144	Ga0316593_10024367	3300032168	Bacteria	1918
1145	Ga0316593_10024859	3300032168	Bacteria	1902
1146	Ga0316593_10062310	3300032168	Bacteria	1277
1147	Ga0316593_10082829	3300032168	Bacteria	1121
1148	Ga0307507_10183866	3300033179	Bacteria	1487
1149	Ga0316592_1000012	3300033524	Bacteria	13271
1150	Ga0316592_1000042	3300033524	Bacteria	10211
1151	Ga0316592_1000126	3300033524	Bacteria	8175
1152	Ga0316592_1000222	3300033524	Bacteria	6986
1153	Ga0316592_1001565	3300033524	Bacteria	3726
1154	Ga0316592_1001896	3300033524	Bacteria	3508
1155	Ga0316592_1003206	3300033524	Bacteria	2921
1156	Ga0316592_1009615	3300033524	Bacteria	1937
1157	Ga0316592_1033847	3300033524	Bacteria	1118
1158	Ga0316586_1000120	3300033527	Bacteria	5956
1159	Ga0316586_1000439	3300033527	Bacteria	4024
1160	Ga0316586_1000685	3300033527	Bacteria	3423
1161	Ga0316586_1000732	3300033527	Bacteria	3356
1162	Ga0316588_1000009	3300033528	Bacteria	13170
1163	Ga0316588_1000013	3300033528	Bacteria	12008
1164	Ga0316588_1000017	3300033528	Bacteria	11463
1165	Ga0316588_1000036	3300033528	Bacteria	9998
1166	Ga0316588_1000592	3300033528	Bacteria	5154
1167	Ga0316588_1001161	3300033528	Bacteria	4184
1168	Ga0316587_1000049	3300033529	Bacteria	7738
1169	Ga0316587_1000272	3300033529	Bacteria	4722
1170	Ga0316587_1000555	3300033529	Bacteria	3898
1171	Ga0316587_1000959	3300033529	Bacteria	3304
1172	Ga0316587_1040869	3300033529	Bacteria	837
1173	Ga0316596_1000008	3300033541	Bacteria	17584
1174	Ga0316596_1000081	3300033541	Bacteria	11362
1175	Ga0316596_1000087	3300033541	Bacteria	11243
1176	Ga0316596_1000228	3300033541	Bacteria	8498
1177	Ga0316596_1000674	3300033541	Bacteria	6156
1178	Ga0316596_1001385	3300033541	Bacteria	4861
1179	Ga0316596_1001991	3300033541	Bacteria	4286
1180	Ga0316596_1005096	3300033541	Bacteria	2987
1181	Ga0316596_1008539	3300033541	Bacteria	2444
1182	Ga0316596_1012830	3300033541	Bacteria	2065
1183	Ga0316596_1016912	3300033541	Bacteria	1829
1184	Ga0316596_1067367	3300033541	Bacteria	957
1185	Ga0373958_0052492	3300034819	Bacteria	864
1186	Ga0373926_0000430	3300035083	Bacteria	10846
1187	Ga0373926_0135345	3300035083	Bacteria	934
1188	Ga0373934_0000201	3300035086	Bacteria	22007
1189	Ga0373944_0000079	3300035089	Bacteria	16580
1190	Ga0373951_0016812	3300035091	Bacteria	1653
1191	Ga0373923_0005512	3300035111	Bacteria	4300
1192	Ga0373923_0057104	3300035111	Bacteria	1649
1193	Ga0373923_0098628	3300035111	Bacteria	1286
1194	Ga0373936_0002373	3300035113	Bacteria	7046
1195	Ga0373936_0050099	3300035113	Bacteria	1688
1196	Ga0373939_0060107	3300035114	Bacteria	1207
1197	Ga0373945_0005158	3300035116	Bacteria	4173
1198	Ga0373945_0142497	3300035116	Bacteria	967
1199	Ga0373953_0008404	3300035117	Bacteria	3505
1200	Ga0373953_0038144	3300035117	Bacteria	1899
1201	Ga0373953_0176717	3300035117	Bacteria	920
1202	Ga0373954_0000179	3300035118	Bacteria	22901
1203	Ga0373954_0001301	3300035118	Bacteria	10045
1204	Ga0373954_0029702	3300035118	Bacteria	2518
1205	Ga0373954_0105827	3300035118	Bacteria	1359
1206	Ga0373954_0288617	3300035118	Bacteria	809
1207	Ga0373956_0000736	3300035119	Bacteria	13465
1208	Ga0373956_0011222	3300035119	Bacteria	3689
1209	Ga0373957_0016608	3300035120	Bacteria	2550
1210	Ga0373960_0107612	3300035121	Bacteria	911
1211	Ga0373943_0003114	3300035170	Bacteria	7535
1212	Ga0373946_0000068	3300035171	Bacteria	27637
1213	Ga0373955_0036793	3300035172	Bacteria	2599
1214	Ga0373955_0042329	3300035172	Bacteria	2445
1215	Ga0373955_0183284	3300035172	Bacteria	1243
1216	Ga0373955_0202842	3300035172	Bacteria	1181
1217	Ga0373955_0304326	3300035172	Bacteria	961
1218	Ga0373942_0024868	3300035207	Bacteria	1539
1219	Ga0373961_0106616	3300035241	Bacteria	913
1220	Ga0316574_0008162	3300035398	Bacteria	5795
1221	Ga0316574_0017292	3300035398	Bacteria	4219
1222	Ga0316574_0051644	3300035398	Bacteria	2563
1223	Ga0316574_0254798	3300035398	Bacteria	1121
1224	Ga0373924_0011640	3300035410	Bacteria	3271
1225	Ga0373924_0014197	3300035410	Bacteria	3006
1226	Ga0373924_0030738	3300035410	Bacteria	2154
1227	Ga0373931_0008399	3300035691	Bacteria	4897
1228	Ga0373931_0235711	3300035691	Bacteria	1107
1229	Ga0373935_0170222	3300035692	Bacteria	1489
1230	Ga0373935_0200517	3300035692	Bacteria	1378
1231	Ga0373927_0027420	3300035695	Bacteria	3719
1232	Ga0373927_0156774	3300035695	Bacteria	1491
1233	Ga0373933_0000456	3300035724	Bacteria	25602
1234	Ga0373933_0008068	3300035724	Bacteria	5747
1235	Ga0373933_0148648	3300035724	Bacteria	1483
1236	Ga0373933_0226044	3300035724	Bacteria	1201
1237	Ga0373937_0000280	3300036401	Bacteria	48734
1238	Ga0373937_0002577	3300036401	Bacteria	15084
1239	Ga0373937_0036109	3300036401	Bacteria	4502
1240	Ga0373937_0225187	3300036401	Bacteria	1765
1241	Ga0373937_0268215	3300036401	Bacteria	1611
1242	Ga0373937_0384547	3300036401	Bacteria	1331
1243	Ga0373937_0711693	3300036401	Bacteria	951
1244	Ga0265778_017224	3300036457	Bacteria	871
1245	Ga0265778_024609	3300036457	Bacteria	757
1246	Ga0316582_0000035	3300036647	Bacteria	31472
1247	Ga0316582_0001664	3300036647	Bacteria	9952
1248	Ga0316582_0013968	3300036647	Bacteria	4541
1249	Ga0316582_0045292	3300036647	Bacteria	2769
1250	Ga0316582_0059972	3300036647	Bacteria	2438
1251	Ga0316582_0068623	3300036647	Bacteria	2290
1252	Ga0316582_0074200	3300036647	Bacteria	2208
1253	Ga0316582_0389859	3300036647	Bacteria	959
1254	Ga0316582_0403102	3300036647	Bacteria	942
1255	Ga0316584_0001810	3300036712	Bacteria	13199
1256	Ga0316584_0005188	3300036712	Bacteria	8711
1257	Ga0316584_0040597	3300036712	Bacteria	3467
1258	Ga0316584_0048760	3300036712	Bacteria	3164
1259	Ga0316584_0052870	3300036712	Bacteria	3038
1260	Ga0316584_0064178	3300036712	Bacteria	2750
1261	Ga0316584_0113298	3300036712	Bacteria	2029
1262	Ga0316584_0174171	3300036712	Bacteria	1594
1263	Ga0316584_0490551	3300036712	Bacteria	864
1264	Ga0316584_0537629	3300036712	Bacteria	817
1265	Ga0373925_0012603	3300037068	Bacteria	6126
1266	Ga0373925_0062848	3300037068	Bacteria	2792
1267	Ga0373925_0101202	3300037068	Bacteria	2215
1268	Ga0373925_0366050	3300037068	Bacteria	1172
1269	Ga0373925_0447510	3300037068	Bacteria	1057
1270	Ga0373925_0678677	3300037068	Bacteria	849
1271	Ga0395899_0004525	3300037312	Bacteria	10838
1272	Ga0395899_0016631	3300037312	Bacteria	5612
1273	Ga0395899_0045157	3300037312	Bacteria	3282
1274	Ga0395899_0081557	3300037312	Bacteria	2353
1275	Ga0395900_0001788	3300037418	Bacteria	24641
1276	Ga0395900_0024504	3300037418	Bacteria	6179
1277	Ga0395900_0067602	3300037418	Bacteria	3671
1278	Ga0395900_0111003	3300037418	Bacteria	2816
1279	Ga0395900_0145237	3300037418	Bacteria	2426
1280	Ga0395900_0235466	3300037418	Bacteria	1839
1281	Ga0395900_0238887	3300037418	Bacteria	1823
1282	Ga0395900_0240343	3300037418	Bacteria	1817
1283	Ga0395900_1038400	3300037418	Bacteria	738
1284	Ga0395898_0037837	3300037466	Bacteria	4783
1285	Ga0395898_0049347	3300037466	Bacteria	4124
1286	Ga0395898_0236928	3300037466	Bacteria	1740
1287	Ga0395905_0001229	3300037471	Bacteria	31899
1288	Ga0395905_0028647	3300037471	Bacteria	5250
1289	Ga0395905_0109755	3300037471	Bacteria	2590
1290	Ga0395905_0204773	3300037471	Bacteria	1849
1291	Ga0316581_0006354	3300037588	Bacteria	3123
1292	Ga0316581_0013417	3300037588	Bacteria	2323
1293	Ga0395901_0016427	3300038443	Bacteria	7538
1294	Ga0395901_0020601	3300038443	Bacteria	6749
1295	Ga0395901_0039763	3300038443	Bacteria	4868
1296	Ga0395901_0070924	3300038443	Bacteria	3630
1297	Ga0395901_0082690	3300038443	Bacteria	3355
1298	Ga0400484_20337	3300038725	Bacteria	5499
1299	Ga0400484_34275	3300038725	Bacteria	23521
1300	Ga0400484_43751	3300038725	Bacteria	7626
1301	Ga0400490_06176	3300038726	Bacteria	115887
1302	Ga0400490_06327	3300038726	Bacteria	1023
1303	Ga0400490_38570	3300038726	Bacteria	40703
1304	Ga0400490_40351	3300038726	Bacteria	8222
1305	Ga0400490_45639	3300038726	Bacteria	1996
1306	Ga0400491_11610	3300038727	Bacteria	2669
1307	Ga0400491_27913	3300038727	Bacteria	1105
1308	Ga0400485_17668	3300038735	Bacteria	8212
1309	Ga0400488_16237	3300038741	Bacteria	1760
1310	Ga0400488_19357	3300038741	Bacteria	3199
1311	Ga0400488_25653	3300038741	Bacteria	6445
1312	Ga0400488_39763	3300038741	Bacteria	2666
1313	Ga0400488_53856	3300038741	Bacteria	4444
1314	Ga0400486_09139	3300038742	Bacteria	5970
1315	Ga0400486_30096	3300038742	Bacteria	27448
1316	Ga0400483_002377	3300039062	Bacteria	27257
1317	Ga0400483_018497	3300039062	Bacteria	1617
1318	Ga0400483_086371	3300039062	Bacteria	4266
1319	Ga0400483_088211	3300039062	Bacteria	13795
1320	Ga0400483_099131	3300039062	Bacteria	4498
1321	Ga0400483_111069	3300039062	Bacteria	6670
1322	Ga0400483_115860	3300039062	Bacteria	1334
1323	Ga0400483_121594	3300039062	Bacteria	16289
1324	Ga0400483_154649	3300039062	Bacteria	1915
1325	Ga0400483_197418	3300039062	Bacteria	7536
1326	Ga0400483_202160	3300039062	Bacteria	24599
1327	Ga0400483_208069	3300039062	Bacteria	1403
1328	Ga0400483_208742	3300039062	Bacteria	6828
1329	Ga0400483_220070	3300039062	Bacteria	6451
1330	Ga0400483_220720	3300039062	Bacteria	7973
1331	Ga0400483_241006	3300039062	Bacteria	2991
1332	Ga0400483_251977	3300039062	Bacteria	5602
1333	Ga0400483_281457	3300039062	Bacteria	8652
1334	Ga0400489_64217	3300039093	Bacteria	1603
1335	Ga0400487_14028	3300039110	Bacteria	3359
1336	Ga0400487_15634	3300039110	Bacteria	1179
1337	Ga0400487_19441	3300039110	Bacteria	5604
1338	Ga0400487_20624	3300039110	Bacteria	1226
1339	Ga0400487_45865	3300039110	Bacteria	2552
1340	Ga0400487_48030	3300039110	Bacteria	1138
1341	Ga0400487_48074	3300039110	Bacteria	2011
1342	Ga0400487_52219	3300039110	Bacteria	45893
1343	Ga0400487_54125	3300039110	Bacteria	2981
1344	Ga0400487_63109	3300039110	Bacteria	17852
1345	Ga0436365_1103900	3300039437	Bacteria	17267
1346	Ga0436361_0100693	3300039447	Bacteria	11650
1347	Ga0436361_0175542	3300039447	Bacteria	7451
1348	Ga0436361_0208808	3300039447	Bacteria	1236
1349	Ga0436361_0274709	3300039447	Bacteria	8094
1350	Ga0436361_0496951	3300039447	Bacteria	2088
1351	Ga0436361_0751899	3300039447	Bacteria	7094
1352	Ga0436361_0908371	3300039447	Bacteria	22684
1353	Ga0436361_0947980	3300039447	Bacteria	3905
1354	Ga0451787_353670	3300041441	Bacteria	871
1355	Ga0451789_0114836	3300041443	Bacteria	957
1356	Ga0451791_0986417	3300041451	Bacteria	815
1357	Ga0451791_1836537	3300041451	Bacteria	1074
1358	Ga0451793_1847700	3300041452	Bacteria	732
1359	Ga0451807_1338362	3300041486	Bacteria	3702
1360	Ga0451851_0832300	3300041507	Bacteria	1533
1361	Ga0451853_0625523	3300041512	Bacteria	1797
1362	Ga0439441_002873	3300042001	Bacteria	2472
1363	Ga0439443_023837	3300042003	Bacteria	978
1364	Ga0439458_0032367	3300042157	Bacteria	1250
1365	Ga0439434_0072638	3300042435	Bacteria	1084
1366	Ga0439435_0003308	3300042436	Bacteria	3335
1367	Ga0439444_0012260	3300042437	Bacteria	1402
1368	Ga0439460_0008554	3300042461	Bacteria	2586
1369	Ga0451577_0000891	3300042876	Bacteria	44308
1370	Ga0451577_0006851	3300042876	Bacteria	11286
1371	Ga0451577_0015319	3300042876	Bacteria	7134
1372	Ga0451577_0024624	3300042876	Bacteria	5474
1373	Ga0451577_0316792	3300042876	Bacteria	1414
1374	Ga0451577_0355991	3300042876	Bacteria	1328
1375	Ga0451577_0566628	3300042876	Bacteria	1031
1376	Ga0466969_0008306	3300044656	Bacteria	5507
1377	Ga0466972_0022567	3300044658	Bacteria	3133
1378	Ga0466972_0176151	3300044658	Bacteria	1003
1379	Ga0453683_0045553	3300044673	Bacteria	2750
1380	Ga0453683_0073779	3300044673	Bacteria	2136
1381	Ga0453683_0102415	3300044673	Bacteria	1798
1382	Ga0453683_0167390	3300044673	Bacteria	1392
1383	Ga0466965_0003813	3300044683	Bacteria	6650
1384	Ga0466966_0062285	3300044684	Bacteria	2352
1385	Ga0466961_0005511	3300044693	Bacteria	7984
1386	Ga0453684_0000005	3300044712	Bacteria	1431632
1387	Ga0453684_0000195	3300044712	Bacteria	265496
1388	Ga0453684_0000356	3300044712	Bacteria	189329
1389	Ga0453684_0003069	3300044712	Bacteria	38658
1390	Ga0453684_0005386	3300044712	Bacteria	25416
1391	Ga0453684_0005797	3300044712	Bacteria	24095
1392	Ga0453684_0018588	3300044712	Bacteria	10655
1393	Ga0453684_0102700	3300044712	Bacteria	3495
1394	Ga0453684_0266107	3300044712	Bacteria	1961
1395	Ga0453684_0431483	3300044712	Bacteria	1470
1396	Ga0453684_0929847	3300044712	Bacteria	929
1397	Ga0466968_0041533	3300044735	Bacteria	1941
1398	Ga0466968_0157772	3300044735	Bacteria	1046
1399	Ga0466959_0013814	3300045049	Bacteria	5864
1400	Ga0466959_0030625	3300045049	Bacteria	3984
1401	Ga0451576_0008451	3300045051	Bacteria	12088
1402	Ga0451576_0066069	3300045051	Bacteria	3765
1403	Ga0451576_0124328	3300045051	Bacteria	2687
1404	Ga0451576_0223451	3300045051	Bacteria	1966
1405	Ga0451576_0688560	3300045051	Bacteria	1074
1406	Ga0451576_0708170	3300045051	Bacteria	1058
1407	Ga0451576_1227086	3300045051	Bacteria	783
1408	Ga0466967_0015452	3300045976	Bacteria	5984
1409	Ga0495617_091297	3300046452	Bacteria	994
1410	Ga0495627_000001	3300046453	Bacteria	1104709
1411	Ga0495592_0041470	3300046454	Bacteria	3449
1412	Ga0495603_0004403	3300046455	Bacteria	8399
1413	Ga0495603_0006545	3300046455	Bacteria	6990
1414	Ga0495603_0012855	3300046455	Bacteria	5062
1415	Ga0495603_0071907	3300046455	Bacteria	2032
1416	Ga0495603_0235537	3300046455	Bacteria	1055
1417	Ga0495603_0415327	3300046455	Bacteria	771
1418	Ga0495629_0007255	3300046459	Bacteria	8164
1419	Ga0495638_0023515	3300046460	Bacteria	4029
1420	Ga0495641_0004391	3300046461	Bacteria	9991
1421	Ga0495641_0026927	3300046461	Bacteria	2800
1422	Ga0495641_0085167	3300046461	Bacteria	1415
1423	Ga0495651_0029416	3300046462	Bacteria	4283
1424	Ga0495651_0120479	3300046462	Bacteria	1928
1425	Ga0495653_0020745	3300046463	Bacteria	5322
1426	Ga0495580_0006940	3300046472	Bacteria	9135
1427	Ga0495580_0010697	3300046472	Bacteria	7126
1428	Ga0495582_0001922	3300046473	Bacteria	11674
1429	Ga0495639_0001079	3300046475	Bacteria	12284
1430	Ga0495639_0002217	3300046475	Bacteria	8551
1431	Ga0495662_0002926	3300046476	Bacteria	8625
1432	Ga0495662_0017921	3300046476	Bacteria	3427
1433	Ga0495662_0369768	3300046476	Bacteria	704
1434	Ga0495584_0031682	3300046491	Bacteria	2676
1435	Ga0495584_0163167	3300046491	Bacteria	1133
1436	Ga0495585_0000038	3300046492	Bacteria	131919
1437	Ga0495585_0132594	3300046492	Bacteria	1310
1438	Ga0495585_0184822	3300046492	Bacteria	1069
1439	Ga0495594_0005266	3300046499	Bacteria	6644
1440	Ga0495594_0107249	3300046499	Bacteria	1573
1441	Ga0495594_0127768	3300046499	Bacteria	1439
1442	Ga0495607_0093728	3300046501	Bacteria	1621
1443	Ga0495606_0029573	3300046507	Bacteria	3842
1444	Ga0495606_0038898	3300046507	Bacteria	3213
1445	Ga0495628_0014049	3300046516	Bacteria	6721
1446	Ga0495628_0119124	3300046516	Bacteria	2026
1447	Ga0495630_0001852	3300046517	Bacteria	14773
1448	Ga0495630_0016816	3300046517	Bacteria	5350
1449	Ga0495630_0138711	3300046517	Bacteria	1848
1450	Ga0495631_0017919	3300046518	Bacteria	3340
1451	Ga0495637_0108658	3300046520	Bacteria	1077
1452	Ga0495644_0002759	3300046523	Bacteria	6960
1453	Ga0495644_0014065	3300046523	Bacteria	3067
1454	Ga0495644_0086005	3300046523	Bacteria	1185
1455	Ga0495663_0006019	3300046525	Bacteria	3356
1456	Ga0495663_0008199	3300046525	Bacteria	2891
1457	Ga0495666_0000206	3300046526	Bacteria	25229
1458	Ga0495666_0024538	3300046526	Bacteria	2978
1459	Ga0495642_0018211	3300046528	Bacteria	2747
1460	Ga0495652_0014578	3300046529	Bacteria	7049
1461	Ga0495652_0085919	3300046529	Bacteria	2584
1462	Ga0495654_0000011	3300046530	Bacteria	363172
1463	Ga0495665_0002753	3300046531	Bacteria	9493
1464	Ga0495640_0022569	3300046533	Bacteria	4596
1465	Ga0495640_0022953	3300046533	Bacteria	4556
1466	Ga0495586_0002351	3300046535	Bacteria	10292
1467	Ga0495586_0003301	3300046535	Bacteria	8652
1468	Ga0495598_0003157	3300046537	Bacteria	3471
1469	Ga0495609_0017079	3300046538	Bacteria	3375
1470	Ga0495609_0040962	3300046538	Bacteria	2083
1471	Ga0495597_0001600	3300046542	Bacteria	15896
1472	Ga0495645_0000794	3300046543	Bacteria	21665
1473	Ga0495633_0010466	3300046558	Bacteria	5058
1474	Ga0495633_0118962	3300046558	Bacteria	1223
1475	Ga0495667_0111196	3300046559	Bacteria	1770
1476	Ga0495667_0119482	3300046559	Bacteria	1702
1477	Ga0495667_0305732	3300046559	Bacteria	1007
1478	Ga0495656_0041315	3300046615	Bacteria	1926
1479	Ga0495656_0124539	3300046615	Bacteria	1220
1480	Ga0495634_0009045	3300046642	Bacteria	7365
1481	Ga0495634_0018116	3300046642	Bacteria	5018
1482	Ga0495611_0010942	3300046648	Bacteria	3842
1483	Ga0495625_0009855	3300046660	Bacteria	7948
1484	Ga0495625_0099484	3300046660	Bacteria	1999
1485	Ga0495635_0003464	3300046663	Bacteria	10901
1486	Ga0495635_0277422	3300046663	Bacteria	1126
1487	Ga0495659_0002088	3300046664	Bacteria	6534
1488	Ga0495659_0025367	3300046664	Bacteria	2029
1489	Ga0495588_0000669	3300046674	Bacteria	15837
1490	Ga0495588_0151027	3300046674	Bacteria	1228
1491	Ga0495657_0029556	3300046675	Bacteria	3843
1492	Ga0495657_0094603	3300046675	Bacteria	1911
1493	Ga0495599_0022290	3300046678	Bacteria	3953
1494	Ga0495647_0000730	3300046681	Bacteria	9715
1495	Ga0495658_0005725	3300046683	Bacteria	6104
1496	Ga0495658_0040497	3300046683	Bacteria	2590
1497	Ga0495658_0284257	3300046683	Bacteria	1044
1498	Ga0495669_0023034	3300046684	Bacteria	2708
1499	Ga0495669_0026182	3300046684	Bacteria	2548
1500	Ga0495613_0004323	3300046689	Bacteria	10637
1501	Ga0495624_0026566	3300046690	Bacteria	3793
1502	Ga0495624_0107278	3300046690	Bacteria	1718
1503	Ga0495670_0012910	3300046691	Bacteria	4106
1504	Ga0495670_0421014	3300046691	Bacteria	722
1505	Ga0495589_0069051	3300046794	Bacteria	1728
1506	Ga0495589_0104918	3300046794	Bacteria	1366
1507	Ga0495600_0002683	3300046809	Bacteria	10290
1508	Ga0495660_0008884	3300046810	Bacteria	5871
1509	Ga0495660_0099204	3300046810	Bacteria	1501
1510	Ga0495581_0001261	3300047315	Bacteria	13923
1511	Ga0495581_0006350	3300047315	Bacteria	6855
1512	Ga0495604_0057180	3300047317	Bacteria	2999
1513	Ga0495674_0001212	3300047319	Bacteria	24989
1514	Ga0495672_0000063	3300047320	Bacteria	201893
1515	Ga0495676_0099751	3300047321	Bacteria	2152
1516	Ga0495676_0135244	3300047321	Bacteria	1773
1517	Ga0495680_0088670	3300047322	Bacteria	2324
1518	Ga0495680_0095793	3300047322	Bacteria	2218
1519	Ga0495680_0116877	3300047322	Bacteria	1972
1520	Ga0495675_0101671	3300047444	Bacteria	1798
1521	Ga0495675_0220165	3300047444	Bacteria	1149
1522	Ga0495681_0007588	3300047470	Bacteria	6901
1523	Ga0495684_0112820	3300047471	Bacteria	2050
1524	Ga0495593_0000683	3300047673	Bacteria	19541
1525	Ga0495593_0340003	3300047673	Bacteria	750
1526	Ga0495614_0005032	3300048089	Bacteria	5965
1527	Ga0496100_0040677	3300048903	Bacteria	2959
1528	Ga0496100_0111229	3300048903	Bacteria	1903
1529	Ga0496101_0012595	3300048904	Bacteria	5646
1530	Ga0496101_0140532	3300048904	Bacteria	1840
1531	Ga0496102_0002928	3300048905	Bacteria	14484
1532	Ga0496102_0015762	3300048905	Bacteria	6586
1533	Ga0496102_0330668	3300048905	Bacteria	1435
1534	Ga0496102_0756911	3300048905	Bacteria	894
1535	Ga0496103_0002769	3300048906	Bacteria	10906
1536	Ga0496103_0056315	3300048906	Bacteria	2440
1537	Ga0496105_0103525	3300048908	Bacteria	2351
1538	Ga0496105_0343656	3300048908	Bacteria	1193
1539	Ga0496106_0007993	3300048909	Bacteria	7815
1540	Ga0496106_0041110	3300048909	Bacteria	3464
1541	Ga0496106_0071987	3300048909	Bacteria	2643
1542	Ga0496106_0165170	3300048909	Bacteria	1752
1543	Ga0496106_0286793	3300048909	Bacteria	1319
1544	Ga0496107_0027411	3300048910	Bacteria	4045
1545	Ga0496107_0038254	3300048910	Bacteria	3443
1546	Ga0496107_0081221	3300048910	Bacteria	2364
1547	Ga0496108_0169352	3300048911	Bacteria	1889
1548	Ga0496108_0190518	3300048911	Bacteria	1777
1549	Ga0496109_0039280	3300048912	Bacteria	4283
1550	Ga0496109_0062506	3300048912	Bacteria	3405
1551	Ga0496109_0299087	3300048912	Bacteria	1517
1552	Ga0496109_0549619	3300048912	Bacteria	1089
1553	Ga0496110_0120752	3300048913	Bacteria	2360
1554	Ga0496110_0331835	3300048913	Bacteria	1385
1555	Ga0496110_0442773	3300048913	Bacteria	1184
1556	Ga0496111_0045998	3300048914	Bacteria	3141
1557	Ga0496111_0289925	3300048914	Bacteria	1214
1558	Ga0496112_0050631	3300048915	Bacteria	4074
1559	Ga0496112_0523248	3300048915	Bacteria	1121
1560	Ga0496114_0001834	3300048917	Bacteria	16097
1561	Ga0496114_0016627	3300048917	Bacteria	5931
1562	Ga0496114_0019442	3300048917	Bacteria	5503
1563	Ga0496114_0047010	3300048917	Bacteria	3588
1564	Ga0496114_0062731	3300048917	Bacteria	3110
1565	Ga0496115_0116871	3300048918	Bacteria	2194
1566	Ga0496115_0430751	3300048918	Bacteria	1068
1567	Ga0496116_0019454	3300048919	Bacteria	5199
1568	Ga0496121_0084055	3300048924	Bacteria	2511
1569	Ga0496121_0120724	3300048924	Bacteria	1980
1570	Ga0496122_0000686	3300048925	Bacteria	67419
1571	Ga0496123_0000646	3300048926	Bacteria	58096
1572	Ga0496124_0407721	3300048927	Bacteria	941
1573	Ga0496125_0001140	3300048928	Bacteria	40434
1574	Ga0496125_0026799	3300048928	Bacteria	5237
1575	Ga0496125_0041182	3300048928	Bacteria	3953
1576	Ga0496125_0052991	3300048928	Bacteria	3331
1577	Ga0496125_0133356	3300048928	Bacteria	1743
1578	Ga0496126_0141879	3300048929	Bacteria	2067
1579	Ga0496126_0296823	3300048929	Bacteria	1335
1580	Ga0501308_001064	3300049128	Bacteria	2079
1581	Ga0501305_002080	3300049161	Bacteria	2101
1582	Ga0501305_004027	3300049161	Bacteria	1702
1583	Ga0495678_000002	3300049459	Bacteria	999613
1584	Ga0501298_040795	3300049521	Bacteria	941
1585	Ga0501316_000924	3300049532	Bacteria	2298
1586	Ga0501319_002498	3300049535	Bacteria	1169
1587	Ga0501334_06530	3300049550	Bacteria	789
1588	Ga0501031_0004228	3300049568	Bacteria	9276
1589	Ga0501031_0043836	3300049568	Bacteria	2919
1590	Ga0501031_0135678	3300049568	Bacteria	1608
1591	Ga0501031_0365085	3300049568	Bacteria	934
1592	Ga0501032_0000464	3300049569	Bacteria	32673
1593	Ga0501032_0004352	3300049569	Bacteria	10696
1594	Ga0501032_0032034	3300049569	Bacteria	3603
1595	Ga0501033_0001142	3300049570	Bacteria	23980
1596	Ga0501033_0006125	3300049570	Bacteria	9437
1597	Ga0501033_0119306	3300049570	Bacteria	1915
1598	Ga0501034_0009261	3300049571	Bacteria	10321
1599	Ga0501034_0013299	3300049571	Bacteria	8481
1600	Ga0501034_0021148	3300049571	Bacteria	6636
1601	Ga0501034_0084371	3300049571	Bacteria	3178
1602	Ga0501034_0112924	3300049571	Bacteria	2707
1603	Ga0501034_0229836	3300049571	Bacteria	1804
1604	Ga0501034_0354235	3300049571	Bacteria	1396
1605	Ga0501036_0014033	3300049572	Bacteria	6659
1606	Ga0501036_0014975	3300049572	Bacteria	6469
1607	Ga0501036_0019901	3300049572	Bacteria	5634
1608	Ga0501036_0056254	3300049572	Bacteria	3333
1609	Ga0501036_0184129	3300049572	Bacteria	1758
1610	Ga0501037_0025742	3300049573	Bacteria	4345
1611	Ga0501037_0031095	3300049573	Bacteria	3942
1612	Ga0501037_0049049	3300049573	Bacteria	3092
1613	Ga0501037_0365050	3300049573	Bacteria	994
1614	Ga0501038_0000689	3300049574	Bacteria	30044
1615	Ga0501038_0009872	3300049574	Bacteria	8738
1616	Ga0501039_0002136	3300049575	Bacteria	14634
1617	Ga0501039_0011879	3300049575	Bacteria	6635
1618	Ga0501039_0191036	3300049575	Bacteria	1610
1619	Ga0501040_0001446	3300049576	Bacteria	15042
1620	Ga0501040_0124788	3300049576	Bacteria	1808
1621	Ga0501040_0256961	3300049576	Bacteria	1246
1622	Ga0501040_0258050	3300049576	Bacteria	1244
1623	Ga0501040_0411789	3300049576	Bacteria	971
1624	Ga0501040_0807691	3300049576	Bacteria	679
1625	Ga0501042_0012624	3300049578	Bacteria	5729
1626	Ga0501042_0101787	3300049578	Bacteria	2066
1627	Ga0501043_0002027	3300049579	Bacteria	17296
1628	Ga0501043_0009409	3300049579	Bacteria	7671
1629	Ga0501043_0075339	3300049579	Bacteria	2650
1630	Ga0501043_0195676	3300049579	Bacteria	1571
1631	Ga0501046_0002787	3300049580	Bacteria	16267
1632	Ga0501046_0007129	3300049580	Bacteria	9834
1633	Ga0501046_0012662	3300049580	Bacteria	7172
1634	Ga0501046_0151986	3300049580	Bacteria	1746
1635	Ga0501047_0208048	3300049581	Bacteria	1816
1636	Ga0501047_0430882	3300049581	Bacteria	1149
1637	Ga0501048_0026377	3300049582	Bacteria	4230
1638	Ga0501067_0056863	3300049583	Bacteria	2167
1639	Ga0501068_0038292	3300049584	Bacteria	2872
1640	Ga0501068_0059207	3300049584	Bacteria	2326
1641	Ga0501068_0235053	3300049584	Bacteria	1166
1642	Ga0501068_0338573	3300049584	Bacteria	966
1643	Ga0501070_0103422	3300049586	Bacteria	2356
1644	Ga0501071_0081366	3300049587	Bacteria	2370
1645	Ga0501071_0635254	3300049587	Bacteria	821
1646	Ga0501072_0074803	3300049588	Bacteria	2679
1647	Ga0501072_0089681	3300049588	Bacteria	2441
1648	Ga0501073_0004419	3300049589	Bacteria	10569
1649	Ga0501074_0464716	3300049590	Bacteria	897
1650	Ga0501075_0001283	3300049591	Bacteria	16295
1651	Ga0501076_0001480	3300049592	Bacteria	15737
1652	Ga0501077_0121700	3300049593	Bacteria	1654
1653	Ga0501230_002240	3300049667	Bacteria	2446
1654	Ga0501249_001607	3300049679	Bacteria	4622
1655	Ga0501079_0162422	3300049741	Bacteria	1742
1656	Ga0501079_0189290	3300049741	Bacteria	1606
1657	Ga0501079_0880924	3300049741	Bacteria	705
1658	Ga0501080_0014968	3300049742	Bacteria	7142
1659	Ga0501081_0000921	3300049743	Bacteria	17468
1660	Ga0501081_0080886	3300049743	Bacteria	2275
1661	Ga0501241_043367	3300049758	Bacteria	876
1662	Ga0501269_000306	3300049766	Bacteria	13280
1663	Ga0501035_0025419	3300049822	Bacteria	5429
1664	Ga0501035_0071234	3300049822	Bacteria	3078
1665	Ga0501035_0139151	3300049822	Bacteria	2111
1666	Ga0501035_0857742	3300049822	Bacteria	722
1667	Ga0501044_0000233	3300049823	Bacteria	69824
1668	Ga0501044_0002232	3300049823	Bacteria	22168
1669	Ga0501044_0024447	3300049823	Bacteria	6411
1670	Ga0501044_0134899	3300049823	Bacteria	2460
1671	Ga0501044_0146304	3300049823	Bacteria	2348
1672	Ga0501045_0083710	3300049824	Bacteria	2353
1673	Ga0501045_0107998	3300049824	Bacteria	2062
1674	Ga0501045_0209477	3300049824	Bacteria	1452
1675	Ga0501045_0265396	3300049824	Bacteria	1278
1676	nmdc:mga03683_135334_c1	3300050489	Bacteria	1105
1677	nmdc:mga03n38_2218_c1	3300050490	Bacteria	5932
1678	nmdc:mga03n38_345481_c1	3300050490	Bacteria	809
1679	nmdc:mga00v17_116_c1	3300050491	Bacteria	47624
1680	nmdc:mga00v17_1215_c1	3300050491	Bacteria	13529
1681	nmdc:mga00v17_158465_c1	3300050491	Bacteria	1456
1682	nmdc:mga00v17_312257_c1	3300050491	Bacteria	1021
1683	nmdc:mga00v17_31358_c1	3300050491	Bacteria	3135
1684	nmdc:mga0yw44_482_c1	3300050492	Bacteria	14179
1685	nmdc:mga0k408_174087_c1	3300050493	Bacteria	1283
1686	nmdc:mga0k408_213792_c1	3300050493	Bacteria	1151
1687	nmdc:mga0k408_233619_c1	3300050493	Bacteria	1098
1688	nmdc:mga0k408_43_c1	3300050493	Bacteria	51763
1689	nmdc:mga0k408_50174_c1	3300050493	Bacteria	2416
1690	nmdc:mga06z11_13407_c1	3300050494	Bacteria	3599
1691	nmdc:mga04h51_48407_c1	3300050495	Bacteria	1417
1692	nmdc:mga04h51_5693_c1	3300050495	Bacteria	3187
1693	nmdc:mga07m45_177624_c1	3300050496	Bacteria	1238
1694	nmdc:mga07m45_318145_c1	3300050496	Bacteria	905
1695	nmdc:mga07m45_35620_c1	3300050496	Bacteria	2769
1696	nmdc:mga07m45_38496_c1	3300050496	Bacteria	2669
1697	nmdc:mga07m45_79_c1	3300050496	Bacteria	35992
1698	nmdc:mga05p37_118838_c1	3300050507	Bacteria	3248
1699	nmdc:mga05p37_191776_c1	3300050507	Bacteria	2480
1700	nmdc:mga09592_11190_c1	3300050508	Bacteria	7301
1701	nmdc:mga09592_23793_c1	3300050508	Bacteria	5060
1702	nmdc:mga09592_283426_c1	3300050508	Bacteria	1437
1703	nmdc:mga09592_299779_c1	3300050508	Bacteria	1394
1704	nmdc:mga09592_6163_c1	3300050508	Bacteria	9762
1705	nmdc:mga0qj67_13296_c1	3300050509	Bacteria	6211
1706	nmdc:mga0qj67_19454_c1	3300050509	Bacteria	5187
1707	nmdc:mga0qj67_369_c1	3300050509	Bacteria	30904
1708	nmdc:mga06r32_112045_c1	3300050510	Bacteria	2685
1709	nmdc:mga06r32_31915_c1	3300050510	Bacteria	4951
1710	nmdc:mga06r32_44695_c1	3300050510	Bacteria	4218
1711	nmdc:mga08y16_1087811_c1	3300050511	Bacteria	775
1712	nmdc:mga08y16_1119462_c1	3300050511	Bacteria	762
1713	nmdc:mga08y16_118180_c1	3300050511	Bacteria	2759
1714	nmdc:mga08y16_131743_c1	3300050511	Bacteria	2600
1715	nmdc:mga08y16_21077_c1	3300050511	Bacteria	6882
1716	nmdc:mga08y16_273337_c1	3300050511	Bacteria	1744
1717	nmdc:mga08y16_565655_c1	3300050511	Bacteria	1149
1718	nmdc:mga08y16_579703_c1	3300050511	Bacteria	1133
1719	nmdc:mga08y16_825812_c1	3300050511	Bacteria	918
1720	nmdc:mga0n895_16692_c1	3300050512	Bacteria	6745
1721	nmdc:mga0n895_333628_c1	3300050512	Bacteria	1536
1722	nmdc:mga0n895_39373_c1	3300050512	Bacteria	4586
1723	nmdc:mga0n895_731579_c1	3300050512	Bacteria	984
1724	nmdc:mga0rr50_148691_c1	3300050513	Bacteria	1891
1725	nmdc:mga0rr50_579854_c1	3300050513	Bacteria	956
1726	nmdc:mga0rr50_83995_c1	3300050513	Bacteria	2464
1727	nmdc:mga08x19_1441_c1	3300050514	Bacteria	14708
1728	nmdc:mga08x19_45766_c1	3300050514	Bacteria	2796
1729	nmdc:mga0a205_1418_c1	3300050515	Bacteria	20365
1730	nmdc:mga0a205_437716_c1	3300050515	Bacteria	1168
1731	nmdc:mga0a205_678593_c1	3300050515	Bacteria	881
1732	nmdc:mga0sz30_42_c2	3300050516	Bacteria	27193
1733	Ga0495601_0153191	3300053077	Bacteria	1505
1734	Ga0495595_0008929	3300053084	Bacteria	4131
1735	Ga0495619_0003332	3300053085	Bacteria	10387
1736	Ga0495619_0006123	3300053085	Bacteria	7620
1737	Ga0500644_0025787	3300053088	Bacteria	1813
1738	Ga0500644_0228437	3300053088	Bacteria	778
1739	Ga0500646_0000927	3300053090	Bacteria	8080
1740	Ga0500583_0047875	3300053092	Bacteria	1971
1741	Ga0500566_0116996	3300053094	Bacteria	1442
1742	Ga0500566_0146697	3300053094	Bacteria	1246
1743	Ga0500650_0000034	3300053098	Bacteria	52582
1744	Ga0500594_0005566	3300053118	Bacteria	2795
1745	Ga0500642_0077153	3300053130	Bacteria	1525
1746	Ga0500564_036419	3300053138	Bacteria	2270
1747	Ga0500568_0015620	3300053139	Bacteria	3395
1748	Ga0500604_0000594	3300053151	Bacteria	9931
1749	Ga0500624_017476	3300053157	Bacteria	1120
1750	Ga0500624_055105	3300053157	Bacteria	748
1751	Ga0500634_0000071	3300053161	Bacteria	40285
1752	Ga0500645_022024	3300053730	Bacteria	1963
1753	Ga0500645_037182	3300053730	Bacteria	1446
1754	Ga0501084_0091896	3300054114	Bacteria	2548
1755	Ga0500661_002319	3300055283	Bacteria	3596
1756	Ga0590071_007191	3300059421	Bacteria	2635
1757	Ga0590071_046541	3300059421	Bacteria	1048
1758	Ga0587084_001171	3300059477	Bacteria	2418
1759	Ga0587084_021739	3300059477	Bacteria	965
1760	Ga0587084_023171	3300059477	Bacteria	946
1761	Ga0587093_001509	3300059478	Bacteria	1986
1762	Ga0587070_002969	3300059491	Bacteria	1990
1763	Ga0587070_008410	3300059491	Bacteria	1462
1764	Ga0587073_0012054	3300059492	Bacteria	1490
1765	Ga0587077_000277	3300059493	Bacteria	3908
1766	Ga0587080_005796	3300059503	Bacteria	1676
1767	Ga0587080_015378	3300059503	Bacteria	1194
1768	Ga0587082_002014	3300059504	Bacteria	2230
1769	Ga0587085_002481	3300059506	Bacteria	1885
1770	Ga0587086_001844	3300059507	Bacteria	1906
1771	Ga0587088_006498	3300059508	Bacteria	1581
1772	Ga0587090_000298	3300059510	Bacteria	3840
1773	Ga0587090_000571	3300059510	Bacteria	3173
1774	Ga0587090_024327	3300059510	Bacteria	970
1775	Ga0587091_000078	3300059511	Bacteria	5276
1776	Ga0587091_056066	3300059511	Bacteria	824
1777	Ga0587092_000616	3300059512	Bacteria	3005
1778	Ga0587092_002170	3300059512	Bacteria	2065
1779	Ga0587115_003580	3300059626	Bacteria	1648
1780	Ga0587117_002991	3300059627	Bacteria	1644
1781	Ga0587062_000745	3300059639	Bacteria	2482
1782	Ga0587068_001577	3300059641	Bacteria	2597
1783	Ga0587068_003558	3300059641	Bacteria	2000
1784	Ga0587068_012597	3300059641	Bacteria	1293
1785	Ga0587072_032511	3300059643	Bacteria	980
1786	Ga0587075_009386	3300059644	Bacteria	1273
1787	Ga0587076_024653	3300059645	Bacteria	1022
1788	Ga0587078_000075	3300059646	Bacteria	4920
1789	Ga0587079_006612	3300059647	Bacteria	1698
1790	Ga0587079_039453	3300059647	Bacteria	947
1791	Ga0587111_0000156	3300060346	Bacteria	4992
1792	Ga0587111_0000191	3300060346	Bacteria	4784
1793	Ga0587111_0001821	3300060346	Bacteria	2692
1794	Ga0587111_0031376	3300060346	Bacteria	1087
1795	Ga0501082_0009229	3300060353	Bacteria	8502
1796	Ga0501082_0409208	3300060353	Bacteria	1184
1797	Ga0530510_0276799	3300061734	Bacteria	1253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005336	Ga0070680_100660421	Ga0070680_1006604211	186
2	3300005343	Ga0070687_100204373	Ga0070687_1002043731	186
3	3300005345	Ga0070692_10154474	Ga0070692_101544742	186
4	3300005353	Ga0070669_100373591	Ga0070669_1003735912	186
5	3300005440	Ga0070705_100029462	Ga0070705_1000294625	186
6	3300005547	Ga0070693_100730522	Ga0070693_1007305221	186
7	3300005549	Ga0070704_100071334	Ga0070704_1000713342	186
8	3300005577	Ga0068857_100040118	Ga0068857_1000401182	186
9	3300005844	Ga0068862_100037283	Ga0068862_1000372831	186
10	3300006881	Ga0068865_100550150	Ga0068865_1005501501	186
11	3300009148	Ga0105243_10768695	Ga0105243_107686951	186
12	3300013306	Ga0163162_10453196	Ga0163162_104531962	186
13	3300025918	Ga0207662_10101532	Ga0207662_101015321	186
14	3300026116	Ga0207674_10044496	Ga0207674_100444963	186
15	3300048913	Ga0496110_0120752	Ga0496110_0120752_11_628	190
16	3300005330	Ga0070690_100276893	Ga0070690_1002768932	191
17	3300005331	Ga0070670_100531297	Ga0070670_1005312972	191
18	3300005334	Ga0068869_100068619	Ga0068869_1000686194	191
19	3300005335	Ga0070666_10357217	Ga0070666_103572171	191
20	3300005338	Ga0068868_100145370	Ga0068868_1001453703	191
21	3300005338	Ga0068868_100315169	Ga0068868_1003151692	191
22	3300005341	Ga0070691_10101492	Ga0070691_101014922	191
23	3300005347	Ga0070668_100891037	Ga0070668_1008910372	191
24	3300005354	Ga0070675_100327763	Ga0070675_1003277632	191
25	3300005355	Ga0070671_100027672	Ga0070671_1000276725	191
26	3300005356	Ga0070674_100060870	Ga0070674_1000608702	191
27	3300005437	Ga0070710_10064406	Ga0070710_100644063	191
28	3300005439	Ga0070711_100025904	Ga0070711_1000259043	191
29	3300005441	Ga0070700_100306945	Ga0070700_1003069452	191
30	3300005456	Ga0070678_100306309	Ga0070678_1003063092	191
31	3300005456	Ga0070678_100307870	Ga0070678_1003078701	191
32	3300005543	Ga0070672_100027021	Ga0070672_1000270213	191
33	3300005549	Ga0070704_100067390	Ga0070704_1000673903	191
34	3300005578	Ga0068854_100047427	Ga0068854_1000474275	191
35	3300005615	Ga0070702_100056630	Ga0070702_1000566304	191
36	3300005834	Ga0068851_10241133	Ga0068851_102411332	191
37	3300005842	Ga0068858_100156277	Ga0068858_1001562773	191
38	3300006163	Ga0070715_10013717	Ga0070715_100137172	191
39	3300006173	Ga0070716_100020863	Ga0070716_1000208633	191
40	3300006237	Ga0097621_100253025	Ga0097621_1002530252	191
41	3300006881	Ga0068865_100038959	Ga0068865_1000389592	191
42	3300006914	Ga0075436_100063502	Ga0075436_1000635023	191
43	3300009098	Ga0105245_10227987	Ga0105245_102279873	191
44	3300009101	Ga0105247_10394019	Ga0105247_103940192	191
45	3300009148	Ga0105243_10008316	Ga0105243_100083165	191
46	3300013296	Ga0157374_10008837	Ga0157374_100088378	191
47	3300013308	Ga0157375_10023571	Ga0157375_100235713	191
48	3300014325	Ga0163163_10054153	Ga0163163_100541535	191
49	3300014745	Ga0157377_10172299	Ga0157377_101722992	191
50	3300014968	Ga0157379_10046029	Ga0157379_100460293	191
51	3300014969	Ga0157376_10033062	Ga0157376_100330626	191
52	3300014969	Ga0157376_10392346	Ga0157376_103923461	191
53	3300025898	Ga0207692_10046398	Ga0207692_100463983	191
54	3300025899	Ga0207642_10266129	Ga0207642_102661292	191
55	3300025901	Ga0207688_10015851	Ga0207688_100158512	191
56	3300025903	Ga0207680_10451019	Ga0207680_104510191	191
57	3300025907	Ga0207645_10061985	Ga0207645_100619852	191
58	3300025915	Ga0207693_10003457	Ga0207693_100034571	191
59	3300025916	Ga0207663_10017659	Ga0207663_100176593	191
60	3300025926	Ga0207659_10205295	Ga0207659_102052952	191
61	3300025926	Ga0207659_10334645	Ga0207659_103346451	191
62	3300025927	Ga0207687_10011912	Ga0207687_100119123	191
63	3300025927	Ga0207687_10191450	Ga0207687_101914502	191
64	3300025934	Ga0207686_10059661	Ga0207686_100596612	191
65	3300025935	Ga0207709_10207871	Ga0207709_102078712	191
66	3300025937	Ga0207669_10036541	Ga0207669_100365412	191
67	3300025938	Ga0207704_10068087	Ga0207704_100680873	191
68	3300025939	Ga0207665_10014889	Ga0207665_100148893	191
69	3300025940	Ga0207691_10076490	Ga0207691_100764905	191
70	3300025941	Ga0207711_10226317	Ga0207711_102263174	191
71	3300025942	Ga0207689_10077626	Ga0207689_100776262	191
72	3300025942	Ga0207689_10191813	Ga0207689_101918132	191
73	3300025972	Ga0207668_10524222	Ga0207668_105242222	191
74	3300025981	Ga0207640_10219519	Ga0207640_102195192	191
75	3300026023	Ga0207677_10072401	Ga0207677_100724013	191
76	3300026035	Ga0207703_10131416	Ga0207703_101314163	191
77	3300026067	Ga0207678_10392435	Ga0207678_103924352	191
78	3300026075	Ga0207708_10014170	Ga0207708_1001417010	191
79	3300026089	Ga0207648_10009360	Ga0207648_100093609	191
80	3300026095	Ga0207676_10133582	Ga0207676_101335823	191
81	3300026121	Ga0207683_10005534	Ga0207683_100055345	191
82	3300026121	Ga0207683_10369352	Ga0207683_103693522	191
83	3300028379	Ga0268266_10821516	Ga0268266_108215161	191
84	3300035083	Ga0373926_0000430	Ga0373926_0000430_8760_9380	191
85	3300035089	Ga0373944_0000079	Ga0373944_0000079_14955_15575	191
86	3300035111	Ga0373923_0005512	Ga0373923_0005512_3290_3910	191
87	3300035113	Ga0373936_0002373	Ga0373936_0002373_5370_5990	191
88	3300035116	Ga0373945_0005158	Ga0373945_0005158_1664_2284	191
89	3300035117	Ga0373953_0176717	Ga0373953_0176717_253_873	191
90	3300035170	Ga0373943_0003114	Ga0373943_0003114_1255_1875	191
91	3300035171	Ga0373946_0000068	Ga0373946_0000068_17361_17981	191
92	3300035410	Ga0373924_0011640	Ga0373924_0011640_1398_2018	191
93	3300035692	Ga0373935_0200517	Ga0373935_0200517_67_687	191
94	3300035724	Ga0373933_0148648	Ga0373933_0148648_230_850	191
95	3300037068	Ga0373925_0101202	Ga0373925_0101202_1006_1626	191
96	3300037068	Ga0373925_0678677	Ga0373925_0678677_38_658	191
97	3300046455	Ga0495603_0004403	Ga0495603_0004403_2880_3500	191
98	3300046455	Ga0495603_0235537	Ga0495603_0235537_281_901	191
99	3300046459	Ga0495629_0007255	Ga0495629_0007255_1792_2412	191
100	3300046461	Ga0495641_0004391	Ga0495641_0004391_7018_7638	191
101	3300046461	Ga0495641_0085167	Ga0495641_0085167_298_918	191
102	3300046472	Ga0495580_0006940	Ga0495580_0006940_6621_7241	191
103	3300046473	Ga0495582_0001922	Ga0495582_0001922_8226_8846	191
104	3300046475	Ga0495639_0001079	Ga0495639_0001079_1793_2413	191
105	3300046476	Ga0495662_0002926	Ga0495662_0002926_439_1059	191
106	3300046476	Ga0495662_0369768	Ga0495662_0369768_72_692	191
107	3300046499	Ga0495594_0005266	Ga0495594_0005266_1267_1887	191
108	3300046517	Ga0495630_0016816	Ga0495630_0016816_1254_1874	191
109	3300046526	Ga0495666_0000206	Ga0495666_0000206_5596_6216	191
110	3300046531	Ga0495665_0002753	Ga0495665_0002753_6235_6855	191
111	3300046533	Ga0495640_0022569	Ga0495640_0022569_1377_1997	191
112	3300046535	Ga0495586_0002351	Ga0495586_0002351_6027_6647	191
113	3300046559	Ga0495667_0305732	Ga0495667_0305732_27_647	191
114	3300046642	Ga0495634_0018116	Ga0495634_0018116_1664_2284	191
115	3300046663	Ga0495635_0003464	Ga0495635_0003464_9406_10026	191
116	3300046664	Ga0495659_0025367	Ga0495659_0025367_325_912	191
117	3300046674	Ga0495588_0000669	Ga0495588_0000669_5881_6501	191
118	3300046674	Ga0495588_0151027	Ga0495588_0151027_56_664	191
119	3300046681	Ga0495647_0000730	Ga0495647_0000730_1664_2284	191
120	3300046683	Ga0495658_0005725	Ga0495658_0005725_2832_3452	191
121	3300046689	Ga0495613_0004323	Ga0495613_0004323_692_1312	191
122	3300046690	Ga0495624_0026566	Ga0495624_0026566_2354_2974	191
123	3300046794	Ga0495589_0104918	Ga0495589_0104918_584_1192	191
124	3300047315	Ga0495581_0001261	Ga0495581_0001261_13269_13889	191
125	3300047315	Ga0495581_0006350	Ga0495581_0006350_5314_5934	191
126	3300047319	Ga0495674_0001212	Ga0495674_0001212_8908_9528	191
127	3300047321	Ga0495676_0135244	Ga0495676_0135244_692_1312	191
128	3300047471	Ga0495684_0112820	Ga0495684_0112820_45_665	191
129	3300047673	Ga0495593_0000683	Ga0495593_0000683_13131_13751	191
130	3300047673	Ga0495593_0340003	Ga0495593_0340003_81_701	191
131	3300048089	Ga0495614_0005032	Ga0495614_0005032_1693_2313	191
132	3300048903	Ga0496100_0040677	Ga0496100_0040677_1983_2603	191
133	3300048904	Ga0496101_0012595	Ga0496101_0012595_1540_2160	191
134	3300048905	Ga0496102_0015762	Ga0496102_0015762_4944_5564	191
135	3300048906	Ga0496103_0056315	Ga0496103_0056315_1421_2041	191
136	3300048909	Ga0496106_0041110	Ga0496106_0041110_284_904	191
137	3300048910	Ga0496107_0038254	Ga0496107_0038254_1733_2353	191
138	3300048911	Ga0496108_0169352	Ga0496108_0169352_902_1522	191
139	3300048912	Ga0496109_0039280	Ga0496109_0039280_912_1532	191
140	3300048914	Ga0496111_0045998	Ga0496111_0045998_2474_3094	191
141	3300048917	Ga0496114_0062731	Ga0496114_0062731_1574_2194	191
142	3300048918	Ga0496115_0116871	Ga0496115_0116871_859_1479	191
143	3300050514	nmdc:mga08x19_45766_c1	nmdc:mga08x19_45766_c1_921_1559	191
144	3300053085	Ga0495619_0006123	Ga0495619_0006123_1468_2088	191
145	3300053094	Ga0500566_0116996	Ga0500566_0116996_135_755	191
146	3300005440	Ga0070705_100026663	Ga0070705_1000266634	192
147	3300005444	Ga0070694_100701315	Ga0070694_1007013151	192
148	3300005467	Ga0070706_100295902	Ga0070706_1002959023	192
149	3300005468	Ga0070707_100115224	Ga0070707_1001152244	192
150	3300005468	Ga0070707_100263076	Ga0070707_1002630762	192
151	3300005544	Ga0070686_100115326	Ga0070686_1001153261	192
152	3300005617	Ga0068859_100030469	Ga0068859_1000304693	192
153	3300005718	Ga0068866_10556073	Ga0068866_105560731	192
154	3300005841	Ga0068863_100384472	Ga0068863_1003844722	192
155	3300005843	Ga0068860_100112403	Ga0068860_1001124035	192
156	3300005844	Ga0068862_100138751	Ga0068862_1001387512	192
157	3300005983	Ga0081540_1005341	Ga0081540_10053415	192
158	3300005983	Ga0081540_1083755	Ga0081540_10837552	192
159	3300006847	Ga0075431_100014586	Ga0075431_1000145867	192
160	3300006852	Ga0075433_10000934	Ga0075433_1000093420	192
161	3300006852	Ga0075433_10039205	Ga0075433_100392051	192
162	3300006852	Ga0075433_10666305	Ga0075433_106663052	192
163	3300006871	Ga0075434_100010076	Ga0075434_1000100764	192
164	3300006871	Ga0075434_100062553	Ga0075434_1000625534	192
165	3300006871	Ga0075434_100119265	Ga0075434_1001192652	192
166	3300006880	Ga0075429_100006874	Ga0075429_1000068742	192
167	3300006880	Ga0075429_100066449	Ga0075429_1000664494	192
168	3300006914	Ga0075436_100259151	Ga0075436_1002591512	192
169	3300006931	Ga0097620_100030471	Ga0097620_1000304718	192
170	3300007076	Ga0075435_100033420	Ga0075435_1000334202	192
171	3300007076	Ga0075435_100197364	Ga0075435_1001973642	192
172	3300007076	Ga0075435_100897663	Ga0075435_1008976631	192
173	3300009098	Ga0105245_10662578	Ga0105245_106625781	192
174	3300009147	Ga0114129_10018133	Ga0114129_100181339	192
175	3300009147	Ga0114129_10523869	Ga0114129_105238692	192
176	3300009177	Ga0105248_10037172	Ga0105248_100371724	192
177	3300009553	Ga0105249_10028649	Ga0105249_100286495	192
178	3300014326	Ga0157380_10381920	Ga0157380_103819201	192
179	3300014968	Ga0157379_10243395	Ga0157379_102433952	192
180	3300025910	Ga0207684_10384141	Ga0207684_103841411	192
181	3300025922	Ga0207646_10361922	Ga0207646_103619221	192
182	3300025923	Ga0207681_10576274	Ga0207681_105762741	192
183	3300025936	Ga0207670_10430181	Ga0207670_104301811	192
184	3300025942	Ga0207689_10640772	Ga0207689_106407721	192
185	3300026035	Ga0207703_10457713	Ga0207703_104577132	192
186	3300026041	Ga0207639_10893277	Ga0207639_108932771	192
187	3300026088	Ga0207641_10688832	Ga0207641_106888321	192
188	3300026118	Ga0207675_100143651	Ga0207675_1001436515	192
189	3300035114	Ga0373939_0060107	Ga0373939_0060107_179_808	192
190	3300035121	Ga0373960_0107612	Ga0373960_0107612_147_776	192
191	3300035691	Ga0373931_0235711	Ga0373931_0235711_301_930	192
192	3300042876	Ga0451577_0355991	Ga0451577_0355991_375_1019	192
193	3300045051	Ga0451576_0066069	Ga0451576_0066069_1585_2214	192
194	3300046472	Ga0495580_0010697	Ga0495580_0010697_6281_6925	192
195	3300046684	Ga0495669_0023034	Ga0495669_0023034_449_1093	192
196	3300050507	nmdc:mga05p37_118838_c1	nmdc:mga05p37_118838_c1_105_776	192
197	3300050508	nmdc:mga09592_11190_c1	nmdc:mga09592_11190_c1_5299_5970	192
198	3300050510	nmdc:mga06r32_112045_c1	nmdc:mga06r32_112045_c1_367_1038	192
199	3300050512	nmdc:mga0n895_16692_c1	nmdc:mga0n895_16692_c1_4846_5475	192
200	3300050512	nmdc:mga0n895_731579_c1	nmdc:mga0n895_731579_c1_292_927	192
201	3300050513	nmdc:mga0rr50_148691_c1	nmdc:mga0rr50_148691_c1_363_1034	192
202	3300050513	nmdc:mga0rr50_579854_c1	nmdc:mga0rr50_579854_c1_291_920	192
203	3300050513	nmdc:mga0rr50_83995_c1	nmdc:mga0rr50_83995_c1_1778_2422	192
204	3300050515	nmdc:mga0a205_1418_c1	nmdc:mga0a205_1418_c1_18521_19192	192
205	3300050515	nmdc:mga0a205_678593_c1	nmdc:mga0a205_678593_c1_176_805	192
206	3300009098	Ga0105245_10505853	Ga0105245_105058532	193
207	3300014325	Ga0163163_10311234	Ga0163163_103112343	193
208	3300046452	Ga0495617_091297	Ga0495617_091297_267_881	193
209	iso_pu_bacteria	2884994152	2884997534	193
210	3300005544	Ga0070686_100671548	Ga0070686_1006715481	194
211	3300005545	Ga0070695_100436175	Ga0070695_1004361752	194
212	3300005546	Ga0070696_100016400	Ga0070696_1000164004	194
213	3300005985	Ga0081539_10039863	Ga0081539_100398632	194
214	3300006881	Ga0068865_100034410	Ga0068865_1000344103	194
215	3300009148	Ga0105243_10390861	Ga0105243_103908613	194
216	3300009176	Ga0105242_10018723	Ga0105242_100187232	194
217	3300009553	Ga0105249_10120989	Ga0105249_101209894	194
218	3300014326	Ga0157380_10219042	Ga0157380_102190423	194
219	3300014745	Ga0157377_10552822	Ga0157377_105528221	194
220	3300025907	Ga0207645_10288121	Ga0207645_102881212	194
221	3300025934	Ga0207686_10392980	Ga0207686_103929802	194
222	3300025935	Ga0207709_10906298	Ga0207709_109062981	194
223	3300026075	Ga0207708_10434486	Ga0207708_104344862	194
224	3300026089	Ga0207648_10028303	Ga0207648_100283039	194
225	3300032002	Ga0307416_100166228	Ga0307416_1001662281	194
226	3300046455	Ga0495603_0071907	Ga0495603_0071907_1073_1690	194
227	3300046491	Ga0495584_0031682	Ga0495584_0031682_384_1001	194
228	3300046492	Ga0495585_0132594	Ga0495585_0132594_499_1116	194
229	3300046501	Ga0495607_0093728	Ga0495607_0093728_732_1349	194
230	3300046520	Ga0495637_0108658	Ga0495637_0108658_172_789	194
231	3300046523	Ga0495644_0002759	Ga0495644_0002759_2770_3387	194
232	3300046525	Ga0495663_0008199	Ga0495663_0008199_2264_2881	194
233	3300046528	Ga0495642_0018211	Ga0495642_0018211_923_1540	194
234	3300046537	Ga0495598_0003157	Ga0495598_0003157_476_1093	194
235	3300046538	Ga0495609_0040962	Ga0495609_0040962_216_833	194
236	3300046615	Ga0495656_0124539	Ga0495656_0124539_411_1028	194
237	3300046664	Ga0495659_0002088	Ga0495659_0002088_4677_5294	194
238	3300046691	Ga0495670_0421014	Ga0495670_0421014_83_700	194
239	3300048905	Ga0496102_0330668	Ga0496102_0330668_736_1362	194
240	3300049571	Ga0501034_0112924	Ga0501034_0112924_491_1102	194
241	3300005518	Ga0070699_100683925	Ga0070699_1006839251	195
242	3300014497	Ga0182008_10004860	Ga0182008_100048609	195
243	3300044735	Ga0466968_0157772	Ga0466968_0157772_367_1023	195
244	3300049583	Ga0501067_0056863	Ga0501067_0056863_586_1197	195
245	3300049576	Ga0501040_0258050	Ga0501040_0258050_419_1051	196
246	3300049741	Ga0501079_0880924	Ga0501079_0880924_37_669	196
247	3300050507	nmdc:mga05p37_191776_c1	nmdc:mga05p37_191776_c1_420_1061	196
248	3300003578	Ga0006562J51391_1016607	Ga0006562J51391_10166073	197
249	3300003771	Ga0055526_1019338	Ga0055526_10193382	197
250	3300003775	Ga0055524_1000675	Ga0055524_10006752	197
251	3300005262	Ga0065165_1000072	Ga0065165_1000072106	197
252	3300005343	Ga0070687_100180529	Ga0070687_1001805292	197
253	3300005356	Ga0070674_100332458	Ga0070674_1003324581	197
254	3300005435	Ga0070714_100009576	Ga0070714_1000095762	197
255	3300006175	Ga0070712_100396470	Ga0070712_1003964702	197
256	3300009098	Ga0105245_10319489	Ga0105245_103194892	197
257	3300009176	Ga0105242_10108628	Ga0105242_101086282	197
258	3300009177	Ga0105248_10020084	Ga0105248_100200844	197
259	3300013297	Ga0157378_10039014	Ga0157378_100390142	197
260	3300013297	Ga0157378_10376451	Ga0157378_103764513	197
261	3300025273	Ga0209673_1026132	Ga0209673_10261322	197
262	3300025284	Ga0209130_1000125	Ga0209130_100012522	197
263	3300025291	Ga0209675_1002593	Ga0209675_10025933	197
264	3300025294	Ga0209025_1000016	Ga0209025_10000163	197
265	3300025294	Ga0209025_1007544	Ga0209025_10075444	197
266	3300025294	Ga0209025_1029337	Ga0209025_10293372	197
267	3300025295	Ga0209564_1000403	Ga0209564_100040312	197
268	3300025299	Ga0209256_1001488	Ga0209256_100148825	197
269	3300025302	Ga0207426_1017807	Ga0207426_10178072	197
270	3300025929	Ga0207664_10000672	Ga0207664_100006723	197
271	3300026118	Ga0207675_100635562	Ga0207675_1006355621	197
272	3300026121	Ga0207683_10165874	Ga0207683_101658743	197
273	3300037312	Ga0395899_0045157	Ga0395899_0045157_621_1262	197
274	3300037418	Ga0395900_0145237	Ga0395900_0145237_1609_2247	197
275	3300037418	Ga0395900_1038400	Ga0395900_1038400_44_685	197
276	3300037466	Ga0395898_0037837	Ga0395898_0037837_3250_3891	197
277	3300037471	Ga0395905_0109755	Ga0395905_0109755_1111_1746	197
278	3300037471	Ga0395905_0204773	Ga0395905_0204773_241_879	197
279	3300038443	Ga0395901_0016427	Ga0395901_0016427_6275_6916	197
280	3300039062	Ga0400483_088211	Ga0400483_088211_10945_11571	197
281	3300039062	Ga0400483_197418	Ga0400483_197418_3427_4053	197
282	3300039447	Ga0436361_0496951	Ga0436361_0496951_159_803	197
283	3300046455	Ga0495603_0012855	Ga0495603_0012855_2942_3574	197
284	3300046455	Ga0495603_0415327	Ga0495603_0415327_96_749	197
285	3300046460	Ga0495638_0023515	Ga0495638_0023515_1796_2434	197
286	3300046499	Ga0495594_0127768	Ga0495594_0127768_705_1337	197
287	3300047321	Ga0495676_0099751	Ga0495676_0099751_119_751	197
288	3300048928	Ga0496125_0133356	Ga0496125_0133356_415_1038	197
289	3300048929	Ga0496126_0141879	Ga0496126_0141879_812_1435	197
290	3300049823	Ga0501044_0000233	Ga0501044_0000233_41183_41821	197
291	3300061734	Ga0530510_0276799	Ga0530510_0276799_56_694	197
292	3300003214	JGI25165J46597_1002618	JGI25165J46597_10026182	198
293	3300005347	Ga0070668_100230780	Ga0070668_1002307801	198
294	3300005347	Ga0070668_100242943	Ga0070668_1002429431	198
295	3300005353	Ga0070669_100011692	Ga0070669_1000116922	198
296	3300005356	Ga0070674_100004336	Ga0070674_1000043366	198
297	3300005406	Ga0070703_10023533	Ga0070703_100235332	198
298	3300005437	Ga0070710_10075936	Ga0070710_100759361	198
299	3300005440	Ga0070705_100000171	Ga0070705_10000017127	198
300	3300005441	Ga0070700_100000482	Ga0070700_10000048223	198
301	3300005444	Ga0070694_100003250	Ga0070694_10000325010	198
302	3300005457	Ga0070662_100059516	Ga0070662_1000595162	198
303	3300005458	Ga0070681_10264876	Ga0070681_102648762	198
304	3300005468	Ga0070707_100471381	Ga0070707_1004713811	198
305	3300005518	Ga0070699_100000167	Ga0070699_10000016711	198
306	3300005530	Ga0070679_100023162	Ga0070679_1000231621	198
307	3300005530	Ga0070679_100341738	Ga0070679_1003417382	198
308	3300005530	Ga0070679_100360614	Ga0070679_1003606141	198
309	3300005536	Ga0070697_100023319	Ga0070697_1000233193	198
310	3300005539	Ga0068853_100028521	Ga0068853_1000285212	198
311	3300005545	Ga0070695_100011249	Ga0070695_1000112492	198
312	3300005546	Ga0070696_100002999	Ga0070696_10000299914	198
313	3300005547	Ga0070693_100005600	Ga0070693_1000056005	198
314	3300005548	Ga0070665_100050164	Ga0070665_1000501641	198
315	3300005549	Ga0070704_100008913	Ga0070704_1000089132	198
316	3300005563	Ga0068855_100019156	Ga0068855_1000191564	198
317	3300005577	Ga0068857_100044417	Ga0068857_1000444172	198
318	3300005615	Ga0070702_100032912	Ga0070702_1000329123	198
319	3300005617	Ga0068859_100018683	Ga0068859_1000186831	198
320	3300005618	Ga0068864_100025773	Ga0068864_1000257735	198
321	3300005718	Ga0068866_10021586	Ga0068866_100215862	198
322	3300005840	Ga0068870_10114278	Ga0068870_101142781	198
323	3300005841	Ga0068863_100237040	Ga0068863_1002370402	198
324	3300005844	Ga0068862_100077668	Ga0068862_1000776682	198
325	3300005844	Ga0068862_100198412	Ga0068862_1001984122	198
326	3300006195	Ga0075366_10213729	Ga0075366_102137292	198
327	3300006846	Ga0075430_100599846	Ga0075430_1005998461	198
328	3300006847	Ga0075431_100038362	Ga0075431_1000383622	198
329	3300006931	Ga0097620_100018683	Ga0097620_1000186836	198
330	3300009148	Ga0105243_10071400	Ga0105243_100714002	198
331	3300009148	Ga0105243_10098915	Ga0105243_100989152	198
332	3300009174	Ga0105241_10327739	Ga0105241_103277392	198
333	3300009545	Ga0105237_10011815	Ga0105237_1001181510	198
334	3300009551	Ga0105238_10302941	Ga0105238_103029412	198
335	3300009553	Ga0105249_10004272	Ga0105249_100042722	198
336	3300010375	Ga0105239_10001582	Ga0105239_1000158215	198
337	3300010375	Ga0105239_10420708	Ga0105239_104207082	198
338	3300011119	Ga0105246_10041565	Ga0105246_100415652	198
339	3300013296	Ga0157374_10127649	Ga0157374_101276492	198
340	3300014326	Ga0157380_10166151	Ga0157380_101661512	198
341	3300021384	Ga0213876_10008784	Ga0213876_100087843	198
342	3300025261	Ga0209233_1001234	Ga0209233_100123410	198
343	3300025885	Ga0207653_10000520	Ga0207653_1000052017	198
344	3300025898	Ga0207692_10065113	Ga0207692_100651131	198
345	3300025899	Ga0207642_10017369	Ga0207642_100173693	198
346	3300025909	Ga0207705_10004379	Ga0207705_100043796	198
347	3300025912	Ga0207707_10036624	Ga0207707_100366242	198
348	3300025912	Ga0207707_10178743	Ga0207707_101787432	198
349	3300025914	Ga0207671_10003123	Ga0207671_1000312317	198
350	3300025917	Ga0207660_10006228	Ga0207660_100062282	198
351	3300025919	Ga0207657_10003797	Ga0207657_1000379710	198
352	3300025921	Ga0207652_10089100	Ga0207652_100891001	198
353	3300025921	Ga0207652_10745048	Ga0207652_107450481	198
354	3300025923	Ga0207681_10003995	Ga0207681_100039954	198
355	3300025924	Ga0207694_10234210	Ga0207694_102342102	198
356	3300025929	Ga0207664_10567971	Ga0207664_105679711	198
357	3300025933	Ga0207706_10071235	Ga0207706_100712352	198
358	3300025935	Ga0207709_10130616	Ga0207709_101306162	198
359	3300025937	Ga0207669_10015427	Ga0207669_100154272	198
360	3300025949	Ga0207667_10010771	Ga0207667_100107714	198
361	3300025961	Ga0207712_10009342	Ga0207712_100093423	198
362	3300025972	Ga0207668_10363850	Ga0207668_103638501	198
363	3300025972	Ga0207668_10376375	Ga0207668_103763752	198
364	3300026041	Ga0207639_10010343	Ga0207639_100103437	198
365	3300026067	Ga0207678_10195153	Ga0207678_101951532	198
366	3300026075	Ga0207708_10000296	Ga0207708_100002967	198
367	3300026088	Ga0207641_10254236	Ga0207641_102542362	198
368	3300028023	Ga0265357_1000794	Ga0265357_10007942	198
369	3300028379	Ga0268266_10000265	Ga0268266_1000026522	198
370	3300028379	Ga0268266_10459669	Ga0268266_104596692	198
371	3300028380	Ga0268265_10022396	Ga0268265_100223963	198
372	3300028380	Ga0268265_10074451	Ga0268265_100744513	198
373	3300028381	Ga0268264_10049829	Ga0268264_100498292	198
374	3300031901	Ga0307406_10075694	Ga0307406_100756942	198
375	3300031911	Ga0307412_10072897	Ga0307412_100728972	198
376	3300032004	Ga0307414_10342663	Ga0307414_103426632	198
377	3300034819	Ga0373958_0052492	Ga0373958_0052492_207_854	198
378	3300036457	Ga0265778_017224	Ga0265778_017224_201_836	198
379	3300036457	Ga0265778_024609	Ga0265778_024609_86_721	198
380	3300039093	Ga0400489_64217	Ga0400489_64217_408_1040	198
381	3300039437	Ga0436365_1103900	Ga0436365_1103900_13909_14544	198
382	3300039447	Ga0436361_0208808	Ga0436361_0208808_499_1134	198
383	3300039447	Ga0436361_0947980	Ga0436361_0947980_3161_3865	198
384	3300041452	Ga0451793_1847700	Ga0451793_1847700_36_686	198
385	3300044673	Ga0453683_0073779	Ga0453683_0073779_788_1423	198
386	3300048905	Ga0496102_0002928	Ga0496102_0002928_2741_3388	198
387	3300048909	Ga0496106_0007993	Ga0496106_0007993_183_830	198
388	3300048910	Ga0496107_0027411	Ga0496107_0027411_2550_3197	198
389	3300048912	Ga0496109_0549619	Ga0496109_0549619_387_1034	198
390	3300048924	Ga0496121_0084055	Ga0496121_0084055_598_1224	198
391	3300048928	Ga0496125_0001140	Ga0496125_0001140_34553_35182	198
392	3300048929	Ga0496126_0296823	Ga0496126_0296823_512_1147	198
393	3300049568	Ga0501031_0135678	Ga0501031_0135678_677_1324	198
394	3300049570	Ga0501033_0119306	Ga0501033_0119306_467_1093	198
395	3300049571	Ga0501034_0013299	Ga0501034_0013299_612_1241	198
396	3300049571	Ga0501034_0229836	Ga0501034_0229836_1039_1665	198
397	3300049572	Ga0501036_0184129	Ga0501036_0184129_182_808	198
398	3300049573	Ga0501037_0049049	Ga0501037_0049049_106_753	198
399	3300049576	Ga0501040_0124788	Ga0501040_0124788_234_881	198
400	3300049579	Ga0501043_0195676	Ga0501043_0195676_162_788	198
401	3300049580	Ga0501046_0007129	Ga0501046_0007129_6424_7071	198
402	3300049581	Ga0501047_0208048	Ga0501047_0208048_823_1449	198
403	3300049822	Ga0501035_0139151	Ga0501035_0139151_916_1542	198
404	3300049823	Ga0501044_0134899	Ga0501044_0134899_162_797	198
405	3300049824	Ga0501045_0209477	Ga0501045_0209477_478_1125	198
406	3300050493	nmdc:mga0k408_213792_c1	nmdc:mga0k408_213792_c1_488_1120	198
407	3300050511	nmdc:mga08y16_1087811_c1	nmdc:mga08y16_1087811_c1_23_670	198
408	3300050511	nmdc:mga08y16_579703_c1	nmdc:mga08y16_579703_c1_429_1085	198
409	3300053157	Ga0500624_055105	Ga0500624_055105_77_703	198
410	3300053161	Ga0500634_0000071	Ga0500634_0000071_31898_32524	198
411	3300059643	Ga0587072_032511	Ga0587072_032511_51_680	198
412	iso_pu_bacteria	2547132512	2548847987	198
413	3300006038	Ga0075365_10001324	Ga0075365_100013243	199
414	3300006042	Ga0075368_10009813	Ga0075368_100098133	199
415	3300006048	Ga0075363_100011063	Ga0075363_1000110636	199
416	3300006051	Ga0075364_10034190	Ga0075364_100341903	199
417	3300006177	Ga0075362_10073007	Ga0075362_100730072	199
418	3300006178	Ga0075367_10065622	Ga0075367_100656222	199
419	3300006186	Ga0075369_10000196	Ga0075369_1000019610	199
420	3300006194	Ga0075427_10042848	Ga0075427_100428481	199
421	3300006353	Ga0075370_10000070	Ga0075370_1000007024	199
422	3300006871	Ga0075434_100041114	Ga0075434_1000411142	199
423	3300006880	Ga0075429_100005914	Ga0075429_1000059148	199
424	3300009147	Ga0114129_10244889	Ga0114129_102448892	199
425	3300010375	Ga0105239_10351625	Ga0105239_103516252	199
426	3300027866	Ga0209813_10006478	Ga0209813_100064783	199
427	3300031903	Ga0307407_10117699	Ga0307407_101176991	199
428	3300050490	nmdc:mga03n38_2218_c1	nmdc:mga03n38_2218_c1_5057_5722	199
429	3300050491	nmdc:mga00v17_116_c1	nmdc:mga00v17_116_c1_32075_32740	199
430	3300050491	nmdc:mga00v17_1215_c1	nmdc:mga00v17_1215_c1_10122_10787	199
431	3300050492	nmdc:mga0yw44_482_c1	nmdc:mga0yw44_482_c1_8924_9589	199
432	3300050494	nmdc:mga06z11_13407_c1	nmdc:mga06z11_13407_c1_1369_2034	199
433	3300050495	nmdc:mga04h51_5693_c1	nmdc:mga04h51_5693_c1_1890_2555	199
434	3300050496	nmdc:mga07m45_79_c1	nmdc:mga07m45_79_c1_28812_29477	199
435	3300050508	nmdc:mga09592_6163_c1	nmdc:mga09592_6163_c1_5461_6126	199
436	3300050512	nmdc:mga0n895_39373_c1	nmdc:mga0n895_39373_c1_3672_4337	199
437	3300050516	nmdc:mga0sz30_42_c2	nmdc:mga0sz30_42_c2_9045_9710	199
438	iso_pu_bacteria	2574179768	2574433118	199
439	iso_pu_bacteria	2891633521	2891634979	199
440	iso_pu_bacteria	639633007	639787222	199
441	3300006852	Ga0075433_10495410	Ga0075433_104954102	200
442	3300028653	Ga0265323_10016313	Ga0265323_100163132	200
443	3300031238	Ga0265332_10000021	Ga0265332_10000021182	200
444	3300031344	Ga0265316_10231603	Ga0265316_102316032	200
445	3300031344	Ga0265316_10466689	Ga0265316_104666892	200
446	3300031616	Ga0307508_10137763	Ga0307508_101377632	200
447	3300033179	Ga0307507_10183866	Ga0307507_101838661	200
448	3300035091	Ga0373951_0016812	Ga0373951_0016812_455_1084	200
449	3300037068	Ga0373925_0447510	Ga0373925_0447510_349_978	200
450	3300037418	Ga0395900_0238887	Ga0395900_0238887_40_699	200
451	3300042876	Ga0451577_0015319	Ga0451577_0015319_4766_5395	200
452	3300044712	Ga0453684_0005386	Ga0453684_0005386_23359_23988	200
453	3300044712	Ga0453684_0005797	Ga0453684_0005797_10225_10854	200
454	3300045051	Ga0451576_0124328	Ga0451576_0124328_722_1357	200
455	3300045051	Ga0451576_0223451	Ga0451576_0223451_975_1604	200
456	3300045051	Ga0451576_1227086	Ga0451576_1227086_138_767	200
457	3300049550	Ga0501334_06530	Ga0501334_06530_136_765	200
458	3300050491	nmdc:mga00v17_312257_c1	nmdc:mga00v17_312257_c1_97_744	200
459	3300009093	Ga0105240_10000563	Ga0105240_1000056348	201
460	3300025913	Ga0207695_10000655	Ga0207695_1000065517	201
461	3300036647	Ga0316582_0389859	Ga0316582_0389859_102_740	201
462	3300005549	Ga0070704_100085597	Ga0070704_1000855972	202
463	3300006844	Ga0075428_101208143	Ga0075428_1012081431	202
464	3300006846	Ga0075430_100010264	Ga0075430_1000102647	202
465	3300006847	Ga0075431_100006349	Ga0075431_1000063493	202
466	3300006847	Ga0075431_100940239	Ga0075431_1009402391	202
467	3300009094	Ga0111539_10146641	Ga0111539_101466412	202
468	3300010375	Ga0105239_10885064	Ga0105239_108850641	202
469	3300026075	Ga0207708_10281868	Ga0207708_102818682	202
470	3300028556	Ga0265337_1000118	Ga0265337_100011834	202
471	3300028558	Ga0265326_10000719	Ga0265326_100007193	202
472	3300028563	Ga0265319_1000096	Ga0265319_100009641	202
473	3300028563	Ga0265319_1000553	Ga0265319_10005536	202
474	3300028573	Ga0265334_10018531	Ga0265334_100185312	202
475	3300028573	Ga0265334_10039309	Ga0265334_100393092	202
476	3300028577	Ga0265318_10005418	Ga0265318_100054182	202
477	3300028577	Ga0265318_10022487	Ga0265318_100224872	202
478	3300028653	Ga0265323_10000359	Ga0265323_100003597	202
479	3300028654	Ga0265322_10000482	Ga0265322_1000048211	202
480	3300028666	Ga0265336_10000597	Ga0265336_100005973	202
481	3300028800	Ga0265338_10000493	Ga0265338_1000049345	202
482	3300028800	Ga0265338_10000597	Ga0265338_100005978	202
483	3300028800	Ga0265338_10019432	Ga0265338_100194326	202
484	3300029957	Ga0265324_10002736	Ga0265324_100027363	202
485	3300029957	Ga0265324_10002808	Ga0265324_100028083	202
486	3300029957	Ga0265324_10004464	Ga0265324_100044644	202
487	3300031235	Ga0265330_10000356	Ga0265330_100003566	202
488	3300031235	Ga0265330_10039738	Ga0265330_100397382	202
489	3300031238	Ga0265332_10000479	Ga0265332_100004794	202
490	3300031239	Ga0265328_10000815	Ga0265328_100008154	202
491	3300031239	Ga0265328_10006017	Ga0265328_100060172	202
492	3300031240	Ga0265320_10005906	Ga0265320_100059066	202
493	3300031240	Ga0265320_10006732	Ga0265320_100067322	202
494	3300031241	Ga0265325_10019062	Ga0265325_100190622	202
495	3300031242	Ga0265329_10000864	Ga0265329_100008643	202
496	3300031247	Ga0265340_10004932	Ga0265340_100049326	202
497	3300031249	Ga0265339_10002055	Ga0265339_100020553	202
498	3300031250	Ga0265331_10000012	Ga0265331_10000012172	202
499	3300031250	Ga0265331_10001576	Ga0265331_100015769	202
500	3300031250	Ga0265331_10006167	Ga0265331_100061677	202
501	3300031250	Ga0265331_10041745	Ga0265331_100417452	202
502	3300031251	Ga0265327_10000206	Ga0265327_10000206111	202
503	3300031251	Ga0265327_10000534	Ga0265327_1000053422	202
504	3300031251	Ga0265327_10001664	Ga0265327_100016643	202
505	3300031251	Ga0265327_10005513	Ga0265327_100055138	202
506	3300031344	Ga0265316_10004876	Ga0265316_100048763	202
507	3300031344	Ga0265316_10045711	Ga0265316_100457112	202
508	3300031344	Ga0265316_10072513	Ga0265316_100725132	202
509	3300031344	Ga0265316_10411283	Ga0265316_104112831	202
510	3300031595	Ga0265313_10002931	Ga0265313_100029312	202
511	3300031711	Ga0265314_10002775	Ga0265314_1000277511	202
512	3300031712	Ga0265342_10003252	Ga0265342_100032528	202
513	3300031712	Ga0265342_10005848	Ga0265342_100058487	202
514	3300032005	Ga0307411_10033327	Ga0307411_100333272	202
515	3300032005	Ga0307411_10221196	Ga0307411_102211962	202
516	3300032168	Ga0316593_10005666	Ga0316593_100056662	202
517	3300032168	Ga0316593_10024859	Ga0316593_100248591	202
518	3300033529	Ga0316587_1000049	Ga0316587_10000493	202
519	3300033541	Ga0316596_1016912	Ga0316596_10169122	202
520	3300035398	Ga0316574_0051644	Ga0316574_0051644_1039_1668	202
521	3300037418	Ga0395900_0001788	Ga0395900_0001788_15952_16578	202
522	3300041441	Ga0451787_353670	Ga0451787_353670_163_795	202
523	3300048909	Ga0496106_0165170	Ga0496106_0165170_781_1443	202
524	3300048917	Ga0496114_0019442	Ga0496114_0019442_862_1524	202
525	3300049573	Ga0501037_0031095	Ga0501037_0031095_1087_1710	202
526	3300049575	Ga0501039_0002136	Ga0501039_0002136_9410_10033	202
527	3300049576	Ga0501040_0256961	Ga0501040_0256961_308_931	202
528	3300049580	Ga0501046_0151986	Ga0501046_0151986_759_1382	202
529	3300049587	Ga0501071_0081366	Ga0501071_0081366_1205_1828	202
530	3300049588	Ga0501072_0074803	Ga0501072_0074803_45_668	202
531	3300049591	Ga0501075_0001283	Ga0501075_0001283_1152_1775	202
532	3300049592	Ga0501076_0001480	Ga0501076_0001480_13528_14151	202
533	3300049593	Ga0501077_0121700	Ga0501077_0121700_588_1211	202
534	3300049743	Ga0501081_0000921	Ga0501081_0000921_9832_10455	202
535	3300050493	nmdc:mga0k408_174087_c1	nmdc:mga0k408_174087_c1_34_669	202
536	3300050508	nmdc:mga09592_23793_c1	nmdc:mga09592_23793_c1_2618_3265	202
537	3300050509	nmdc:mga0qj67_13296_c1	nmdc:mga0qj67_13296_c1_4804_5451	202
538	3300050510	nmdc:mga06r32_31915_c1	nmdc:mga06r32_31915_c1_1687_2334	202
539	3300050511	nmdc:mga08y16_118180_c1	nmdc:mga08y16_118180_c1_705_1367	202
540	3300054114	Ga0501084_0091896	Ga0501084_0091896_1645_2268	202
541	3300060353	Ga0501082_0009229	Ga0501082_0009229_1869_2492	202
542	3300060353	Ga0501082_0409208	Ga0501082_0409208_399_1022	202
543	iso_pu_bacteria	2738541276	2738715289	202
544	3300003323	rootH1_10084130	rootH1_100841309	203
545	3300003323	rootH1_10384712	rootH1_103847121	203
546	3300005327	Ga0070658_10026770	Ga0070658_100267702	203
547	3300005337	Ga0070682_100085115	Ga0070682_1000851152	203
548	3300005344	Ga0070661_100171724	Ga0070661_1001717242	203
549	3300005539	Ga0068853_100558757	Ga0068853_1005587572	203
550	3300006846	Ga0075430_100024799	Ga0075430_1000247991	203
551	3300013307	Ga0157372_11046462	Ga0157372_110464622	203
552	3300025909	Ga0207705_10046679	Ga0207705_100466792	203
553	3300028558	Ga0265326_10000283	Ga0265326_1000028316	203
554	3300028558	Ga0265326_10041931	Ga0265326_100419312	203
555	3300028563	Ga0265319_1000819	Ga0265319_100081910	203
556	3300028577	Ga0265318_10003317	Ga0265318_100033173	203
557	3300028666	Ga0265336_10000043	Ga0265336_1000004375	203
558	3300028800	Ga0265338_10000142	Ga0265338_1000014274	203
559	3300029957	Ga0265324_10003379	Ga0265324_100033793	203
560	3300031247	Ga0265340_10000006	Ga0265340_1000000675	203
561	3300031249	Ga0265339_10024720	Ga0265339_100247202	203
562	3300031250	Ga0265331_10003879	Ga0265331_1000387910	203
563	3300031251	Ga0265327_10000014	Ga0265327_10000014341	203
564	3300031251	Ga0265327_10001313	Ga0265327_1000131325	203
565	3300031251	Ga0265327_10062154	Ga0265327_100621542	203
566	3300031344	Ga0265316_10040745	Ga0265316_100407454	203
567	3300031507	Ga0307509_10000053	Ga0307509_1000005313	203
568	3300031665	Ga0316575_10029247	Ga0316575_100292472	203
569	3300031712	Ga0265342_10020488	Ga0265342_100204883	203
570	3300032133	Ga0316583_10000894	Ga0316583_100008945	203
571	3300032168	Ga0316593_10007781	Ga0316593_100077812	203
572	3300037312	Ga0395899_0016631	Ga0395899_0016631_917_1540	203
573	3300037418	Ga0395900_0024504	Ga0395900_0024504_3449_4072	203
574	3300037471	Ga0395905_0028647	Ga0395905_0028647_304_927	203
575	3300038443	Ga0395901_0082690	Ga0395901_0082690_2366_2989	203
576	3300039447	Ga0436361_0175542	Ga0436361_0175542_2327_2959	203
577	3300042876	Ga0451577_0006851	Ga0451577_0006851_3602_4258	203
578	3300042876	Ga0451577_0316792	Ga0451577_0316792_151_810	203
579	3300042876	Ga0451577_0566628	Ga0451577_0566628_238_876	203
580	3300044656	Ga0466969_0008306	Ga0466969_0008306_2651_3274	203
581	3300044658	Ga0466972_0176151	Ga0466972_0176151_263_886	203
582	3300044673	Ga0453683_0102415	Ga0453683_0102415_701_1357	203
583	3300044673	Ga0453683_0167390	Ga0453683_0167390_673_1332	203
584	3300044684	Ga0466966_0062285	Ga0466966_0062285_859_1482	203
585	3300044693	Ga0466961_0005511	Ga0466961_0005511_5117_5740	203
586	3300044712	Ga0453684_0000195	Ga0453684_0000195_57014_57673	203
587	3300044712	Ga0453684_0018588	Ga0453684_0018588_8574_9227	203
588	3300044712	Ga0453684_0266107	Ga0453684_0266107_63_719	203
589	3300044712	Ga0453684_0431483	Ga0453684_0431483_603_1262	203
590	3300044712	Ga0453684_0929847	Ga0453684_0929847_155_793	203
591	3300045049	Ga0466959_0030625	Ga0466959_0030625_1363_1986	203
592	3300045051	Ga0451576_0008451	Ga0451576_0008451_9309_9968	203
593	3300049758	Ga0501241_043367	Ga0501241_043367_148_777	203
594	3300059477	Ga0587084_023171	Ga0587084_023171_156_779	203
595	3300059478	Ga0587093_001509	Ga0587093_001509_1002_1625	203
596	3300059491	Ga0587070_002969	Ga0587070_002969_102_725	203
597	3300059491	Ga0587070_008410	Ga0587070_008410_358_981	203
598	3300059493	Ga0587077_000277	Ga0587077_000277_3256_3879	203
599	3300059503	Ga0587080_015378	Ga0587080_015378_439_1062	203
600	3300059510	Ga0587090_000298	Ga0587090_000298_1266_1889	203
601	3300059510	Ga0587090_000298	Ga0587090_000298_1952_2575	203
602	3300059510	Ga0587090_000571	Ga0587090_000571_137_760	203
603	3300059510	Ga0587090_024327	Ga0587090_024327_52_675	203
604	3300059511	Ga0587091_000078	Ga0587091_000078_752_1375	203
605	3300059512	Ga0587092_002170	Ga0587092_002170_177_800	203
606	3300059639	Ga0587062_000745	Ga0587062_000745_850_1473	203
607	3300059641	Ga0587068_001577	Ga0587068_001577_1613_2236	203
608	3300059641	Ga0587068_003558	Ga0587068_003558_157_780	203
609	3300059644	Ga0587075_009386	Ga0587075_009386_388_1011	203
610	3300059645	Ga0587076_024653	Ga0587076_024653_209_832	203
611	3300059646	Ga0587078_000075	Ga0587078_000075_1621_2244	203
612	3300060346	Ga0587111_0000156	Ga0587111_0000156_783_1406	203
613	3300002704	JGI25155J39150_1001956	JGI25155J39150_10019562	204
614	3300002704	JGI25155J39150_1001968	JGI25155J39150_10019682	204
615	3300002705	JGI25156J39149_1001328	JGI25156J39149_10013288	204
616	3300002705	JGI25156J39149_1012509	JGI25156J39149_10125091	204
617	3300002737	JGI25162J39368_1004947	JGI25162J39368_10049472	204
618	3300002738	JGI25154J39366_1000618	JGI25154J39366_100061811	204
619	3300002738	JGI25154J39366_1009341	JGI25154J39366_10093412	204
620	3300002738	JGI25154J39366_1009392	JGI25154J39366_10093922	204
621	3300002741	JGI25157J39369_1002816	JGI25157J39369_10028162	204
622	3300002741	JGI25157J39369_1014148	JGI25157J39369_10141481	204
623	3300003163	Ga0006759J45824_1030552	Ga0006759J45824_10305523	204
624	3300003291	Ga0007421J48921_103704	Ga0007421J48921_1037041	204
625	3300003300	Ga0006758J48902_1032376	Ga0006758J48902_10323762	204
626	3300003308	Ga0006777J48905_1052586	Ga0006777J48905_10525861	204
627	3300003323	rootH1_10002081	rootH1_1000208182	204
628	3300003544	Ga0007417J51691_1014262	Ga0007417J51691_10142623	204
629	3300003544	Ga0007417J51691_1015597	Ga0007417J51691_10155973	204
630	3300003559	Ga0007427J51700_115684	Ga0007427J51700_1156841	204
631	3300003574	Ga0007410J51695_1015221	Ga0007410J51695_10152213	204
632	3300003574	Ga0007410J51695_1020044	Ga0007410J51695_10200443	204
633	3300003575	Ga0007409J51694_1008075	Ga0007409J51694_10080753	204
634	3300003577	Ga0007416J51690_1009527	Ga0007416J51690_10095273	204
635	3300003579	Ga0007429J51699_1033716	Ga0007429J51699_10337162	204
636	3300003579	Ga0007429J51699_1053583	Ga0007429J51699_10535832	204
637	3300003611	Ga0007411J51799_109336	Ga0007411J51799_1093363	204
638	3300003693	Ga0032354_1013414	Ga0032354_10134143	204
639	3300003751	Ga0055538_1000020	Ga0055538_1000020239	204
640	3300003752	Ga0055539_1000025	Ga0055539_1000025239	204
641	3300003756	Ga0055533_1000034	Ga0055533_10000346	204
642	3300003758	Ga0055532_1000051	Ga0055532_10000516	204
643	3300003759	Ga0055525_1000044	Ga0055525_1000044239	204
644	3300003763	Ga0055529_1000060	Ga0055529_1000060140	204
645	3300003771	Ga0055526_1011426	Ga0055526_10114263	204
646	3300003771	Ga0055526_1011578	Ga0055526_10115783	204
647	3300003841	Ga0055541_1000019	Ga0055541_1000019239	204
648	3300004803	Ga0058862_12694891	Ga0058862_126948912	204
649	3300005337	Ga0070682_100027008	Ga0070682_1000270082	204
650	3300005339	Ga0070660_100012644	Ga0070660_1000126446	204
651	3300005344	Ga0070661_100001972	Ga0070661_1000019728	204
652	3300005344	Ga0070661_100030263	Ga0070661_1000302632	204
653	3300005455	Ga0070663_100454643	Ga0070663_1004546431	204
654	3300005457	Ga0070662_100080154	Ga0070662_1000801542	204
655	3300005530	Ga0070679_100259657	Ga0070679_1002596572	204
656	3300005539	Ga0068853_100080653	Ga0068853_1000806532	204
657	3300005539	Ga0068853_100850470	Ga0068853_1008504702	204
658	3300005546	Ga0070696_100033395	Ga0070696_1000333955	204
659	3300005563	Ga0068855_100000396	Ga0068855_10000039650	204
660	3300005563	Ga0068855_100056617	Ga0068855_1000566173	204
661	3300005563	Ga0068855_100399146	Ga0068855_1003991462	204
662	3300005564	Ga0070664_100019510	Ga0070664_1000195101	204
663	3300005578	Ga0068854_100014099	Ga0068854_1000140993	204
664	3300005614	Ga0068856_100251103	Ga0068856_1002511032	204
665	3300005616	Ga0068852_100035921	Ga0068852_1000359213	204
666	3300005618	Ga0068864_100212372	Ga0068864_1002123722	204
667	3300006028	Ga0070717_10194485	Ga0070717_101944852	204
668	3300006048	Ga0075363_100192874	Ga0075363_1001928742	204
669	3300006175	Ga0070712_100052091	Ga0070712_1000520912	204
670	3300006177	Ga0075362_10141967	Ga0075362_101419672	204
671	3300006195	Ga0075366_10001177	Ga0075366_100011779	204
672	3300006195	Ga0075366_10348293	Ga0075366_103482932	204
673	3300006353	Ga0075370_10070408	Ga0075370_100704082	204
674	3300006946	Ga0079104_1002636	Ga0079104_10026368	204
675	3300006946	Ga0079104_1029840	Ga0079104_10298402	204
676	3300009036	Ga0105244_10015662	Ga0105244_100156623	204
677	3300009093	Ga0105240_10031262	Ga0105240_100312622	204
678	3300009093	Ga0105240_10185432	Ga0105240_101854321	204
679	3300009093	Ga0105240_10487748	Ga0105240_104877482	204
680	3300009545	Ga0105237_10094463	Ga0105237_100944633	204
681	3300009545	Ga0105237_10521837	Ga0105237_105218372	204
682	3300009551	Ga0105238_10051778	Ga0105238_100517785	204
683	3300009551	Ga0105238_10170360	Ga0105238_101703602	204
684	3300010375	Ga0105239_10186762	Ga0105239_101867622	204
685	3300010375	Ga0105239_11366174	Ga0105239_113661741	204
686	3300013102	Ga0157371_10461921	Ga0157371_104619211	204
687	3300013306	Ga0163162_11064461	Ga0163162_110644611	204
688	3300014325	Ga0163163_10108090	Ga0163163_101080903	204
689	3300017792	Ga0163161_10048577	Ga0163161_100485772	204
690	3300017792	Ga0163161_10110480	Ga0163161_101104802	204
691	3300017792	Ga0163161_10317153	Ga0163161_103171532	204
692	3300020082	Ga0206353_11181477	Ga0206353_111814772	204
693	3300021361	Ga0213872_10013437	Ga0213872_100134373	204
694	3300025206	Ga0209435_100028	Ga0209435_100028132	204
695	3300025206	Ga0209435_100037	Ga0209435_10003735	204
696	3300025224	Ga0209784_100002	Ga0209784_100002238	204
697	3300025225	Ga0209566_100003	Ga0209566_100003238	204
698	3300025226	Ga0209674_100004	Ga0209674_100004238	204
699	3300025229	Ga0209147_100004	Ga0209147_100004261	204
700	3300025230	Ga0209563_100006	Ga0209563_100006238	204
701	3300025233	Ga0209437_100602	Ga0209437_1006027	204
702	3300025233	Ga0209437_102027	Ga0209437_1020273	204
703	3300025233	Ga0209437_106995	Ga0209437_1069952	204
704	3300025242	Ga0209258_100458	Ga0209258_10045840	204
705	3300025245	Ga0207425_1000636	Ga0207425_100063617	204
706	3300025246	Ga0209646_1000021	Ga0209646_1000021263	204
707	3300025246	Ga0209646_1000049	Ga0209646_1000049236	204
708	3300025246	Ga0209646_1000095	Ga0209646_1000095132	204
709	3300025250	Ga0209026_1014621	Ga0209026_10146212	204
710	3300025253	Ga0209677_100003	Ga0209677_100003238	204
711	3300025256	Ga0209759_1000100	Ga0209759_1000100117	204
712	3300025256	Ga0209759_1009817	Ga0209759_10098172	204
713	3300025263	Ga0209565_1023540	Ga0209565_10235402	204
714	3300025272	Ga0209455_1000026	Ga0209455_1000026139	204
715	3300025272	Ga0209455_1001665	Ga0209455_10016657	204
716	3300025295	Ga0209564_1000002	Ga0209564_1000002566	204
717	3300025295	Ga0209564_1000096	Ga0209564_100009685	204
718	3300025297	Ga0209758_1000866	Ga0209758_100086626	204
719	3300025728	Ga0207655_1021569	Ga0207655_10215692	204
720	3300025728	Ga0207655_1027376	Ga0207655_10273763	204
721	3300025885	Ga0207653_10072028	Ga0207653_100720282	204
722	3300025913	Ga0207695_10034866	Ga0207695_100348663	204
723	3300025913	Ga0207695_10038144	Ga0207695_100381443	204
724	3300025913	Ga0207695_10133062	Ga0207695_101330621	204
725	3300025914	Ga0207671_10313373	Ga0207671_103133732	204
726	3300025914	Ga0207671_10471783	Ga0207671_104717832	204
727	3300025919	Ga0207657_10003726	Ga0207657_100037266	204
728	3300025920	Ga0207649_10158248	Ga0207649_101582482	204
729	3300025923	Ga0207681_10127104	Ga0207681_101271042	204
730	3300025924	Ga0207694_10010628	Ga0207694_100106283	204
731	3300025924	Ga0207694_10062020	Ga0207694_100620202	204
732	3300025933	Ga0207706_10109541	Ga0207706_101095412	204
733	3300025934	Ga0207686_10323763	Ga0207686_103237632	204
734	3300025949	Ga0207667_10000032	Ga0207667_1000003250	204
735	3300025949	Ga0207667_10011898	Ga0207667_100118982	204
736	3300025949	Ga0207667_10030433	Ga0207667_100304337	204
737	3300025949	Ga0207667_10396708	Ga0207667_103967082	204
738	3300025972	Ga0207668_10605878	Ga0207668_106058782	204
739	3300026041	Ga0207639_10942150	Ga0207639_109421501	204
740	3300026078	Ga0207702_10036021	Ga0207702_100360212	204
741	3300026095	Ga0207676_10593219	Ga0207676_105932192	204
742	3300026142	Ga0207698_10066782	Ga0207698_100667822	204
743	3300031250	Ga0265331_10005555	Ga0265331_100055556	204
744	3300031250	Ga0265331_10071781	Ga0265331_100717812	204
745	3300031250	Ga0265331_10121406	Ga0265331_101214062	204
746	3300031251	Ga0265327_10001547	Ga0265327_1000154713	204
747	3300031251	Ga0265327_10048616	Ga0265327_100486162	204
748	3300031344	Ga0265316_10141280	Ga0265316_101412802	204
749	3300031548	Ga0307408_100015741	Ga0307408_1000157414	204
750	3300031548	Ga0307408_100124346	Ga0307408_1001243462	204
751	3300031838	Ga0307518_10052185	Ga0307518_100521852	204
752	3300031901	Ga0307406_10147572	Ga0307406_101475722	204
753	3300031911	Ga0307412_10209113	Ga0307412_102091132	204
754	3300032004	Ga0307414_10102033	Ga0307414_101020332	204
755	3300032168	Ga0316593_10082829	Ga0316593_100828292	204
756	3300035695	Ga0373927_0156774	Ga0373927_0156774_176_823	204
757	3300036401	Ga0373937_0711693	Ga0373937_0711693_203_850	204
758	3300037312	Ga0395899_0004525	Ga0395899_0004525_3398_4024	204
759	3300037312	Ga0395899_0081557	Ga0395899_0081557_1383_2009	204
760	3300037418	Ga0395900_0067602	Ga0395900_0067602_1497_2123	204
761	3300037418	Ga0395900_0111003	Ga0395900_0111003_1590_2216	204
762	3300037466	Ga0395898_0236928	Ga0395898_0236928_251_877	204
763	3300037471	Ga0395905_0001229	Ga0395905_0001229_28334_28960	204
764	3300038443	Ga0395901_0020601	Ga0395901_0020601_1610_2236	204
765	3300038443	Ga0395901_0039763	Ga0395901_0039763_868_1494	204
766	3300038443	Ga0395901_0070924	Ga0395901_0070924_1459_2085	204
767	3300039062	Ga0400483_018497	Ga0400483_018497_653_1294	204
768	3300039062	Ga0400483_208069	Ga0400483_208069_136_771	204
769	3300039447	Ga0436361_0274709	Ga0436361_0274709_2543_3169	204
770	3300039447	Ga0436361_0908371	Ga0436361_0908371_3161_3832	204
771	3300041486	Ga0451807_1338362	Ga0451807_1338362_1253_1894	204
772	3300042157	Ga0439458_0032367	Ga0439458_0032367_108_734	204
773	3300042876	Ga0451577_0024624	Ga0451577_0024624_518_1198	204
774	3300044658	Ga0466972_0022567	Ga0466972_0022567_558_1184	204
775	3300044673	Ga0453683_0045553	Ga0453683_0045553_432_1112	204
776	3300044683	Ga0466965_0003813	Ga0466965_0003813_5110_5736	204
777	3300044712	Ga0453684_0003069	Ga0453684_0003069_18119_18766	204
778	3300044712	Ga0453684_0102700	Ga0453684_0102700_360_986	204
779	3300044735	Ga0466968_0041533	Ga0466968_0041533_760_1386	204
780	3300045049	Ga0466959_0013814	Ga0466959_0013814_3922_4548	204
781	3300045051	Ga0451576_0688560	Ga0451576_0688560_411_1058	204
782	3300046492	Ga0495585_0000038	Ga0495585_0000038_7020_7721	204
783	3300046492	Ga0495585_0184822	Ga0495585_0184822_150_854	204
784	3300046507	Ga0495606_0029573	Ga0495606_0029573_956_1660	204
785	3300046507	Ga0495606_0038898	Ga0495606_0038898_467_1093	204
786	3300046518	Ga0495631_0017919	Ga0495631_0017919_2171_2875	204
787	3300046523	Ga0495644_0014065	Ga0495644_0014065_1988_2692	204
788	3300046525	Ga0495663_0006019	Ga0495663_0006019_2240_2944	204
789	3300046530	Ga0495654_0000011	Ga0495654_0000011_1546_2244	204
790	3300046542	Ga0495597_0001600	Ga0495597_0001600_3944_4648	204
791	3300046558	Ga0495633_0010466	Ga0495633_0010466_2853_3557	204
792	3300046558	Ga0495633_0118962	Ga0495633_0118962_367_1041	204
793	3300046615	Ga0495656_0041315	Ga0495656_0041315_545_1249	204
794	3300046648	Ga0495611_0010942	Ga0495611_0010942_2861_3565	204
795	3300046660	Ga0495625_0099484	Ga0495625_0099484_727_1359	204
796	3300046691	Ga0495670_0012910	Ga0495670_0012910_3022_3726	204
797	3300046794	Ga0495589_0069051	Ga0495589_0069051_626_1330	204
798	3300046810	Ga0495660_0099204	Ga0495660_0099204_675_1301	204
799	3300047320	Ga0495672_0000063	Ga0495672_0000063_104133_104759	204
800	3300047470	Ga0495681_0007588	Ga0495681_0007588_4947_5573	204
801	3300048903	Ga0496100_0111229	Ga0496100_0111229_682_1311	204
802	3300048906	Ga0496103_0002769	Ga0496103_0002769_2590_3216	204
803	3300048908	Ga0496105_0343656	Ga0496105_0343656_356_979	204
804	3300048913	Ga0496110_0331835	Ga0496110_0331835_581_1213	204
805	3300048919	Ga0496116_0019454	Ga0496116_0019454_3714_4346	204
806	3300048924	Ga0496121_0120724	Ga0496121_0120724_342_974	204
807	3300048925	Ga0496122_0000686	Ga0496122_0000686_65946_66578	204
808	3300048926	Ga0496123_0000646	Ga0496123_0000646_54117_54749	204
809	3300048928	Ga0496125_0026799	Ga0496125_0026799_607_1239	204
810	3300048928	Ga0496125_0052991	Ga0496125_0052991_2656_3288	204
811	3300049128	Ga0501308_001064	Ga0501308_001064_1383_2009	204
812	3300049161	Ga0501305_002080	Ga0501305_002080_1371_2009	204
813	3300049161	Ga0501305_004027	Ga0501305_004027_185_811	204
814	3300049532	Ga0501316_000924	Ga0501316_000924_51_689	204
815	3300049535	Ga0501319_002498	Ga0501319_002498_81_707	204
816	3300049575	Ga0501039_0191036	Ga0501039_0191036_570_1214	204
817	3300049578	Ga0501042_0101787	Ga0501042_0101787_368_991	204
818	3300049667	Ga0501230_002240	Ga0501230_002240_1025_1663	204
819	3300049679	Ga0501249_001607	Ga0501249_001607_2967_3593	204
820	3300049766	Ga0501269_000306	Ga0501269_000306_2823_3449	204
821	3300050493	nmdc:mga0k408_43_c1	nmdc:mga0k408_43_c1_34193_34828	204
822	3300053157	Ga0500624_017476	Ga0500624_017476_14_643	204
823	3300059477	Ga0587084_021739	Ga0587084_021739_156_782	204
824	3300059492	Ga0587073_0012054	Ga0587073_0012054_316_942	204
825	3300059503	Ga0587080_005796	Ga0587080_005796_245_871	204
826	3300059504	Ga0587082_002014	Ga0587082_002014_1594_2220	204
827	3300059507	Ga0587086_001844	Ga0587086_001844_84_710	204
828	3300059511	Ga0587091_056066	Ga0587091_056066_83_712	204
829	3300059647	Ga0587079_006612	Ga0587079_006612_806_1432	204
830	3300059647	Ga0587079_039453	Ga0587079_039453_289_915	204
831	3300060346	Ga0587111_0000191	Ga0587111_0000191_3994_4620	204
832	3300060346	Ga0587111_0031376	Ga0587111_0031376_429_1055	204
833	iso_pu_bacteria	2687453129	2687578643	204
834	3300003203	JGI25406J46586_10027783	JGI25406J46586_100277832	205
835	3300004799	Ga0058863_11903184	Ga0058863_119031842	205
836	3300005328	Ga0070676_10334221	Ga0070676_103342211	205
837	3300005330	Ga0070690_100471761	Ga0070690_1004717612	205
838	3300005331	Ga0070670_100245594	Ga0070670_1002455941	205
839	3300005334	Ga0068869_100030734	Ga0068869_1000307344	205
840	3300005334	Ga0068869_100083330	Ga0068869_1000833302	205
841	3300005334	Ga0068869_100160243	Ga0068869_1001602432	205
842	3300005334	Ga0068869_100802477	Ga0068869_1008024771	205
843	3300005335	Ga0070666_10001848	Ga0070666_1000184817	205
844	3300005335	Ga0070666_10286423	Ga0070666_102864232	205
845	3300005336	Ga0070680_100332498	Ga0070680_1003324981	205
846	3300005338	Ga0068868_100026276	Ga0068868_1000262766	205
847	3300005338	Ga0068868_100059908	Ga0068868_1000599082	205
848	3300005340	Ga0070689_100204212	Ga0070689_1002042122	205
849	3300005340	Ga0070689_100290780	Ga0070689_1002907802	205
850	3300005340	Ga0070689_100392548	Ga0070689_1003925482	205
851	3300005340	Ga0070689_100482203	Ga0070689_1004822031	205
852	3300005341	Ga0070691_10255279	Ga0070691_102552792	205
853	3300005341	Ga0070691_10272201	Ga0070691_102722012	205
854	3300005343	Ga0070687_100034420	Ga0070687_1000344202	205
855	3300005343	Ga0070687_100276833	Ga0070687_1002768331	205
856	3300005345	Ga0070692_10075428	Ga0070692_100754282	205
857	3300005347	Ga0070668_100014334	Ga0070668_1000143343	205
858	3300005347	Ga0070668_100520004	Ga0070668_1005200042	205
859	3300005347	Ga0070668_100662292	Ga0070668_1006622921	205
860	3300005353	Ga0070669_100002406	Ga0070669_1000024068	205
861	3300005353	Ga0070669_100370992	Ga0070669_1003709922	205
862	3300005354	Ga0070675_100155732	Ga0070675_1001557322	205
863	3300005354	Ga0070675_100673721	Ga0070675_1006737212	205
864	3300005355	Ga0070671_100003757	Ga0070671_10000375713	205
865	3300005356	Ga0070674_100145814	Ga0070674_1001458142	205
866	3300005356	Ga0070674_100489279	Ga0070674_1004892792	205
867	3300005364	Ga0070673_100004007	Ga0070673_10000400712	205
868	3300005364	Ga0070673_100258404	Ga0070673_1002584042	205
869	3300005364	Ga0070673_100383433	Ga0070673_1003834332	205
870	3300005364	Ga0070673_100799357	Ga0070673_1007993571	205
871	3300005365	Ga0070688_100029238	Ga0070688_1000292382	205
872	3300005366	Ga0070659_100234767	Ga0070659_1002347671	205
873	3300005366	Ga0070659_100973351	Ga0070659_1009733511	205
874	3300005367	Ga0070667_100144099	Ga0070667_1001440992	205
875	3300005367	Ga0070667_100170354	Ga0070667_1001703542	205
876	3300005434	Ga0070709_10137422	Ga0070709_101374222	205
877	3300005436	Ga0070713_100001357	Ga0070713_10000135721	205
878	3300005438	Ga0070701_10052016	Ga0070701_100520162	205
879	3300005439	Ga0070711_100000614	Ga0070711_10000061426	205
880	3300005440	Ga0070705_100006894	Ga0070705_1000068943	205
881	3300005440	Ga0070705_100090821	Ga0070705_1000908212	205
882	3300005440	Ga0070705_100164983	Ga0070705_1001649832	205
883	3300005441	Ga0070700_100001025	Ga0070700_10000102516	205
884	3300005441	Ga0070700_100537006	Ga0070700_1005370061	205
885	3300005441	Ga0070700_100626033	Ga0070700_1006260331	205
886	3300005444	Ga0070694_100218178	Ga0070694_1002181782	205
887	3300005456	Ga0070678_100000304	Ga0070678_1000003044	205
888	3300005456	Ga0070678_100150545	Ga0070678_1001505452	205
889	3300005457	Ga0070662_100361870	Ga0070662_1003618702	205
890	3300005458	Ga0070681_10001964	Ga0070681_1000196418	205
891	3300005458	Ga0070681_10008051	Ga0070681_100080517	205
892	3300005459	Ga0068867_100001530	Ga0068867_1000015307	205
893	3300005459	Ga0068867_100153310	Ga0068867_1001533102	205
894	3300005459	Ga0068867_100263914	Ga0068867_1002639141	205
895	3300005466	Ga0070685_10000794	Ga0070685_1000079421	205
896	3300005466	Ga0070685_10130431	Ga0070685_101304312	205
897	3300005467	Ga0070706_100067356	Ga0070706_1000673563	205
898	3300005468	Ga0070707_100387861	Ga0070707_1003878612	205
899	3300005468	Ga0070707_100858666	Ga0070707_1008586662	205
900	3300005518	Ga0070699_100018494	Ga0070699_1000184945	205
901	3300005518	Ga0070699_100021494	Ga0070699_1000214942	205
902	3300005518	Ga0070699_100094317	Ga0070699_1000943173	205
903	3300005536	Ga0070697_100009368	Ga0070697_1000093685	205
904	3300005536	Ga0070697_100112410	Ga0070697_1001124102	205
905	3300005536	Ga0070697_100221993	Ga0070697_1002219932	205
906	3300005539	Ga0068853_100177042	Ga0068853_1001770422	205
907	3300005539	Ga0068853_100327164	Ga0068853_1003271642	205
908	3300005539	Ga0068853_100344777	Ga0068853_1003447772	205
909	3300005539	Ga0068853_100373887	Ga0068853_1003738871	205
910	3300005543	Ga0070672_100365167	Ga0070672_1003651671	205
911	3300005543	Ga0070672_100613774	Ga0070672_1006137741	205
912	3300005544	Ga0070686_100119322	Ga0070686_1001193222	205
913	3300005544	Ga0070686_100169840	Ga0070686_1001698402	205
914	3300005544	Ga0070686_100332766	Ga0070686_1003327662	205
915	3300005546	Ga0070696_100013419	Ga0070696_1000134192	205
916	3300005546	Ga0070696_100443978	Ga0070696_1004439782	205
917	3300005547	Ga0070693_100000346	Ga0070693_10000034626	205
918	3300005547	Ga0070693_100118251	Ga0070693_1001182512	205
919	3300005548	Ga0070665_100031699	Ga0070665_1000316997	205
920	3300005549	Ga0070704_100017614	Ga0070704_1000176142	205
921	3300005549	Ga0070704_100026289	Ga0070704_1000262892	205
922	3300005549	Ga0070704_100165380	Ga0070704_1001653802	205
923	3300005564	Ga0070664_100034946	Ga0070664_1000349462	205
924	3300005564	Ga0070664_100549439	Ga0070664_1005494392	205
925	3300005577	Ga0068857_100182199	Ga0068857_1001821992	205
926	3300005577	Ga0068857_100680343	Ga0068857_1006803432	205
927	3300005578	Ga0068854_100036517	Ga0068854_1000365172	205
928	3300005578	Ga0068854_100042796	Ga0068854_1000427963	205
929	3300005578	Ga0068854_100230468	Ga0068854_1002304682	205
930	3300005578	Ga0068854_100590690	Ga0068854_1005906902	205
931	3300005614	Ga0068856_100242288	Ga0068856_1002422882	205
932	3300005614	Ga0068856_100303876	Ga0068856_1003038762	205
933	3300005615	Ga0070702_100017523	Ga0070702_1000175233	205
934	3300005615	Ga0070702_100031902	Ga0070702_1000319024	205
935	3300005616	Ga0068852_100335833	Ga0068852_1003358332	205
936	3300005617	Ga0068859_100023812	Ga0068859_1000238126	205
937	3300005617	Ga0068859_100122416	Ga0068859_1001224162	205
938	3300005617	Ga0068859_100332816	Ga0068859_1003328162	205
939	3300005617	Ga0068859_100378253	Ga0068859_1003782532	205
940	3300005618	Ga0068864_100006968	Ga0068864_10000696812	205
941	3300005618	Ga0068864_100222496	Ga0068864_1002224962	205
942	3300005718	Ga0068866_10003595	Ga0068866_100035956	205
943	3300005718	Ga0068866_10114678	Ga0068866_101146782	205
944	3300005719	Ga0068861_100075684	Ga0068861_1000756842	205
945	3300005719	Ga0068861_100146024	Ga0068861_1001460242	205
946	3300005840	Ga0068870_10136449	Ga0068870_101364492	205
947	3300005840	Ga0068870_10257566	Ga0068870_102575662	205
948	3300005841	Ga0068863_100005831	Ga0068863_1000058313	205
949	3300005841	Ga0068863_100026468	Ga0068863_1000264686	205
950	3300005842	Ga0068858_100009828	Ga0068858_1000098289	205
951	3300005842	Ga0068858_100402757	Ga0068858_1004027572	205
952	3300005842	Ga0068858_100663047	Ga0068858_1006630471	205
953	3300005843	Ga0068860_100102195	Ga0068860_1001021952	205
954	3300005843	Ga0068860_100120088	Ga0068860_1001200882	205
955	3300005844	Ga0068862_100251814	Ga0068862_1002518142	205
956	3300005844	Ga0068862_100351066	Ga0068862_1003510662	205
957	3300005844	Ga0068862_100714966	Ga0068862_1007149662	205
958	3300005844	Ga0068862_100974131	Ga0068862_1009741312	205
959	3300005844	Ga0068862_101176494	Ga0068862_1011764941	205
960	3300005985	Ga0081539_10000496	Ga0081539_1000049657	205
961	3300006028	Ga0070717_10559670	Ga0070717_105596702	205
962	3300006051	Ga0075364_10215776	Ga0075364_102157762	205
963	3300006058	Ga0075432_10121179	Ga0075432_101211792	205
964	3300006163	Ga0070715_10008876	Ga0070715_100088762	205
965	3300006163	Ga0070715_10071545	Ga0070715_100715452	205
966	3300006173	Ga0070716_100168934	Ga0070716_1001689342	205
967	3300006175	Ga0070712_100000999	Ga0070712_10000099921	205
968	3300006175	Ga0070712_100453517	Ga0070712_1004535172	205
969	3300006177	Ga0075362_10005300	Ga0075362_100053003	205
970	3300006177	Ga0075362_10116295	Ga0075362_101162952	205
971	3300006195	Ga0075366_10329657	Ga0075366_103296571	205
972	3300006237	Ga0097621_100009617	Ga0097621_1000096178	205
973	3300006237	Ga0097621_100078824	Ga0097621_1000788242	205
974	3300006353	Ga0075370_10017029	Ga0075370_100170293	205
975	3300006358	Ga0068871_100009286	Ga0068871_1000092864	205
976	3300006358	Ga0068871_100054099	Ga0068871_1000540994	205
977	3300006844	Ga0075428_100057314	Ga0075428_1000573143	205
978	3300006844	Ga0075428_100197695	Ga0075428_1001976952	205
979	3300006844	Ga0075428_101041446	Ga0075428_1010414462	205
980	3300006846	Ga0075430_100003425	Ga0075430_10000342517	205
981	3300006846	Ga0075430_100061149	Ga0075430_1000611492	205
982	3300006846	Ga0075430_100105842	Ga0075430_1001058422	205
983	3300006847	Ga0075431_100037115	Ga0075431_1000371153	205
984	3300006852	Ga0075433_10278601	Ga0075433_102786012	205
985	3300006880	Ga0075429_100176884	Ga0075429_1001768842	205
986	3300006880	Ga0075429_100471744	Ga0075429_1004717442	205
987	3300006880	Ga0075429_100569478	Ga0075429_1005694782	205
988	3300006881	Ga0068865_100233301	Ga0068865_1002333011	205
989	3300006914	Ga0075436_100020065	Ga0075436_1000200656	205
990	3300006931	Ga0097620_100023811	Ga0097620_1000238112	205
991	3300006931	Ga0097620_100122422	Ga0097620_1001224222	205
992	3300006931	Ga0097620_100332821	Ga0097620_1003328212	205
993	3300006931	Ga0097620_100378240	Ga0097620_1003782402	205
994	3300007076	Ga0075435_100538222	Ga0075435_1005382222	205
995	3300009093	Ga0105240_10487292	Ga0105240_104872922	205
996	3300009094	Ga0111539_10127301	Ga0111539_101273014	205
997	3300009094	Ga0111539_10164443	Ga0111539_101644432	205
998	3300009094	Ga0111539_10278981	Ga0111539_102789811	205
999	3300009094	Ga0111539_10641150	Ga0111539_106411501	205
1000	3300009098	Ga0105245_10017906	Ga0105245_100179068	205
1001	3300009098	Ga0105245_10017913	Ga0105245_100179132	205
1002	3300009098	Ga0105245_10110655	Ga0105245_101106552	205
1003	3300009098	Ga0105245_10522408	Ga0105245_105224082	205
1004	3300009098	Ga0105245_11231053	Ga0105245_112310531	205
1005	3300009101	Ga0105247_10070752	Ga0105247_100707522	205
1006	3300009148	Ga0105243_10204891	Ga0105243_102048912	205
1007	3300009148	Ga0105243_10220258	Ga0105243_102202582	205
1008	3300009174	Ga0105241_10089342	Ga0105241_100893422	205
1009	3300009176	Ga0105242_10013473	Ga0105242_100134737	205
1010	3300009176	Ga0105242_10100102	Ga0105242_101001022	205
1011	3300009177	Ga0105248_10008716	Ga0105248_100087169	205
1012	3300009177	Ga0105248_10158633	Ga0105248_101586332	205
1013	3300009177	Ga0105248_10185132	Ga0105248_101851322	205
1014	3300009177	Ga0105248_10615989	Ga0105248_106159892	205
1015	3300009545	Ga0105237_10045617	Ga0105237_100456172	205
1016	3300009545	Ga0105237_10083264	Ga0105237_100832642	205
1017	3300009545	Ga0105237_10357317	Ga0105237_103573172	205
1018	3300009553	Ga0105249_10216694	Ga0105249_102166943	205
1019	3300009553	Ga0105249_10524406	Ga0105249_105244062	205
1020	3300010375	Ga0105239_10226581	Ga0105239_102265812	205
1021	3300010375	Ga0105239_10250577	Ga0105239_102505771	205
1022	3300011119	Ga0105246_10137864	Ga0105246_101378642	205
1023	3300013296	Ga0157374_10056204	Ga0157374_100562043	205
1024	3300013296	Ga0157374_10106392	Ga0157374_101063923	205
1025	3300013296	Ga0157374_10286429	Ga0157374_102864291	205
1026	3300013297	Ga0157378_10076604	Ga0157378_100766042	205
1027	3300013297	Ga0157378_10146733	Ga0157378_101467332	205
1028	3300013297	Ga0157378_10382540	Ga0157378_103825402	205
1029	3300013297	Ga0157378_10786858	Ga0157378_107868581	205
1030	3300013306	Ga0163162_10037561	Ga0163162_100375616	205
1031	3300013306	Ga0163162_10198812	Ga0163162_101988122	205
1032	3300013306	Ga0163162_10267807	Ga0163162_102678072	205
1033	3300013306	Ga0163162_10302655	Ga0163162_103026552	205
1034	3300013306	Ga0163162_10704802	Ga0163162_107048021	205
1035	3300013308	Ga0157375_10011398	Ga0157375_100113988	205
1036	3300013308	Ga0157375_10069520	Ga0157375_100695202	205
1037	3300013308	Ga0157375_10072089	Ga0157375_100720892	205
1038	3300013308	Ga0157375_10075828	Ga0157375_100758283	205
1039	3300013308	Ga0157375_10684665	Ga0157375_106846652	205
1040	3300014325	Ga0163163_10063216	Ga0163163_100632162	205
1041	3300014326	Ga0157380_10094964	Ga0157380_100949642	205
1042	3300014326	Ga0157380_10618058	Ga0157380_106180581	205
1043	3300014745	Ga0157377_10062558	Ga0157377_100625582	205
1044	3300014968	Ga0157379_10136889	Ga0157379_101368892	205
1045	3300014968	Ga0157379_10809052	Ga0157379_108090521	205
1046	3300014969	Ga0157376_10013233	Ga0157376_100132335	205
1047	3300014969	Ga0157376_10708219	Ga0157376_107082192	205
1048	3300017792	Ga0163161_10065851	Ga0163161_100658512	205
1049	3300025899	Ga0207642_10025415	Ga0207642_100254152	205
1050	3300025899	Ga0207642_10061003	Ga0207642_100610031	205
1051	3300025903	Ga0207680_10713644	Ga0207680_107136441	205
1052	3300025905	Ga0207685_10074184	Ga0207685_100741842	205
1053	3300025907	Ga0207645_10311797	Ga0207645_103117971	205
1054	3300025908	Ga0207643_10022253	Ga0207643_100222533	205
1055	3300025911	Ga0207654_10331446	Ga0207654_103314461	205
1056	3300025912	Ga0207707_10009284	Ga0207707_100092844	205
1057	3300025912	Ga0207707_10010896	Ga0207707_100108963	205
1058	3300025915	Ga0207693_10594881	Ga0207693_105948811	205
1059	3300025917	Ga0207660_10279610	Ga0207660_102796102	205
1060	3300025918	Ga0207662_10022891	Ga0207662_100228914	205
1061	3300025918	Ga0207662_10056729	Ga0207662_100567292	205
1062	3300025922	Ga0207646_10657121	Ga0207646_106571211	205
1063	3300025925	Ga0207650_10624089	Ga0207650_106240892	205
1064	3300025926	Ga0207659_10141942	Ga0207659_101419422	205
1065	3300025926	Ga0207659_10162635	Ga0207659_101626352	205
1066	3300025926	Ga0207659_10284141	Ga0207659_102841412	205
1067	3300025932	Ga0207690_10602612	Ga0207690_106026121	205
1068	3300025933	Ga0207706_10214509	Ga0207706_102145092	205
1069	3300025934	Ga0207686_10204180	Ga0207686_102041802	205
1070	3300025934	Ga0207686_10217255	Ga0207686_102172552	205
1071	3300025935	Ga0207709_10028471	Ga0207709_100284715	205
1072	3300025935	Ga0207709_10401639	Ga0207709_104016392	205
1073	3300025936	Ga0207670_10152192	Ga0207670_101521922	205
1074	3300025936	Ga0207670_10373633	Ga0207670_103736332	205
1075	3300025937	Ga0207669_10015097	Ga0207669_100150973	205
1076	3300025937	Ga0207669_10101801	Ga0207669_101018012	205
1077	3300025938	Ga0207704_10034573	Ga0207704_100345733	205
1078	3300025938	Ga0207704_10134482	Ga0207704_101344821	205
1079	3300025941	Ga0207711_10045696	Ga0207711_100456962	205
1080	3300025942	Ga0207689_10007770	Ga0207689_100077704	205
1081	3300025942	Ga0207689_10158247	Ga0207689_101582472	205
1082	3300025942	Ga0207689_10262572	Ga0207689_102625722	205
1083	3300025942	Ga0207689_10366315	Ga0207689_103663152	205
1084	3300025942	Ga0207689_10649125	Ga0207689_106491251	205
1085	3300025960	Ga0207651_10028920	Ga0207651_100289203	205
1086	3300025961	Ga0207712_10250394	Ga0207712_102503942	205
1087	3300025961	Ga0207712_10604070	Ga0207712_106040702	205
1088	3300025972	Ga0207668_10007330	Ga0207668_100073307	205
1089	3300025972	Ga0207668_10172472	Ga0207668_101724722	205
1090	3300025972	Ga0207668_10608956	Ga0207668_106089562	205
1091	3300025981	Ga0207640_10260025	Ga0207640_102600252	205
1092	3300025986	Ga0207658_10021998	Ga0207658_100219983	205
1093	3300026023	Ga0207677_10017006	Ga0207677_100170065	205
1094	3300026023	Ga0207677_10072358	Ga0207677_100723582	205
1095	3300026035	Ga0207703_10314123	Ga0207703_103141232	205
1096	3300026035	Ga0207703_10714343	Ga0207703_107143432	205
1097	3300026035	Ga0207703_11119368	Ga0207703_111193681	205
1098	3300026075	Ga0207708_10027615	Ga0207708_100276153	205
1099	3300026075	Ga0207708_10331553	Ga0207708_103315532	205
1100	3300026088	Ga0207641_10506501	Ga0207641_105065012	205
1101	3300026089	Ga0207648_10068261	Ga0207648_100682612	205
1102	3300026089	Ga0207648_10074053	Ga0207648_100740533	205
1103	3300026089	Ga0207648_10249018	Ga0207648_102490181	205
1104	3300026095	Ga0207676_10182579	Ga0207676_101825792	205
1105	3300026116	Ga0207674_10006165	Ga0207674_100061653	205
1106	3300026116	Ga0207674_10125546	Ga0207674_101255463	205
1107	3300026116	Ga0207674_10277623	Ga0207674_102776232	205
1108	3300026116	Ga0207674_10278464	Ga0207674_102784642	205
1109	3300026118	Ga0207675_100067433	Ga0207675_1000674333	205
1110	3300026118	Ga0207675_100109641	Ga0207675_1001096413	205
1111	3300026118	Ga0207675_100156359	Ga0207675_1001563592	205
1112	3300026121	Ga0207683_10099676	Ga0207683_100996762	205
1113	3300026121	Ga0207683_10131984	Ga0207683_101319842	205
1114	3300027364	Ga0209967_1034100	Ga0209967_10341001	205
1115	3300027395	Ga0209996_1003581	Ga0209996_10035812	205
1116	3300027682	Ga0209971_1003818	Ga0209971_10038182	205
1117	3300027866	Ga0209813_10007696	Ga0209813_100076962	205
1118	3300027876	Ga0209974_10043854	Ga0209974_100438542	205
1119	3300027907	Ga0207428_10113890	Ga0207428_101138903	205
1120	3300027907	Ga0207428_10360078	Ga0207428_103600781	205
1121	3300027907	Ga0207428_10365023	Ga0207428_103650232	205
1122	3300028380	Ga0268265_10001851	Ga0268265_1000185110	205
1123	3300028380	Ga0268265_10050614	Ga0268265_100506142	205
1124	3300028380	Ga0268265_10430225	Ga0268265_104302251	205
1125	3300028380	Ga0268265_10910834	Ga0268265_109108341	205
1126	3300028381	Ga0268264_10283146	Ga0268264_102831462	205
1127	3300031665	Ga0316575_10006294	Ga0316575_100062943	205
1128	3300031691	Ga0316579_10011358	Ga0316579_100113585	205
1129	3300031728	Ga0316578_10090077	Ga0316578_100900772	205
1130	3300031728	Ga0316578_10096747	Ga0316578_100967472	205
1131	3300031733	Ga0316577_10112457	Ga0316577_101124572	205
1132	3300032002	Ga0307416_100629122	Ga0307416_1006291222	205
1133	3300032002	Ga0307416_100756801	Ga0307416_1007568012	205
1134	3300032133	Ga0316583_10002917	Ga0316583_100029172	205
1135	3300032133	Ga0316583_10005006	Ga0316583_100050062	205
1136	3300033524	Ga0316592_1003206	Ga0316592_10032064	205
1137	3300033524	Ga0316592_1033847	Ga0316592_10338472	205
1138	3300033527	Ga0316586_1000120	Ga0316586_10001207	205
1139	3300033541	Ga0316596_1067367	Ga0316596_10673672	205
1140	3300035083	Ga0373926_0135345	Ga0373926_0135345_242_913	205
1141	3300035086	Ga0373934_0000201	Ga0373934_0000201_11407_12078	205
1142	3300035111	Ga0373923_0057104	Ga0373923_0057104_339_1010	205
1143	3300035111	Ga0373923_0098628	Ga0373923_0098628_77_748	205
1144	3300035113	Ga0373936_0050099	Ga0373936_0050099_466_1137	205
1145	3300035116	Ga0373945_0142497	Ga0373945_0142497_237_881	205
1146	3300035117	Ga0373953_0008404	Ga0373953_0008404_1839_2510	205
1147	3300035117	Ga0373953_0038144	Ga0373953_0038144_223_849	205
1148	3300035118	Ga0373954_0000179	Ga0373954_0000179_21834_22460	205
1149	3300035118	Ga0373954_0001301	Ga0373954_0001301_3875_4546	205
1150	3300035118	Ga0373954_0029702	Ga0373954_0029702_1372_2043	205
1151	3300035118	Ga0373954_0105827	Ga0373954_0105827_79_750	205
1152	3300035118	Ga0373954_0288617	Ga0373954_0288617_118_765	205
1153	3300035119	Ga0373956_0000736	Ga0373956_0000736_10922_11593	205
1154	3300035119	Ga0373956_0011222	Ga0373956_0011222_1179_1850	205
1155	3300035120	Ga0373957_0016608	Ga0373957_0016608_920_1591	205
1156	3300035172	Ga0373955_0036793	Ga0373955_0036793_1539_2210	205
1157	3300035172	Ga0373955_0042329	Ga0373955_0042329_711_1382	205
1158	3300035172	Ga0373955_0183284	Ga0373955_0183284_427_1053	205
1159	3300035172	Ga0373955_0202842	Ga0373955_0202842_303_974	205
1160	3300035172	Ga0373955_0304326	Ga0373955_0304326_118_744	205
1161	3300035207	Ga0373942_0024868	Ga0373942_0024868_130_780	205
1162	3300035241	Ga0373961_0106616	Ga0373961_0106616_23_673	205
1163	3300035398	Ga0316574_0017292	Ga0316574_0017292_2509_3150	205
1164	3300035410	Ga0373924_0014197	Ga0373924_0014197_1179_1850	205
1165	3300035410	Ga0373924_0030738	Ga0373924_0030738_226_852	205
1166	3300035691	Ga0373931_0008399	Ga0373931_0008399_3262_3912	205
1167	3300035692	Ga0373935_0170222	Ga0373935_0170222_466_1137	205
1168	3300035695	Ga0373927_0027420	Ga0373927_0027420_2703_3347	205
1169	3300035724	Ga0373933_0000456	Ga0373933_0000456_4611_5282	205
1170	3300035724	Ga0373933_0008068	Ga0373933_0008068_5059_5685	205
1171	3300035724	Ga0373933_0226044	Ga0373933_0226044_156_782	205
1172	3300036401	Ga0373937_0000280	Ga0373937_0000280_27400_28026	205
1173	3300036401	Ga0373937_0002577	Ga0373937_0002577_1947_2573	205
1174	3300036401	Ga0373937_0036109	Ga0373937_0036109_2622_3293	205
1175	3300036401	Ga0373937_0225187	Ga0373937_0225187_339_1010	205
1176	3300036401	Ga0373937_0268215	Ga0373937_0268215_570_1217	205
1177	3300036401	Ga0373937_0384547	Ga0373937_0384547_88_720	205
1178	3300036647	Ga0316582_0045292	Ga0316582_0045292_444_1070	205
1179	3300036712	Ga0316584_0064178	Ga0316584_0064178_587_1228	205
1180	3300036712	Ga0316584_0537629	Ga0316584_0537629_155_802	205
1181	3300037068	Ga0373925_0012603	Ga0373925_0012603_2130_2774	205
1182	3300037068	Ga0373925_0062848	Ga0373925_0062848_117_788	205
1183	3300037068	Ga0373925_0366050	Ga0373925_0366050_465_1097	205
1184	3300038726	Ga0400490_38570	Ga0400490_38570_15885_16523	205
1185	3300038741	Ga0400488_19357	Ga0400488_19357_1223_1861	205
1186	3300039062	Ga0400483_208742	Ga0400483_208742_4954_5592	205
1187	3300039110	Ga0400487_48030	Ga0400487_48030_181_819	205
1188	3300039110	Ga0400487_48074	Ga0400487_48074_948_1586	205
1189	3300039110	Ga0400487_52219	Ga0400487_52219_18287_18925	205
1190	3300042001	Ga0439441_002873	Ga0439441_002873_1284_1910	205
1191	3300042003	Ga0439443_023837	Ga0439443_023837_287_913	205
1192	3300042435	Ga0439434_0072638	Ga0439434_0072638_101_748	205
1193	3300042436	Ga0439435_0003308	Ga0439435_0003308_1724_2350	205
1194	3300042437	Ga0439444_0012260	Ga0439444_0012260_187_813	205
1195	3300042461	Ga0439460_0008554	Ga0439460_0008554_755_1381	205
1196	3300042876	Ga0451577_0000891	Ga0451577_0000891_20782_21435	205
1197	3300044712	Ga0453684_0000005	Ga0453684_0000005_348683_349336	205
1198	3300044712	Ga0453684_0000356	Ga0453684_0000356_184720_185376	205
1199	3300045051	Ga0451576_0708170	Ga0451576_0708170_276_902	205
1200	3300045976	Ga0466967_0015452	Ga0466967_0015452_4964_5590	205
1201	3300046454	Ga0495592_0041470	Ga0495592_0041470_1484_2155	205
1202	3300046461	Ga0495641_0026927	Ga0495641_0026927_522_1193	205
1203	3300046462	Ga0495651_0029416	Ga0495651_0029416_124_795	205
1204	3300046462	Ga0495651_0120479	Ga0495651_0120479_1156_1827	205
1205	3300046463	Ga0495653_0020745	Ga0495653_0020745_4262_4933	205
1206	3300046475	Ga0495639_0002217	Ga0495639_0002217_5855_6526	205
1207	3300046476	Ga0495662_0017921	Ga0495662_0017921_2479_3150	205
1208	3300046499	Ga0495594_0107249	Ga0495594_0107249_466_1137	205
1209	3300046516	Ga0495628_0014049	Ga0495628_0014049_697_1368	205
1210	3300046516	Ga0495628_0119124	Ga0495628_0119124_358_1029	205
1211	3300046517	Ga0495630_0001852	Ga0495630_0001852_6594_7265	205
1212	3300046517	Ga0495630_0138711	Ga0495630_0138711_1124_1750	205
1213	3300046526	Ga0495666_0024538	Ga0495666_0024538_552_1223	205
1214	3300046529	Ga0495652_0014578	Ga0495652_0014578_3767_4438	205
1215	3300046529	Ga0495652_0085919	Ga0495652_0085919_646_1317	205
1216	3300046533	Ga0495640_0022953	Ga0495640_0022953_3110_3781	205
1217	3300046535	Ga0495586_0003301	Ga0495586_0003301_3762_4433	205
1218	3300046543	Ga0495645_0000794	Ga0495645_0000794_17081_17752	205
1219	3300046559	Ga0495667_0111196	Ga0495667_0111196_821_1447	205
1220	3300046559	Ga0495667_0119482	Ga0495667_0119482_774_1445	205
1221	3300046642	Ga0495634_0009045	Ga0495634_0009045_996_1667	205
1222	3300046663	Ga0495635_0277422	Ga0495635_0277422_480_1106	205
1223	3300046675	Ga0495657_0029556	Ga0495657_0029556_3078_3749	205
1224	3300046675	Ga0495657_0094603	Ga0495657_0094603_387_1013	205
1225	3300046678	Ga0495599_0022290	Ga0495599_0022290_342_1013	205
1226	3300046683	Ga0495658_0040497	Ga0495658_0040497_1755_2426	205
1227	3300046683	Ga0495658_0284257	Ga0495658_0284257_155_781	205
1228	3300046684	Ga0495669_0026182	Ga0495669_0026182_13_639	205
1229	3300046690	Ga0495624_0107278	Ga0495624_0107278_148_771	205
1230	3300046809	Ga0495600_0002683	Ga0495600_0002683_1824_2495	205
1231	3300047317	Ga0495604_0057180	Ga0495604_0057180_1206_1877	205
1232	3300047322	Ga0495680_0088670	Ga0495680_0088670_1545_2216	205
1233	3300047322	Ga0495680_0095793	Ga0495680_0095793_1267_1893	205
1234	3300047322	Ga0495680_0116877	Ga0495680_0116877_646_1317	205
1235	3300047444	Ga0495675_0101671	Ga0495675_0101671_292_963	205
1236	3300047444	Ga0495675_0220165	Ga0495675_0220165_398_1024	205
1237	3300048918	Ga0496115_0430751	Ga0496115_0430751_147_773	205
1238	3300049521	Ga0501298_040795	Ga0501298_040795_272_898	205
1239	3300049571	Ga0501034_0084371	Ga0501034_0084371_2137_2781	205
1240	3300049573	Ga0501037_0365050	Ga0501037_0365050_296_940	205
1241	3300049576	Ga0501040_0411789	Ga0501040_0411789_166_792	205
1242	3300049576	Ga0501040_0807691	Ga0501040_0807691_15_641	205
1243	3300049584	Ga0501068_0038292	Ga0501068_0038292_478_1122	205
1244	3300049584	Ga0501068_0235053	Ga0501068_0235053_72_698	205
1245	3300049584	Ga0501068_0338573	Ga0501068_0338573_247_873	205
1246	3300049586	Ga0501070_0103422	Ga0501070_0103422_1638_2261	205
1247	3300049587	Ga0501071_0635254	Ga0501071_0635254_156_782	205
1248	3300049588	Ga0501072_0089681	Ga0501072_0089681_367_993	205
1249	3300049589	Ga0501073_0004419	Ga0501073_0004419_621_1265	205
1250	3300049590	Ga0501074_0464716	Ga0501074_0464716_113_757	205
1251	3300049741	Ga0501079_0162422	Ga0501079_0162422_409_1035	205
1252	3300049741	Ga0501079_0189290	Ga0501079_0189290_518_1168	205
1253	3300049742	Ga0501080_0014968	Ga0501080_0014968_189_833	205
1254	3300049743	Ga0501081_0080886	Ga0501081_0080886_147_773	205
1255	3300049824	Ga0501045_0083710	Ga0501045_0083710_1581_2207	205
1256	3300050489	nmdc:mga03683_135334_c1	nmdc:mga03683_135334_c1_62_727	205
1257	3300050491	nmdc:mga00v17_31358_c1	nmdc:mga00v17_31358_c1_820_1491	205
1258	3300050493	nmdc:mga0k408_233619_c1	nmdc:mga0k408_233619_c1_253_912	205
1259	3300050495	nmdc:mga04h51_48407_c1	nmdc:mga04h51_48407_c1_583_1254	205
1260	3300050496	nmdc:mga07m45_35620_c1	nmdc:mga07m45_35620_c1_1100_1771	205
1261	3300050508	nmdc:mga09592_283426_c1	nmdc:mga09592_283426_c1_251_877	205
1262	3300050508	nmdc:mga09592_299779_c1	nmdc:mga09592_299779_c1_541_1167	205
1263	3300050509	nmdc:mga0qj67_19454_c1	nmdc:mga0qj67_19454_c1_455_1084	205
1264	3300050509	nmdc:mga0qj67_369_c1	nmdc:mga0qj67_369_c1_322_948	205
1265	3300050510	nmdc:mga06r32_44695_c1	nmdc:mga06r32_44695_c1_1181_1828	205
1266	3300050511	nmdc:mga08y16_1119462_c1	nmdc:mga08y16_1119462_c1_33_659	205
1267	3300050511	nmdc:mga08y16_273337_c1	nmdc:mga08y16_273337_c1_964_1590	205
1268	3300050511	nmdc:mga08y16_565655_c1	nmdc:mga08y16_565655_c1_165_791	205
1269	3300050511	nmdc:mga08y16_825812_c1	nmdc:mga08y16_825812_c1_159_791	205
1270	3300050512	nmdc:mga0n895_333628_c1	nmdc:mga0n895_333628_c1_558_1229	205
1271	3300050514	nmdc:mga08x19_1441_c1	nmdc:mga08x19_1441_c1_646_1269	205
1272	3300050515	nmdc:mga0a205_437716_c1	nmdc:mga0a205_437716_c1_38_691	205
1273	3300053077	Ga0495601_0153191	Ga0495601_0153191_475_1146	205
1274	3300053084	Ga0495595_0008929	Ga0495595_0008929_950_1621	205
1275	3300053085	Ga0495619_0003332	Ga0495619_0003332_3369_4040	205
1276	3300053088	Ga0500644_0228437	Ga0500644_0228437_54_719	205
1277	3300053090	Ga0500646_0000927	Ga0500646_0000927_2515_3180	205
1278	3300053092	Ga0500583_0047875	Ga0500583_0047875_77_742	205
1279	3300053094	Ga0500566_0146697	Ga0500566_0146697_356_1027	205
1280	3300053118	Ga0500594_0005566	Ga0500594_0005566_1746_2417	205
1281	3300053130	Ga0500642_0077153	Ga0500642_0077153_355_1020	205
1282	3300053139	Ga0500568_0015620	Ga0500568_0015620_2133_2798	205
1283	3300053151	Ga0500604_0000594	Ga0500604_0000594_7247_7912	205
1284	3300059421	Ga0590071_007191	Ga0590071_007191_416_1042	205
1285	3300059421	Ga0590071_046541	Ga0590071_046541_103_729	205
1286	iso_pu_bacteria	8055225921	8055228249	205
1287	3300004799	Ga0058863_10547931	Ga0058863_105479311	206
1288	3300005289	Ga0065704_10175009	Ga0065704_101750092	206
1289	3300005328	Ga0070676_10002162	Ga0070676_1000216214	206
1290	3300005328	Ga0070676_10173239	Ga0070676_101732392	206
1291	3300005331	Ga0070670_100000001	Ga0070670_100000001520	206
1292	3300005331	Ga0070670_100390130	Ga0070670_1003901302	206
1293	3300005335	Ga0070666_10001838	Ga0070666_100018383	206
1294	3300005338	Ga0068868_100043463	Ga0068868_1000434632	206
1295	3300005339	Ga0070660_100537715	Ga0070660_1005377152	206
1296	3300005340	Ga0070689_100113945	Ga0070689_1001139452	206
1297	3300005347	Ga0070668_100092564	Ga0070668_1000925642	206
1298	3300005347	Ga0070668_100238173	Ga0070668_1002381732	206
1299	3300005347	Ga0070668_100268466	Ga0070668_1002684662	206
1300	3300005353	Ga0070669_100004477	Ga0070669_1000044774	206
1301	3300005353	Ga0070669_100015401	Ga0070669_1000154016	206
1302	3300005353	Ga0070669_100180588	Ga0070669_1001805882	206
1303	3300005354	Ga0070675_100012856	Ga0070675_1000128566	206
1304	3300005354	Ga0070675_100090708	Ga0070675_1000907081	206
1305	3300005355	Ga0070671_100000018	Ga0070671_100000018116	206
1306	3300005355	Ga0070671_100051649	Ga0070671_1000516492	206
1307	3300005356	Ga0070674_100021687	Ga0070674_1000216875	206
1308	3300005364	Ga0070673_100031354	Ga0070673_1000313542	206
1309	3300005366	Ga0070659_100518452	Ga0070659_1005184522	206
1310	3300005367	Ga0070667_100000026	Ga0070667_10000002694	206
1311	3300005367	Ga0070667_100018332	Ga0070667_1000183322	206
1312	3300005367	Ga0070667_100393849	Ga0070667_1003938491	206
1313	3300005434	Ga0070709_10390213	Ga0070709_103902132	206
1314	3300005439	Ga0070711_100736503	Ga0070711_1007365032	206
1315	3300005455	Ga0070663_100088355	Ga0070663_1000883552	206
1316	3300005456	Ga0070678_100001502	Ga0070678_10000150211	206
1317	3300005457	Ga0070662_100440770	Ga0070662_1004407701	206
1318	3300005457	Ga0070662_100467042	Ga0070662_1004670422	206
1319	3300005457	Ga0070662_100507079	Ga0070662_1005070792	206
1320	3300005459	Ga0068867_100004199	Ga0068867_1000041994	206
1321	3300005466	Ga0070685_10000007	Ga0070685_10000007131	206
1322	3300005530	Ga0070679_100234313	Ga0070679_1002343132	206
1323	3300005539	Ga0068853_100187375	Ga0068853_1001873752	206
1324	3300005543	Ga0070672_100002511	Ga0070672_1000025117	206
1325	3300005543	Ga0070672_100096188	Ga0070672_1000961882	206
1326	3300005548	Ga0070665_100018625	Ga0070665_1000186252	206
1327	3300005548	Ga0070665_100060972	Ga0070665_1000609722	206
1328	3300005548	Ga0070665_100306058	Ga0070665_1003060582	206
1329	3300005578	Ga0068854_100281601	Ga0068854_1002816012	206
1330	3300005614	Ga0068856_100042923	Ga0068856_1000429232	206
1331	3300005617	Ga0068859_100009093	Ga0068859_1000090936	206
1332	3300005617	Ga0068859_100181508	Ga0068859_1001815082	206
1333	3300005618	Ga0068864_100000012	Ga0068864_100000012162	206
1334	3300005618	Ga0068864_100055647	Ga0068864_1000556472	206
1335	3300005719	Ga0068861_100044557	Ga0068861_1000445572	206
1336	3300005841	Ga0068863_100015418	Ga0068863_1000154186	206
1337	3300005842	Ga0068858_100055498	Ga0068858_1000554983	206
1338	3300005842	Ga0068858_100798388	Ga0068858_1007983882	206
1339	3300005843	Ga0068860_100000307	Ga0068860_10000030711	206
1340	3300005843	Ga0068860_100001391	Ga0068860_10000139114	206
1341	3300005843	Ga0068860_100070283	Ga0068860_1000702832	206
1342	3300005844	Ga0068862_100001330	Ga0068862_10000133012	206
1343	3300005844	Ga0068862_100129199	Ga0068862_1001291992	206
1344	3300006175	Ga0070712_100583305	Ga0070712_1005833052	206
1345	3300006177	Ga0075362_10077894	Ga0075362_100778942	206
1346	3300006237	Ga0097621_100034668	Ga0097621_1000346682	206
1347	3300006237	Ga0097621_100506751	Ga0097621_1005067512	206
1348	3300006358	Ga0068871_100019447	Ga0068871_1000194472	206
1349	3300006881	Ga0068865_100028965	Ga0068865_1000289652	206
1350	3300006931	Ga0097620_100009093	Ga0097620_1000090936	206
1351	3300006931	Ga0097620_100181511	Ga0097620_1001815112	206
1352	3300006946	Ga0079104_1035578	Ga0079104_10355782	206
1353	3300009094	Ga0111539_10012202	Ga0111539_100122023	206
1354	3300009094	Ga0111539_10236038	Ga0111539_102360382	206
1355	3300009174	Ga0105241_10557527	Ga0105241_105575272	206
1356	3300009177	Ga0105248_10114691	Ga0105248_101146913	206
1357	3300009553	Ga0105249_10029991	Ga0105249_100299913	206
1358	3300009553	Ga0105249_10087899	Ga0105249_100878992	206
1359	3300009553	Ga0105249_10242656	Ga0105249_102426562	206
1360	3300013296	Ga0157374_10005449	Ga0157374_1000544910	206
1361	3300013296	Ga0157374_10196774	Ga0157374_101967742	206
1362	3300013297	Ga0157378_10132694	Ga0157378_101326942	206
1363	3300013306	Ga0163162_10011365	Ga0163162_100113655	206
1364	3300013308	Ga0157375_10012303	Ga0157375_100123037	206
1365	3300013308	Ga0157375_10142050	Ga0157375_101420502	206
1366	3300013308	Ga0157375_10719457	Ga0157375_107194571	206
1367	3300014325	Ga0163163_10000051	Ga0163163_1000005177	206
1368	3300014325	Ga0163163_10354057	Ga0163163_103540572	206
1369	3300014326	Ga0157380_10512693	Ga0157380_105126932	206
1370	3300014968	Ga0157379_10408546	Ga0157379_104085462	206
1371	3300017792	Ga0163161_10026117	Ga0163161_100261173	206
1372	3300020077	Ga0206351_10852300	Ga0206351_108523001	206
1373	3300020080	Ga0206350_10329904	Ga0206350_103299042	206
1374	3300025315	Ga0207697_10016241	Ga0207697_100162412	206
1375	3300025321	Ga0207656_10032543	Ga0207656_100325432	206
1376	3300025900	Ga0207710_10014240	Ga0207710_100142404	206
1377	3300025903	Ga0207680_10004960	Ga0207680_100049601	206
1378	3300025907	Ga0207645_10000102	Ga0207645_1000010210	206
1379	3300025908	Ga0207643_10320414	Ga0207643_103204141	206
1380	3300025910	Ga0207684_10021984	Ga0207684_100219845	206
1381	3300025923	Ga0207681_10003604	Ga0207681_100036046	206
1382	3300025923	Ga0207681_10008813	Ga0207681_100088131	206
1383	3300025925	Ga0207650_10000002	Ga0207650_100000021196	206
1384	3300025925	Ga0207650_10076546	Ga0207650_100765463	206
1385	3300025926	Ga0207659_10034693	Ga0207659_100346932	206
1386	3300025931	Ga0207644_10000026	Ga0207644_1000002662	206
1387	3300025931	Ga0207644_10010181	Ga0207644_100101815	206
1388	3300025933	Ga0207706_10103035	Ga0207706_101030352	206
1389	3300025933	Ga0207706_10293640	Ga0207706_102936401	206
1390	3300025933	Ga0207706_10402526	Ga0207706_104025262	206
1391	3300025936	Ga0207670_10123533	Ga0207670_101235332	206
1392	3300025937	Ga0207669_10040887	Ga0207669_100408872	206
1393	3300025938	Ga0207704_10021705	Ga0207704_100217052	206
1394	3300025940	Ga0207691_10003239	Ga0207691_100032392	206
1395	3300025941	Ga0207711_10000916	Ga0207711_1000091626	206
1396	3300025941	Ga0207711_10423426	Ga0207711_104234261	206
1397	3300025960	Ga0207651_10040598	Ga0207651_100405983	206
1398	3300025961	Ga0207712_10051280	Ga0207712_100512802	206
1399	3300025972	Ga0207668_10012572	Ga0207668_100125723	206
1400	3300025972	Ga0207668_10048897	Ga0207668_100488972	206
1401	3300025972	Ga0207668_10078503	Ga0207668_100785032	206
1402	3300025981	Ga0207640_10052448	Ga0207640_100524482	206
1403	3300025986	Ga0207658_10000001	Ga0207658_10000001159	206
1404	3300026023	Ga0207677_10132299	Ga0207677_101322992	206
1405	3300026035	Ga0207703_10039845	Ga0207703_100398452	206
1406	3300026035	Ga0207703_10179339	Ga0207703_101793392	206
1407	3300026035	Ga0207703_10515186	Ga0207703_105151862	206
1408	3300026067	Ga0207678_10030882	Ga0207678_100308822	206
1409	3300026075	Ga0207708_10573890	Ga0207708_105738902	206
1410	3300026088	Ga0207641_10010824	Ga0207641_100108243	206
1411	3300026088	Ga0207641_10125424	Ga0207641_101254242	206
1412	3300026088	Ga0207641_10144670	Ga0207641_101446702	206
1413	3300026089	Ga0207648_10000687	Ga0207648_1000068742	206
1414	3300026095	Ga0207676_10000001	Ga0207676_100000011196	206
1415	3300026095	Ga0207676_10009854	Ga0207676_100098542	206
1416	3300026118	Ga0207675_100051895	Ga0207675_1000518953	206
1417	3300026118	Ga0207675_100540607	Ga0207675_1005406072	206
1418	3300026121	Ga0207683_10000675	Ga0207683_1000067528	206
1419	3300027111	Ga0209281_1023531	Ga0209281_10235311	206
1420	3300027907	Ga0207428_10008338	Ga0207428_100083383	206
1421	3300028379	Ga0268266_10012716	Ga0268266_100127163	206
1422	3300028379	Ga0268266_10077847	Ga0268266_100778473	206
1423	3300028379	Ga0268266_10458245	Ga0268266_104582452	206
1424	3300028379	Ga0268266_10501150	Ga0268266_105011502	206
1425	3300028380	Ga0268265_10006237	Ga0268265_100062372	206
1426	3300028380	Ga0268265_10034914	Ga0268265_100349143	206
1427	3300028381	Ga0268264_10000061	Ga0268264_10000061157	206
1428	3300028381	Ga0268264_10005365	Ga0268264_100053654	206
1429	3300028381	Ga0268264_10149636	Ga0268264_101496362	206
1430	3300031251	Ga0265327_10000112	Ga0265327_10000112100	206
1431	3300031691	Ga0316579_10000051	Ga0316579_1000005111	206
1432	3300031691	Ga0316579_10000784	Ga0316579_100007849	206
1433	3300031691	Ga0316579_10009517	Ga0316579_100095172	206
1434	3300031691	Ga0316579_10042684	Ga0316579_100426842	206
1435	3300031691	Ga0316579_10057182	Ga0316579_100571822	206
1436	3300031727	Ga0316576_10000113	Ga0316576_1000011331	206
1437	3300031727	Ga0316576_10002850	Ga0316576_100028507	206
1438	3300031727	Ga0316576_10050681	Ga0316576_100506812	206
1439	3300031728	Ga0316578_10000266	Ga0316578_100002662	206
1440	3300031728	Ga0316578_10001016	Ga0316578_100010162	206
1441	3300031728	Ga0316578_10001109	Ga0316578_100011094	206
1442	3300031728	Ga0316578_10017288	Ga0316578_100172883	206
1443	3300031728	Ga0316578_10020950	Ga0316578_100209505	206
1444	3300031728	Ga0316578_10024677	Ga0316578_100246772	206
1445	3300031728	Ga0316578_10201099	Ga0316578_102010992	206
1446	3300031733	Ga0316577_10000110	Ga0316577_100001107	206
1447	3300031733	Ga0316577_10002403	Ga0316577_100024035	206
1448	3300031733	Ga0316577_10006251	Ga0316577_100062513	206
1449	3300031733	Ga0316577_10360847	Ga0316577_103608471	206
1450	3300032002	Ga0307416_100270884	Ga0307416_1002708842	206
1451	3300032133	Ga0316583_10015292	Ga0316583_100152923	206
1452	3300032133	Ga0316583_10043528	Ga0316583_100435282	206
1453	3300032137	Ga0316585_10000367	Ga0316585_100003673	206
1454	3300032137	Ga0316585_10044543	Ga0316585_100445431	206
1455	3300032139	Ga0316580_10000061	Ga0316580_1000006113	206
1456	3300032139	Ga0316580_10002276	Ga0316580_100022763	206
1457	3300032139	Ga0316580_10037987	Ga0316580_100379871	206
1458	3300032168	Ga0316593_10000088	Ga0316593_100000889	206
1459	3300032168	Ga0316593_10000103	Ga0316593_100001035	206
1460	3300032168	Ga0316593_10000116	Ga0316593_100001163	206
1461	3300032168	Ga0316593_10000485	Ga0316593_100004856	206
1462	3300032168	Ga0316593_10000556	Ga0316593_100005566	206
1463	3300032168	Ga0316593_10000872	Ga0316593_100008723	206
1464	3300032168	Ga0316593_10003995	Ga0316593_100039953	206
1465	3300032168	Ga0316593_10004333	Ga0316593_100043332	206
1466	3300032168	Ga0316593_10004520	Ga0316593_100045201	206
1467	3300032168	Ga0316593_10009388	Ga0316593_100093882	206
1468	3300032168	Ga0316593_10012862	Ga0316593_100128622	206
1469	3300032168	Ga0316593_10014388	Ga0316593_100143882	206
1470	3300032168	Ga0316593_10015276	Ga0316593_100152761	206
1471	3300032168	Ga0316593_10024345	Ga0316593_100243452	206
1472	3300032168	Ga0316593_10024367	Ga0316593_100243672	206
1473	3300032168	Ga0316593_10062310	Ga0316593_100623102	206
1474	3300033524	Ga0316592_1000012	Ga0316592_10000129	206
1475	3300033524	Ga0316592_1000042	Ga0316592_10000422	206
1476	3300033524	Ga0316592_1000126	Ga0316592_10001262	206
1477	3300033524	Ga0316592_1000222	Ga0316592_10002223	206
1478	3300033524	Ga0316592_1001565	Ga0316592_10015652	206
1479	3300033524	Ga0316592_1001896	Ga0316592_10018962	206
1480	3300033524	Ga0316592_1009615	Ga0316592_10096152	206
1481	3300033527	Ga0316586_1000439	Ga0316586_10004392	206
1482	3300033527	Ga0316586_1000685	Ga0316586_10006853	206
1483	3300033527	Ga0316586_1000732	Ga0316586_10007323	206
1484	3300033528	Ga0316588_1000009	Ga0316588_10000099	206
1485	3300033528	Ga0316588_1000013	Ga0316588_10000139	206
1486	3300033528	Ga0316588_1000017	Ga0316588_10000179	206
1487	3300033528	Ga0316588_1000036	Ga0316588_10000368	206
1488	3300033528	Ga0316588_1000592	Ga0316588_10005924	206
1489	3300033528	Ga0316588_1001161	Ga0316588_10011612	206
1490	3300033529	Ga0316587_1000272	Ga0316587_10002722	206
1491	3300033529	Ga0316587_1000555	Ga0316587_10005552	206
1492	3300033529	Ga0316587_1000959	Ga0316587_10009592	206
1493	3300033529	Ga0316587_1040869	Ga0316587_10408691	206
1494	3300033541	Ga0316596_1000008	Ga0316596_10000089	206
1495	3300033541	Ga0316596_1000081	Ga0316596_10000813	206
1496	3300033541	Ga0316596_1000087	Ga0316596_10000874	206
1497	3300033541	Ga0316596_1000228	Ga0316596_10002287	206
1498	3300033541	Ga0316596_1000674	Ga0316596_10006743	206
1499	3300033541	Ga0316596_1001385	Ga0316596_10013853	206
1500	3300033541	Ga0316596_1001991	Ga0316596_10019912	206
1501	3300033541	Ga0316596_1005096	Ga0316596_10050962	206
1502	3300033541	Ga0316596_1008539	Ga0316596_10085392	206
1503	3300033541	Ga0316596_1012830	Ga0316596_10128301	206
1504	3300035398	Ga0316574_0008162	Ga0316574_0008162_2460_3113	206
1505	3300035398	Ga0316574_0254798	Ga0316574_0254798_390_1034	206
1506	3300036647	Ga0316582_0000035	Ga0316582_0000035_14162_14815	206
1507	3300036647	Ga0316582_0001664	Ga0316582_0001664_2075_2716	206
1508	3300036647	Ga0316582_0013968	Ga0316582_0013968_2266_2934	206
1509	3300036647	Ga0316582_0059972	Ga0316582_0059972_1758_2414	206
1510	3300036647	Ga0316582_0068623	Ga0316582_0068623_727_1380	206
1511	3300036647	Ga0316582_0074200	Ga0316582_0074200_1295_1930	206
1512	3300036647	Ga0316582_0403102	Ga0316582_0403102_239_907	206
1513	3300036712	Ga0316584_0001810	Ga0316584_0001810_3235_3888	206
1514	3300036712	Ga0316584_0005188	Ga0316584_0005188_3061_3702	206
1515	3300036712	Ga0316584_0040597	Ga0316584_0040597_2629_3282	206
1516	3300036712	Ga0316584_0048760	Ga0316584_0048760_1036_1689	206
1517	3300036712	Ga0316584_0052870	Ga0316584_0052870_1807_2475	206
1518	3300036712	Ga0316584_0113298	Ga0316584_0113298_452_1108	206
1519	3300036712	Ga0316584_0174171	Ga0316584_0174171_802_1446	206
1520	3300036712	Ga0316584_0490551	Ga0316584_0490551_14_655	206
1521	3300037418	Ga0395900_0235466	Ga0395900_0235466_1068_1697	206
1522	3300037418	Ga0395900_0240343	Ga0395900_0240343_771_1409	206
1523	3300037466	Ga0395898_0049347	Ga0395898_0049347_2025_2654	206
1524	3300037588	Ga0316581_0006354	Ga0316581_0006354_2025_2666	206
1525	3300037588	Ga0316581_0013417	Ga0316581_0013417_1044_1679	206
1526	3300038725	Ga0400484_20337	Ga0400484_20337_443_1078	206
1527	3300038725	Ga0400484_34275	Ga0400484_34275_14893_15534	206
1528	3300038725	Ga0400484_43751	Ga0400484_43751_4523_5164	206
1529	3300038726	Ga0400490_06176	Ga0400490_06176_30156_30797	206
1530	3300038726	Ga0400490_06327	Ga0400490_06327_355_996	206
1531	3300038726	Ga0400490_40351	Ga0400490_40351_4520_5161	206
1532	3300038726	Ga0400490_45639	Ga0400490_45639_22_657	206
1533	3300038727	Ga0400491_11610	Ga0400491_11610_839_1477	206
1534	3300038727	Ga0400491_27913	Ga0400491_27913_449_1084	206
1535	3300038735	Ga0400485_17668	Ga0400485_17668_2695_3333	206
1536	3300038741	Ga0400488_16237	Ga0400488_16237_1004_1645	206
1537	3300038741	Ga0400488_25653	Ga0400488_25653_1025_1666	206
1538	3300038741	Ga0400488_39763	Ga0400488_39763_614_1249	206
1539	3300038741	Ga0400488_53856	Ga0400488_53856_874_1515	206
1540	3300038742	Ga0400486_09139	Ga0400486_09139_4961_5599	206
1541	3300038742	Ga0400486_30096	Ga0400486_30096_5234_5872	206
1542	3300039062	Ga0400483_002377	Ga0400483_002377_19084_19764	206
1543	3300039062	Ga0400483_086371	Ga0400483_086371_2419_3057	206
1544	3300039062	Ga0400483_099131	Ga0400483_099131_1347_1988	206
1545	3300039062	Ga0400483_111069	Ga0400483_111069_1485_2123	206
1546	3300039062	Ga0400483_115860	Ga0400483_115860_95_736	206
1547	3300039062	Ga0400483_121594	Ga0400483_121594_11360_12001	206
1548	3300039062	Ga0400483_154649	Ga0400483_154649_492_1133	206
1549	3300039062	Ga0400483_202160	Ga0400483_202160_14931_15611	206
1550	3300039062	Ga0400483_220070	Ga0400483_220070_1321_1959	206
1551	3300039062	Ga0400483_220720	Ga0400483_220720_2504_3145	206
1552	3300039062	Ga0400483_241006	Ga0400483_241006_931_1575	206
1553	3300039062	Ga0400483_251977	Ga0400483_251977_4745_5383	206
1554	3300039062	Ga0400483_281457	Ga0400483_281457_7452_8093	206
1555	3300039110	Ga0400487_14028	Ga0400487_14028_762_1409	206
1556	3300039110	Ga0400487_15634	Ga0400487_15634_205_843	206
1557	3300039110	Ga0400487_19441	Ga0400487_19441_3781_4422	206
1558	3300039110	Ga0400487_20624	Ga0400487_20624_230_871	206
1559	3300039110	Ga0400487_45865	Ga0400487_45865_563_1201	206
1560	3300039110	Ga0400487_54125	Ga0400487_54125_1339_1980	206
1561	3300039110	Ga0400487_63109	Ga0400487_63109_4751_5392	206
1562	3300041451	Ga0451791_0986417	Ga0451791_0986417_150_779	206
1563	3300048904	Ga0496101_0140532	Ga0496101_0140532_448_1086	206
1564	3300048908	Ga0496105_0103525	Ga0496105_0103525_700_1335	206
1565	3300048909	Ga0496106_0071987	Ga0496106_0071987_726_1397	206
1566	3300048909	Ga0496106_0286793	Ga0496106_0286793_519_1157	206
1567	3300048910	Ga0496107_0081221	Ga0496107_0081221_432_1070	206
1568	3300048911	Ga0496108_0190518	Ga0496108_0190518_550_1212	206
1569	3300048912	Ga0496109_0062506	Ga0496109_0062506_1040_1678	206
1570	3300048912	Ga0496109_0299087	Ga0496109_0299087_636_1274	206
1571	3300048913	Ga0496110_0442773	Ga0496110_0442773_110_748	206
1572	3300048914	Ga0496111_0289925	Ga0496111_0289925_213_851	206
1573	3300048915	Ga0496112_0523248	Ga0496112_0523248_362_1000	206
1574	3300048917	Ga0496114_0001834	Ga0496114_0001834_529_1191	206
1575	3300048917	Ga0496114_0016627	Ga0496114_0016627_2823_3458	206
1576	3300048917	Ga0496114_0047010	Ga0496114_0047010_708_1346	206
1577	3300048928	Ga0496125_0041182	Ga0496125_0041182_1225_1896	206
1578	3300049568	Ga0501031_0004228	Ga0501031_0004228_6499_7143	206
1579	3300049568	Ga0501031_0043836	Ga0501031_0043836_1952_2590	206
1580	3300049568	Ga0501031_0365085	Ga0501031_0365085_68_709	206
1581	3300049569	Ga0501032_0000464	Ga0501032_0000464_10365_11009	206
1582	3300049569	Ga0501032_0004352	Ga0501032_0004352_8568_9212	206
1583	3300049569	Ga0501032_0032034	Ga0501032_0032034_2793_3434	206
1584	3300049570	Ga0501033_0001142	Ga0501033_0001142_21537_22181	206
1585	3300049570	Ga0501033_0006125	Ga0501033_0006125_2040_2684	206
1586	3300049571	Ga0501034_0009261	Ga0501034_0009261_2134_2778	206
1587	3300049571	Ga0501034_0021148	Ga0501034_0021148_1675_2313	206
1588	3300049571	Ga0501034_0354235	Ga0501034_0354235_738_1379	206
1589	3300049572	Ga0501036_0014033	Ga0501036_0014033_1797_2441	206
1590	3300049572	Ga0501036_0014975	Ga0501036_0014975_1964_2608	206
1591	3300049572	Ga0501036_0019901	Ga0501036_0019901_3275_3919	206
1592	3300049572	Ga0501036_0056254	Ga0501036_0056254_1835_2476	206
1593	3300049573	Ga0501037_0025742	Ga0501037_0025742_1843_2487	206
1594	3300049574	Ga0501038_0000689	Ga0501038_0000689_7882_8526	206
1595	3300049574	Ga0501038_0009872	Ga0501038_0009872_5561_6199	206
1596	3300049575	Ga0501039_0011879	Ga0501039_0011879_1547_2185	206
1597	3300049576	Ga0501040_0001446	Ga0501040_0001446_9946_10590	206
1598	3300049578	Ga0501042_0012624	Ga0501042_0012624_1970_2614	206
1599	3300049579	Ga0501043_0002027	Ga0501043_0002027_5998_6642	206
1600	3300049579	Ga0501043_0009409	Ga0501043_0009409_1759_2403	206
1601	3300049579	Ga0501043_0075339	Ga0501043_0075339_1543_2187	206
1602	3300049580	Ga0501046_0002787	Ga0501046_0002787_7852_8496	206
1603	3300049580	Ga0501046_0012662	Ga0501046_0012662_1942_2586	206
1604	3300049581	Ga0501047_0430882	Ga0501047_0430882_42_686	206
1605	3300049582	Ga0501048_0026377	Ga0501048_0026377_1970_2614	206
1606	3300049584	Ga0501068_0059207	Ga0501068_0059207_111_755	206
1607	3300049822	Ga0501035_0025419	Ga0501035_0025419_2819_3463	206
1608	3300049822	Ga0501035_0071234	Ga0501035_0071234_42_686	206
1609	3300049822	Ga0501035_0857742	Ga0501035_0857742_49_690	206
1610	3300049823	Ga0501044_0002232	Ga0501044_0002232_7853_8497	206
1611	3300049823	Ga0501044_0024447	Ga0501044_0024447_982_1626	206
1612	3300049823	Ga0501044_0146304	Ga0501044_0146304_968_1609	206
1613	3300049824	Ga0501045_0107998	Ga0501045_0107998_970_1614	206
1614	3300049824	Ga0501045_0265396	Ga0501045_0265396_426_1070	206
1615	3300050511	nmdc:mga08y16_131743_c1	nmdc:mga08y16_131743_c1_1474_2118	206
1616	3300050511	nmdc:mga08y16_21077_c1	nmdc:mga08y16_21077_c1_1491_2135	206
1617	3300053098	Ga0500650_0000034	Ga0500650_0000034_42877_43524	206
1618	3300053138	Ga0500564_036419	Ga0500564_036419_914_1558	206
1619	3300055283	Ga0500661_002319	Ga0500661_002319_2192_2836	206
1620	3300059477	Ga0587084_001171	Ga0587084_001171_271_915	206
1621	3300059506	Ga0587085_002481	Ga0587085_002481_212_856	206
1622	3300059508	Ga0587088_006498	Ga0587088_006498_215_859	206
1623	3300059512	Ga0587092_000616	Ga0587092_000616_1467_2111	206
1624	3300059626	Ga0587115_003580	Ga0587115_003580_280_924	206
1625	3300059627	Ga0587117_002991	Ga0587117_002991_290_934	206
1626	3300059641	Ga0587068_012597	Ga0587068_012597_593_1237	206
1627	3300060346	Ga0587111_0001821	Ga0587111_0001821_652_1296	206
1628	3300005543	Ga0070672_100476113	Ga0070672_1004761132	207
1629	3300005563	Ga0068855_100357108	Ga0068855_1003571082	207
1630	3300013308	Ga0157375_10399281	Ga0157375_103992812	207
1631	3300025256	Ga0209759_1003396	Ga0209759_10033967	207
1632	3300025912	Ga0207707_10325807	Ga0207707_103258072	207
1633	3300025949	Ga0207667_10347806	Ga0207667_103478062	207
1634	iso_pu_bacteria	2857553236	2857556928	207
1635	iso_pu_bacteria	2919476304	2919477779	207
1636	3300003577	Ga0007416J51690_1050757	Ga0007416J51690_10507572	208
1637	3300005331	Ga0070670_100268694	Ga0070670_1002686942	208
1638	3300005333	Ga0070677_10000061	Ga0070677_1000006114	208
1639	3300005335	Ga0070666_10018466	Ga0070666_100184662	208
1640	3300005338	Ga0068868_100006042	Ga0068868_1000060427	208
1641	3300005347	Ga0070668_100005777	Ga0070668_1000057773	208
1642	3300005364	Ga0070673_100009414	Ga0070673_1000094146	208
1643	3300005367	Ga0070667_100003765	Ga0070667_10000376513	208
1644	3300005456	Ga0070678_100004959	Ga0070678_1000049593	208
1645	3300005459	Ga0068867_100010922	Ga0068867_1000109226	208
1646	3300005543	Ga0070672_100006913	Ga0070672_1000069132	208
1647	3300005548	Ga0070665_100018491	Ga0070665_1000184912	208
1648	3300005578	Ga0068854_100311368	Ga0068854_1003113681	208
1649	3300005616	Ga0068852_100003619	Ga0068852_10000361913	208
1650	3300005840	Ga0068870_10032901	Ga0068870_100329012	208
1651	3300005843	Ga0068860_100115373	Ga0068860_1001153732	208
1652	3300006358	Ga0068871_100047889	Ga0068871_1000478892	208
1653	3300006881	Ga0068865_100026301	Ga0068865_1000263015	208
1654	3300006946	Ga0079104_1010479	Ga0079104_10104792	208
1655	3300013100	Ga0157373_10205183	Ga0157373_102051832	208
1656	3300013105	Ga0157369_10051029	Ga0157369_100510292	208
1657	3300013296	Ga0157374_10694983	Ga0157374_106949832	208
1658	3300015261	Ga0182006_1000008	Ga0182006_1000008271	208
1659	3300015265	Ga0182005_1000008	Ga0182005_1000008329	208
1660	3300025321	Ga0207656_10001440	Ga0207656_100014409	208
1661	3300025893	Ga0207682_10004319	Ga0207682_100043195	208
1662	3300025901	Ga0207688_10089406	Ga0207688_100894062	208
1663	3300025903	Ga0207680_10020947	Ga0207680_100209474	208
1664	3300025907	Ga0207645_10000732	Ga0207645_1000073231	208
1665	3300025908	Ga0207643_10039865	Ga0207643_100398653	208
1666	3300025926	Ga0207659_10022533	Ga0207659_100225335	208
1667	3300025931	Ga0207644_10015473	Ga0207644_100154732	208
1668	3300025938	Ga0207704_10007850	Ga0207704_100078502	208
1669	3300025940	Ga0207691_10000180	Ga0207691_100001803	208
1670	3300025941	Ga0207711_10042197	Ga0207711_100421972	208
1671	3300025960	Ga0207651_10022992	Ga0207651_100229923	208
1672	3300025972	Ga0207668_10027166	Ga0207668_100271662	208
1673	3300025981	Ga0207640_10350513	Ga0207640_103505131	208
1674	3300025986	Ga0207658_10005886	Ga0207658_100058862	208
1675	3300026023	Ga0207677_10029660	Ga0207677_100296603	208
1676	3300026035	Ga0207703_10091652	Ga0207703_100916522	208
1677	3300026041	Ga0207639_10038432	Ga0207639_100384324	208
1678	3300026088	Ga0207641_10014927	Ga0207641_100149272	208
1679	3300026089	Ga0207648_10029050	Ga0207648_100290503	208
1680	3300026121	Ga0207683_10000146	Ga0207683_1000014668	208
1681	3300026142	Ga0207698_10001624	Ga0207698_1000162413	208
1682	3300028379	Ga0268266_10012490	Ga0268266_100124906	208
1683	3300028381	Ga0268264_10016354	Ga0268264_100163542	208
1684	3300046453	Ga0495627_000001	Ga0495627_000001_506946_507584	208
1685	3300046523	Ga0495644_0086005	Ga0495644_0086005_209_847	208
1686	3300046538	Ga0495609_0017079	Ga0495609_0017079_1157_1795	208
1687	3300046810	Ga0495660_0008884	Ga0495660_0008884_5017_5655	208
1688	3300048905	Ga0496102_0756911	Ga0496102_0756911_176_847	208
1689	3300048927	Ga0496124_0407721	Ga0496124_0407721_80_718	208
1690	3300049459	Ga0495678_000002	Ga0495678_000002_1579_2217	208
1691	3300005539	Ga0068853_100045569	Ga0068853_1000455692	209
1692	3300006058	Ga0075432_10005596	Ga0075432_100055964	209
1693	3300013297	Ga0157378_10480276	Ga0157378_104802762	209
1694	3300025913	Ga0207695_10071033	Ga0207695_100710332	209
1695	3300027907	Ga0207428_10294130	Ga0207428_102941301	209
1696	3300031238	Ga0265332_10000003	Ga0265332_1000000379	209
1697	3300032002	Ga0307416_100052007	Ga0307416_1000520073	209
1698	3300046455	Ga0495603_0006545	Ga0495603_0006545_1620_2285	209
1699	3300046491	Ga0495584_0163167	Ga0495584_0163167_211_876	209
1700	3300009176	Ga0105242_10143562	Ga0105242_101435622	210
1701	3300013297	Ga0157378_10051099	Ga0157378_100510992	210
1702	3300013306	Ga0163162_10020571	Ga0163162_100205712	210
1703	3300013308	Ga0157375_10071106	Ga0157375_100711062	210
1704	3300014325	Ga0163163_10133893	Ga0163163_101338932	210
1705	3300014968	Ga0157379_10150839	Ga0157379_101508392	210
1706	3300014969	Ga0157376_10073932	Ga0157376_100739322	210
1707	3300014969	Ga0157376_10174025	Ga0157376_101740252	210
1708	3300021361	Ga0213872_10003808	Ga0213872_100038082	210
1709	3300039447	Ga0436361_0100693	Ga0436361_0100693_2411_3058	210
1710	3300039447	Ga0436361_0751899	Ga0436361_0751899_637_1284	210
1711	3300048915	Ga0496112_0050631	Ga0496112_0050631_420_1139	210
1712	3300014497	Ga0182008_10063481	Ga0182008_100634811	211
1713	3300025911	Ga0207654_10184673	Ga0207654_101846732	213
1714	3300046660	Ga0495625_0009855	Ga0495625_0009855_442_1101	213
1715	3300050490	nmdc:mga03n38_345481_c1	nmdc:mga03n38_345481_c1_125_784	213
1716	3300050491	nmdc:mga00v17_158465_c1	nmdc:mga00v17_158465_c1_317_976	213
1717	3300050493	nmdc:mga0k408_50174_c1	nmdc:mga0k408_50174_c1_1065_1724	213
1718	3300050496	nmdc:mga07m45_318145_c1	nmdc:mga07m45_318145_c1_34_693	213
1719	3300050496	nmdc:mga07m45_38496_c1	nmdc:mga07m45_38496_c1_241_900	213
1720	3300005328	Ga0070676_10063812	Ga0070676_100638122	214
1721	3300005347	Ga0070668_100060644	Ga0070668_1000606442	214
1722	3300005353	Ga0070669_100061118	Ga0070669_1000611182	214
1723	3300005456	Ga0070678_100236058	Ga0070678_1002360582	214
1724	3300013306	Ga0163162_10272473	Ga0163162_102724732	214
1725	3300025907	Ga0207645_10098993	Ga0207645_100989932	214
1726	3300025923	Ga0207681_10049651	Ga0207681_100496513	214
1727	3300025925	Ga0207650_10517481	Ga0207650_105174812	214
1728	3300025972	Ga0207668_10054922	Ga0207668_100549223	214
1729	3300026121	Ga0207683_10384311	Ga0207683_103843112	214
1730	iso_pu_bacteria	2511231002	2511245528	214
1731	3300025303	Ga0209051_1038247	Ga0209051_10382472	215
1732	3300025925	Ga0207650_10039594	Ga0207650_100395943	215
1733	3300003187	JGI25151J46595_10002355	JGI25151J46595_100023558	216
1734	3300005288	Ga0065714_10115854	Ga0065714_101158542	216
1735	3300005459	Ga0068867_100222924	Ga0068867_1002229242	216
1736	3300009545	Ga0105237_10663719	Ga0105237_106637192	216
1737	3300009551	Ga0105238_10065592	Ga0105238_100655922	216
1738	3300010375	Ga0105239_10574188	Ga0105239_105741882	216
1739	3300013105	Ga0157369_10014134	Ga0157369_100141342	216
1740	3300013308	Ga0157375_10375760	Ga0157375_103757602	216
1741	3300002704	JGI25155J39150_1000008	JGI25155J39150_1000008131	218
1742	3300002705	JGI25156J39149_1000002	JGI25156J39149_1000002124	218
1743	3300002738	JGI25154J39366_1000010	JGI25154J39366_1000010193	218
1744	3300002741	JGI25157J39369_1000001	JGI25157J39369_1000001145	218
1745	3300002774	JGI25150J39212_1012964	JGI25150J39212_10129641	218
1746	3300002987	JGI25159J45721_1010313	JGI25159J45721_10103131	218
1747	3300002987	JGI25159J45721_1010536	JGI25159J45721_10105361	218
1748	3300003187	JGI25151J46595_10030875	JGI25151J46595_100308752	218
1749	3300003354	JGI25160J50197_1000349	JGI25160J50197_10003492	218
1750	3300003354	JGI25160J50197_1037536	JGI25160J50197_10375362	218
1751	3300003374	JGI25161J50226_1000076	JGI25161J50226_100007625	218
1752	3300003771	Ga0055526_1012698	Ga0055526_10126982	218
1753	3300003771	Ga0055526_1013519	Ga0055526_10135192	218
1754	3300003773	Ga0055537_1006212	Ga0055537_10062122	218
1755	3300003775	Ga0055524_1000130	Ga0055524_100013052	218
1756	3300003784	Ga0055534_1003142	Ga0055534_10031423	218
1757	3300003790	Ga0055528_1002061	Ga0055528_10020614	218
1758	3300003792	Ga0055540_1000685	Ga0055540_10006853	218
1759	3300003794	Ga0055531_10001278	Ga0055531_1000127816	218
1760	3300003794	Ga0055531_10010900	Ga0055531_100109003	218
1761	3300004625	Ga0055543_1000118	Ga0055543_100011861	218
1762	3300005262	Ga0065165_1048918	Ga0065165_10489182	218
1763	3300005262	Ga0065165_1071216	Ga0065165_10712161	218
1764	3300005468	Ga0070707_100017396	Ga0070707_1000173964	218
1765	3300006177	Ga0075362_10136155	Ga0075362_101361552	218
1766	3300006195	Ga0075366_10075152	Ga0075366_100751522	218
1767	3300006353	Ga0075370_10161878	Ga0075370_101618782	218
1768	3300009147	Ga0114129_10969915	Ga0114129_109699151	218
1769	3300025206	Ga0209435_100001	Ga0209435_1000011173	218
1770	3300025208	Ga0209436_103684	Ga0209436_1036844	218
1771	3300025245	Ga0207425_1019252	Ga0207425_10192522	218
1772	3300025246	Ga0209646_1000001	Ga0209646_10000011542	218
1773	3300025250	Ga0209026_1000001	Ga0209026_1000001195	218
1774	3300025256	Ga0209759_1000001	Ga0209759_10000011173	218
1775	3300025258	Ga0209129_1012297	Ga0209129_10122972	218
1776	3300025263	Ga0209565_1008581	Ga0209565_10085812	218
1777	3300025263	Ga0209565_1009729	Ga0209565_10097292	218
1778	3300025273	Ga0209673_1000232	Ga0209673_10002324	218
1779	3300025284	Ga0209130_1000041	Ga0209130_1000041210	218
1780	3300025284	Ga0209130_1003555	Ga0209130_10035554	218
1781	3300025291	Ga0209675_1000128	Ga0209675_100012857	218
1782	3300025292	Ga0209676_1000054	Ga0209676_1000054162	218
1783	3300025294	Ga0209025_1011038	Ga0209025_10110384	218
1784	3300025294	Ga0209025_1012518	Ga0209025_10125183	218
1785	3300025294	Ga0209025_1017065	Ga0209025_10170651	218
1786	3300025295	Ga0209564_1019000	Ga0209564_10190001	218
1787	3300025295	Ga0209564_1033897	Ga0209564_10338972	218
1788	3300025297	Ga0209758_1019945	Ga0209758_10199453	218
1789	3300025297	Ga0209758_1056908	Ga0209758_10569082	218
1790	3300025298	Ga0209050_1000066	Ga0209050_1000066162	218
1791	3300025298	Ga0209050_1007123	Ga0209050_10071234	218
1792	3300025299	Ga0209256_1000003	Ga0209256_10000031435	218
1793	3300025302	Ga0207426_1000061	Ga0207426_100006131	218
1794	3300025302	Ga0207426_1001601	Ga0207426_100160116	218
1795	3300025303	Ga0209051_1000044	Ga0209051_1000044162	218
1796	3300025304	Ga0209257_1000082	Ga0209257_1000082162	218
1797	3300025922	Ga0207646_10064740	Ga0207646_100647403	218
1798	3300028786	Ga0307517_10126414	Ga0307517_101264142	218
1799	3300031456	Ga0307513_10000021	Ga0307513_10000021125	218
1800	3300031548	Ga0307408_100009944	Ga0307408_1000099444	218
1801	3300031901	Ga0307406_10072698	Ga0307406_100726982	218
1802	3300041443	Ga0451789_0114836	Ga0451789_0114836_61_807	218
1803	3300041451	Ga0451791_1836537	Ga0451791_1836537_12_668	218
1804	3300041507	Ga0451851_0832300	Ga0451851_0832300_335_1078	218
1805	3300041512	Ga0451853_0625523	Ga0451853_0625523_604_1260	218
1806	3300050496	nmdc:mga07m45_177624_c1	nmdc:mga07m45_177624_c1_168_824	218
1807	3300053088	Ga0500644_0025787	Ga0500644_0025787_550_1206	218
1808	3300053730	Ga0500645_022024	Ga0500645_022024_417_1073	218
1809	3300053730	Ga0500645_037182	Ga0500645_037182_777_1433	218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

33

215

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8ef8-assembly1.cif.gz_N	staphylococcus aureus clpp y63w in complex with compound 3471	0.9989	42	214
8ef8-assembly1.cif.gz_M	staphylococcus aureus clpp y63w in complex with compound 3471	0.9981	42	214
8ef8-assembly1.cif.gz_L	staphylococcus aureus clpp y63w in complex with compound 3471	0.9973	42	214
6mx2-assembly5.cif.gz_E	crystal structure of clpp1 from clostridium difficile 630.	0.9972	42	218
2zl4-assembly1.cif.gz_L	crystal structure of h.pylori clpp s99a in complex with the peptide aaaa	0.9967	43	214

ID	Description	Score	Start	End	Superfamily
1yg8S00	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9919	43	218	3.90.226.10
1yg8S00	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.97	43	218	3.90.226.10
af_Q2PMR0_6_196_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.97	29	216	3.90.226.10
1y7oA00	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9606	41	216	3.90.226.10
af_A0A0R0FC89_136_330_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9516	29	218	3.90.226.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7X1EET5-F1-model_v4	deleted	1.004	72	163
AF-A0A2W4J8K3-F1-model_v4	ATP-dependent Clp protease proteolytic subunit	1.003	44	144	GO:0004176 GO:0004252 GO:0006515 GO:0009368 GO:0051117
AF-A0A813EY87-F1-model_v4	ATP-dependent Clp protease proteolytic subunit	1.002	74	214	GO:0004176 GO:0004252 GO:0006515 GO:0009368 GO:0016020 GO:0051117
AF-A0A7C4RZ48-F1-model_v4	ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)	1.002	93	214	GO:0004176 GO:0004252 GO:0006515 GO:0009368 GO:0051117
AF-A0A428VV44-F1-model_v4	ATP-dependent Clp protease proteolytic subunit	1.002	44	141	GO:0004176 GO:0004252 GO:0006515 GO:0009368 GO:0051117

Feature Viewer

pLDDT	pTM	Quality
88.26	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495760

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00574

CLP_protease

Clp protease

33

215

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map