F495719

General Info

Members Datasets Scaffolds Average Seq Length
1790 600 1686 275

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221597|2643996627
Length 318
Sequence PPPRADAAGAEASRAEAERLGPVLASASVTDTDVVEPESHPAGRRRRGERPRWWLYIVLTLGLIAMVMPFVWMFLGSFKSDAEIRQNPTGFLPQNPTVENYETLFGRLDFTTFFINSVVVAVFVTLGNIVFCSMIGYALAKLQFRGKKLLFALVIGTLMVPGVVTFVPLFVLTANLGLVNSYPGLILPFLISPLGVFLMRQFMLSLPDELIEAARIDGASEWRIFLRVIMPMCGPAVATLTILTFLGSWNNFLWPLVVATKEDMYTLPVALALYSVSQNAAKYGLMMAGAVVVVAPILLVFVFLQRYFVQGIALTGIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
8 2643221566 Microbacterium sp. Root166 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
11 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
12 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
13 2643221711 Terrabacter sp. Root85 Isolate Unclassified
14 2671180694 Paenibacillus sp. A3 Isolate Unclassified
15 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
16 2734482264 Dyella sp. AD052 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2738543009 Luteibacter sp. OK325 Isolate Unclassified
19 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
20 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
21 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
22 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
23 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
24 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
25 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
26 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
27 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
28 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
29 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
30 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
31 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
32 2818991457 Xanthomonas translucens 569 Isolate Unclassified
33 2818991459 Paenibacillus sp. 597 Isolate Unclassified
34 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
35 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
36 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
37 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
38 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
39 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
40 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
41 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
42 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
43 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
44 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
45 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
46 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
47 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
48 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
49 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
50 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
51 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
52 2919069694 Microbacterium sp. 1154 Isolate Unclassified
53 2919085039 Luteibacter sp. 1214 Isolate Unclassified
54 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
55 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
56 2919395869 Microbacterium resistens 2980 Isolate Unclassified
57 2919404418 Luteibacter sp. 3190 Isolate Unclassified
58 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
59 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
60 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
61 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
62 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
63 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
64 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
65 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
66 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
67 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
68 2941471342 Luteibacter sp. 621 Isolate Unclassified
69 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
70 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
71 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
72 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
73 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
74 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
75 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
76 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
77 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
78 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
79 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
80 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
81 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
82 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
83 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
84 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
85 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
86 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
87 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
88 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
89 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
90 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
91 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
92 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
93 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
94 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
95 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
96 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
97 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
98 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
99 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
100 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
101 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
102 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
104 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
105 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
106 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
107 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
108 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
109 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
110 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
111 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
112 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
113 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
114 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
115 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
116 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
117 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
118 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
119 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
120 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
121 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
122 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
123 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
124 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
125 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
126 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
127 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
128 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
129 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
130 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
131 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
132 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
133 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
134 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
135 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
136 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
137 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
138 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
139 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
140 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
141 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
142 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
143 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
144 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
145 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
146 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
147 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
148 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
149 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
150 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
151 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
152 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
153 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
154 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
155 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
156 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
157 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
158 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
159 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
160 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
161 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
162 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
163 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
164 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
165 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
166 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
167 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
168 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
169 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
170 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
171 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
172 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
173 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
174 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
175 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
176 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
177 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
178 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
179 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
180 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
181 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
182 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
183 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
184 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
185 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
186 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
187 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
188 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
189 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
190 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
191 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
192 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
193 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
195 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
196 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
197 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
198 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
199 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
200 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
201 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
202 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
203 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
204 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
205 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
206 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
207 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
208 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
209 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
210 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
211 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
212 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
213 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
215 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
216 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
217 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
218 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
219 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
220 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
221 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
222 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
223 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
224 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
225 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
226 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
227 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
228 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
229 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
230 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
231 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
232 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
233 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
234 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
235 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
236 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
237 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
238 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
239 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
240 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
245 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
246 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
247 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
248 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
249 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
250 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
251 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
252 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
253 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
254 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
255 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
256 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
257 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
260 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
262 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
266 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
351 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
355 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
356 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
357 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
358 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
359 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
360 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
361 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
362 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
363 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
364 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
365 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
366 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
367 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
368 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
369 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
370 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
371 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
372 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
373 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
374 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
375 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
376 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
377 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
378 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
379 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
380 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
381 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
382 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
383 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
384 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
385 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
386 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
387 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
388 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
389 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
390 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
391 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
392 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
393 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
394 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
395 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
396 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
397 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
398 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
399 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
400 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
401 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
402 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
403 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
404 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
405 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
406 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
407 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
408 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
409 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
410 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
411 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
412 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
413 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
414 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
415 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
416 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
417 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
418 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
419 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
420 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
421 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
422 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
423 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
424 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
425 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
426 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
427 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
428 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
429 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
430 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
431 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
432 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
433 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
434 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
435 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
436 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
437 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
438 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
439 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
440 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
441 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
442 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
443 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
444 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
445 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
446 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
447 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
448 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
449 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
450 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
451 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
452 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
453 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
454 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
455 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
456 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
457 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
458 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
459 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
460 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
461 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
462 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
463 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
464 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
465 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
466 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
467 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
468 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
469 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
470 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
471 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
472 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
473 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
474 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
475 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
476 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
477 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
478 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
479 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
480 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
481 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
482 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
483 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
484 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
485 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
486 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
487 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
488 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
489 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
490 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
491 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
492 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
493 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
494 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
495 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
496 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
497 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
498 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
499 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
500 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
501 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
502 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
503 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
504 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
505 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
506 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
507 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
508 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
509 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
510 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
511 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
512 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
513 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
514 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
515 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
516 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
517 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
518 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
519 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
520 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
521 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
522 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
523 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
534 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
536 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
538 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
539 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
540 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
541 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
542 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
543 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
544 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
545 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
546 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
547 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
548 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
549 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
550 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
551 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
552 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
553 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
554 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
557 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
558 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
559 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
560 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
561 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
562 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
563 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
564 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
565 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
566 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
567 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
568 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
569 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
570 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
571 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
572 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
573 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
574 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
575 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
576 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
577 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
578 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
579 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
580 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
581 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
582 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
583 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
584 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
585 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
586 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
587 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
588 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
589 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
592 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
593 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
594 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
595 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
596 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
597 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
598 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
599 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
600 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 0.22
Isolates 5.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 3.8
Nodule 0.06
Rhizoplane 5.64
Rhizosphere 81.06
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2631437 2162886007 Bacteria 1156
2 JGI24747J21853_1005997 3300001978 Bacteria 1138
3 JGI24739J22299_10029488 3300001989 Bacteria 1907
4 JGI24748J21848_1009022 3300002074 Bacteria 1174
5 JGI24749J21850_1002994 3300002076 Bacteria 2359
6 JGI24034J26672_10003696 3300002239 Bacteria 2139
7 JGI25162J39368_1000901 3300002737 Bacteria 19346
8 JGI25152J39213_1001221 3300002773 Bacteria 11759
9 JGI25151J46595_10027910 3300003187 Bacteria 2255
10 JGI25406J46586_10015116 3300003203 Bacteria 3263
11 JGI25406J46586_10021274 3300003203 Bacteria 2606
12 rootH1_10119622 3300003316 Unclassified 1324
13 rootH2_10131010 3300003320 Bacteria 4842
14 rootL2_10047765 3300003322 Bacteria 4750
15 rootH1_10016342 3300003323 Bacteria 2031
16 rootH1_10114839 3300003323 Bacteria 3033
17 Ga0006562J51391_1022123 3300003578 Bacteria 2707
18 Ga0055525_1000013 3300003759 Bacteria 440870
19 Ga0055537_1000164 3300003773 Bacteria 49285
20 Ga0055524_1023138 3300003775 Bacteria 2008
21 Ga0055524_1030846 3300003775 Bacteria 1555
22 Ga0055536_1008801 3300003781 Bacteria 4276
23 Ga0055534_1000026 3300003784 Bacteria 130908
24 Ga0055528_1000748 3300003790 Bacteria 22667
25 Ga0058692_1000012 3300003856 Bacteria 318930
26 Ga0065704_10070355 3300005289 Bacteria 30536
27 Ga0065704_10091180 3300005289 Bacteria 2735
28 Ga0065712_10071120 3300005290 Bacteria 5471
29 Ga0065715_10097407 3300005293 Bacteria 3710
30 Ga0065715_10111046 3300005293 Bacteria 2586
31 Ga0065715_10194193 3300005293 Bacteria 1391
32 Ga0065707_10003479 3300005295 Bacteria 5294
33 Ga0065707_10082235 3300005295 Bacteria 18552
34 Ga0065707_10106911 3300005295 Bacteria 2577
35 Ga0070658_10005452 3300005327 Bacteria 10315
36 Ga0070658_10367575 3300005327 Bacteria 1233
37 Ga0070658_10475911 3300005327 Bacteria 1077
38 Ga0070676_10000834 3300005328 Bacteria 15223
39 Ga0070676_10011250 3300005328 Bacteria 4865
40 Ga0070676_10111057 3300005328 Bacteria 1707
41 Ga0070683_100003457 3300005329 Bacteria 12830
42 Ga0070683_100012210 3300005329 Bacteria 7457
43 Ga0070683_100122593 3300005329 Bacteria 2456
44 Ga0070683_100131221 3300005329 Bacteria 2371
45 Ga0070683_100503871 3300005329 Bacteria 1157
46 Ga0070690_100010415 3300005330 Bacteria 5412
47 Ga0070690_100067068 3300005330 Bacteria 2324
48 Ga0070690_100405913 3300005330 Bacteria 1001
49 Ga0070670_100000750 3300005331 Bacteria 25161
50 Ga0070670_100004679 3300005331 Bacteria 11478
51 Ga0070670_100018426 3300005331 Bacteria 5990
52 Ga0070670_100024723 3300005331 Bacteria 5166
53 Ga0070670_100036121 3300005331 Bacteria 4253
54 Ga0070670_100108371 3300005331 Bacteria 2393
55 Ga0070670_100128152 3300005331 Bacteria 2190
56 Ga0070670_100153287 3300005331 Bacteria 1995
57 Ga0070670_100175294 3300005331 Bacteria 1861
58 Ga0070670_100357457 3300005331 Bacteria 1284
59 Ga0070670_100394812 3300005331 Bacteria 1220
60 Ga0070670_100489761 3300005331 Bacteria 1092
61 Ga0070677_10000899 3300005333 Bacteria 9791
62 Ga0070677_10007855 3300005333 Bacteria 3569
63 Ga0070677_10010637 3300005333 Bacteria 3151
64 Ga0068869_100009942 3300005334 Bacteria 6184
65 Ga0068869_100010913 3300005334 Bacteria 5944
66 Ga0068869_100017478 3300005334 Bacteria 4862
67 Ga0070666_10009663 3300005335 Bacteria 6022
68 Ga0070666_10022092 3300005335 Bacteria 4129
69 Ga0070666_10026167 3300005335 Bacteria 3809
70 Ga0070666_10098776 3300005335 Bacteria 2010
71 Ga0070680_100015220 3300005336 Bacteria 6026
72 Ga0070680_100025917 3300005336 Bacteria 4689
73 Ga0070680_100084159 3300005336 Bacteria 2627
74 Ga0070680_100093034 3300005336 Bacteria 2497
75 Ga0070680_100109579 3300005336 Bacteria 2298
76 Ga0070680_100202702 3300005336 Bacteria 1673
77 Ga0070682_100000168 3300005337 Bacteria 50136
78 Ga0070682_100005980 3300005337 Bacteria 6810
79 Ga0070682_100020067 3300005337 Bacteria 3929
80 Ga0068868_100000111 3300005338 Bacteria 50857
81 Ga0068868_100002161 3300005338 Bacteria 13569
82 Ga0068868_100034387 3300005338 Bacteria 3913
83 Ga0068868_100048891 3300005338 Bacteria 3319
84 Ga0068868_100085421 3300005338 Bacteria 2536
85 Ga0068868_100133028 3300005338 Bacteria 2037
86 Ga0068868_100194591 3300005338 Bacteria 1687
87 Ga0070660_100002113 3300005339 Bacteria 13705
88 Ga0070660_100002835 3300005339 Bacteria 11934
89 Ga0070660_100010603 3300005339 Bacteria 6514
90 Ga0070660_100011507 3300005339 Bacteria 6293
91 Ga0070660_100047704 3300005339 Bacteria 3287
92 Ga0070660_100104403 3300005339 Bacteria 2248
93 Ga0070660_100238083 3300005339 Bacteria 1482
94 Ga0070660_100334785 3300005339 Bacteria 1245
95 Ga0070689_100000779 3300005340 Bacteria 19555
96 Ga0070689_100000909 3300005340 Bacteria 18480
97 Ga0070689_100021356 3300005340 Bacteria 4819
98 Ga0070689_100073584 3300005340 Bacteria 2673
99 Ga0070689_100112596 3300005340 Bacteria 2166
100 Ga0070689_100211585 3300005340 Bacteria 1587
101 Ga0070689_100251961 3300005340 Bacteria 1457
102 Ga0070687_100002720 3300005343 Bacteria 6699
103 Ga0070687_100078676 3300005343 Bacteria 1793
104 Ga0070661_100001153 3300005344 Bacteria 18604
105 Ga0070661_100011729 3300005344 Bacteria 6114
106 Ga0070661_100019948 3300005344 Bacteria 4777
107 Ga0070661_100045364 3300005344 Bacteria 3213
108 Ga0070661_100104250 3300005344 Bacteria 2113
109 Ga0070661_100165207 3300005344 Bacteria 1678
110 Ga0070661_100321049 3300005344 Bacteria 1209
111 Ga0070692_10045636 3300005345 Bacteria 2261
112 Ga0070668_100004755 3300005347 Bacteria 10073
113 Ga0070668_100008946 3300005347 Bacteria 7434
114 Ga0070668_100009734 3300005347 Bacteria 7128
115 Ga0070668_100016576 3300005347 Bacteria 5508
116 Ga0070668_100038675 3300005347 Bacteria 3648
117 Ga0070668_100040962 3300005347 Bacteria 3547
118 Ga0070668_100065996 3300005347 Bacteria 2807
119 Ga0070668_100075209 3300005347 Bacteria 2636
120 Ga0070668_100081807 3300005347 Bacteria 2532
121 Ga0070668_100158360 3300005347 Bacteria 1836
122 Ga0070669_100035569 3300005353 Bacteria 3609
123 Ga0070669_100205394 3300005353 Bacteria 1552
124 Ga0070669_100212910 3300005353 Bacteria 1525
125 Ga0070675_100000309 3300005354 Bacteria 32752
126 Ga0070675_100000787 3300005354 Bacteria 22209
127 Ga0070675_100001895 3300005354 Bacteria 15437
128 Ga0070675_100018080 3300005354 Bacteria 5610
129 Ga0070675_100028390 3300005354 Bacteria 4503
130 Ga0070675_100079325 3300005354 Bacteria 2735
131 Ga0070675_100099053 3300005354 Bacteria 2453
132 Ga0070675_100183563 3300005354 Bacteria 1810
133 Ga0070671_100001487 3300005355 Bacteria 17515
134 Ga0070671_100004353 3300005355 Bacteria 11197
135 Ga0070671_100006355 3300005355 Bacteria 9430
136 Ga0070671_100014482 3300005355 Bacteria 6374
137 Ga0070671_100063813 3300005355 Bacteria 3068
138 Ga0070671_100099729 3300005355 Bacteria 2436
139 Ga0070671_100121315 3300005355 Bacteria 2200
140 Ga0070671_100129696 3300005355 Bacteria 2123
141 Ga0070671_100371323 3300005355 Bacteria 1222
142 Ga0070674_100001341 3300005356 Bacteria 12981
143 Ga0070674_100008152 3300005356 Bacteria 6217
144 Ga0070674_100019087 3300005356 Bacteria 4349
145 Ga0070674_100034972 3300005356 Bacteria 3361
146 Ga0070674_100154780 3300005356 Bacteria 1733
147 Ga0070673_100002952 3300005364 Bacteria 10482
148 Ga0070673_100025219 3300005364 Bacteria 4372
149 Ga0070673_100062891 3300005364 Bacteria 2951
150 Ga0070673_100074611 3300005364 Bacteria 2734
151 Ga0070673_100076248 3300005364 Bacteria 2707
152 Ga0070673_100128658 3300005364 Bacteria 2122
153 Ga0070673_100200636 3300005364 Bacteria 1718
154 Ga0070673_100532896 3300005364 Bacteria 1065
155 Ga0070688_100000521 3300005365 Bacteria 19436
156 Ga0070688_100002852 3300005365 Bacteria 8811
157 Ga0070659_100006667 3300005366 Bacteria 8345
158 Ga0070659_100016024 3300005366 Bacteria 5623
159 Ga0070659_100036258 3300005366 Bacteria 3844
160 Ga0070659_100037523 3300005366 Bacteria 3778
161 Ga0070659_100065471 3300005366 Bacteria 2878
162 Ga0070659_100101324 3300005366 Bacteria 2318
163 Ga0070659_100164349 3300005366 Bacteria 1816
164 Ga0070659_100234694 3300005366 Bacteria 1516
165 Ga0070659_100267901 3300005366 Bacteria 1418
166 Ga0070667_100039573 3300005367 Bacteria 3952
167 Ga0070667_100076147 3300005367 Bacteria 2865
168 Ga0070667_100099286 3300005367 Bacteria 2513
169 Ga0070667_100437103 3300005367 Bacteria 1194
170 Ga0070709_10000036 3300005434 Bacteria 109782
171 Ga0070709_10002889 3300005434 Bacteria 9264
172 Ga0070709_10022540 3300005434 Bacteria 3686
173 Ga0070709_10249537 3300005434 Bacteria 1278
174 Ga0070714_100004155 3300005435 Bacteria 10885
175 Ga0070714_100054443 3300005435 Bacteria 3418
176 Ga0070714_100124934 3300005435 Bacteria 2293
177 Ga0070714_100315816 3300005435 Bacteria 1460
178 Ga0070713_100000148 3300005436 Bacteria 46770
179 Ga0070713_100053481 3300005436 Bacteria 3346
180 Ga0070710_10000115 3300005437 Bacteria 37911
181 Ga0070710_10017264 3300005437 Bacteria 3690
182 Ga0070701_10016430 3300005438 Bacteria 3441
183 Ga0070701_10054793 3300005438 Bacteria 2080
184 Ga0070711_100000029 3300005439 Bacteria 101028
185 Ga0070711_100016777 3300005439 Bacteria 4655
186 Ga0070711_100017088 3300005439 Bacteria 4615
187 Ga0070711_100090330 3300005439 Bacteria 2206
188 Ga0070711_100143737 3300005439 Bacteria 1792
189 Ga0070705_100032792 3300005440 Unclassified 2889
190 Ga0070700_100012436 3300005441 Bacteria 4751
191 Ga0070700_100054831 3300005441 Bacteria 2493
192 Ga0070700_100082130 3300005441 Bacteria 2083
193 Ga0070700_100273987 3300005441 Bacteria 1221
194 Ga0070694_100014538 3300005444 Bacteria 4927
195 Ga0070694_100015451 3300005444 Bacteria 4797
196 Ga0070694_100034370 3300005444 Bacteria 3343
197 Ga0070708_100031969 3300005445 Bacteria 4560
198 Ga0070708_100063819 3300005445 Bacteria 3298
199 Ga0070708_100098924 3300005445 Bacteria 2668
200 Ga0070708_100151250 3300005445 Bacteria 2159
201 Ga0070708_100175221 3300005445 Bacteria 2004
202 Ga0070663_100004597 3300005455 Bacteria 8129
203 Ga0070663_100010776 3300005455 Bacteria 5708
204 Ga0070663_100076510 3300005455 Bacteria 2448
205 Ga0070663_100375302 3300005455 Bacteria 1157
206 Ga0070678_100003595 3300005456 Bacteria 8648
207 Ga0070678_100006528 3300005456 Bacteria 6851
208 Ga0070678_100138649 3300005456 Bacteria 1943
209 Ga0070678_100139608 3300005456 Bacteria 1937
210 Ga0070678_100168595 3300005456 Bacteria 1781
211 Ga0070662_100001756 3300005457 Bacteria 13349
212 Ga0070662_100004591 3300005457 Bacteria 8744
213 Ga0070662_100029025 3300005457 Bacteria 3856
214 Ga0070662_100107429 3300005457 Bacteria 2121
215 Ga0070662_100132139 3300005457 Bacteria 1926
216 Ga0070681_10011966 3300005458 Bacteria 8603
217 Ga0070681_10011971 3300005458 Bacteria 8602
218 Ga0070681_10052326 3300005458 Bacteria 4072
219 Ga0070681_10114895 3300005458 Bacteria 2630
220 Ga0070681_10157808 3300005458 Bacteria 2193
221 Ga0070681_10204918 3300005458 Bacteria 1890
222 Ga0070681_10676884 3300005458 Bacteria 947
223 Ga0068867_100002745 3300005459 Bacteria 12407
224 Ga0068867_100010756 3300005459 Bacteria 6454
225 Ga0068867_100045351 3300005459 Bacteria 3224
226 Ga0068867_100431334 3300005459 Bacteria 1119
227 Ga0070685_10001540 3300005466 Bacteria 12159
228 Ga0070685_10171912 3300005466 Bacteria 1389
229 Ga0070706_100004892 3300005467 Bacteria 12822
230 Ga0070706_100528721 3300005467 Bacteria 1097
231 Ga0070707_100023290 3300005468 Bacteria 5858
232 Ga0070707_100076582 3300005468 Unclassified 3227
233 Ga0070707_100101926 3300005468 Bacteria 2782
234 Ga0070698_100024526 3300005471 Bacteria 6292
235 Ga0070698_100046264 3300005471 Unclassified 4449
236 Ga0070698_100349176 3300005471 Bacteria 1411
237 Ga0070699_100009308 3300005518 Bacteria 8508
238 Ga0070699_100021522 3300005518 Bacteria 5561
239 Ga0070699_100069868 3300005518 Unclassified 3052
240 Ga0070699_100122061 3300005518 Bacteria 2292
241 Ga0070699_100239802 3300005518 Bacteria 1618
242 Ga0070699_100375434 3300005518 Bacteria 1283
243 Ga0070699_100522283 3300005518 Bacteria 1079
244 Ga0070699_100618564 3300005518 Bacteria 988
245 Ga0070679_100003207 3300005530 Bacteria 14944
246 Ga0070679_100023799 3300005530 Bacteria 6001
247 Ga0070679_100052768 3300005530 Bacteria 4048
248 Ga0070679_100084243 3300005530 Bacteria 3167
249 Ga0070679_100213343 3300005530 Bacteria 1893
250 Ga0070684_100009746 3300005535 Bacteria 7582
251 Ga0070684_100028927 3300005535 Bacteria 4691
252 Ga0070684_100068217 3300005535 Bacteria 3125
253 Ga0068853_100001138 3300005539 Bacteria 18828
254 Ga0068853_100012919 3300005539 Bacteria 6806
255 Ga0068853_100026476 3300005539 Bacteria 4869
256 Ga0068853_100028355 3300005539 Bacteria 4709
257 Ga0068853_100049554 3300005539 Bacteria 3609
258 Ga0068853_100211417 3300005539 Bacteria 1768
259 Ga0068853_100329938 3300005539 Bacteria 1415
260 Ga0068853_100450455 3300005539 Bacteria 1210
261 Ga0070672_100000414 3300005543 Bacteria 24728
262 Ga0070672_100000486 3300005543 Bacteria 23097
263 Ga0070672_100005648 3300005543 Bacteria 8322
264 Ga0070672_100018497 3300005543 Bacteria 5038
265 Ga0070672_100118952 3300005543 Bacteria 2160
266 Ga0070672_100165625 3300005543 Bacteria 1836
267 Ga0070672_100462288 3300005543 Bacteria 1094
268 Ga0070672_100574033 3300005543 Bacteria 981
269 Ga0070686_100009361 3300005544 Bacteria 5505
270 Ga0070686_100054066 3300005544 Bacteria 2567
271 Ga0070686_100221669 3300005544 Bacteria 1367
272 Ga0070695_100019170 3300005545 Bacteria 4162
273 Ga0070695_100125071 3300005545 Bacteria 1765
274 Ga0070696_100011025 3300005546 Bacteria 6053
275 Ga0070696_100060592 3300005546 Bacteria 2646
276 Ga0070696_100143748 3300005546 Bacteria 1746
277 Ga0070696_100370959 3300005546 Bacteria 1113
278 Ga0070693_100055546 3300005547 Bacteria 2281
279 Ga0070693_100060780 3300005547 Bacteria 2194
280 Ga0070693_100063397 3300005547 Bacteria 2154
281 Ga0070693_100156990 3300005547 Bacteria 1446
282 Ga0070693_100332400 3300005547 Bacteria 1035
283 Ga0070665_100008988 3300005548 Bacteria 10121
284 Ga0070665_100024630 3300005548 Bacteria 6064
285 Ga0070665_100028180 3300005548 Bacteria 5656
286 Ga0070665_100029890 3300005548 Bacteria 5483
287 Ga0070665_100055565 3300005548 Bacteria 3970
288 Ga0070665_100198905 3300005548 Bacteria 2005
289 Ga0070665_100399674 3300005548 Bacteria 1382
290 Ga0070704_100110977 3300005549 Bacteria 2087
291 Ga0070704_100123588 3300005549 Bacteria 1993
292 Ga0070704_100291184 3300005549 Bacteria 1357
293 Ga0068855_100000418 3300005563 Bacteria 52788
294 Ga0068855_100002094 3300005563 Bacteria 24690
295 Ga0068855_100004040 3300005563 Bacteria 17906
296 Ga0068855_100033476 3300005563 Bacteria 6133
297 Ga0068855_100055211 3300005563 Bacteria 4666
298 Ga0068855_100093730 3300005563 Bacteria 3463
299 Ga0068855_100260062 3300005563 Bacteria 1934
300 Ga0068855_100496924 3300005563 Bacteria 1326
301 Ga0070664_100000136 3300005564 Bacteria 49325
302 Ga0070664_100000452 3300005564 Bacteria 31099
303 Ga0070664_100005148 3300005564 Bacteria 10494
304 Ga0070664_100005519 3300005564 Bacteria 10154
305 Ga0070664_100034938 3300005564 Bacteria 4218
306 Ga0070664_100039326 3300005564 Bacteria 3985
307 Ga0070664_100081217 3300005564 Bacteria 2793
308 Ga0070664_100137558 3300005564 Bacteria 2149
309 Ga0070664_100183606 3300005564 Bacteria 1860
310 Ga0070664_100226563 3300005564 Bacteria 1674
311 Ga0070664_100289486 3300005564 Bacteria 1478
312 Ga0068857_100000271 3300005577 Bacteria 35241
313 Ga0068857_100021740 3300005577 Bacteria 5646
314 Ga0068857_100027250 3300005577 Bacteria 5039
315 Ga0068857_100046312 3300005577 Bacteria 3859
316 Ga0068857_100301231 3300005577 Bacteria 1478
317 Ga0068854_100010432 3300005578 Bacteria 6025
318 Ga0068854_100026833 3300005578 Bacteria 3963
319 Ga0068854_100051280 3300005578 Bacteria 2956
320 Ga0068854_100451711 3300005578 Bacteria 1073
321 Ga0068856_100002662 3300005614 Bacteria 18314
322 Ga0068856_100005148 3300005614 Bacteria 12910
323 Ga0068856_100011558 3300005614 Bacteria 8563
324 Ga0068856_100023876 3300005614 Bacteria 5948
325 Ga0068856_100187288 3300005614 Bacteria 2083
326 Ga0068856_100235153 3300005614 Bacteria 1848
327 Ga0068856_100354049 3300005614 Bacteria 1487
328 Ga0070702_100100289 3300005615 Bacteria 1775
329 Ga0070702_100162288 3300005615 Bacteria 1446
330 Ga0068852_100001602 3300005616 Bacteria 15397
331 Ga0068852_100003611 3300005616 Bacteria 10828
332 Ga0068852_100007212 3300005616 Bacteria 8106
333 Ga0068852_100009962 3300005616 Bacteria 7072
334 Ga0068852_100025722 3300005616 Bacteria 4773
335 Ga0068852_100061379 3300005616 Bacteria 3267
336 Ga0068852_100119728 3300005616 Bacteria 2407
337 Ga0068852_100598153 3300005616 Bacteria 1107
338 Ga0068852_100768268 3300005616 Bacteria 976
339 Ga0068859_100002639 3300005617 Bacteria 18240
340 Ga0068859_100028111 3300005617 Bacteria 5638
341 Ga0068859_100220318 3300005617 Bacteria 1985
342 Ga0068859_100255222 3300005617 Bacteria 1844
343 Ga0068859_100280537 3300005617 Bacteria 1759
344 Ga0068859_100457833 3300005617 Bacteria 1372
345 Ga0068864_100000034 3300005618 Bacteria 199411
346 Ga0068864_100010778 3300005618 Bacteria 7553
347 Ga0068864_100012827 3300005618 Bacteria 6931
348 Ga0068864_100015982 3300005618 Bacteria 6245
349 Ga0068864_100290175 3300005618 Bacteria 1529
350 Ga0068866_10003961 3300005718 Bacteria 6080
351 Ga0068866_10328334 3300005718 Bacteria 965
352 Ga0068861_100003776 3300005719 Bacteria 10114
353 Ga0068861_100009118 3300005719 Bacteria 6841
354 Ga0068861_100021580 3300005719 Bacteria 4629
355 Ga0068861_100023045 3300005719 Bacteria 4489
356 Ga0068861_100047853 3300005719 Bacteria 3230
357 Ga0068861_100091389 3300005719 Bacteria 2403
358 Ga0068861_100278666 3300005719 Bacteria 1439
359 Ga0068851_10002104 3300005834 Bacteria 8758
360 Ga0068851_10002365 3300005834 Bacteria 8292
361 Ga0068851_10022695 3300005834 Bacteria 3061
362 Ga0068851_10076538 3300005834 Bacteria 1740
363 Ga0068851_10115309 3300005834 Bacteria 1439
364 Ga0068851_10171127 3300005834 Bacteria 1199
365 Ga0068870_10001310 3300005840 Bacteria 10023
366 Ga0068870_10005059 3300005840 Bacteria 5728
367 Ga0068870_10035866 3300005840 Bacteria 2548
368 Ga0068870_10074218 3300005840 Bacteria 1863
369 Ga0068863_100000966 3300005841 Bacteria 28912
370 Ga0068863_100011674 3300005841 Bacteria 8497
371 Ga0068863_100030463 3300005841 Bacteria 5152
372 Ga0068863_100099173 3300005841 Bacteria 2767
373 Ga0068863_100112653 3300005841 Bacteria 2591
374 Ga0068863_100153893 3300005841 Bacteria 2201
375 Ga0068863_100261421 3300005841 Bacteria 1673
376 Ga0068858_100003742 3300005842 Bacteria 15055
377 Ga0068858_100020530 3300005842 Bacteria 6173
378 Ga0068858_100047736 3300005842 Bacteria 3969
379 Ga0068858_100069531 3300005842 Bacteria 3264
380 Ga0068858_100081796 3300005842 Bacteria 3002
381 Ga0068858_100095644 3300005842 Bacteria 2768
382 Ga0068858_100194731 3300005842 Bacteria 1915
383 Ga0068858_100288446 3300005842 Bacteria 1564
384 Ga0068858_100504899 3300005842 Bacteria 1168
385 Ga0068860_100027056 3300005843 Bacteria 5526
386 Ga0068860_100047070 3300005843 Bacteria 4111
387 Ga0068860_100235175 3300005843 Bacteria 1781
388 Ga0068860_100509560 3300005843 Bacteria 1202
389 Ga0068860_100557183 3300005843 Bacteria 1149
390 Ga0068860_100939636 3300005843 Bacteria 882
391 Ga0068862_100000636 3300005844 Bacteria 36346
392 Ga0068862_100009443 3300005844 Bacteria 8069
393 Ga0068862_100009944 3300005844 Bacteria 7859
394 Ga0068862_100183943 3300005844 Bacteria 1877
395 Ga0068862_100251899 3300005844 Bacteria 1609
396 Ga0068862_100284723 3300005844 Bacteria 1516
397 Ga0068862_100351844 3300005844 Unclassified 1367
398 Ga0081455_10005634 3300005937 Bacteria 13677
399 Ga0081538_10011849 3300005981 Bacteria 7040
400 Ga0081539_10000760 3300005985 Bacteria 63804
401 Ga0081539_10009935 3300005985 Bacteria 7847
402 Ga0081539_10012106 3300005985 Bacteria 6703
403 Ga0070717_10007851 3300006028 Bacteria 7943
404 Ga0070717_10016913 3300006028 Bacteria 5663
405 Ga0075365_10015357 3300006038 Bacteria 4631
406 Ga0075365_10025733 3300006038 Bacteria 3728
407 Ga0075365_10259306 3300006038 Bacteria 1222
408 Ga0075363_100015519 3300006048 Bacteria 3746
409 Ga0075364_10049854 3300006051 Bacteria 2731
410 Ga0075364_10137913 3300006051 Bacteria 1639
411 Ga0070716_100104013 3300006173 Bacteria 1747
412 Ga0070712_100373205 3300006175 Bacteria 1173
413 Ga0075367_10020625 3300006178 Bacteria 3673
414 Ga0075366_10188498 3300006195 Bacteria 1253
415 Ga0097621_100001752 3300006237 Bacteria 14870
416 Ga0097621_100017172 3300006237 Bacteria 5491
417 Ga0097621_100054448 3300006237 Bacteria 3263
418 Ga0097621_100056567 3300006237 Bacteria 3205
419 Ga0097621_100058650 3300006237 Bacteria 3149
420 Ga0097621_100060218 3300006237 Bacteria 3112
421 Ga0097621_100065182 3300006237 Bacteria 2997
422 Ga0097621_100473726 3300006237 Bacteria 1131
423 Ga0097621_100639878 3300006237 Bacteria 975
424 Ga0075370_10009295 3300006353 Bacteria 5101
425 Ga0075370_10075351 3300006353 Bacteria 1934
426 Ga0068871_100006211 3300006358 Bacteria 8424
427 Ga0068871_100022878 3300006358 Bacteria 4824
428 Ga0068871_100077819 3300006358 Bacteria 2742
429 Ga0068871_100219868 3300006358 Bacteria 1645
430 Ga0068871_100247785 3300006358 Bacteria 1551
431 Ga0075428_100000313 3300006844 Bacteria 47841
432 Ga0075428_100006604 3300006844 Bacteria 12903
433 Ga0075428_100102793 3300006844 Bacteria 3116
434 Ga0075428_100200678 3300006844 Bacteria 2156
435 Ga0075428_100260302 3300006844 Bacteria 1868
436 Ga0075428_100269587 3300006844 Bacteria 1832
437 Ga0075428_100843395 3300006844 Bacteria 973
438 Ga0075430_100001872 3300006846 Bacteria 17221
439 Ga0075430_100003277 3300006846 Bacteria 13574
440 Ga0075430_100015989 3300006846 Bacteria 6390
441 Ga0075430_100018449 3300006846 Bacteria 5936
442 Ga0075430_100073138 3300006846 Bacteria 2875
443 Ga0075430_100161214 3300006846 Bacteria 1867
444 Ga0075430_100549682 3300006846 Bacteria 952
445 Ga0075431_100000035 3300006847 Bacteria 70355
446 Ga0075431_100013588 3300006847 Bacteria 8227
447 Ga0075431_100015765 3300006847 Bacteria 7663
448 Ga0075431_100018446 3300006847 Bacteria 7105
449 Ga0075431_100132435 3300006847 Bacteria 2571
450 Ga0075431_100228393 3300006847 Unclassified 1897
451 Ga0075433_10061356 3300006852 Bacteria 3293
452 Ga0075433_10101124 3300006852 Bacteria 2553
453 Ga0075434_100037527 3300006871 Bacteria 4797
454 Ga0075434_100107697 3300006871 Bacteria 2797
455 Ga0075434_100551790 3300006871 Bacteria 1172
456 Ga0075429_100000937 3300006880 Bacteria 23079
457 Ga0075429_100003909 3300006880 Bacteria 12731
458 Ga0075429_100007779 3300006880 Bacteria 9308
459 Ga0075429_100009974 3300006880 Bacteria 8233
460 Ga0075429_100112698 3300006880 Bacteria 2377
461 Ga0075429_100232722 3300006880 Bacteria 1614
462 Ga0068865_100044392 3300006881 Bacteria 3042
463 Ga0068865_100059225 3300006881 Bacteria 2678
464 Ga0068865_100076095 3300006881 Bacteria 2395
465 Ga0068865_100239770 3300006881 Bacteria 1426
466 Ga0068865_100344001 3300006881 Bacteria 1206
467 Ga0075436_100004424 3300006914 Bacteria 9647
468 Ga0075436_100193153 3300006914 Bacteria 1441
469 Ga0097620_100002639 3300006931 Bacteria 18240
470 Ga0097620_100028111 3300006931 Bacteria 5638
471 Ga0097620_100220334 3300006931 Bacteria 1985
472 Ga0097620_100255237 3300006931 Bacteria 1844
473 Ga0097620_100280547 3300006931 Bacteria 1759
474 Ga0097620_100457816 3300006931 Bacteria 1372
475 Ga0099826_10026478 3300006948 Bacteria 4278
476 Ga0075435_100008286 3300007076 Bacteria 7449
477 Ga0099794_10196166 3300007265 Bacteria 1033
478 Ga0105251_10000261 3300009011 Bacteria 52880
479 Ga0105251_10036316 3300009011 Bacteria 2425
480 Ga0105244_10064169 3300009036 Bacteria 1843
481 Ga0105240_10000463 3300009093 Bacteria 74767
482 Ga0105240_10005467 3300009093 Bacteria 18939
483 Ga0105240_10016657 3300009093 Bacteria 9941
484 Ga0105240_10021739 3300009093 Bacteria 8525
485 Ga0105240_10025318 3300009093 Bacteria 7800
486 Ga0105240_10121688 3300009093 Bacteria 3142
487 Ga0111539_10002396 3300009094 Bacteria 24917
488 Ga0111539_10015958 3300009094 Bacteria 9331
489 Ga0111539_10020077 3300009094 Bacteria 8231
490 Ga0111539_10226404 3300009094 Bacteria 2178
491 Ga0111539_10583964 3300009094 Bacteria 1301
492 Ga0105245_10000284 3300009098 Bacteria 48293
493 Ga0105245_10002175 3300009098 Bacteria 17760
494 Ga0105245_10033521 3300009098 Bacteria 4553
495 Ga0105245_10061693 3300009098 Bacteria 3380
496 Ga0105245_10135198 3300009098 Bacteria 2316
497 Ga0105247_10364351 3300009101 Bacteria 1020
498 Ga0114129_10000407 3300009147 Bacteria 50629
499 Ga0114129_10004942 3300009147 Bacteria 18798
500 Ga0114129_10018631 3300009147 Bacteria 9882
501 Ga0114129_10043627 3300009147 Bacteria 6309
502 Ga0114129_10081904 3300009147 Bacteria 4486
503 Ga0114129_10370672 3300009147 Bacteria 1892
504 Ga0114129_10492033 3300009147 Bacteria 1603
505 Ga0105243_10014388 3300009148 Bacteria 5989
506 Ga0105243_10017625 3300009148 Bacteria 5402
507 Ga0105243_10030466 3300009148 Bacteria 4154
508 Ga0105243_10034597 3300009148 Bacteria 3913
509 Ga0105243_10229910 3300009148 Bacteria 1645
510 Ga0105243_10294928 3300009148 Bacteria 1467
511 Ga0105243_10430632 3300009148 Bacteria 1233
512 Ga0105241_10001727 3300009174 Bacteria 16585
513 Ga0105241_10049719 3300009174 Bacteria 3194
514 Ga0105241_10428828 3300009174 Bacteria 1165
515 Ga0105241_10560987 3300009174 Bacteria 1027
516 Ga0105242_10039729 3300009176 Bacteria 3788
517 Ga0105242_10154332 3300009176 Bacteria 2004
518 Ga0105242_10327196 3300009176 Bacteria 1408
519 Ga0105242_10404365 3300009176 Bacteria 1275
520 Ga0105248_10003094 3300009177 Bacteria 18444
521 Ga0105248_10005709 3300009177 Bacteria 13664
522 Ga0105248_10259488 3300009177 Bacteria 1956
523 Ga0105248_10272171 3300009177 Bacteria 1907
524 Ga0105248_10425554 3300009177 Bacteria 1495
525 Ga0105237_10004560 3300009545 Bacteria 15996
526 Ga0105237_10015715 3300009545 Bacteria 7869
527 Ga0105237_10164163 3300009545 Bacteria 2220
528 Ga0105237_10165436 3300009545 Bacteria 2211
529 Ga0105237_10366260 3300009545 Bacteria 1446
530 Ga0105238_10002021 3300009551 Bacteria 20477
531 Ga0105238_10040924 3300009551 Bacteria 4695
532 Ga0105238_10337555 3300009551 Bacteria 1494
533 Ga0105238_10551981 3300009551 Bacteria 1156
534 Ga0105249_10013352 3300009553 Bacteria 7253
535 Ga0105249_10016378 3300009553 Bacteria 6576
536 Ga0105249_10030383 3300009553 Bacteria 4884
537 Ga0105249_10144972 3300009553 Bacteria 2280
538 Ga0105249_10356235 3300009553 Bacteria 1483
539 Ga0105032_101063 3300009979 Bacteria 2562
540 Ga0099796_10034850 3300010159 Bacteria 1665
541 Ga0105239_10062626 3300010375 Bacteria 4083
542 Ga0105239_10122990 3300010375 Bacteria 2883
543 Ga0105239_10435864 3300010375 Bacteria 1485
544 Ga0105239_10491505 3300010375 Bacteria 1395
545 Ga0105239_10659812 3300010375 Bacteria 1195
546 Ga0105239_10866579 3300010375 Bacteria 1036
547 Ga0105246_10015274 3300011119 Bacteria 4845
548 Ga0105246_10040446 3300011119 Bacteria 3146
549 Ga0105246_10057019 3300011119 Bacteria 2702
550 Ga0105246_10060438 3300011119 Bacteria 2633
551 Ga0105246_10086451 3300011119 Bacteria 2248
552 Ga0105246_10289526 3300011119 Bacteria 1317
553 Ga0157373_10000950 3300013100 Bacteria 22473
554 Ga0157373_10002118 3300013100 Bacteria 15024
555 Ga0157373_10031989 3300013100 Bacteria 3788
556 Ga0157371_10000354 3300013102 Bacteria 58515
557 Ga0157371_10003827 3300013102 Bacteria 13434
558 Ga0157371_10012445 3300013102 Bacteria 6502
559 Ga0157371_10030522 3300013102 Bacteria 3889
560 Ga0157370_10006412 3300013104 Bacteria 12977
561 Ga0157370_10008040 3300013104 Bacteria 11425
562 Ga0157370_10024251 3300013104 Bacteria 6009
563 Ga0157370_10037832 3300013104 Bacteria 4672
564 Ga0157370_10093371 3300013104 Bacteria 2824
565 Ga0157370_10114930 3300013104 Bacteria 2514
566 Ga0157370_10166936 3300013104 Bacteria 2047
567 Ga0157370_10168518 3300013104 Bacteria 2036
568 Ga0157370_10230755 3300013104 Bacteria 1713
569 Ga0157370_10695434 3300013104 Bacteria 928
570 Ga0157369_10003584 3300013105 Bacteria 18441
571 Ga0157369_10006086 3300013105 Bacteria 14001
572 Ga0157369_10015066 3300013105 Bacteria 8727
573 Ga0157369_10031499 3300013105 Bacteria 5838
574 Ga0157369_10037862 3300013105 Bacteria 5277
575 Ga0157369_10046030 3300013105 Bacteria 4743
576 Ga0157369_10060944 3300013105 Bacteria 4068
577 Ga0157369_10101144 3300013105 Bacteria 3072
578 Ga0157369_10146365 3300013105 Bacteria 2498
579 Ga0157369_10284511 3300013105 Bacteria 1722
580 Ga0157369_10597577 3300013105 Bacteria 1139
581 Ga0157374_10039568 3300013296 Bacteria 4339
582 Ga0157374_10118321 3300013296 Bacteria 2555
583 Ga0157378_10130776 3300013297 Bacteria 2323
584 Ga0157378_10165204 3300013297 Bacteria 2073
585 Ga0157378_10166723 3300013297 Bacteria 2064
586 Ga0157378_10212644 3300013297 Bacteria 1834
587 Ga0157378_10219146 3300013297 Bacteria 1808
588 Ga0163162_10000004 3300013306 Bacteria 505593
589 Ga0163162_10017618 3300013306 Bacteria 6988
590 Ga0163162_10030312 3300013306 Bacteria 5360
591 Ga0163162_10060843 3300013306 Bacteria 3813
592 Ga0163162_10118890 3300013306 Bacteria 2745
593 Ga0163162_10147681 3300013306 Bacteria 2468
594 Ga0163162_10192046 3300013306 Bacteria 2170
595 Ga0163162_10211746 3300013306 Bacteria 2068
596 Ga0163162_10277191 3300013306 Bacteria 1809
597 Ga0163162_10595729 3300013306 Bacteria 1232
598 Ga0163162_10855916 3300013306 Bacteria 1024
599 Ga0157372_10001786 3300013307 Bacteria 23354
600 Ga0157372_10002030 3300013307 Bacteria 22017
601 Ga0157372_10022638 3300013307 Bacteria 6802
602 Ga0157372_10089089 3300013307 Bacteria 3505
603 Ga0157372_10136640 3300013307 Bacteria 2823
604 Ga0157372_10140568 3300013307 Bacteria 2781
605 Ga0157372_10181570 3300013307 Bacteria 2436
606 Ga0157372_10184470 3300013307 Bacteria 2416
607 Ga0157372_10187040 3300013307 Bacteria 2398
608 Ga0157375_10004827 3300013308 Bacteria 11710
609 Ga0157375_10006843 3300013308 Bacteria 9934
610 Ga0157375_10017904 3300013308 Bacteria 6409
611 Ga0157375_10052031 3300013308 Bacteria 4024
612 Ga0157375_10126198 3300013308 Bacteria 2674
613 Ga0157375_10136388 3300013308 Bacteria 2578
614 Ga0157375_10204122 3300013308 Bacteria 2133
615 Ga0157375_10206506 3300013308 Bacteria 2121
616 Ga0157375_10223663 3300013308 Bacteria 2041
617 Ga0157375_10861507 3300013308 Bacteria 1052
618 Ga0163163_10000815 3300014325 Bacteria 26528
619 Ga0163163_10040136 3300014325 Bacteria 4570
620 Ga0163163_10050890 3300014325 Bacteria 4081
621 Ga0163163_10125073 3300014325 Bacteria 2609
622 Ga0163163_10377757 3300014325 Bacteria 1475
623 Ga0163163_10422563 3300014325 Bacteria 1392
624 Ga0163163_10784384 3300014325 Bacteria 1016
625 Ga0157380_10001539 3300014326 Bacteria 15145
626 Ga0157380_10005164 3300014326 Bacteria 9126
627 Ga0157380_10085232 3300014326 Bacteria 2592
628 Ga0157380_10114814 3300014326 Bacteria 2270
629 Ga0157380_10264671 3300014326 Bacteria 1564
630 Ga0157380_10285507 3300014326 Bacteria 1512
631 Ga0157380_10644480 3300014326 Bacteria 1056
632 Ga0157377_10000062 3300014745 Bacteria 81937
633 Ga0157377_10008372 3300014745 Bacteria 5043
634 Ga0157377_10063955 3300014745 Bacteria 2109
635 Ga0157377_10276231 3300014745 Bacteria 1099
636 Ga0157379_10008849 3300014968 Bacteria 8780
637 Ga0157379_10036665 3300014968 Bacteria 4372
638 Ga0157376_10015154 3300014969 Bacteria 5813
639 Ga0157376_10016125 3300014969 Bacteria 5664
640 Ga0157376_10093301 3300014969 Bacteria 2613
641 Ga0157376_10265210 3300014969 Bacteria 1611
642 Ga0157376_10715510 3300014969 Bacteria 1008
643 Ga0157376_10813407 3300014969 Bacteria 948
644 Ga0182006_1013303 3300015261 Bacteria 3573
645 Ga0182006_1078273 3300015261 Bacteria 1211
646 Ga0182007_10000098 3300015262 Bacteria 61202
647 Ga0182005_1000311 3300015265 Bacteria 29429
648 Ga0183369_1015 3300015685 Bacteria 176552
649 Ga0163161_10004013 3300017792 Bacteria 10300
650 Ga0163161_10055800 3300017792 Bacteria 2868
651 Ga0163161_10122114 3300017792 Bacteria 1958
652 Ga0163161_10147680 3300017792 Bacteria 1785
653 Ga0163161_10152835 3300017792 Bacteria 1755
654 Ga0206354_11579096 3300020081 Bacteria 1175
655 Ga0213872_10000198 3300021361 Bacteria 53480
656 Ga0213876_10021545 3300021384 Bacteria 3408
657 Ga0213876_10157735 3300021384 Bacteria 1207
658 Ga0209566_100924 3300025225 Bacteria 13668
659 Ga0209563_100025 3300025230 Bacteria 596456
660 Ga0207425_1029520 3300025245 Bacteria 1105
661 Ga0209677_101516 3300025253 Bacteria 9944
662 Ga0209129_1000064 3300025258 Bacteria 236026
663 Ga0209565_1000022 3300025263 Bacteria 390888
664 Ga0207666_1005762 3300025271 Bacteria 1589
665 Ga0209673_1000110 3300025273 Bacteria 181173
666 Ga0207673_1005002 3300025290 Bacteria 1604
667 Ga0209675_1000060 3300025291 Bacteria 184316
668 Ga0209676_1000219 3300025292 Bacteria 125330
669 Ga0209676_1000279 3300025292 Bacteria 106358
670 Ga0209676_1000969 3300025292 Bacteria 34541
671 Ga0209025_1001016 3300025294 Bacteria 41317
672 Ga0209564_1000304 3300025295 Bacteria 97304
673 Ga0209050_1000542 3300025298 Bacteria 62500
674 Ga0209050_1000825 3300025298 Bacteria 43030
675 Ga0209256_1002825 3300025299 Bacteria 13266
676 Ga0209256_1004280 3300025299 Bacteria 9095
677 Ga0209256_1008488 3300025299 Bacteria 4752
678 Ga0209257_1000251 3300025304 Bacteria 123796
679 Ga0209257_1000726 3300025304 Bacteria 50193
680 Ga0209257_1003684 3300025304 Bacteria 12784
681 Ga0207697_10000964 3300025315 Bacteria 16191
682 Ga0207697_10020151 3300025315 Bacteria 2731
683 Ga0207656_10000979 3300025321 Bacteria 9307
684 Ga0207656_10049903 3300025321 Bacteria 1806
685 Ga0207656_10052820 3300025321 Bacteria 1761
686 Ga0207656_10075918 3300025321 Bacteria 1502
687 Ga0207656_10123922 3300025321 Bacteria 1205
688 Ga0207655_1000988 3300025728 Bacteria 29048
689 Ga0207655_1036302 3300025728 Bacteria 2187
690 Ga0207713_1000598 3300025735 Bacteria 35526
691 Ga0207713_1037313 3300025735 Bacteria 2073
692 Ga0207682_10000782 3300025893 Bacteria 14719
693 Ga0207682_10000895 3300025893 Bacteria 13797
694 Ga0207682_10001163 3300025893 Bacteria 12207
695 Ga0207682_10012609 3300025893 Bacteria 3298
696 Ga0207682_10021196 3300025893 Bacteria 2556
697 Ga0207692_10000903 3300025898 Bacteria 10743
698 Ga0207692_10075658 3300025898 Bacteria 1787
699 Ga0207688_10008843 3300025901 Bacteria 5480
700 Ga0207688_10032129 3300025901 Bacteria 2900
701 Ga0207688_10033800 3300025901 Bacteria 2829
702 Ga0207688_10067304 3300025901 Bacteria 2027
703 Ga0207688_10121295 3300025901 Bacteria 1526
704 Ga0207680_10005628 3300025903 Bacteria 5997
705 Ga0207680_10011759 3300025903 Bacteria 4434
706 Ga0207680_10019884 3300025903 Bacteria 3601
707 Ga0207647_10066191 3300025904 Bacteria 2192
708 Ga0207699_10000078 3300025906 Bacteria 76220
709 Ga0207699_10010710 3300025906 Bacteria 4611
710 Ga0207699_10096777 3300025906 Bacteria 1864
711 Ga0207645_10000982 3300025907 Bacteria 23565
712 Ga0207645_10003714 3300025907 Bacteria 11497
713 Ga0207643_10000251 3300025908 Bacteria 37540
714 Ga0207643_10003541 3300025908 Bacteria 8406
715 Ga0207643_10056067 3300025908 Bacteria 2241
716 Ga0207643_10120490 3300025908 Bacteria 1554
717 Ga0207643_10129307 3300025908 Bacteria 1501
718 Ga0207643_10135694 3300025908 Bacteria 1467
719 Ga0207705_10415303 3300025909 Bacteria 1041
720 Ga0207684_10002367 3300025910 Bacteria 19084
721 Ga0207654_10013753 3300025911 Bacteria 4169
722 Ga0207707_10002784 3300025912 Bacteria 15597
723 Ga0207707_10060720 3300025912 Bacteria 3288
724 Ga0207707_10102342 3300025912 Bacteria 2503
725 Ga0207707_10146648 3300025912 Bacteria 2063
726 Ga0207695_10000868 3300025913 Bacteria 55031
727 Ga0207695_10020549 3300025913 Bacteria 7559
728 Ga0207695_10026577 3300025913 Bacteria 6460
729 Ga0207695_10043588 3300025913 Bacteria 4781
730 Ga0207671_10014604 3300025914 Bacteria 6196
731 Ga0207693_10045157 3300025915 Bacteria 3462
732 Ga0207693_10101165 3300025915 Bacteria 2260
733 Ga0207693_10209203 3300025915 Bacteria 1533
734 Ga0207693_10367455 3300025915 Bacteria 1125
735 Ga0207663_10000050 3300025916 Bacteria 63105
736 Ga0207663_10012965 3300025916 Bacteria 4521
737 Ga0207663_10013274 3300025916 Bacteria 4475
738 Ga0207663_10151997 3300025916 Bacteria 1625
739 Ga0207660_10039944 3300025917 Bacteria 3282
740 Ga0207660_10043270 3300025917 Bacteria 3164
741 Ga0207660_10058125 3300025917 Bacteria 2772
742 Ga0207660_10071694 3300025917 Bacteria 2521
743 Ga0207662_10001682 3300025918 Bacteria 10820
744 Ga0207662_10075188 3300025918 Bacteria 2052
745 Ga0207657_10000428 3300025919 Bacteria 44668
746 Ga0207657_10001329 3300025919 Bacteria 26244
747 Ga0207657_10010544 3300025919 Bacteria 9214
748 Ga0207657_10013585 3300025919 Bacteria 7987
749 Ga0207657_10040119 3300025919 Bacteria 4151
750 Ga0207657_10041951 3300025919 Bacteria 4041
751 Ga0207649_10001669 3300025920 Bacteria 12840
752 Ga0207649_10012035 3300025920 Bacteria 4787
753 Ga0207649_10014334 3300025920 Bacteria 4436
754 Ga0207649_10030162 3300025920 Bacteria 3209
755 Ga0207649_10077838 3300025920 Bacteria 2138
756 Ga0207652_10008090 3300025921 Bacteria 8442
757 Ga0207652_10036760 3300025921 Bacteria 4141
758 Ga0207652_10063451 3300025921 Bacteria 3195
759 Ga0207652_10091390 3300025921 Bacteria 2677
760 Ga0207652_10144493 3300025921 Bacteria 2128
761 Ga0207652_10165852 3300025921 Bacteria 1981
762 Ga0207646_10097038 3300025922 Bacteria 2641
763 Ga0207681_10002886 3300025923 Bacteria 10869
764 Ga0207681_10015126 3300025923 Bacteria 4811
765 Ga0207681_10035282 3300025923 Bacteria 3294
766 Ga0207681_10048471 3300025923 Bacteria 2867
767 Ga0207681_10142637 3300025923 Bacteria 1786
768 Ga0207681_10327334 3300025923 Bacteria 1220
769 Ga0207694_10009665 3300025924 Bacteria 7270
770 Ga0207694_10022155 3300025924 Bacteria 4817
771 Ga0207694_10036163 3300025924 Bacteria 3789
772 Ga0207650_10000326 3300025925 Bacteria 46321
773 Ga0207650_10002489 3300025925 Bacteria 12814
774 Ga0207650_10024037 3300025925 Bacteria 4327
775 Ga0207650_10026571 3300025925 Bacteria 4131
776 Ga0207650_10029958 3300025925 Bacteria 3916
777 Ga0207650_10050356 3300025925 Bacteria 3079
778 Ga0207650_10079054 3300025925 Bacteria 2490
779 Ga0207650_10275025 3300025925 Bacteria 1370
780 Ga0207650_10421027 3300025925 Bacteria 1108
781 Ga0207659_10000299 3300025926 Bacteria 29997
782 Ga0207659_10004977 3300025926 Bacteria 8053
783 Ga0207659_10012477 3300025926 Bacteria 5408
784 Ga0207659_10013525 3300025926 Bacteria 5231
785 Ga0207659_10045257 3300025926 Bacteria 3101
786 Ga0207659_10176585 3300025926 Bacteria 1689
787 Ga0207687_10000927 3300025927 Bacteria 19983
788 Ga0207687_10030751 3300025927 Bacteria 3623
789 Ga0207687_10049359 3300025927 Bacteria 2926
790 Ga0207687_10187134 3300025927 Bacteria 1608
791 Ga0207687_10263344 3300025927 Bacteria 1375
792 Ga0207687_10265957 3300025927 Bacteria 1369
793 Ga0207700_10000303 3300025928 Bacteria 29240
794 Ga0207700_10125722 3300025928 Bacteria 2086
795 Ga0207664_10002862 3300025929 Bacteria 11466
796 Ga0207664_10015333 3300025929 Bacteria 5557
797 Ga0207664_10039542 3300025929 Bacteria 3662
798 Ga0207664_10123808 3300025929 Bacteria 2168
799 Ga0207664_10200966 3300025929 Bacteria 1720
800 Ga0207664_10264910 3300025929 Bacteria 1504
801 Ga0207644_10004733 3300025931 Bacteria 8843
802 Ga0207644_10005112 3300025931 Bacteria 8565
803 Ga0207644_10011002 3300025931 Bacteria 5975
804 Ga0207644_10011363 3300025931 Bacteria 5889
805 Ga0207644_10018324 3300025931 Bacteria 4734
806 Ga0207644_10031694 3300025931 Bacteria 3684
807 Ga0207644_10055555 3300025931 Bacteria 2854
808 Ga0207644_10105086 3300025931 Bacteria 2127
809 Ga0207644_10161663 3300025931 Bacteria 1741
810 Ga0207690_10003928 3300025932 Bacteria 8790
811 Ga0207690_10019893 3300025932 Bacteria 4139
812 Ga0207690_10035613 3300025932 Bacteria 3217
813 Ga0207690_10050325 3300025932 Bacteria 2781
814 Ga0207690_10163118 3300025932 Bacteria 1663
815 Ga0207690_10163136 3300025932 Bacteria 1663
816 Ga0207706_10000024 3300025933 Bacteria 151942
817 Ga0207706_10003902 3300025933 Bacteria 14154
818 Ga0207706_10004120 3300025933 Bacteria 13715
819 Ga0207706_10035147 3300025933 Bacteria 4458
820 Ga0207706_10051386 3300025933 Bacteria 3640
821 Ga0207706_10078143 3300025933 Bacteria 2911
822 Ga0207706_10094240 3300025933 Bacteria 2633
823 Ga0207706_10153108 3300025933 Bacteria 2028
824 Ga0207706_10384206 3300025933 Bacteria 1218
825 Ga0207686_10254085 3300025934 Bacteria 1285
826 Ga0207686_10412338 3300025934 Bacteria 1032
827 Ga0207709_10004948 3300025935 Bacteria 7627
828 Ga0207709_10009213 3300025935 Bacteria 5437
829 Ga0207709_10016347 3300025935 Bacteria 4124
830 Ga0207709_10033228 3300025935 Bacteria 3027
831 Ga0207709_10115869 3300025935 Bacteria 1801
832 Ga0207709_10430110 3300025935 Unclassified 1016
833 Ga0207670_10000517 3300025936 Bacteria 21308
834 Ga0207670_10015774 3300025936 Bacteria 4523
835 Ga0207670_10235662 3300025936 Bacteria 1407
836 Ga0207669_10009725 3300025937 Bacteria 4595
837 Ga0207669_10041059 3300025937 Bacteria 2689
838 Ga0207669_10077087 3300025937 Bacteria 2118
839 Ga0207669_10077657 3300025937 Bacteria 2112
840 Ga0207669_10182315 3300025937 Bacteria 1506
841 Ga0207669_10405995 3300025937 Bacteria 1068
842 Ga0207704_10050222 3300025938 Bacteria 2514
843 Ga0207704_10060879 3300025938 Bacteria 2338
844 Ga0207704_10135012 3300025938 Bacteria 1716
845 Ga0207704_10172406 3300025938 Bacteria 1553
846 Ga0207665_10017189 3300025939 Bacteria 4751
847 Ga0207691_10000040 3300025940 Bacteria 106561
848 Ga0207691_10000049 3300025940 Bacteria 94813
849 Ga0207691_10000754 3300025940 Bacteria 31954
850 Ga0207691_10015297 3300025940 Bacteria 7299
851 Ga0207691_10039565 3300025940 Bacteria 4362
852 Ga0207691_10052205 3300025940 Bacteria 3734
853 Ga0207691_10053428 3300025940 Bacteria 3688
854 Ga0207711_10011444 3300025941 Bacteria 7376
855 Ga0207711_10011756 3300025941 Bacteria 7271
856 Ga0207711_10012368 3300025941 Bacteria 7092
857 Ga0207711_10040127 3300025941 Bacteria 3982
858 Ga0207711_10225523 3300025941 Bacteria 1715
859 Ga0207711_10239770 3300025941 Bacteria 1662
860 Ga0207711_10260708 3300025941 Bacteria 1593
861 Ga0207711_10279330 3300025941 Bacteria 1538
862 Ga0207689_10002070 3300025942 Bacteria 18932
863 Ga0207689_10014817 3300025942 Bacteria 6618
864 Ga0207661_10008625 3300025944 Bacteria 7283
865 Ga0207661_10026789 3300025944 Bacteria 4397
866 Ga0207661_10256244 3300025944 Bacteria 1557
867 Ga0207679_10004970 3300025945 Bacteria 8299
868 Ga0207679_10010501 3300025945 Bacteria 5965
869 Ga0207679_10019569 3300025945 Bacteria 4550
870 Ga0207679_10071814 3300025945 Bacteria 2612
871 Ga0207679_10404030 3300025945 Bacteria 1202
872 Ga0207667_10002333 3300025949 Bacteria 23767
873 Ga0207667_10010607 3300025949 Bacteria 10758
874 Ga0207667_10016073 3300025949 Bacteria 8472
875 Ga0207667_10016262 3300025949 Bacteria 8406
876 Ga0207667_10090555 3300025949 Bacteria 3161
877 Ga0207667_10248203 3300025949 Bacteria 1821
878 Ga0207667_10270694 3300025949 Bacteria 1736
879 Ga0207667_10290758 3300025949 Bacteria 1670
880 Ga0207667_10324556 3300025949 Bacteria 1572
881 Ga0207651_10011167 3300025960 Bacteria 5014
882 Ga0207651_10012398 3300025960 Bacteria 4823
883 Ga0207651_10032655 3300025960 Bacteria 3347
884 Ga0207651_10039426 3300025960 Bacteria 3115
885 Ga0207651_10053767 3300025960 Bacteria 2755
886 Ga0207651_10157211 3300025960 Bacteria 1777
887 Ga0207651_10250692 3300025960 Bacteria 1448
888 Ga0207651_10344951 3300025960 Bacteria 1252
889 Ga0207651_10396422 3300025960 Bacteria 1173
890 Ga0207651_10589862 3300025960 Bacteria 970
891 Ga0207712_10010920 3300025961 Bacteria 5781
892 Ga0207712_10030600 3300025961 Unclassified 3620
893 Ga0207712_10031124 3300025961 Bacteria 3591
894 Ga0207712_10036140 3300025961 Bacteria 3362
895 Ga0207712_10048418 3300025961 Bacteria 2957
896 Ga0207668_10001161 3300025972 Bacteria 15650
897 Ga0207668_10008778 3300025972 Bacteria 6038
898 Ga0207668_10022882 3300025972 Bacteria 4007
899 Ga0207668_10030189 3300025972 Bacteria 3560
900 Ga0207668_10036852 3300025972 Bacteria 3268
901 Ga0207668_10038689 3300025972 Bacteria 3204
902 Ga0207668_10042295 3300025972 Bacteria 3085
903 Ga0207668_10053376 3300025972 Bacteria 2801
904 Ga0207668_10067860 3300025972 Bacteria 2533
905 Ga0207668_10151595 3300025972 Bacteria 1795
906 Ga0207668_10649080 3300025972 Bacteria 923
907 Ga0207640_10006727 3300025981 Bacteria 6318
908 Ga0207640_10039495 3300025981 Bacteria 2988
909 Ga0207640_10073632 3300025981 Bacteria 2309
910 Ga0207640_10123832 3300025981 Bacteria 1857
911 Ga0207640_10196646 3300025981 Bacteria 1524
912 Ga0207640_10248436 3300025981 Bacteria 1379
913 Ga0207640_10276713 3300025981 Bacteria 1316
914 Ga0207658_10021763 3300025986 Bacteria 4456
915 Ga0207658_10037942 3300025986 Bacteria 3466
916 Ga0207658_10062639 3300025986 Bacteria 2784
917 Ga0207658_10076767 3300025986 Bacteria 2546
918 Ga0207658_10111955 3300025986 Bacteria 2159
919 Ga0207658_10184957 3300025986 Bacteria 1727
920 Ga0207677_10000007 3300026023 Bacteria 274553
921 Ga0207677_10007343 3300026023 Bacteria 6088
922 Ga0207677_10032110 3300026023 Bacteria 3372
923 Ga0207677_10043471 3300026023 Bacteria 2987
924 Ga0207677_10075835 3300026023 Bacteria 2392
925 Ga0207677_10234008 3300026023 Bacteria 1482
926 Ga0207703_10005765 3300026035 Bacteria 9926
927 Ga0207703_10011452 3300026035 Bacteria 6897
928 Ga0207703_10037545 3300026035 Bacteria 3859
929 Ga0207703_10043818 3300026035 Bacteria 3593
930 Ga0207703_10050520 3300026035 Bacteria 3366
931 Ga0207703_10244461 3300026035 Bacteria 1615
932 Ga0207703_10265607 3300026035 Bacteria 1553
933 Ga0207703_10319513 3300026035 Bacteria 1421
934 Ga0207639_10000020 3300026041 Bacteria 236698
935 Ga0207639_10017183 3300026041 Bacteria 5128
936 Ga0207639_10029908 3300026041 Bacteria 3992
937 Ga0207639_10051442 3300026041 Bacteria 3133
938 Ga0207639_10085356 3300026041 Bacteria 2510
939 Ga0207639_10116158 3300026041 Bacteria 2190
940 Ga0207639_10131912 3300026041 Bacteria 2069
941 Ga0207639_10165568 3300026041 Bacteria 1867
942 Ga0207678_10002787 3300026067 Bacteria 15850
943 Ga0207678_10006003 3300026067 Bacteria 10808
944 Ga0207678_10026479 3300026067 Bacteria 5058
945 Ga0207678_10037151 3300026067 Bacteria 4238
946 Ga0207678_10185125 3300026067 Bacteria 1779
947 Ga0207708_10000568 3300026075 Bacteria 28553
948 Ga0207708_10003604 3300026075 Bacteria 11412
949 Ga0207708_10025674 3300026075 Bacteria 4459
950 Ga0207708_10265712 3300026075 Bacteria 1386
951 Ga0207702_10007015 3300026078 Bacteria 9636
952 Ga0207702_10023555 3300026078 Bacteria 5107
953 Ga0207702_10024746 3300026078 Bacteria 4981
954 Ga0207702_10137135 3300026078 Bacteria 2209
955 Ga0207702_10266296 3300026078 Bacteria 1615
956 Ga0207641_10020666 3300026088 Bacteria 5409
957 Ga0207641_10046684 3300026088 Bacteria 3651
958 Ga0207641_10084138 3300026088 Bacteria 2769
959 Ga0207641_10255594 3300026088 Bacteria 1638
960 Ga0207648_10002748 3300026089 Bacteria 18702
961 Ga0207648_10003734 3300026089 Bacteria 15928
962 Ga0207648_10003955 3300026089 Bacteria 15407
963 Ga0207648_10013979 3300026089 Bacteria 7439
964 Ga0207648_10032574 3300026089 Bacteria 4600
965 Ga0207648_10142883 3300026089 Bacteria 2110
966 Ga0207648_10352095 3300026089 Bacteria 1328
967 Ga0207648_10510140 3300026089 Bacteria 1101
968 Ga0207676_10000020 3300026095 Bacteria 301541
969 Ga0207676_10001211 3300026095 Bacteria 19276
970 Ga0207676_10010158 3300026095 Bacteria 6700
971 Ga0207676_10021442 3300026095 Bacteria 4739
972 Ga0207676_10097268 3300026095 Bacteria 2431
973 Ga0207676_10146827 3300026095 Bacteria 2026
974 Ga0207676_10290758 3300026095 Bacteria 1488
975 Ga0207676_10303052 3300026095 Bacteria 1460
976 Ga0207676_10437196 3300026095 Bacteria 1231
977 Ga0207674_10000005 3300026116 Bacteria 237935
978 Ga0207674_10001026 3300026116 Bacteria 36426
979 Ga0207674_10012490 3300026116 Bacteria 9490
980 Ga0207674_10025887 3300026116 Bacteria 6244
981 Ga0207674_10045600 3300026116 Bacteria 4508
982 Ga0207674_10158898 3300026116 Bacteria 2215
983 Ga0207674_10246968 3300026116 Bacteria 1732
984 Ga0207674_10402495 3300026116 Unclassified 1323
985 Ga0207675_100000498 3300026118 Bacteria 38133
986 Ga0207675_100002397 3300026118 Bacteria 18561
987 Ga0207675_100010157 3300026118 Bacteria 8824
988 Ga0207675_100036708 3300026118 Bacteria 4571
989 Ga0207675_100073772 3300026118 Bacteria 3192
990 Ga0207675_100091111 3300026118 Bacteria 2867
991 Ga0207675_100295845 3300026118 Bacteria 1575
992 Ga0207675_100577971 3300026118 Bacteria 1125
993 Ga0207683_10000059 3300026121 Bacteria 83666
994 Ga0207683_10007743 3300026121 Bacteria 9197
995 Ga0207683_10008998 3300026121 Bacteria 8507
996 Ga0207683_10011053 3300026121 Bacteria 7694
997 Ga0207683_10035987 3300026121 Bacteria 4308
998 Ga0207683_10040913 3300026121 Bacteria 4046
999 Ga0207683_10048843 3300026121 Bacteria 3703
1000 Ga0207683_10194378 3300026121 Bacteria 1843
1001 Ga0207683_10323044 3300026121 Bacteria 1414
1002 Ga0207683_10367790 3300026121 Bacteria 1321
1003 Ga0207698_10003455 3300026142 Bacteria 9512
1004 Ga0207698_10009186 3300026142 Bacteria 6288
1005 Ga0207698_10057413 3300026142 Bacteria 3011
1006 Ga0207698_10091662 3300026142 Bacteria 2488
1007 Ga0207698_10120511 3300026142 Bacteria 2219
1008 Ga0207698_10144175 3300026142 Bacteria 2057
1009 Ga0207698_10147968 3300026142 Bacteria 2034
1010 Ga0207698_10219953 3300026142 Bacteria 1715
1011 Ga0207698_10304589 3300026142 Bacteria 1485
1012 Ga0207698_10681245 3300026142 Bacteria 1021
1013 Ga0209371_1000007 3300027312 Bacteria 1050654
1014 Ga0209967_1001326 3300027364 Bacteria 3170
1015 Ga0209995_1003612 3300027471 Bacteria 2464
1016 Ga0209968_1002148 3300027526 Bacteria 2986
1017 Ga0209982_1003364 3300027552 Bacteria 2271
1018 Ga0209982_1013949 3300027552 Bacteria 1212
1019 Ga0209970_1012207 3300027614 Bacteria 1419
1020 Ga0210002_1011020 3300027617 Bacteria 1394
1021 Ga0209983_1003543 3300027665 Bacteria 3319
1022 Ga0209971_1001813 3300027682 Bacteria 5235
1023 Ga0209998_10000570 3300027717 Bacteria 9954
1024 Ga0209974_10002425 3300027876 Bacteria 6754
1025 Ga0209974_10013601 3300027876 Bacteria 2710
1026 Ga0207428_10006327 3300027907 Bacteria 10948
1027 Ga0207428_10020960 3300027907 Bacteria 5540
1028 Ga0268266_10011510 3300028379 Bacteria 7682
1029 Ga0268266_10011697 3300028379 Bacteria 7614
1030 Ga0268266_10017062 3300028379 Bacteria 6201
1031 Ga0268266_10057844 3300028379 Bacteria 3337
1032 Ga0268266_10065188 3300028379 Bacteria 3148
1033 Ga0268266_10141091 3300028379 Bacteria 2162
1034 Ga0268266_10473981 3300028379 Bacteria 1192
1035 Ga0268265_10000343 3300028380 Bacteria 50355
1036 Ga0268265_10019931 3300028380 Bacteria 4672
1037 Ga0268265_10089431 3300028380 Unclassified 2456
1038 Ga0268265_10142366 3300028380 Unclassified 2009
1039 Ga0268265_10314851 3300028380 Bacteria 1415
1040 Ga0268264_10012516 3300028381 Bacteria 6987
1041 Ga0268264_10015691 3300028381 Bacteria 6204
1042 Ga0268264_10019508 3300028381 Bacteria 5539
1043 Ga0268264_10047271 3300028381 Bacteria 3578
1044 Ga0268264_10098017 3300028381 Bacteria 2542
1045 Ga0268264_10235251 3300028381 Bacteria 1694
1046 Ga0268264_10282763 3300028381 Bacteria 1555
1047 Ga0265337_1000601 3300028556 Bacteria 18933
1048 Ga0265326_10000310 3300028558 Bacteria 21412
1049 Ga0265319_1000204 3300028563 Bacteria 44924
1050 Ga0265318_10000880 3300028577 Bacteria 19643
1051 Ga0265336_10000004 3300028666 Bacteria 418303
1052 Ga0307515_10021160 3300028794 Bacteria 11549
1053 Ga0307515_10122996 3300028794 Bacteria 2922
1054 Ga0265338_10000012 3300028800 Bacteria 418599
1055 Ga0265338_10013018 3300028800 Bacteria 9435
1056 Ga0268256_1000008 3300030500 Bacteria 1050654
1057 Ga0307512_10010700 3300030522 Bacteria 8727
1058 Ga0316177_1169858 3300030731 Bacteria 2478
1059 Ga0316177_1208350 3300030731 Bacteria 3117
1060 Ga0316176_1099732 3300030732 Bacteria 1698
1061 Ga0314311_1016410 3300030733 Bacteria 1224
1062 Ga0314311_1246557 3300030733 Bacteria 2246
1063 Ga0316180_1188098 3300030736 Bacteria 2227
1064 Ga0265320_10054170 3300031240 Bacteria 1936
1065 Ga0265340_10000001 3300031247 Bacteria 1647668
1066 Ga0265339_10026591 3300031249 Bacteria 3313
1067 Ga0265331_10006222 3300031250 Bacteria 7083
1068 Ga0265327_10000636 3300031251 Bacteria 57230
1069 Ga0265316_10044605 3300031344 Bacteria 3525
1070 Ga0265316_10136474 3300031344 Bacteria 1845
1071 Ga0265316_10166479 3300031344 Bacteria 1646
1072 Ga0265316_10186525 3300031344 Unclassified 1543
1073 Ga0307513_10009488 3300031456 Bacteria 12307
1074 Ga0307513_10094735 3300031456 Bacteria 3029
1075 Ga0307513_10109823 3300031456 Bacteria 2755
1076 Ga0307509_10000698 3300031507 Bacteria 57430
1077 Ga0307509_10006311 3300031507 Bacteria 16014
1078 Ga0307408_100000726 3300031548 Bacteria 26703
1079 Ga0307408_100011237 3300031548 Bacteria 5913
1080 Ga0307408_100053696 3300031548 Bacteria 2911
1081 Ga0307408_100148434 3300031548 Bacteria 1848
1082 Ga0307408_100202846 3300031548 Bacteria 1606
1083 Ga0307508_10028702 3300031616 Bacteria 5030
1084 Ga0307508_10034390 3300031616 Bacteria 4569
1085 Ga0307514_10077055 3300031649 Bacteria 2481
1086 Ga0307514_10120466 3300031649 Bacteria 1832
1087 Ga0265342_10069499 3300031712 Bacteria 2056
1088 Ga0265342_10160741 3300031712 Bacteria 1241
1089 Ga0307516_10028409 3300031730 Bacteria 5660
1090 Ga0307405_10009584 3300031731 Bacteria 4972
1091 Ga0307405_10020368 3300031731 Bacteria 3705
1092 Ga0307405_10043117 3300031731 Bacteria 2750
1093 Ga0307405_10310101 3300031731 Bacteria 1201
1094 Ga0307405_10379443 3300031731 Bacteria 1100
1095 Ga0307413_10005238 3300031824 Bacteria 5757
1096 Ga0307413_10035633 3300031824 Bacteria 2856
1097 Ga0307413_10073741 3300031824 Bacteria 2159
1098 Ga0307413_10076045 3300031824 Bacteria 2133
1099 Ga0307518_10225440 3300031838 Bacteria 1219
1100 Ga0307410_10001046 3300031852 Bacteria 12017
1101 Ga0307410_10002884 3300031852 Bacteria 8463
1102 Ga0307410_10013077 3300031852 Bacteria 4828
1103 Ga0307410_10176716 3300031852 Unclassified 1613
1104 Ga0307406_10015841 3300031901 Bacteria 4370
1105 Ga0307406_10026484 3300031901 Bacteria 3483
1106 Ga0307406_10085458 3300031901 Bacteria 2110
1107 Ga0307406_10346564 3300031901 Bacteria 1159
1108 Ga0307407_10004639 3300031903 Bacteria 5863
1109 Ga0307407_10013768 3300031903 Bacteria 3938
1110 Ga0307407_10028569 3300031903 Bacteria 2983
1111 Ga0307407_10033376 3300031903 Bacteria 2808
1112 Ga0307407_10039417 3300031903 Bacteria 2627
1113 Ga0307407_10397588 3300031903 Bacteria 988
1114 Ga0307412_10004627 3300031911 Bacteria 7671
1115 Ga0307412_10005496 3300031911 Bacteria 7117
1116 Ga0307412_10051004 3300031911 Bacteria 2733
1117 Ga0307412_10100758 3300031911 Bacteria 2042
1118 Ga0307412_10151275 3300031911 Bacteria 1713
1119 Ga0307412_10158999 3300031911 Bacteria 1676
1120 Ga0307412_10525166 3300031911 Bacteria 990
1121 Ga0307409_100004396 3300031995 Bacteria 7912
1122 Ga0307409_100010225 3300031995 Bacteria 5818
1123 Ga0307409_100018761 3300031995 Bacteria 4662
1124 Ga0307409_100037023 3300031995 Bacteria 3593
1125 Ga0307409_100064280 3300031995 Bacteria 2882
1126 Ga0307409_100081819 3300031995 Bacteria 2612
1127 Ga0307409_100135804 3300031995 Bacteria 2110
1128 Ga0307409_100415599 3300031995 Bacteria 1289
1129 Ga0307409_100734134 3300031995 Bacteria 990
1130 Ga0307416_100001305 3300032002 Bacteria 13447
1131 Ga0307416_100007531 3300032002 Bacteria 6937
1132 Ga0307416_100017093 3300032002 Bacteria 5063
1133 Ga0307416_100038289 3300032002 Bacteria 3699
1134 Ga0307416_100042073 3300032002 Bacteria 3563
1135 Ga0307416_100115623 3300032002 Bacteria 2376
1136 Ga0307416_100118633 3300032002 Bacteria 2351
1137 Ga0307416_100174472 3300032002 Bacteria 2006
1138 Ga0307416_100238604 3300032002 Bacteria 1759
1139 Ga0307416_100624417 3300032002 Bacteria 1160
1140 Ga0307414_10021655 3300032004 Bacteria 4040
1141 Ga0307414_10038086 3300032004 Bacteria 3226
1142 Ga0307414_10104213 3300032004 Bacteria 2142
1143 Ga0307414_10509442 3300032004 Bacteria 1066
1144 Ga0307411_10009621 3300032005 Bacteria 5097
1145 Ga0307411_10014468 3300032005 Bacteria 4391
1146 Ga0307411_10026522 3300032005 Bacteria 3491
1147 Ga0307411_10045841 3300032005 Bacteria 2814
1148 Ga0307411_10614844 3300032005 Bacteria 936
1149 Ga0307415_100012488 3300032126 Bacteria 4913
1150 Ga0307415_100015145 3300032126 Bacteria 4557
1151 Ga0307415_100030508 3300032126 Bacteria 3462
1152 Ga0307415_100048359 3300032126 Bacteria 2870
1153 Ga0307415_100053735 3300032126 Bacteria 2746
1154 Ga0307415_100069356 3300032126 Bacteria 2472
1155 Ga0307415_100216025 3300032126 Bacteria 1533
1156 Ga0307415_100345881 3300032126 Bacteria 1250
1157 Ga0307415_100567817 3300032126 Bacteria 1004
1158 Ga0307510_10039557 3300033180 Bacteria 5192
1159 Ga0373923_0100378 3300035111 Bacteria 1276
1160 Ga0373932_0000192 3300035112 Bacteria 17724
1161 Ga0373932_0055320 3300035112 Bacteria 1190
1162 Ga0373939_0028187 3300035114 Bacteria 1596
1163 Ga0373943_0118293 3300035170 Bacteria 1406
1164 Ga0373943_0150030 3300035170 Bacteria 1262
1165 Ga0373943_0350799 3300035170 Bacteria 846
1166 Ga0373946_0060994 3300035171 Bacteria 1605
1167 Ga0373924_0016783 3300035410 Bacteria 2800
1168 Ga0373924_0079657 3300035410 Bacteria 1392
1169 Ga0373935_0001592 3300035692 Bacteria 12642
1170 Ga0373935_0069111 3300035692 Bacteria 2274
1171 Ga0373947_0031609 3300035725 Bacteria 3117
1172 Ga0373947_0329523 3300035725 Bacteria 1022
1173 Ga0373937_0008582 3300036401 Bacteria 8875
1174 Ga0373937_0035437 3300036401 Bacteria 4542
1175 Ga0373925_0104082 3300037068 Bacteria 2185
1176 Ga0373925_0104152 3300037068 Bacteria 2185
1177 Ga0373925_0115201 3300037068 Bacteria 2081
1178 Ga0373925_0324992 3300037068 Bacteria 1245
1179 Ga0395899_0004003 3300037312 Bacteria 11613
1180 Ga0395899_0007299 3300037312 Bacteria 8548
1181 Ga0395899_0120886 3300037312 Bacteria 1876
1182 Ga0395900_0000103 3300037418 Bacteria 153001
1183 Ga0395900_0000148 3300037418 Bacteria 117889
1184 Ga0395900_0020207 3300037418 Bacteria 6795
1185 Ga0395900_0026802 3300037418 Bacteria 5898
1186 Ga0395900_0071561 3300037418 Bacteria 3565
1187 Ga0395900_0125307 3300037418 Bacteria 2635
1188 Ga0395900_0154506 3300037418 Bacteria 2344
1189 Ga0395900_0229424 3300037418 Bacteria 1868
1190 Ga0395900_0287913 3300037418 Bacteria 1632
1191 Ga0395900_0546998 3300037418 Bacteria 1103
1192 Ga0395900_0752479 3300037418 Bacteria 905
1193 Ga0395898_0017104 3300037466 Bacteria 7406
1194 Ga0395898_0019897 3300037466 Bacteria 6826
1195 Ga0395898_0159657 3300037466 Bacteria 2156
1196 Ga0395898_0163496 3300037466 Bacteria 2129
1197 Ga0395898_0544068 3300037466 Bacteria 1103
1198 Ga0395898_0587024 3300037466 Bacteria 1057
1199 Ga0395905_0028613 3300037471 Bacteria 5253
1200 Ga0395905_0051696 3300037471 Bacteria 3849
1201 Ga0395905_0178394 3300037471 Bacteria 1994
1202 Ga0395901_0001119 3300038443 Bacteria 28462
1203 Ga0395901_0008138 3300038443 Bacteria 10591
1204 Ga0395901_0008501 3300038443 Bacteria 10373
1205 Ga0395901_0020746 3300038443 Bacteria 6726
1206 Ga0395901_0025740 3300038443 Bacteria 6040
1207 Ga0395901_0040121 3300038443 Bacteria 4847
1208 Ga0395901_0070274 3300038443 Bacteria 3647
1209 Ga0237816_00249 3300039145 Bacteria 4501
1210 Ga0436365_0234277 3300039437 Bacteria 6084
1211 Ga0436365_0618531 3300039437 Bacteria 2209
1212 Ga0436365_1229888 3300039437 Bacteria 15957
1213 Ga0436365_1354094 3300039437 Bacteria 2248
1214 Ga0436360_0229645 3300039438 Bacteria 1798
1215 Ga0436361_0650497 3300039447 Bacteria 3381
1216 Ga0436361_0692684 3300039447 Bacteria 133303
1217 Ga0436361_1175052 3300039447 Bacteria 844
1218 Ga0439465_0020667 3300041413 Bacteria 2063
1219 Ga0451787_065400 3300041441 Bacteria 2910
1220 Ga0451789_0257034 3300041443 Bacteria 6534
1221 Ga0451789_0950072 3300041443 Bacteria 1492
1222 Ga0451791_0042636 3300041451 Bacteria 7210
1223 Ga0451797_1175428 3300041453 Bacteria 1299
1224 Ga0451797_1364848 3300041453 Bacteria 2333
1225 Ga0451795_0305657 3300041456 Bacteria 2537
1226 Ga0451841_0635676 3300041498 Bacteria 4781
1227 Ga0451843_0339065 3300041509 Bacteria 4551
1228 Ga0451843_0531320 3300041509 Bacteria 1467
1229 Ga0451853_1688468 3300041512 Bacteria 2510
1230 Ga0439433_0001035 3300041999 Bacteria 5637
1231 Ga0439433_0007022 3300041999 Bacteria 2431
1232 Ga0439433_0010873 3300041999 Bacteria 1990
1233 Ga0439442_000181 3300042002 Bacteria 16116
1234 Ga0439442_000263 3300042002 Bacteria 12809
1235 Ga0439442_000649 3300042002 Bacteria 7387
1236 Ga0439443_002198 3300042003 Bacteria 2302
1237 Ga0439448_0000850 3300042005 Bacteria 7454
1238 Ga0439432_010445 3300042006 Bacteria 3213
1239 Ga0439462_0034094 3300042015 Bacteria 1351
1240 Ga0439463_000675 3300042016 Bacteria 9466
1241 Ga0450914_001647 3300042118 Bacteria 1452
1242 Ga0450919_004053 3300042121 Bacteria 1801
1243 Ga0450920_000124 3300042122 Bacteria 10478
1244 Ga0450920_003529 3300042122 Bacteria 2715
1245 Ga0450920_012978 3300042122 Bacteria 1566
1246 Ga0450900_005406 3300042136 Bacteria 1507
1247 Ga0450902_009538 3300042137 Bacteria 1530
1248 Ga0450905_008867 3300042142 Bacteria 1379
1249 Ga0450907_000239 3300042146 Bacteria 18900
1250 Ga0439434_0000223 3300042435 Bacteria 15843
1251 Ga0439444_0002964 3300042437 Bacteria 2366
1252 Ga0439464_0000974 3300042439 Bacteria 6484
1253 Ga0439464_0007697 3300042439 Bacteria 2819
1254 Ga0439460_0057707 3300042461 Bacteria 1178
1255 Ga0439460_0072149 3300042461 Bacteria 1071
1256 Ga0450918_000791 3300042531 Bacteria 6656
1257 Ga0451577_0012876 3300042876 Bacteria 7850
1258 Ga0451577_0144627 3300042876 Bacteria 2138
1259 Ga0451577_0150046 3300042876 Bacteria 2097
1260 Ga0451577_0285562 3300042876 Bacteria 1495
1261 Ga0451577_0318253 3300042876 Bacteria 1411
1262 Ga0451577_0370301 3300042876 Bacteria 1300
1263 Ga0439440_0000905 3300042993 Bacteria 5196
1264 Ga0439440_0041521 3300042993 Bacteria 1123
1265 Ga0466969_0001688 3300044656 Bacteria 11796
1266 Ga0466972_0003228 3300044658 Bacteria 8091
1267 Ga0453683_0297729 3300044673 Bacteria 1032
1268 Ga0466965_0011477 3300044683 Bacteria 4153
1269 Ga0466965_0016523 3300044683 Bacteria 3514
1270 Ga0466965_0028421 3300044683 Bacteria 2717
1271 Ga0466965_0091791 3300044683 Bacteria 1546
1272 Ga0466961_0002650 3300044693 Bacteria 11103
1273 Ga0466961_0081362 3300044693 Bacteria 2049
1274 Ga0466963_0005765 3300044694 Bacteria 7282
1275 Ga0466963_0152430 3300044694 Bacteria 1606
1276 Ga0466964_0005286 3300044706 Bacteria 4789
1277 Ga0453684_0000169 3300044712 Bacteria 289762
1278 Ga0453684_0036851 3300044712 Bacteria 6730
1279 Ga0453684_0039790 3300044712 Bacteria 6397
1280 Ga0453684_0041174 3300044712 Bacteria 6254
1281 Ga0453684_0130197 3300044712 Bacteria 3020
1282 Ga0453684_0142056 3300044712 Bacteria 2865
1283 Ga0453684_0328661 3300044712 Bacteria 1730
1284 Ga0453684_0344839 3300044712 Bacteria 1681
1285 Ga0453684_0632785 3300044712 Bacteria 1169
1286 Ga0466971_0030128 3300044719 Bacteria 2428
1287 Ga0466968_0009194 3300044735 Bacteria 3801
1288 Ga0466968_0011464 3300044735 Bacteria 3454
1289 Ga0466968_0035093 3300044735 Bacteria 2097
1290 Ga0466968_0181841 3300044735 Bacteria 978
1291 Ga0466970_0000483 3300044765 Bacteria 19605
1292 Ga0466957_0008856 3300044842 Bacteria 5731
1293 Ga0466957_0025234 3300044842 Plasmid 3522
1294 Ga0466957_0080826 3300044842 Bacteria 2024
1295 Ga0466960_0014640 3300044901 Bacteria 3364
1296 Ga0466959_0001490 3300045049 Bacteria 14375
1297 Ga0466959_0005409 3300045049 Bacteria 8739
1298 Ga0466959_0102628 3300045049 Bacteria 2047
1299 Ga0466959_0223581 3300045049 Bacteria 1305
1300 Ga0451576_0024024 3300045051 Bacteria 6588
1301 Ga0451576_0048685 3300045051 Bacteria 4450
1302 Ga0451576_0077413 3300045051 Bacteria 3461
1303 Ga0451576_0446894 3300045051 Bacteria 1357
1304 Ga0451576_0847390 3300045051 Bacteria 959
1305 Ga0466958_0013515 3300045836 Bacteria 4649
1306 Ga0466958_0022949 3300045836 Bacteria 3659
1307 Ga0466958_0060538 3300045836 Bacteria 2305
1308 Ga0466967_0267229 3300045976 Bacteria 1638
1309 Ga0466967_1091184 3300045976 Bacteria 795
1310 Ga0495627_008122 3300046453 Bacteria 3954
1311 Ga0495592_0000499 3300046454 Bacteria 28648
1312 Ga0495629_0087597 3300046459 Bacteria 2173
1313 Ga0495629_0113904 3300046459 Bacteria 1885
1314 Ga0495638_0003431 3300046460 Bacteria 12482
1315 Ga0495638_0102782 3300046460 Bacteria 1707
1316 Ga0495638_0286047 3300046460 Bacteria 894
1317 Ga0495651_0067681 3300046462 Bacteria 2724
1318 Ga0495653_0003821 3300046463 Bacteria 12182
1319 Ga0495580_0085420 3300046472 Bacteria 2198
1320 Ga0495582_0182468 3300046473 Bacteria 1196
1321 Ga0495582_0206664 3300046473 Bacteria 1122
1322 Ga0495662_0042102 3300046476 Bacteria 2204
1323 Ga0495607_0128786 3300046501 Bacteria 1320
1324 Ga0495610_0047983 3300046512 Bacteria 2098
1325 Ga0495628_0209079 3300046516 Bacteria 1468
1326 Ga0495631_0023857 3300046518 Bacteria 2830
1327 Ga0495632_0119089 3300046519 Bacteria 1235
1328 Ga0495663_0013748 3300046525 Bacteria 2264
1329 Ga0495652_0009336 3300046529 Bacteria 8915
1330 Ga0495640_0003428 3300046533 Bacteria 12764
1331 Ga0495640_0308789 3300046533 Bacteria 981
1332 Ga0495586_0033087 3300046535 Bacteria 2774
1333 Ga0495587_0013216 3300046536 Bacteria 5189
1334 Ga0495587_0097249 3300046536 Bacteria 1698
1335 Ga0495621_0095660 3300046539 Bacteria 1125
1336 Ga0495645_0052938 3300046543 Bacteria 2952
1337 Ga0495633_0000587 3300046558 Bacteria 35276
1338 Ga0495633_0014316 3300046558 Bacteria 4151
1339 Ga0495667_0011807 3300046559 Bacteria 5917
1340 Ga0495667_0012571 3300046559 Bacteria 5741
1341 Ga0495625_0064471 3300046660 Bacteria 2584
1342 Ga0495625_0066389 3300046660 Bacteria 2541
1343 Ga0495625_0179990 3300046660 Bacteria 1406
1344 Ga0495657_0083707 3300046675 Bacteria 2059
1345 Ga0495657_0184880 3300046675 Bacteria 1277
1346 Ga0495599_0003454 3300046678 Bacteria 9251
1347 Ga0495647_0059830 3300046681 Bacteria 1500
1348 Ga0495658_0044878 3300046683 Bacteria 2478
1349 Ga0495658_0172476 3300046683 Bacteria 1339
1350 Ga0495658_0258889 3300046683 Bacteria 1095
1351 Ga0495613_0051236 3300046689 Bacteria 3043
1352 Ga0495613_0127011 3300046689 Bacteria 1828
1353 Ga0495649_0000444 3300046694 Bacteria 35791
1354 Ga0495600_0004313 3300046809 Bacteria 8508
1355 Ga0495581_0041906 3300047315 Bacteria 2650
1356 Ga0495604_0125255 3300047317 Bacteria 1854
1357 Ga0495604_0260863 3300047317 Bacteria 1178
1358 Ga0495674_0013547 3300047319 Bacteria 7663
1359 Ga0495674_0130154 3300047319 Bacteria 2120
1360 Ga0495672_0000456 3300047320 Bacteria 48378
1361 Ga0495680_0006852 3300047322 Bacteria 10526
1362 Ga0495680_0157183 3300047322 Bacteria 1653
1363 Ga0495684_0001503 3300047471 Bacteria 18650
1364 Ga0495684_0269922 3300047471 Bacteria 1231
1365 Ga0496100_0103170 3300048903 Bacteria 1969
1366 Ga0496100_0147076 3300048903 Bacteria 1677
1367 Ga0496100_0378644 3300048903 Bacteria 1074
1368 Ga0496101_0001805 3300048904 Bacteria 12885
1369 Ga0496101_0006284 3300048904 Bacteria 7648
1370 Ga0496101_0008732 3300048904 Bacteria 6626
1371 Ga0496101_0044083 3300048904 Bacteria 3191
1372 Ga0496101_0054078 3300048904 Bacteria 2899
1373 Ga0496101_0084094 3300048904 Bacteria 2356
1374 Ga0496101_0122662 3300048904 Bacteria 1966
1375 Ga0496102_0001232 3300048905 Bacteria 23171
1376 Ga0496102_0003427 3300048905 Bacteria 13443
1377 Ga0496102_0007340 3300048905 Bacteria 9413
1378 Ga0496102_0064873 3300048905 Bacteria 3346
1379 Ga0496102_0098708 3300048905 Bacteria 2710
1380 Ga0496102_0134143 3300048905 Bacteria 2319
1381 Ga0496103_0011352 3300048906 Bacteria 5276
1382 Ga0496103_0011990 3300048906 Bacteria 5148
1383 Ga0496103_0048028 3300048906 Bacteria 2637
1384 Ga0496104_0011558 3300048907 Bacteria 7911
1385 Ga0496104_0011782 3300048907 Bacteria 7846
1386 Ga0496104_0013849 3300048907 Bacteria 7276
1387 Ga0496104_0014068 3300048907 Bacteria 7223
1388 Ga0496104_0038022 3300048907 Bacteria 4501
1389 Ga0496104_0123553 3300048907 Bacteria 2485
1390 Ga0496104_0267836 3300048907 Bacteria 1621
1391 Ga0496104_0319935 3300048907 Bacteria 1464
1392 Ga0496104_0392591 3300048907 Bacteria 1300
1393 Ga0496105_0009252 3300048908 Bacteria 7697
1394 Ga0496105_0031134 3300048908 Bacteria 4373
1395 Ga0496105_0031392 3300048908 Bacteria 4355
1396 Ga0496105_0037798 3300048908 Bacteria 3976
1397 Ga0496105_0041480 3300048908 Bacteria 3793
1398 Ga0496105_0063389 3300048908 Bacteria 3049
1399 Ga0496105_0146171 3300048908 Bacteria 1944
1400 Ga0496105_0210862 3300048908 Bacteria 1583
1401 Ga0496105_0224579 3300048908 Bacteria 1528
1402 Ga0496105_0475987 3300048908 Bacteria 983
1403 Ga0496106_0000802 3300048909 Bacteria 22754
1404 Ga0496106_0002663 3300048909 Bacteria 13289
1405 Ga0496106_0014902 3300048909 Bacteria 5751
1406 Ga0496106_0111284 3300048909 Bacteria 2132
1407 Ga0496106_0117926 3300048909 Bacteria 2072
1408 Ga0496106_0150215 3300048909 Bacteria 1837
1409 Ga0496106_0219044 3300048909 Bacteria 1518
1410 Ga0496106_0276689 3300048909 Bacteria 1344
1411 Ga0496106_0475459 3300048909 Bacteria 1004
1412 Ga0496107_0002232 3300048910 Bacteria 12475
1413 Ga0496107_0021038 3300048910 Bacteria 4610
1414 Ga0496107_0155418 3300048910 Bacteria 1693
1415 Ga0496107_0257141 3300048910 Bacteria 1300
1416 Ga0496108_0002995 3300048911 Bacteria 13570
1417 Ga0496108_0062012 3300048911 Bacteria 3148
1418 Ga0496108_0125160 3300048911 Bacteria 2206
1419 Ga0496108_0294990 3300048911 Bacteria 1412
1420 Ga0496108_0612334 3300048911 Bacteria 948
1421 Ga0496109_0001654 3300048912 Bacteria 18622
1422 Ga0496109_0019496 3300048912 Bacteria 5985
1423 Ga0496109_0122278 3300048912 Bacteria 2425
1424 Ga0496109_0137823 3300048912 Bacteria 2281
1425 Ga0496109_0346041 3300048912 Bacteria 1404
1426 Ga0496109_0564765 3300048912 Bacteria 1073
1427 Ga0496110_0001296 3300048913 Bacteria 17952
1428 Ga0496110_0020547 3300048913 Bacteria 5576
1429 Ga0496110_0069548 3300048913 Bacteria 3118
1430 Ga0496110_0312762 3300048913 Bacteria 1430
1431 Ga0496111_0027240 3300048914 Bacteria 4042
1432 Ga0496111_0032617 3300048914 Bacteria 3714
1433 Ga0496111_0038617 3300048914 Bacteria 3421
1434 Ga0496111_0082418 3300048914 Bacteria 2349
1435 Ga0496111_0356971 3300048914 Bacteria 1082
1436 Ga0496112_0100015 3300048915 Bacteria 2869
1437 Ga0496113_0066413 3300048916 Bacteria 2732
1438 Ga0496113_0256388 3300048916 Bacteria 1397
1439 Ga0496114_0000211 3300048917 Bacteria 42451
1440 Ga0496114_0008157 3300048917 Bacteria 8301
1441 Ga0496114_0015107 3300048917 Bacteria 6207
1442 Ga0496114_0018763 3300048917 Bacteria 5598
1443 Ga0496114_0019190 3300048917 Bacteria 5539
1444 Ga0496114_0023848 3300048917 Bacteria 4993
1445 Ga0496114_0024725 3300048917 Bacteria 4903
1446 Ga0496114_0028642 3300048917 Bacteria 4571
1447 Ga0496114_0036508 3300048917 Bacteria 4062
1448 Ga0496114_0078839 3300048917 Bacteria 2779
1449 Ga0496114_0086316 3300048917 Bacteria 2659
1450 Ga0496114_0105197 3300048917 Bacteria 2414
1451 Ga0496114_0107093 3300048917 Bacteria 2392
1452 Ga0496114_0141748 3300048917 Bacteria 2081
1453 Ga0496114_0155317 3300048917 Bacteria 1986
1454 Ga0496114_0171323 3300048917 Bacteria 1892
1455 Ga0496114_0202840 3300048917 Bacteria 1737
1456 Ga0496114_0391704 3300048917 Bacteria 1230
1457 Ga0496114_0461964 3300048917 Bacteria 1124
1458 Ga0496115_0055897 3300048918 Bacteria 3171
1459 Ga0496116_0006836 3300048919 Bacteria 10255
1460 Ga0496116_0024931 3300048919 Bacteria 4409
1461 Ga0496116_0046994 3300048919 Bacteria 2909
1462 Ga0496116_0061156 3300048919 Bacteria 2439
1463 Ga0496117_0000061 3300048920 Bacteria 258454
1464 Ga0496117_0000797 3300048920 Bacteria 49103
1465 Ga0496117_0002044 3300048920 Bacteria 26720
1466 Ga0496117_0002609 3300048920 Bacteria 22400
1467 Ga0496117_0007748 3300048920 Bacteria 10371
1468 Ga0496117_0011874 3300048920 Bacteria 7748
1469 Ga0496117_0015584 3300048920 Bacteria 6467
1470 Ga0496118_0003212 3300048921 Bacteria 20860
1471 Ga0496118_0020747 3300048921 Bacteria 5817
1472 Ga0496118_0045041 3300048921 Bacteria 3449
1473 Ga0496118_0095065 3300048921 Bacteria 2035
1474 Ga0496119_0000495 3300048922 Bacteria 53700
1475 Ga0496119_0002457 3300048922 Bacteria 20349
1476 Ga0496119_0003426 3300048922 Bacteria 16471
1477 Ga0496119_0005999 3300048922 Bacteria 11415
1478 Ga0496119_0013217 3300048922 Bacteria 6600
1479 Ga0496120_0000523 3300048923 Bacteria 59431
1480 Ga0496120_0000685 3300048923 Bacteria 49749
1481 Ga0496120_0001757 3300048923 Bacteria 24522
1482 Ga0496120_0004595 3300048923 Bacteria 11489
1483 Ga0496120_0008021 3300048923 Bacteria 7770
1484 Ga0496120_0027938 3300048923 Bacteria 3464
1485 Ga0496120_0109047 3300048923 Bacteria 1449
1486 Ga0496121_0003381 3300048924 Bacteria 22854
1487 Ga0496121_0100899 3300048924 Bacteria 2227
1488 Ga0496122_0000022 3300048925 Bacteria 388704
1489 Ga0496122_0000095 3300048925 Bacteria 200509
1490 Ga0496122_0000372 3300048925 Bacteria 96314
1491 Ga0496122_0002465 3300048925 Bacteria 26173
1492 Ga0496122_0003449 3300048925 Bacteria 20794
1493 Ga0496122_0005695 3300048925 Bacteria 14703
1494 Ga0496122_0032798 3300048925 Bacteria 4286
1495 Ga0496122_0104295 3300048925 Bacteria 1884
1496 Ga0496122_0166365 3300048925 Bacteria 1336
1497 Ga0496123_0000016 3300048926 Bacteria 424330
1498 Ga0496123_0000100 3300048926 Bacteria 170019
1499 Ga0496123_0000436 3300048926 Bacteria 74963
1500 Ga0496123_0001597 3300048926 Bacteria 30772
1501 Ga0496123_0001609 3300048926 Bacteria 30606
1502 Ga0496123_0002295 3300048926 Bacteria 24011
1503 Ga0496123_0010540 3300048926 Bacteria 8149
1504 Ga0496123_0031861 3300048926 Bacteria 3827
1505 Ga0496123_0049292 3300048926 Bacteria 2825
1506 Ga0496124_0001486 3300048927 Bacteria 34446
1507 Ga0496124_0003225 3300048927 Bacteria 20145
1508 Ga0496124_0004974 3300048927 Bacteria 15207
1509 Ga0496124_0006648 3300048927 Bacteria 12541
1510 Ga0496124_0010274 3300048927 Bacteria 9504
1511 Ga0496124_0010942 3300048927 Bacteria 9125
1512 Ga0496124_0038734 3300048927 Bacteria 4136
1513 Ga0496124_0084933 3300048927 Bacteria 2595
1514 Ga0496124_0086465 3300048927 Bacteria 2566
1515 Ga0496124_0113712 3300048927 Bacteria 2175
1516 Ga0496124_0230670 3300048927 Bacteria 1384
1517 Ga0496124_0279921 3300048927 Bacteria 1217
1518 Ga0496125_0000579 3300048928 Bacteria 62660
1519 Ga0496125_0004417 3300048928 Bacteria 16246
1520 Ga0496125_0007394 3300048928 Bacteria 11686
1521 Ga0496125_0007966 3300048928 Bacteria 11191
1522 Ga0496125_0009168 3300048928 Bacteria 10226
1523 Ga0496125_0010844 3300048928 Bacteria 9173
1524 Ga0496125_0015873 3300048928 Bacteria 7256
1525 Ga0496126_0002496 3300048929 Bacteria 24724
1526 Ga0496126_0002948 3300048929 Bacteria 22109
1527 Ga0496126_0019041 3300048929 Bacteria 6776
1528 Ga0496126_0221845 3300048929 Bacteria 1587
1529 Ga0496126_0273963 3300048929 Bacteria 1400
1530 Ga0496126_0367948 3300048929 Bacteria 1173
1531 Ga0501031_0087810 3300049568 Bacteria 2028
1532 Ga0501032_0158161 3300049569 Bacteria 1488
1533 Ga0501033_0022344 3300049570 Bacteria 4772
1534 Ga0501033_0084576 3300049570 Bacteria 2325
1535 Ga0501034_0189060 3300049571 Bacteria 2022
1536 Ga0501036_0009946 3300049572 Bacteria 7831
1537 Ga0501036_0095182 3300049572 Bacteria 2517
1538 Ga0501036_0180205 3300049572 Bacteria 1779
1539 Ga0501037_0022015 3300049573 Bacteria 4719
1540 Ga0501037_0067736 3300049573 Bacteria 2599
1541 Ga0501038_0020799 3300049574 Bacteria 5898
1542 Ga0501038_0048787 3300049574 Bacteria 3663
1543 Ga0501038_0055323 3300049574 Bacteria 3409
1544 Ga0501039_0002127 3300049575 Bacteria 14662
1545 Ga0501039_0107250 3300049575 Bacteria 2182
1546 Ga0501039_0141219 3300049575 Bacteria 1892
1547 Ga0501040_0001855 3300049576 Bacteria 13554
1548 Ga0501041_0000351 3300049577 Bacteria 22714
1549 Ga0501041_0080908 3300049577 Bacteria 2000
1550 Ga0501041_0137975 3300049577 Bacteria 1520
1551 Ga0501042_0003297 3300049578 Bacteria 10103
1552 Ga0501042_0004598 3300049578 Bacteria 8810
1553 Ga0501043_0147692 3300049579 Bacteria 1840
1554 Ga0501046_0043463 3300049580 Bacteria 3577
1555 Ga0501047_0107013 3300049581 Bacteria 2678
1556 Ga0501047_0215593 3300049581 Bacteria 1777
1557 Ga0501048_0002195 3300049582 Bacteria 14849
1558 Ga0501048_0069248 3300049582 Bacteria 2492
1559 Ga0501048_0096211 3300049582 Bacteria 2089
1560 Ga0501067_0005857 3300049583 Bacteria 6814
1561 Ga0501067_0009340 3300049583 Bacteria 5433
1562 Ga0501067_0110472 3300049583 Bacteria 1528
1563 Ga0501068_0013843 3300049584 Bacteria 4597
1564 Ga0501068_0088155 3300049584 Bacteria 1912
1565 Ga0501068_0093280 3300049584 Bacteria 1860
1566 Ga0501069_0007921 3300049585 Bacteria 5580
1567 Ga0501069_0014894 3300049585 Bacteria 4164
1568 Ga0501069_0040040 3300049585 Bacteria 2590
1569 Ga0501069_0114786 3300049585 Bacteria 1536
1570 Ga0501069_0153591 3300049585 Bacteria 1324
1571 Ga0501069_0168499 3300049585 Bacteria 1263
1572 Ga0501070_0542902 3300049586 Bacteria 931
1573 Ga0501071_0000630 3300049587 Bacteria 18317
1574 Ga0501071_0013332 3300049587 Bacteria 5599
1575 Ga0501072_0020276 3300049588 Bacteria 5150
1576 Ga0501072_0142697 3300049588 Bacteria 1910
1577 Ga0501072_0150786 3300049588 Bacteria 1853
1578 Ga0501072_0221430 3300049588 Bacteria 1508
1579 Ga0501073_0180680 3300049589 Bacteria 1460
1580 Ga0501073_0286909 3300049589 Bacteria 1136
1581 Ga0501075_0002675 3300049591 Bacteria 11910
1582 Ga0501075_0009786 3300049591 Bacteria 6719
1583 Ga0501075_0069723 3300049591 Bacteria 2657
1584 Ga0501075_0085492 3300049591 Bacteria 2390
1585 Ga0501076_0004511 3300049592 Bacteria 9911
1586 Ga0501076_0171982 3300049592 Bacteria 1766
1587 Ga0501076_0202805 3300049592 Bacteria 1620
1588 Ga0501077_0000141 3300049593 Bacteria 39400
1589 Ga0501077_0013975 3300049593 Bacteria 5035
1590 Ga0501249_006180 3300049679 Bacteria 2462
1591 Ga0501225_0041592 3300049705 Bacteria 1268
1592 Ga0501079_0006920 3300049741 Bacteria 8547
1593 Ga0501079_0065798 3300049741 Bacteria 2797
1594 Ga0501080_0003355 3300049742 Bacteria 14143
1595 Ga0501081_0012009 3300049743 Bacteria 5677
1596 Ga0501081_0247964 3300049743 Bacteria 1299
1597 Ga0501083_0174612 3300049744 Bacteria 1404
1598 Ga0501035_0042501 3300049822 Bacteria 4099
1599 Ga0501035_0056585 3300049822 Bacteria 3498
1600 Ga0501035_0061092 3300049822 Bacteria 3354
1601 Ga0501035_0146084 3300049822 Bacteria 2054
1602 Ga0501044_0039025 3300049823 Bacteria 4956
1603 Ga0501044_0102000 3300049823 Bacteria 2886
1604 Ga0501044_0270768 3300049823 Bacteria 1634
1605 Ga0501044_0323077 3300049823 Bacteria 1467
1606 Ga0501045_0002620 3300049824 Bacteria 12250
1607 Ga0501045_0426520 3300049824 Bacteria 986
1608 nmdc:mga0yw44_132879_c1 3300050492 Bacteria 1612
1609 nmdc:mga0yw44_2395_c2 3300050492 Bacteria 3532
1610 nmdc:mga0yw44_45073_c1 3300050492 Bacteria 2642
1611 nmdc:mga0yw44_92227_c1 3300050492 Bacteria 1917
1612 nmdc:mga0k408_43076_c1 3300050493 Bacteria 2600
1613 nmdc:mga06z11_33920_c1 3300050494 Bacteria 2501
1614 nmdc:mga06z11_60936_c1 3300050494 Bacteria 1966
1615 nmdc:mga07m45_11299_c1 3300050496 Bacteria 4688
1616 nmdc:mga05p37_100669_c1 3300050507 Bacteria 3559
1617 nmdc:mga05p37_106302_c1 3300050507 Bacteria 3453
1618 nmdc:mga05p37_225575_c1 3300050507 Bacteria 2259
1619 nmdc:mga05p37_312822_c1 3300050507 Bacteria 1861
1620 nmdc:mga05p37_4635_c1 3300050507 Bacteria 16080
1621 nmdc:mga05p37_5320_c1 3300050507 Bacteria 15110
1622 nmdc:mga05p37_64790_c1 3300050507 Bacteria 4497
1623 nmdc:mga09592_12537_c1 3300050508 Bacteria 6907
1624 nmdc:mga09592_13076_c1 3300050508 Bacteria 6773
1625 nmdc:mga09592_1452_c1 3300050508 Bacteria 19039
1626 nmdc:mga09592_162496_c1 3300050508 Bacteria 1929
1627 nmdc:mga09592_3369_c1 3300050508 Bacteria 12913
1628 nmdc:mga09592_693711_c1 3300050508 Bacteria 867
1629 nmdc:mga09592_9039_c1 3300050508 Bacteria 8098
1630 nmdc:mga09592_9619_c1 3300050508 Bacteria 7853
1631 nmdc:mga0qj67_10385_c1 3300050509 Bacteria 6957
1632 nmdc:mga0qj67_12086_c1 3300050509 Bacteria 6493
1633 nmdc:mga0qj67_19885_c1 3300050509 Bacteria 5136
1634 nmdc:mga0qj67_2242_c1 3300050509 Bacteria 13741
1635 nmdc:mga0qj67_63723_c1 3300050509 Bacteria 2931
1636 nmdc:mga0qj67_84526_c1 3300050509 Bacteria 2545
1637 nmdc:mga06r32_2463_c1 3300050510 Bacteria 16560
1638 nmdc:mga06r32_3884_c2 3300050510 Bacteria 8594
1639 nmdc:mga06r32_84_c1 3300050510 Bacteria 64075
1640 nmdc:mga06r32_98329_c1 3300050510 Bacteria 2869
1641 nmdc:mga08y16_120708_c1 3300050511 Bacteria 2728
1642 nmdc:mga08y16_155351_c1 3300050511 Bacteria 2377
1643 nmdc:mga08y16_1683_c1 3300050511 Bacteria 22428
1644 nmdc:mga08y16_38334_c1 3300050511 Bacteria 5033
1645 nmdc:mga08y16_723_c1 3300050511 Bacteria 31338
1646 nmdc:mga0n895_118080_c1 3300050512 Bacteria 2672
1647 nmdc:mga0n895_178716_c1 3300050512 Bacteria 2153
1648 nmdc:mga0n895_520034_c1 3300050512 Bacteria 1198
1649 nmdc:mga0rr50_184572_c1 3300050513 Bacteria 1706
1650 nmdc:mga0rr50_325243_c1 3300050513 Bacteria 1290
1651 nmdc:mga0rr50_5781_c1 3300050513 Bacteria 7426
1652 nmdc:mga0a205_22164_c1 3300050515 Bacteria 6012
1653 Ga0495601_0022058 3300053077 Bacteria 3907
1654 Ga0495601_0091612 3300053077 Bacteria 1957
1655 Ga0495655_0039320 3300053083 Bacteria 1198
1656 Ga0495595_0021586 3300053084 Bacteria 2815
1657 Ga0495619_0001037 3300053085 Bacteria 18232
1658 Ga0495619_0330320 3300053085 Bacteria 1055
1659 Ga0500644_0033300 3300053088 Bacteria 1653
1660 Ga0500651_0005499 3300053093 Bacteria 7236
1661 Ga0500651_0193478 3300053093 Bacteria 1203
1662 Ga0500556_0001056 3300053104 Bacteria 14189
1663 Ga0500593_000191 3300053117 Bacteria 24934
1664 Ga0500617_021014 3300053124 Bacteria 2867
1665 Ga0500621_035915 3300053126 Bacteria 1988
1666 Ga0500559_0000097 3300053136 Bacteria 70124
1667 Ga0500559_0000231 3300053136 Bacteria 44310
1668 Ga0500568_0003392 3300053139 Bacteria 8903
1669 Ga0500568_0045052 3300053139 Bacteria 1757
1670 Ga0500573_0000005 3300053140 Bacteria 315762
1671 Ga0500588_0038796 3300053146 Bacteria 1422
1672 Ga0500619_003928 3300053154 Bacteria 3125
1673 Ga0500622_0001090 3300053156 Bacteria 22587
1674 Ga0500622_0013309 3300053156 Bacteria 4438
1675 Ga0500622_0016140 3300053156 Bacteria 3994
1676 Ga0500630_033228 3300053159 Bacteria 2531
1677 Ga0500634_0000198 3300053161 Bacteria 19488
1678 Ga0501084_0005592 3300054114 Bacteria 10318
1679 Ga0501084_0106887 3300054114 Bacteria 2351
1680 Ga0590075_008038 3300059424 Bacteria 2511
1681 Ga0587106_012551 3300059605 Bacteria 1138
1682 Ga0587128_013955 3300059630 Bacteria 1142
1683 Ga0501082_0000838 3300060353 Bacteria 27077
1684 Ga0501082_0012424 3300060353 Bacteria 7318
1685 Ga0466962_0014309 3300061719 Bacteria 3823
1686 Ga0530510_0064645 3300061734 Bacteria 2650

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100002094 Ga0068855_1000020947 220
2 3300025949 Ga0207667_10002333 Ga0207667_100023337 220
3 3300014969 Ga0157376_10813407 Ga0157376_108134072 240
4 3300037312 Ga0395899_0004003 Ga0395899_0004003_996_1718 240
5 3300044683 Ga0466965_0011477 Ga0466965_0011477_1386_2192 244
6 3300048919 Ga0496116_0061156 Ga0496116_0061156_759_1496 245
7 3300005616 Ga0068852_100025722 Ga0068852_1000257222 246
8 3300013105 Ga0157369_10037862 Ga0157369_100378623 246
9 3300035410 Ga0373924_0079657 Ga0373924_0079657_12_752 246
10 3300037068 Ga0373925_0104082 Ga0373925_0104082_22_762 246
11 3300044673 Ga0453683_0297729 Ga0453683_0297729_250_990 246
12 3300046460 Ga0495638_0286047 Ga0495638_0286047_131_871 246
13 3300046681 Ga0495647_0059830 Ga0495647_0059830_741_1481 246
14 3300050512 nmdc:mga0n895_520034_c1 nmdc:mga0n895_520034_c1_35_775 246
15 3300005339 Ga0070660_100238083 Ga0070660_1002380832 248
16 3300025919 Ga0207657_10040119 Ga0207657_100401194 248
17 3300005434 Ga0070709_10000036 Ga0070709_1000003660 250
18 3300025906 Ga0207699_10000078 Ga0207699_1000007827 250
19 3300010375 Ga0105239_10491505 Ga0105239_104915052 251
20 3300039447 Ga0436361_1175052 Ga0436361_1175052_64_825 251
21 3300048914 Ga0496111_0032617 Ga0496111_0032617_1362_2294 251
22 3300005434 Ga0070709_10022540 Ga0070709_100225403 252
23 3300005439 Ga0070711_100000029 Ga0070711_10000002943 252
24 3300005444 Ga0070694_100015451 Ga0070694_1000154513 252
25 3300005545 Ga0070695_100019170 Ga0070695_1000191703 252
26 3300005547 Ga0070693_100060780 Ga0070693_1000607802 252
27 3300006173 Ga0070716_100104013 Ga0070716_1001040132 252
28 3300025901 Ga0207688_10121295 Ga0207688_101212952 252
29 3300025906 Ga0207699_10010710 Ga0207699_100107104 252
30 3300025916 Ga0207663_10000050 Ga0207663_1000005048 252
31 3300025939 Ga0207665_10017189 Ga0207665_100171893 252
32 3300037418 Ga0395900_0020207 Ga0395900_0020207_3832_4590 252
33 3300037418 Ga0395900_0752479 Ga0395900_0752479_134_892 252
34 3300037466 Ga0395898_0019897 Ga0395898_0019897_4359_5117 252
35 3300038443 Ga0395901_0040121 Ga0395901_0040121_2427_3185 252
36 3300028556 Ga0265337_1000601 Ga0265337_10006017 253
37 3300028558 Ga0265326_10000310 Ga0265326_1000031022 253
38 3300028563 Ga0265319_1000204 Ga0265319_100020441 253
39 3300028577 Ga0265318_10000880 Ga0265318_1000088010 253
40 3300028666 Ga0265336_10000004 Ga0265336_10000004250 253
41 3300028800 Ga0265338_10000012 Ga0265338_10000012176 253
42 3300031240 Ga0265320_10054170 Ga0265320_100541702 253
43 3300031247 Ga0265340_10000001 Ga0265340_100000011452 253
44 3300031249 Ga0265339_10026591 Ga0265339_100265912 253
45 3300031344 Ga0265316_10136474 Ga0265316_101364742 253
46 3300031712 Ga0265342_10069499 Ga0265342_100694992 253
47 3300035170 Ga0373943_0350799 Ga0373943_0350799_56_817 253
48 3300046689 Ga0495613_0051236 Ga0495613_0051236_2193_2954 253
49 3300047319 Ga0495674_0130154 Ga0495674_0130154_665_1426 253
50 3300047322 Ga0495680_0157183 Ga0495680_0157183_428_1189 253
51 3300047471 Ga0495684_0269922 Ga0495684_0269922_56_817 253
52 3300031344 Ga0265316_10166479 Ga0265316_101664792 254
53 3300031712 Ga0265342_10160741 Ga0265342_101607411 254
54 3300046501 Ga0495607_0128786 Ga0495607_0128786_253_1020 254
55 3300053083 Ga0495655_0039320 Ga0495655_0039320_34_855 254
56 3300001989 JGI24739J22299_10029488 JGI24739J22299_100294882 255
57 3300005336 Ga0070680_100202702 Ga0070680_1002027021 255
58 3300005339 Ga0070660_100104403 Ga0070660_1001044033 255
59 3300005366 Ga0070659_100234694 Ga0070659_1002346942 255
60 3300005366 Ga0070659_100267901 Ga0070659_1002679012 255
61 3300005458 Ga0070681_10011966 Ga0070681_100119667 255
62 3300005539 Ga0068853_100450455 Ga0068853_1004504552 255
63 3300005546 Ga0070696_100060592 Ga0070696_1000605923 255
64 3300005547 Ga0070693_100063397 Ga0070693_1000633972 255
65 3300005577 Ga0068857_100027250 Ga0068857_1000272503 255
66 3300009148 Ga0105243_10014388 Ga0105243_100143882 255
67 3300011119 Ga0105246_10015274 Ga0105246_100152744 255
68 3300013307 Ga0157372_10184470 Ga0157372_101844703 255
69 3300025912 Ga0207707_10102342 Ga0207707_101023422 255
70 3300025917 Ga0207660_10043270 Ga0207660_100432702 255
71 3300025921 Ga0207652_10091390 Ga0207652_100913902 255
72 3300025932 Ga0207690_10035613 Ga0207690_100356132 255
73 3300025932 Ga0207690_10163118 Ga0207690_101631182 255
74 3300026116 Ga0207674_10025887 Ga0207674_100258873 255
75 3300037418 Ga0395900_0026802 Ga0395900_0026802_2807_3709 255
76 3300038443 Ga0395901_0008138 Ga0395901_0008138_9163_10065 255
77 3300038443 Ga0395901_0020746 Ga0395901_0020746_162_983 255
78 3300049572 Ga0501036_0180205 Ga0501036_0180205_439_1338 255
79 3300049588 Ga0501072_0150786 Ga0501072_0150786_108_1007 255
80 3300005331 Ga0070670_100000750 Ga0070670_1000007507 256
81 3300005354 Ga0070675_100018080 Ga0070675_1000180805 256
82 3300005364 Ga0070673_100128658 Ga0070673_1001286582 256
83 3300005543 Ga0070672_100005648 Ga0070672_1000056483 256
84 3300005564 Ga0070664_100137558 Ga0070664_1001375582 256
85 3300005618 Ga0068864_100015982 Ga0068864_1000159825 256
86 3300006237 Ga0097621_100001752 Ga0097621_10000175214 256
87 3300006914 Ga0075436_100004424 Ga0075436_1000044247 256
88 3300013308 Ga0157375_10004827 Ga0157375_100048273 256
89 3300014969 Ga0157376_10016125 Ga0157376_100161252 256
90 3300025893 Ga0207682_10021196 Ga0207682_100211962 256
91 3300025925 Ga0207650_10024037 Ga0207650_100240374 256
92 3300025940 Ga0207691_10000754 Ga0207691_1000075424 256
93 3300025960 Ga0207651_10250692 Ga0207651_102506922 256
94 3300026095 Ga0207676_10021442 Ga0207676_100214424 256
95 3300045976 Ga0466967_1091184 Ga0466967_1091184_13_783 256
96 3300048915 Ga0496112_0100015 Ga0496112_0100015_1255_2100 256
97 3300006844 Ga0075428_100269587 Ga0075428_1002695872 257
98 3300006847 Ga0075431_100018446 Ga0075431_1000184466 257
99 3300006948 Ga0099826_10026478 Ga0099826_100264782 257
100 3300009094 Ga0111539_10583964 Ga0111539_105839642 257
101 3300009098 Ga0105245_10000284 Ga0105245_1000028436 257
102 3300013306 Ga0163162_10060843 Ga0163162_100608432 257
103 3300014326 Ga0157380_10264671 Ga0157380_102646712 257
104 3300025927 Ga0207687_10000927 Ga0207687_100009278 257
105 3300032126 Ga0307415_100345881 Ga0307415_1003458812 257
106 3300045836 Ga0466958_0013515 Ga0466958_0013515_785_1558 257
107 3300005327 Ga0070658_10005452 Ga0070658_100054525 258
108 3300005329 Ga0070683_100012210 Ga0070683_1000122105 258
109 3300005336 Ga0070680_100084159 Ga0070680_1000841592 258
110 3300005339 Ga0070660_100002835 Ga0070660_1000028358 258
111 3300005344 Ga0070661_100001153 Ga0070661_1000011539 258
112 3300005366 Ga0070659_100037523 Ga0070659_1000375232 258
113 3300005435 Ga0070714_100054443 Ga0070714_1000544432 258
114 3300005458 Ga0070681_10052326 Ga0070681_100523262 258
115 3300005530 Ga0070679_100023799 Ga0070679_1000237992 258
116 3300005535 Ga0070684_100028927 Ga0070684_1000289272 258
117 3300005563 Ga0068855_100004040 Ga0068855_1000040403 258
118 3300005564 Ga0070664_100000136 Ga0070664_10000013626 258
119 3300005577 Ga0068857_100000271 Ga0068857_10000027117 258
120 3300005578 Ga0068854_100051280 Ga0068854_1000512802 258
121 3300005614 Ga0068856_100002662 Ga0068856_1000026628 258
122 3300005616 Ga0068852_100003611 Ga0068852_1000036117 258
123 3300005834 Ga0068851_10022695 Ga0068851_100226952 258
124 3300009093 Ga0105240_10005467 Ga0105240_1000546712 258
125 3300009174 Ga0105241_10049719 Ga0105241_100497192 258
126 3300009545 Ga0105237_10015715 Ga0105237_100157152 258
127 3300009551 Ga0105238_10002021 Ga0105238_1000202110 258
128 3300010375 Ga0105239_10866579 Ga0105239_108665792 258
129 3300013100 Ga0157373_10031989 Ga0157373_100319893 258
130 3300013104 Ga0157370_10008040 Ga0157370_100080405 258
131 3300013105 Ga0157369_10006086 Ga0157369_100060865 258
132 3300013307 Ga0157372_10001786 Ga0157372_100017866 258
133 3300021384 Ga0213876_10021545 Ga0213876_100215452 258
134 3300025321 Ga0207656_10049903 Ga0207656_100499032 258
135 3300025911 Ga0207654_10013753 Ga0207654_100137532 258
136 3300025912 Ga0207707_10060720 Ga0207707_100607202 258
137 3300025913 Ga0207695_10020549 Ga0207695_100205494 258
138 3300025914 Ga0207671_10014604 Ga0207671_100146044 258
139 3300025917 Ga0207660_10058125 Ga0207660_100581252 258
140 3300025919 Ga0207657_10010544 Ga0207657_100105442 258
141 3300025920 Ga0207649_10001669 Ga0207649_100016695 258
142 3300025921 Ga0207652_10165852 Ga0207652_101658522 258
143 3300025924 Ga0207694_10022155 Ga0207694_100221552 258
144 3300025929 Ga0207664_10200966 Ga0207664_102009662 258
145 3300025932 Ga0207690_10019893 Ga0207690_100198932 258
146 3300025944 Ga0207661_10026789 Ga0207661_100267892 258
147 3300025945 Ga0207679_10004970 Ga0207679_100049702 258
148 3300025949 Ga0207667_10010607 Ga0207667_100106075 258
149 3300025981 Ga0207640_10039495 Ga0207640_100394953 258
150 3300026041 Ga0207639_10017183 Ga0207639_100171834 258
151 3300026078 Ga0207702_10023555 Ga0207702_100235553 258
152 3300026089 Ga0207648_10352095 Ga0207648_103520952 258
153 3300026116 Ga0207674_10000005 Ga0207674_1000000582 258
154 3300026118 Ga0207675_100577971 Ga0207675_1005779711 258
155 3300026142 Ga0207698_10009186 Ga0207698_100091864 258
156 3300039437 Ga0436365_1229888 Ga0436365_1229888_2595_3404 258
157 3300044683 Ga0466965_0091791 Ga0466965_0091791_10_903 258
158 3300005616 Ga0068852_100768268 Ga0068852_1007682681 259
159 3300006881 Ga0068865_100239770 Ga0068865_1002397701 259
160 3300017792 Ga0163161_10055800 Ga0163161_100558003 259
161 3300025934 Ga0207686_10254085 Ga0207686_102540852 259
162 3300032002 Ga0307416_100624417 Ga0307416_1006244172 259
163 3300045049 Ga0466959_0102628 Ga0466959_0102628_65_844 259
164 3300048904 Ga0496101_0006284 Ga0496101_0006284_1117_2049 259
165 3300048908 Ga0496105_0009252 Ga0496105_0009252_211_1143 259
166 3300048917 Ga0496114_0024725 Ga0496114_0024725_2345_3277 259
167 3300049588 Ga0501072_0221430 Ga0501072_0221430_411_1193 259
168 iso_pu_bacteria 2844849076 2844851229 259
169 3300005445 Ga0070708_100063819 Ga0070708_1000638192 260
170 3300042015 Ga0439462_0034094 Ga0439462_0034094_532_1317 260
171 3300044765 Ga0466970_0000483 Ga0466970_0000483_4472_5257 260
172 3300048904 Ga0496101_0054078 Ga0496101_0054078_1669_2496 260
173 3300048905 Ga0496102_0007340 Ga0496102_0007340_7063_7890 260
174 3300048906 Ga0496103_0011990 Ga0496103_0011990_419_1246 260
175 3300048917 Ga0496114_0107093 Ga0496114_0107093_199_1026 260
176 3300049572 Ga0501036_0095182 Ga0501036_0095182_378_1280 260
177 3300049573 Ga0501037_0067736 Ga0501037_0067736_1450_2352 260
178 3300049578 Ga0501042_0004598 Ga0501042_0004598_1244_2146 260
179 3300049582 Ga0501048_0069248 Ga0501048_0069248_1234_2136 260
180 3300049587 Ga0501071_0000630 Ga0501071_0000630_6656_7558 260
181 3300049588 Ga0501072_0142697 Ga0501072_0142697_608_1510 260
182 3300049741 Ga0501079_0065798 Ga0501079_0065798_351_1253 260
183 3300049743 Ga0501081_0247964 Ga0501081_0247964_85_987 260
184 3300049822 Ga0501035_0146084 Ga0501035_0146084_1031_1933 260
185 3300050494 nmdc:mga06z11_60936_c1 nmdc:mga06z11_60936_c1_376_1161 260
186 3300053117 Ga0500593_000191 Ga0500593_000191_6747_7661 260
187 3300005338 Ga0068868_100133028 Ga0068868_1001330281 261
188 3300005518 Ga0070699_100522283 Ga0070699_1005222832 261
189 3300006038 Ga0075365_10025733 Ga0075365_100257331 261
190 3300009176 Ga0105242_10404365 Ga0105242_104043651 261
191 3300009979 Ga0105032_101063 Ga0105032_1010632 261
192 3300025960 Ga0207651_10344951 Ga0207651_103449512 261
193 3300026023 Ga0207677_10075835 Ga0207677_100758352 261
194 3300026095 Ga0207676_10437196 Ga0207676_104371961 261
195 3300026121 Ga0207683_10035987 Ga0207683_100359873 261
196 3300030731 Ga0316177_1208350 Ga0316177_12083502 261
197 3300030732 Ga0316176_1099732 Ga0316176_10997323 261
198 3300030733 Ga0314311_1016410 Ga0314311_10164101 261
199 3300041413 Ga0439465_0020667 Ga0439465_0020667_46_1014 261
200 3300042142 Ga0450905_008867 Ga0450905_008867_11_799 261
201 3300048917 Ga0496114_0078839 Ga0496114_0078839_1854_2675 261
202 3300053104 Ga0500556_0001056 Ga0500556_0001056_8152_9051 261
203 3300005339 Ga0070660_100011507 Ga0070660_1000115072 262
204 3300013104 Ga0157370_10093371 Ga0157370_100933712 262
205 3300020081 Ga0206354_11579096 Ga0206354_115790962 262
206 3300025253 Ga0209677_101516 Ga0209677_1015167 262
207 3300037418 Ga0395900_0071561 Ga0395900_0071561_1581_2471 262
208 iso_pu_bacteria 2738541337 2739054155 262
209 3300005340 Ga0070689_100112596 Ga0070689_1001125963 263
210 3300005356 Ga0070674_100008152 Ga0070674_1000081522 263
211 3300005441 Ga0070700_100054831 Ga0070700_1000548312 263
212 3300005543 Ga0070672_100165625 Ga0070672_1001656252 263
213 3300013306 Ga0163162_10147681 Ga0163162_101476812 263
214 3300014326 Ga0157380_10114814 Ga0157380_101148142 263
215 3300025927 Ga0207687_10263344 Ga0207687_102633442 263
216 3300025936 Ga0207670_10235662 Ga0207670_102356621 263
217 3300025941 Ga0207711_10225523 Ga0207711_102255232 263
218 3300026089 Ga0207648_10032574 Ga0207648_100325742 263
219 3300026089 Ga0207648_10510140 Ga0207648_105101402 263
220 3300041999 Ga0439433_0007022 Ga0439433_0007022_418_1212 263
221 3300042122 Ga0450920_012978 Ga0450920_012978_506_1300 263
222 3300044712 Ga0453684_0142056 Ga0453684_0142056_525_1373 263
223 3300049568 Ga0501031_0087810 Ga0501031_0087810_221_1048 263
224 3300049574 Ga0501038_0020799 Ga0501038_0020799_2179_3006 263
225 3300049822 Ga0501035_0056585 Ga0501035_0056585_606_1433 263
226 3300013307 Ga0157372_10136640 Ga0157372_101366403 264
227 3300025916 Ga0207663_10151997 Ga0207663_101519972 264
228 3300046539 Ga0495621_0095660 Ga0495621_0095660_231_1025 264
229 3300048904 Ga0496101_0084094 Ga0496101_0084094_877_1674 264
230 3300048906 Ga0496103_0048028 Ga0496103_0048028_1219_2016 264
231 3300048909 Ga0496106_0276689 Ga0496106_0276689_518_1315 264
232 3300048910 Ga0496107_0155418 Ga0496107_0155418_572_1369 264
233 3300048912 Ga0496109_0122278 Ga0496109_0122278_219_1016 264
234 3300048913 Ga0496110_0312762 Ga0496110_0312762_261_1058 264
235 3300048920 Ga0496117_0011874 Ga0496117_0011874_6944_7738 264
236 3300049569 Ga0501032_0158161 Ga0501032_0158161_245_1075 264
237 3300049570 Ga0501033_0084576 Ga0501033_0084576_678_1508 264
238 3300049581 Ga0501047_0107013 Ga0501047_0107013_384_1214 264
239 3300049583 Ga0501067_0110472 Ga0501067_0110472_619_1416 264
240 3300049705 Ga0501225_0041592 Ga0501225_0041592_452_1249 264
241 3300049823 Ga0501044_0323077 Ga0501044_0323077_589_1419 264
242 3300003759 Ga0055525_1000013 Ga0055525_1000013324 265
243 3300006353 Ga0075370_10075351 Ga0075370_100753512 265
244 3300009148 Ga0105243_10034597 Ga0105243_100345973 265
245 3300009174 Ga0105241_10560987 Ga0105241_105609871 265
246 3300009177 Ga0105248_10003094 Ga0105248_100030944 265
247 3300009553 Ga0105249_10030383 Ga0105249_100303834 265
248 3300014325 Ga0163163_10000815 Ga0163163_100008155 265
249 3300025230 Ga0209563_100025 Ga0209563_100025263 265
250 3300031250 Ga0265331_10006222 Ga0265331_100062223 265
251 3300031251 Ga0265327_10000636 Ga0265327_1000063637 265
252 3300031548 Ga0307408_100000726 Ga0307408_10000072610 265
253 3300031995 Ga0307409_100064280 Ga0307409_1000642802 265
254 3300032005 Ga0307411_10045841 Ga0307411_100458412 265
255 3300045051 Ga0451576_0024024 Ga0451576_0024024_2476_3273 265
256 3300048909 Ga0496106_0014902 Ga0496106_0014902_4145_4942 265
257 3300048911 Ga0496108_0062012 Ga0496108_0062012_917_1714 265
258 3300048912 Ga0496109_0019496 Ga0496109_0019496_2075_2872 265
259 3300048913 Ga0496110_0069548 Ga0496110_0069548_1816_2613 265
260 3300048916 Ga0496113_0256388 Ga0496113_0256388_107_904 265
261 3300050496 nmdc:mga07m45_11299_c1 nmdc:mga07m45_11299_c1_3106_3942 265
262 3300053139 Ga0500568_0003392 Ga0500568_0003392_1116_1940 265
263 3300003316 rootH1_10119622 rootH1_101196222 266
264 3300009098 Ga0105245_10061693 Ga0105245_100616932 266
265 3300030731 Ga0316177_1169858 Ga0316177_11698583 266
266 3300050511 nmdc:mga08y16_120708_c1 nmdc:mga08y16_120708_c1_1157_1957 266
267 3300053159 Ga0500630_033228 Ga0500630_033228_1265_2149 266
268 iso_pu_bacteria 2585428059 2587740573 266
269 iso_pu_bacteria 2643221676 2644426525 266
270 iso_pu_bacteria 2818991459 2819668712 266
271 iso_pu_bacteria 2857453340 2857454222 266
272 iso_pu_bacteria 2971410472 2971415177 266
273 iso_pu_bacteria 8056533031 8056540772 266
274 3300003578 Ga0006562J51391_1022123 Ga0006562J51391_10221232 267
275 3300005437 Ga0070710_10000115 Ga0070710_1000011522 267
276 3300006038 Ga0075365_10259306 Ga0075365_102593062 267
277 3300011119 Ga0105246_10057019 Ga0105246_100570193 267
278 3300013105 Ga0157369_10015066 Ga0157369_100150666 267
279 3300013105 Ga0157369_10597577 Ga0157369_105975772 267
280 3300013308 Ga0157375_10052031 Ga0157375_100520313 267
281 3300014326 Ga0157380_10085232 Ga0157380_100852322 267
282 3300014745 Ga0157377_10063955 Ga0157377_100639552 267
283 3300017792 Ga0163161_10122114 Ga0163161_101221142 267
284 3300025898 Ga0207692_10000903 Ga0207692_1000090310 267
285 3300026116 Ga0207674_10158898 Ga0207674_101588983 267
286 3300026142 Ga0207698_10147968 Ga0207698_101479682 267
287 3300030733 Ga0314311_1246557 Ga0314311_12465573 267
288 3300030736 Ga0316180_1188098 Ga0316180_11880982 267
289 3300031852 Ga0307410_10002884 Ga0307410_100028844 267
290 3300031903 Ga0307407_10013768 Ga0307407_100137682 267
291 3300031995 Ga0307409_100004396 Ga0307409_1000043965 267
292 3300031995 Ga0307409_100415599 Ga0307409_1004155992 267
293 3300032002 Ga0307416_100038289 Ga0307416_1000382892 267
294 3300032004 Ga0307414_10509442 Ga0307414_105094422 267
295 3300032126 Ga0307415_100069356 Ga0307415_1000693562 267
296 3300037418 Ga0395900_0154506 Ga0395900_0154506_985_1812 267
297 3300037466 Ga0395898_0017104 Ga0395898_0017104_190_1017 267
298 3300038443 Ga0395901_0008501 Ga0395901_0008501_4955_5782 267
299 3300038443 Ga0395901_0070274 Ga0395901_0070274_413_1240 267
300 3300041453 Ga0451797_1175428 Ga0451797_1175428_401_1222 267
301 3300041509 Ga0451843_0531320 Ga0451843_0531320_500_1324 267
302 3300041512 Ga0451853_1688468 Ga0451853_1688468_408_1232 267
303 3300041999 Ga0439433_0010873 Ga0439433_0010873_888_1712 267
304 3300044658 Ga0466972_0003228 Ga0466972_0003228_4028_4834 267
305 3300044683 Ga0466965_0016523 Ga0466965_0016523_2336_3142 267
306 3300044683 Ga0466965_0028421 Ga0466965_0028421_1615_2421 267
307 3300044735 Ga0466968_0011464 Ga0466968_0011464_883_1689 267
308 3300044901 Ga0466960_0014640 Ga0466960_0014640_2140_2946 267
309 3300047315 Ga0495581_0041906 Ga0495581_0041906_1359_2186 267
310 3300047317 Ga0495604_0260863 Ga0495604_0260863_112_939 267
311 3300048904 Ga0496101_0122662 Ga0496101_0122662_925_1752 267
312 3300048905 Ga0496102_0134143 Ga0496102_0134143_904_1722 267
313 3300048907 Ga0496104_0011558 Ga0496104_0011558_4506_5333 267
314 3300048907 Ga0496104_0267836 Ga0496104_0267836_726_1553 267
315 3300048908 Ga0496105_0037798 Ga0496105_0037798_2286_3113 267
316 3300048908 Ga0496105_0475987 Ga0496105_0475987_69_896 267
317 3300048913 Ga0496110_0020547 Ga0496110_0020547_1125_1952 267
318 3300048914 Ga0496111_0027240 Ga0496111_0027240_2226_3053 267
319 3300048914 Ga0496111_0038617 Ga0496111_0038617_804_1622 267
320 3300048917 Ga0496114_0018763 Ga0496114_0018763_3759_4586 267
321 3300048917 Ga0496114_0019190 Ga0496114_0019190_114_941 267
322 3300048917 Ga0496114_0141748 Ga0496114_0141748_481_1305 267
323 3300048917 Ga0496114_0155317 Ga0496114_0155317_295_1119 267
324 3300048917 Ga0496114_0391704 Ga0496114_0391704_254_1072 267
325 3300048922 Ga0496119_0005999 Ga0496119_0005999_9582_10484 267
326 3300048923 Ga0496120_0004595 Ga0496120_0004595_9630_10532 267
327 3300048927 Ga0496124_0113712 Ga0496124_0113712_352_1251 267
328 3300049570 Ga0501033_0022344 Ga0501033_0022344_2720_3544 267
329 3300049572 Ga0501036_0009946 Ga0501036_0009946_3378_4202 267
330 3300049574 Ga0501038_0048787 Ga0501038_0048787_808_1632 267
331 3300049575 Ga0501039_0002127 Ga0501039_0002127_5224_6048 267
332 3300049575 Ga0501039_0141219 Ga0501039_0141219_785_1609 267
333 3300049576 Ga0501040_0001855 Ga0501040_0001855_2975_3799 267
334 3300049577 Ga0501041_0000351 Ga0501041_0000351_4205_5029 267
335 3300049577 Ga0501041_0080908 Ga0501041_0080908_488_1312 267
336 3300049578 Ga0501042_0003297 Ga0501042_0003297_1848_2672 267
337 3300049579 Ga0501043_0147692 Ga0501043_0147692_420_1244 267
338 3300049580 Ga0501046_0043463 Ga0501046_0043463_2098_2922 267
339 3300049582 Ga0501048_0002195 Ga0501048_0002195_2807_3631 267
340 3300049582 Ga0501048_0096211 Ga0501048_0096211_372_1196 267
341 3300049584 Ga0501068_0093280 Ga0501068_0093280_707_1531 267
342 3300049585 Ga0501069_0040040 Ga0501069_0040040_94_918 267
343 3300049585 Ga0501069_0168499 Ga0501069_0168499_310_1134 267
344 3300049586 Ga0501070_0542902 Ga0501070_0542902_89_895 267
345 3300049587 Ga0501071_0013332 Ga0501071_0013332_2734_3558 267
346 3300049588 Ga0501072_0020276 Ga0501072_0020276_710_1534 267
347 3300049589 Ga0501073_0180680 Ga0501073_0180680_236_1060 267
348 3300049589 Ga0501073_0286909 Ga0501073_0286909_37_858 267
349 3300049591 Ga0501075_0009786 Ga0501075_0009786_5598_6422 267
350 3300049591 Ga0501075_0085492 Ga0501075_0085492_655_1479 267
351 3300049592 Ga0501076_0004511 Ga0501076_0004511_4397_5221 267
352 3300049593 Ga0501077_0013975 Ga0501077_0013975_3944_4768 267
353 3300049741 Ga0501079_0006920 Ga0501079_0006920_7034_7858 267
354 3300049743 Ga0501081_0012009 Ga0501081_0012009_2100_2924 267
355 3300049744 Ga0501083_0174612 Ga0501083_0174612_257_1081 267
356 3300049822 Ga0501035_0042501 Ga0501035_0042501_885_1709 267
357 3300049824 Ga0501045_0002620 Ga0501045_0002620_2889_3713 267
358 3300049824 Ga0501045_0426520 Ga0501045_0426520_127_951 267
359 3300054114 Ga0501084_0005592 Ga0501084_0005592_4202_5026 267
360 3300059605 Ga0587106_012551 Ga0587106_012551_239_1060 267
361 3300059630 Ga0587128_013955 Ga0587128_013955_110_937 267
362 3300060353 Ga0501082_0012424 Ga0501082_0012424_3734_4558 267
363 iso_pu_bacteria 2585428059 2587739794 267
364 iso_pu_bacteria 2808606365 2808872136 267
365 iso_pu_bacteria 2919446982 2919448496 267
366 iso_pu_bacteria 2928972540 2928975561 267
367 iso_pu_bacteria 2977240413 2977241592 267
368 iso_pu_bacteria 8004182704 8004184330 267
369 3300005347 Ga0070668_100065996 Ga0070668_1000659962 268
370 3300005347 Ga0070668_100075209 Ga0070668_1000752093 268
371 3300005459 Ga0068867_100431334 Ga0068867_1004313342 268
372 3300005617 Ga0068859_100255222 Ga0068859_1002552222 268
373 3300005719 Ga0068861_100278666 Ga0068861_1002786662 268
374 3300005841 Ga0068863_100153893 Ga0068863_1001538932 268
375 3300005842 Ga0068858_100020530 Ga0068858_1000205303 268
376 3300005843 Ga0068860_100027056 Ga0068860_1000270563 268
377 3300006237 Ga0097621_100473726 Ga0097621_1004737262 268
378 3300006931 Ga0097620_100255237 Ga0097620_1002552372 268
379 3300009093 Ga0105240_10121688 Ga0105240_101216883 268
380 3300013104 Ga0157370_10006412 Ga0157370_100064124 268
381 3300013297 Ga0157378_10219146 Ga0157378_102191462 268
382 3300013306 Ga0163162_10595729 Ga0163162_105957292 268
383 3300013308 Ga0157375_10861507 Ga0157375_108615072 268
384 3300014325 Ga0163163_10125073 Ga0163163_101250733 268
385 3300014326 Ga0157380_10644480 Ga0157380_106444802 268
386 3300025321 Ga0207656_10052820 Ga0207656_100528202 268
387 3300025913 Ga0207695_10043588 Ga0207695_100435882 268
388 3300025940 Ga0207691_10053428 Ga0207691_100534282 268
389 3300025972 Ga0207668_10022882 Ga0207668_100228822 268
390 3300025972 Ga0207668_10038689 Ga0207668_100386894 268
391 3300026035 Ga0207703_10037545 Ga0207703_100375453 268
392 3300026088 Ga0207641_10084138 Ga0207641_100841383 268
393 3300026142 Ga0207698_10144175 Ga0207698_101441751 268
394 3300028380 Ga0268265_10019931 Ga0268265_100199313 268
395 3300028381 Ga0268264_10047271 Ga0268264_100472713 268
396 3300028381 Ga0268264_10282763 Ga0268264_102827632 268
397 3300046675 Ga0495657_0184880 Ga0495657_0184880_252_1082 268
398 3300048912 Ga0496109_0564765 Ga0496109_0564765_168_974 268
399 3300048920 Ga0496117_0002044 Ga0496117_0002044_25575_26387 268
400 3300048921 Ga0496118_0045041 Ga0496118_0045041_269_1081 268
401 3300048922 Ga0496119_0003426 Ga0496119_0003426_7830_8642 268
402 3300048923 Ga0496120_0027938 Ga0496120_0027938_2623_3435 268
403 3300048923 Ga0496120_0109047 Ga0496120_0109047_126_938 268
404 3300048925 Ga0496122_0000095 Ga0496122_0000095_54879_55691 268
405 3300048925 Ga0496122_0104295 Ga0496122_0104295_1047_1859 268
406 3300048926 Ga0496123_0000100 Ga0496123_0000100_114301_115113 268
407 3300048926 Ga0496123_0049292 Ga0496123_0049292_1052_1864 268
408 3300048927 Ga0496124_0084933 Ga0496124_0084933_695_1507 268
409 3300048928 Ga0496125_0009168 Ga0496125_0009168_4296_5108 268
410 3300048929 Ga0496126_0273963 Ga0496126_0273963_545_1357 268
411 3300049575 Ga0501039_0107250 Ga0501039_0107250_1002_1820 268
412 3300049583 Ga0501067_0005857 Ga0501067_0005857_5573_6406 268
413 3300049584 Ga0501068_0088155 Ga0501068_0088155_931_1764 268
414 3300049585 Ga0501069_0014894 Ga0501069_0014894_2449_3282 268
415 3300049585 Ga0501069_0114786 Ga0501069_0114786_105_935 268
416 iso_pu_bacteria 8057977335 8057981165 268
417 3300003203 JGI25406J46586_10021274 JGI25406J46586_100212742 269
418 3300003320 rootH2_10131010 rootH2_101310104 269
419 3300005468 Ga0070707_100101926 Ga0070707_1001019263 269
420 3300005614 Ga0068856_100354049 Ga0068856_1003540492 269
421 3300005616 Ga0068852_100119728 Ga0068852_1001197282 269
422 3300005985 Ga0081539_10000760 Ga0081539_1000076036 269
423 3300006237 Ga0097621_100639878 Ga0097621_1006398781 269
424 3300006358 Ga0068871_100022878 Ga0068871_1000228782 269
425 3300006846 Ga0075430_100018449 Ga0075430_1000184493 269
426 3300006914 Ga0075436_100193153 Ga0075436_1001931532 269
427 3300009093 Ga0105240_10000463 Ga0105240_1000046327 269
428 3300009176 Ga0105242_10154332 Ga0105242_101543322 269
429 3300010375 Ga0105239_10122990 Ga0105239_101229903 269
430 3300014745 Ga0157377_10276231 Ga0157377_102762312 269
431 3300014969 Ga0157376_10715510 Ga0157376_107155102 269
432 3300025225 Ga0209566_100924 Ga0209566_1009247 269
433 3300025931 Ga0207644_10105086 Ga0207644_101050861 269
434 3300025941 Ga0207711_10260708 Ga0207711_102607082 269
435 3300026041 Ga0207639_10029908 Ga0207639_100299082 269
436 3300028794 Ga0307515_10122996 Ga0307515_101229962 269
437 3300031731 Ga0307405_10310101 Ga0307405_103101012 269
438 3300031901 Ga0307406_10085458 Ga0307406_100854582 269
439 3300032126 Ga0307415_100567817 Ga0307415_1005678172 269
440 3300037418 Ga0395900_0546998 Ga0395900_0546998_89_952 269
441 3300042461 Ga0439460_0057707 Ga0439460_0057707_160_1053 269
442 3300044693 Ga0466961_0002650 Ga0466961_0002650_5373_6191 269
443 3300044694 Ga0466963_0005765 Ga0466963_0005765_3274_4143 269
444 3300044706 Ga0466964_0005286 Ga0466964_0005286_110_979 269
445 3300044719 Ga0466971_0030128 Ga0466971_0030128_453_1313 269
446 3300044735 Ga0466968_0035093 Ga0466968_0035093_943_1803 269
447 3300044735 Ga0466968_0181841 Ga0466968_0181841_108_926 269
448 3300044842 Ga0466957_0008856 Ga0466957_0008856_2515_3384 269
449 3300044842 Ga0466957_0080826 Ga0466957_0080826_818_1681 269
450 3300045049 Ga0466959_0001490 Ga0466959_0001490_12365_13183 269
451 3300045049 Ga0466959_0223581 Ga0466959_0223581_132_992 269
452 3300046463 Ga0495653_0003821 Ga0495653_0003821_7279_8106 269
453 3300046473 Ga0495582_0206664 Ga0495582_0206664_65_874 269
454 3300046476 Ga0495662_0042102 Ga0495662_0042102_1134_1961 269
455 3300046516 Ga0495628_0209079 Ga0495628_0209079_387_1214 269
456 3300046529 Ga0495652_0009336 Ga0495652_0009336_305_1132 269
457 3300046533 Ga0495640_0003428 Ga0495640_0003428_6448_7275 269
458 3300046559 Ga0495667_0011807 Ga0495667_0011807_178_1005 269
459 3300046809 Ga0495600_0004313 Ga0495600_0004313_1272_2099 269
460 3300047319 Ga0495674_0013547 Ga0495674_0013547_1348_2175 269
461 3300047322 Ga0495680_0006852 Ga0495680_0006852_2231_3058 269
462 3300047471 Ga0495684_0001503 Ga0495684_0001503_10942_11769 269
463 3300048917 Ga0496114_0023848 Ga0496114_0023848_1746_2564 269
464 3300048917 Ga0496114_0202840 Ga0496114_0202840_340_1236 269
465 3300050509 nmdc:mga0qj67_12086_c1 nmdc:mga0qj67_12086_c1_3274_4101 269
466 3300053077 Ga0495601_0022058 Ga0495601_0022058_1059_1886 269
467 3300053085 Ga0495619_0001037 Ga0495619_0001037_12300_13127 269
468 3300061719 Ga0466962_0014309 Ga0466962_0014309_318_1178 269
469 3300061734 Ga0530510_0064645 Ga0530510_0064645_1645_2481 269
470 iso_pu_bacteria 2537561836 2538835051 269
471 iso_pu_bacteria 2593339238 2595448621 269
472 iso_pu_bacteria 2593339239 2595450872 269
473 iso_pu_bacteria 2643221562 2643828477 269
474 iso_pu_bacteria 2718218334 2721029549 269
475 iso_pu_bacteria 2734482264 2735834852 269
476 iso_pu_bacteria 2738543009 2739228010 269
477 iso_pu_bacteria 2818991440 2819564528 269
478 iso_pu_bacteria 2842914999 2842915968 269
479 iso_pu_bacteria 2842918807 2842921242 269
480 iso_pu_bacteria 2884338543 2884342733 269
481 iso_pu_bacteria 2904463128 2904465172 269
482 iso_pu_bacteria 2919085039 2919088680 269
483 iso_pu_bacteria 2919404418 2919407295 269
484 iso_pu_bacteria 2933418574 2933419809 269
485 iso_pu_bacteria 2941471342 2941474172 269
486 iso_pu_bacteria 2953994433 2953996484 269
487 3300005329 Ga0070683_100003457 Ga0070683_1000034578 270
488 3300005329 Ga0070683_100122593 Ga0070683_1001225932 270
489 3300005338 Ga0068868_100194591 Ga0068868_1001945912 270
490 3300005347 Ga0070668_100016576 Ga0070668_1000165763 270
491 3300005354 Ga0070675_100183563 Ga0070675_1001835632 270
492 3300005435 Ga0070714_100315816 Ga0070714_1003158162 270
493 3300005547 Ga0070693_100332400 Ga0070693_1003324002 270
494 3300005548 Ga0070665_100399674 Ga0070665_1003996742 270
495 3300005549 Ga0070704_100291184 Ga0070704_1002911842 270
496 3300005843 Ga0068860_100557183 Ga0068860_1005571832 270
497 3300005981 Ga0081538_10011849 Ga0081538_100118492 270
498 3300006881 Ga0068865_100059225 Ga0068865_1000592253 270
499 3300007076 Ga0075435_100008286 Ga0075435_1000082863 270
500 3300009098 Ga0105245_10033521 Ga0105245_100335213 270
501 3300009098 Ga0105245_10135198 Ga0105245_101351983 270
502 3300009177 Ga0105248_10272171 Ga0105248_102721712 270
503 3300010375 Ga0105239_10435864 Ga0105239_104358642 270
504 3300011119 Ga0105246_10289526 Ga0105246_102895262 270
505 3300013296 Ga0157374_10039568 Ga0157374_100395684 270
506 3300013308 Ga0157375_10126198 Ga0157375_101261982 270
507 3300025901 Ga0207688_10067304 Ga0207688_100673042 270
508 3300025929 Ga0207664_10264910 Ga0207664_102649102 270
509 3300025931 Ga0207644_10161663 Ga0207644_101616632 270
510 3300025935 Ga0207709_10033228 Ga0207709_100332283 270
511 3300025944 Ga0207661_10256244 Ga0207661_102562442 270
512 3300025972 Ga0207668_10001161 Ga0207668_100011613 270
513 3300025981 Ga0207640_10248436 Ga0207640_102484361 270
514 3300026095 Ga0207676_10303052 Ga0207676_103030522 270
515 3300026118 Ga0207675_100091111 Ga0207675_1000911113 270
516 3300028381 Ga0268264_10235251 Ga0268264_102352512 270
517 3300031824 Ga0307413_10076045 Ga0307413_100760452 270
518 3300031838 Ga0307518_10225440 Ga0307518_102254402 270
519 3300031903 Ga0307407_10039417 Ga0307407_100394172 270
520 3300032002 Ga0307416_100042073 Ga0307416_1000420732 270
521 3300032002 Ga0307416_100238604 Ga0307416_1002386041 270
522 3300032004 Ga0307414_10104213 Ga0307414_101042132 270
523 3300032126 Ga0307415_100012488 Ga0307415_1000124882 270
524 3300035112 Ga0373932_0000192 Ga0373932_0000192_4214_5026 270
525 3300035725 Ga0373947_0329523 Ga0373947_0329523_152_997 270
526 3300037068 Ga0373925_0104152 Ga0373925_0104152_337_1164 270
527 3300042003 Ga0439443_002198 Ga0439443_002198_621_1514 270
528 3300042005 Ga0439448_0000850 Ga0439448_0000850_4846_5739 270
529 3300042016 Ga0439463_000675 Ga0439463_000675_3977_4870 270
530 3300042118 Ga0450914_001647 Ga0450914_001647_262_1155 270
531 3300042136 Ga0450900_005406 Ga0450900_005406_174_1067 270
532 3300042137 Ga0450902_009538 Ga0450902_009538_437_1330 270
533 3300042437 Ga0439444_0002964 Ga0439444_0002964_507_1400 270
534 3300042439 Ga0439464_0000974 Ga0439464_0000974_2685_3578 270
535 3300042461 Ga0439460_0072149 Ga0439460_0072149_97_987 270
536 3300042993 Ga0439440_0000905 Ga0439440_0000905_2262_3155 270
537 3300044656 Ga0466969_0001688 Ga0466969_0001688_2295_3128 270
538 3300044693 Ga0466961_0081362 Ga0466961_0081362_482_1315 270
539 3300044735 Ga0466968_0009194 Ga0466968_0009194_2270_3103 270
540 3300044842 Ga0466957_0025234 Ga0466957_0025234_930_1763 270
541 3300045049 Ga0466959_0005409 Ga0466959_0005409_2578_3411 270
542 3300045836 Ga0466958_0060538 Ga0466958_0060538_1060_1911 270
543 3300046459 Ga0495629_0113904 Ga0495629_0113904_574_1413 270
544 3300046473 Ga0495582_0182468 Ga0495582_0182468_17_856 270
545 3300046683 Ga0495658_0172476 Ga0495658_0172476_49_888 270
546 3300048903 Ga0496100_0378644 Ga0496100_0378644_141_959 270
547 3300048904 Ga0496101_0001805 Ga0496101_0001805_8267_9085 270
548 3300048905 Ga0496102_0003427 Ga0496102_0003427_11199_12017 270
549 3300048907 Ga0496104_0013849 Ga0496104_0013849_4847_5665 270
550 3300048908 Ga0496105_0146171 Ga0496105_0146171_301_1119 270
551 3300048909 Ga0496106_0002663 Ga0496106_0002663_8482_9300 270
552 3300048910 Ga0496107_0002232 Ga0496107_0002232_2181_2999 270
553 3300048911 Ga0496108_0125160 Ga0496108_0125160_318_1136 270
554 3300048912 Ga0496109_0137823 Ga0496109_0137823_123_941 270
555 3300048917 Ga0496114_0036508 Ga0496114_0036508_559_1377 270
556 3300048920 Ga0496117_0000797 Ga0496117_0000797_33341_34177 270
557 3300048928 Ga0496125_0007966 Ga0496125_0007966_3759_4595 270
558 3300048929 Ga0496126_0002948 Ga0496126_0002948_6253_7089 270
559 3300049571 Ga0501034_0189060 Ga0501034_0189060_244_1077 270
560 3300049573 Ga0501037_0022015 Ga0501037_0022015_131_964 270
561 3300049574 Ga0501038_0055323 Ga0501038_0055323_1175_2008 270
562 3300049823 Ga0501044_0039025 Ga0501044_0039025_3798_4631 270
563 3300049823 Ga0501044_0270768 Ga0501044_0270768_235_1068 270
564 3300050513 nmdc:mga0rr50_5781_c1 nmdc:mga0rr50_5781_c1_1624_2436 270
565 3300059424 Ga0590075_008038 Ga0590075_008038_1399_2289 270
566 iso_pu_bacteria 2585428059 2587737742 270
567 iso_pu_bacteria 2643221566 2643846507 270
568 iso_pu_bacteria 2643221597 2643996627 270
569 iso_pu_bacteria 2643221657 2644321289 270
570 iso_pu_bacteria 2643221676 2644423172 270
571 iso_pu_bacteria 2671180694 2673822818 270
572 iso_pu_bacteria 2791354901 2791910027 270
573 iso_pu_bacteria 2818991318 2819428218 270
574 iso_pu_bacteria 2925326138 2925329674 270
575 iso_pu_bacteria 2980182181 2980184313 270
576 iso_pu_bacteria 2984527788 2984529647 270
577 iso_pu_bacteria 2984532647 2984535754 270
578 iso_pu_bacteria 3001267043 3001271700 270
579 iso_pu_bacteria 3006973921 3006975206 270
580 iso_pu_bacteria 3006984091 3006986443 270
581 iso_pu_bacteria 3006988479 3006990436 270
582 iso_pu_bacteria 3006988479 3006991007 270
583 iso_pu_bacteria 8046991243 8046998388 270
584 3300003323 rootH1_10016342 rootH1_100163422 271
585 3300003781 Ga0055536_1008801 Ga0055536_10088014 271
586 3300005329 Ga0070683_100131221 Ga0070683_1001312212 271
587 3300005337 Ga0070682_100000168 Ga0070682_10000016834 271
588 3300005338 Ga0068868_100000111 Ga0068868_10000011153 271
589 3300005340 Ga0070689_100000779 Ga0070689_1000007793 271
590 3300005364 Ga0070673_100076248 Ga0070673_1000762483 271
591 3300005439 Ga0070711_100016777 Ga0070711_1000167773 271
592 3300005445 Ga0070708_100175221 Ga0070708_1001752212 271
593 3300005539 Ga0068853_100211417 Ga0068853_1002114172 271
594 3300005618 Ga0068864_100000034 Ga0068864_100000034136 271
595 3300005842 Ga0068858_100003742 Ga0068858_10000374213 271
596 3300005842 Ga0068858_100504899 Ga0068858_1005048992 271
597 3300006038 Ga0075365_10015357 Ga0075365_100153572 271
598 3300009098 Ga0105245_10002175 Ga0105245_1000217513 271
599 3300010375 Ga0105239_10659812 Ga0105239_106598122 271
600 3300013102 Ga0157371_10030522 Ga0157371_100305222 271
601 3300013105 Ga0157369_10284511 Ga0157369_102845112 271
602 3300021384 Ga0213876_10157735 Ga0213876_101577352 271
603 3300025916 Ga0207663_10013274 Ga0207663_100132742 271
604 3300025927 Ga0207687_10030751 Ga0207687_100307512 271
605 3300025936 Ga0207670_10000517 Ga0207670_1000051720 271
606 3300025960 Ga0207651_10053767 Ga0207651_100537673 271
607 3300026023 Ga0207677_10000007 Ga0207677_10000007238 271
608 3300026035 Ga0207703_10005765 Ga0207703_100057656 271
609 3300026041 Ga0207639_10165568 Ga0207639_101655682 271
610 3300026095 Ga0207676_10000020 Ga0207676_10000020226 271
611 3300026142 Ga0207698_10057413 Ga0207698_100574132 271
612 3300031731 Ga0307405_10379443 Ga0307405_103794432 271
613 3300031911 Ga0307412_10004627 Ga0307412_100046274 271
614 3300032002 Ga0307416_100174472 Ga0307416_1001744722 271
615 3300039437 Ga0436365_0234277 Ga0436365_0234277_3541_4356 271
616 3300039437 Ga0436365_1354094 Ga0436365_1354094_570_1385 271
617 3300044712 Ga0453684_0344839 Ga0453684_0344839_592_1419 271
618 3300046558 Ga0495633_0000587 Ga0495633_0000587_16829_17644 271
619 3300046694 Ga0495649_0000444 Ga0495649_0000444_18109_18924 271
620 3300048910 Ga0496107_0257141 Ga0496107_0257141_32_859 271
621 3300048925 Ga0496122_0005695 Ga0496122_0005695_8870_9685 271
622 3300048926 Ga0496123_0001597 Ga0496123_0001597_24204_25019 271
623 3300048927 Ga0496124_0279921 Ga0496124_0279921_347_1162 271
624 3300050492 nmdc:mga0yw44_132879_c1 nmdc:mga0yw44_132879_c1_484_1347 271
625 3300050492 nmdc:mga0yw44_2395_c2 nmdc:mga0yw44_2395_c2_2519_3406 271
626 3300053136 Ga0500559_0000231 Ga0500559_0000231_25685_26554 271
627 3300053140 Ga0500573_0000005 Ga0500573_0000005_23805_24671 271
628 iso_pu_bacteria 2751185782 2753270671 271
629 iso_pu_bacteria 2757320536 2758227034 271
630 iso_pu_bacteria 2773857758 2774381080 271
631 iso_pu_bacteria 2888578766 2888583343 271
632 iso_pu_bacteria 2889049205 2889054314 271
633 iso_pu_bacteria 2904509784 2904511036 271
634 iso_pu_bacteria 2908678064 2908680214 271
635 iso_pu_bacteria 2919069694 2919072415 271
636 iso_pu_bacteria 2977228692 2977229037 271
637 iso_pu_bacteria 2977236895 2977237824 271
638 iso_pu_bacteria 2977264416 2977267694 271
639 iso_pu_bacteria 8016254467 8016256587 271
640 3300003203 JGI25406J46586_10015116 JGI25406J46586_100151162 272
641 3300005289 Ga0065704_10091180 Ga0065704_100911803 272
642 3300005290 Ga0065712_10071120 Ga0065712_100711203 272
643 3300005293 Ga0065715_10097407 Ga0065715_100974072 272
644 3300005293 Ga0065715_10194193 Ga0065715_101941932 272
645 3300005295 Ga0065707_10003479 Ga0065707_100034792 272
646 3300005295 Ga0065707_10082235 Ga0065707_1008223516 272
647 3300005328 Ga0070676_10111057 Ga0070676_101110572 272
648 3300005329 Ga0070683_100503871 Ga0070683_1005038712 272
649 3300005330 Ga0070690_100010415 Ga0070690_1000104153 272
650 3300005331 Ga0070670_100036121 Ga0070670_1000361212 272
651 3300005331 Ga0070670_100153287 Ga0070670_1001532872 272
652 3300005334 Ga0068869_100009942 Ga0068869_1000099425 272
653 3300005335 Ga0070666_10022092 Ga0070666_100220924 272
654 3300005336 Ga0070680_100109579 Ga0070680_1001095792 272
655 3300005338 Ga0068868_100085421 Ga0068868_1000854213 272
656 3300005339 Ga0070660_100002113 Ga0070660_1000021139 272
657 3300005340 Ga0070689_100000909 Ga0070689_10000090910 272
658 3300005340 Ga0070689_100073584 Ga0070689_1000735841 272
659 3300005340 Ga0070689_100211585 Ga0070689_1002115852 272
660 3300005343 Ga0070687_100002720 Ga0070687_1000027202 272
661 3300005344 Ga0070661_100011729 Ga0070661_1000117293 272
662 3300005344 Ga0070661_100019948 Ga0070661_1000199483 272
663 3300005344 Ga0070661_100321049 Ga0070661_1003210492 272
664 3300005347 Ga0070668_100008946 Ga0070668_1000089465 272
665 3300005347 Ga0070668_100009734 Ga0070668_1000097342 272
666 3300005353 Ga0070669_100035569 Ga0070669_1000355693 272
667 3300005353 Ga0070669_100205394 Ga0070669_1002053941 272
668 3300005354 Ga0070675_100000309 Ga0070675_10000030923 272
669 3300005354 Ga0070675_100099053 Ga0070675_1000990532 272
670 3300005355 Ga0070671_100001487 Ga0070671_1000014873 272
671 3300005355 Ga0070671_100014482 Ga0070671_1000144822 272
672 3300005355 Ga0070671_100371323 Ga0070671_1003713232 272
673 3300005364 Ga0070673_100200636 Ga0070673_1002006362 272
674 3300005364 Ga0070673_100532896 Ga0070673_1005328961 272
675 3300005365 Ga0070688_100000521 Ga0070688_1000005218 272
676 3300005366 Ga0070659_100016024 Ga0070659_1000160245 272
677 3300005434 Ga0070709_10002889 Ga0070709_100028894 272
678 3300005436 Ga0070713_100000148 Ga0070713_1000001482 272
679 3300005436 Ga0070713_100053481 Ga0070713_1000534812 272
680 3300005437 Ga0070710_10017264 Ga0070710_100172643 272
681 3300005439 Ga0070711_100017088 Ga0070711_1000170882 272
682 3300005439 Ga0070711_100090330 Ga0070711_1000903302 272
683 3300005440 Ga0070705_100032792 Ga0070705_1000327922 272
684 3300005441 Ga0070700_100012436 Ga0070700_1000124362 272
685 3300005444 Ga0070694_100014538 Ga0070694_1000145382 272
686 3300005444 Ga0070694_100034370 Ga0070694_1000343703 272
687 3300005445 Ga0070708_100031969 Ga0070708_1000319692 272
688 3300005445 Ga0070708_100098924 Ga0070708_1000989241 272
689 3300005445 Ga0070708_100151250 Ga0070708_1001512502 272
690 3300005457 Ga0070662_100001756 Ga0070662_1000017568 272
691 3300005457 Ga0070662_100004591 Ga0070662_1000045914 272
692 3300005457 Ga0070662_100132139 Ga0070662_1001321392 272
693 3300005458 Ga0070681_10114895 Ga0070681_101148952 272
694 3300005458 Ga0070681_10676884 Ga0070681_106768841 272
695 3300005459 Ga0068867_100045351 Ga0068867_1000453512 272
696 3300005467 Ga0070706_100528721 Ga0070706_1005287211 272
697 3300005468 Ga0070707_100076582 Ga0070707_1000765823 272
698 3300005471 Ga0070698_100024526 Ga0070698_1000245262 272
699 3300005471 Ga0070698_100046264 Ga0070698_1000462642 272
700 3300005518 Ga0070699_100009308 Ga0070699_1000093082 272
701 3300005518 Ga0070699_100021522 Ga0070699_1000215222 272
702 3300005518 Ga0070699_100618564 Ga0070699_1006185642 272
703 3300005530 Ga0070679_100052768 Ga0070679_1000527682 272
704 3300005530 Ga0070679_100084243 Ga0070679_1000842432 272
705 3300005535 Ga0070684_100068217 Ga0070684_1000682172 272
706 3300005543 Ga0070672_100462288 Ga0070672_1004622881 272
707 3300005543 Ga0070672_100574033 Ga0070672_1005740332 272
708 3300005544 Ga0070686_100054066 Ga0070686_1000540662 272
709 3300005546 Ga0070696_100011025 Ga0070696_1000110253 272
710 3300005546 Ga0070696_100143748 Ga0070696_1001437482 272
711 3300005548 Ga0070665_100024630 Ga0070665_1000246305 272
712 3300005563 Ga0068855_100000418 Ga0068855_10000041829 272
713 3300005563 Ga0068855_100496924 Ga0068855_1004969242 272
714 3300005564 Ga0070664_100000452 Ga0070664_1000004525 272
715 3300005564 Ga0070664_100005519 Ga0070664_1000055194 272
716 3300005564 Ga0070664_100183606 Ga0070664_1001836062 272
717 3300005564 Ga0070664_100226563 Ga0070664_1002265632 272
718 3300005577 Ga0068857_100021740 Ga0068857_1000217403 272
719 3300005614 Ga0068856_100005148 Ga0068856_1000051483 272
720 3300005614 Ga0068856_100235153 Ga0068856_1002351532 272
721 3300005615 Ga0070702_100100289 Ga0070702_1001002892 272
722 3300005616 Ga0068852_100007212 Ga0068852_1000072123 272
723 3300005617 Ga0068859_100002639 Ga0068859_10000263910 272
724 3300005617 Ga0068859_100220318 Ga0068859_1002203182 272
725 3300005617 Ga0068859_100457833 Ga0068859_1004578332 272
726 3300005618 Ga0068864_100010778 Ga0068864_1000107785 272
727 3300005618 Ga0068864_100290175 Ga0068864_1002901752 272
728 3300005718 Ga0068866_10328334 Ga0068866_103283341 272
729 3300005719 Ga0068861_100009118 Ga0068861_1000091184 272
730 3300005719 Ga0068861_100021580 Ga0068861_1000215802 272
731 3300005719 Ga0068861_100047853 Ga0068861_1000478532 272
732 3300005719 Ga0068861_100091389 Ga0068861_1000913892 272
733 3300005840 Ga0068870_10001310 Ga0068870_100013105 272
734 3300005840 Ga0068870_10035866 Ga0068870_100358663 272
735 3300005841 Ga0068863_100000966 Ga0068863_10000096620 272
736 3300005842 Ga0068858_100081796 Ga0068858_1000817963 272
737 3300005842 Ga0068858_100288446 Ga0068858_1002884462 272
738 3300005843 Ga0068860_100509560 Ga0068860_1005095601 272
739 3300005843 Ga0068860_100939636 Ga0068860_1009396361 272
740 3300005844 Ga0068862_100000636 Ga0068862_1000006365 272
741 3300005844 Ga0068862_100009944 Ga0068862_1000099443 272
742 3300005844 Ga0068862_100183943 Ga0068862_1001839432 272
743 3300005844 Ga0068862_100351844 Ga0068862_1003518442 272
744 3300005985 Ga0081539_10009935 Ga0081539_100099355 272
745 3300005985 Ga0081539_10012106 Ga0081539_100121062 272
746 3300006175 Ga0070712_100373205 Ga0070712_1003732052 272
747 3300006237 Ga0097621_100056567 Ga0097621_1000565672 272
748 3300006358 Ga0068871_100247785 Ga0068871_1002477852 272
749 3300006844 Ga0075428_100000313 Ga0075428_10000031332 272
750 3300006844 Ga0075428_100006604 Ga0075428_1000066045 272
751 3300006844 Ga0075428_100102793 Ga0075428_1001027932 272
752 3300006844 Ga0075428_100260302 Ga0075428_1002603022 272
753 3300006846 Ga0075430_100001872 Ga0075430_1000018725 272
754 3300006846 Ga0075430_100003277 Ga0075430_1000032775 272
755 3300006846 Ga0075430_100015989 Ga0075430_1000159894 272
756 3300006846 Ga0075430_100073138 Ga0075430_1000731381 272
757 3300006846 Ga0075430_100161214 Ga0075430_1001612142 272
758 3300006847 Ga0075431_100000035 Ga0075431_1000000355 272
759 3300006847 Ga0075431_100013588 Ga0075431_1000135882 272
760 3300006847 Ga0075431_100015765 Ga0075431_1000157653 272
761 3300006847 Ga0075431_100132435 Ga0075431_1001324352 272
762 3300006847 Ga0075431_100228393 Ga0075431_1002283932 272
763 3300006852 Ga0075433_10101124 Ga0075433_101011242 272
764 3300006871 Ga0075434_100107697 Ga0075434_1001076972 272
765 3300006871 Ga0075434_100551790 Ga0075434_1005517902 272
766 3300006880 Ga0075429_100000937 Ga0075429_10000093712 272
767 3300006880 Ga0075429_100003909 Ga0075429_1000039095 272
768 3300006880 Ga0075429_100007779 Ga0075429_1000077796 272
769 3300006880 Ga0075429_100009974 Ga0075429_1000099747 272
770 3300006880 Ga0075429_100112698 Ga0075429_1001126982 272
771 3300006881 Ga0068865_100044392 Ga0068865_1000443922 272
772 3300006881 Ga0068865_100344001 Ga0068865_1003440012 272
773 3300006931 Ga0097620_100002639 Ga0097620_10000263910 272
774 3300006931 Ga0097620_100220334 Ga0097620_1002203342 272
775 3300006931 Ga0097620_100457816 Ga0097620_1004578162 272
776 3300007265 Ga0099794_10196166 Ga0099794_101961662 272
777 3300009093 Ga0105240_10021739 Ga0105240_100217394 272
778 3300009094 Ga0111539_10002396 Ga0111539_1000239616 272
779 3300009094 Ga0111539_10015958 Ga0111539_100159585 272
780 3300009094 Ga0111539_10020077 Ga0111539_100200774 272
781 3300009147 Ga0114129_10000407 Ga0114129_1000040746 272
782 3300009147 Ga0114129_10004942 Ga0114129_1000494213 272
783 3300009147 Ga0114129_10043627 Ga0114129_100436273 272
784 3300009147 Ga0114129_10081904 Ga0114129_100819042 272
785 3300009147 Ga0114129_10370672 Ga0114129_103706722 272
786 3300009148 Ga0105243_10017625 Ga0105243_100176252 272
787 3300009148 Ga0105243_10294928 Ga0105243_102949282 272
788 3300009176 Ga0105242_10039729 Ga0105242_100397293 272
789 3300009176 Ga0105242_10327196 Ga0105242_103271961 272
790 3300009545 Ga0105237_10165436 Ga0105237_101654362 272
791 3300009553 Ga0105249_10013352 Ga0105249_100133524 272
792 3300009553 Ga0105249_10016378 Ga0105249_100163785 272
793 3300009553 Ga0105249_10356235 Ga0105249_103562352 272
794 3300011119 Ga0105246_10060438 Ga0105246_100604382 272
795 3300013104 Ga0157370_10024251 Ga0157370_100242513 272
796 3300013105 Ga0157369_10146365 Ga0157369_101463652 272
797 3300013306 Ga0163162_10192046 Ga0163162_101920463 272
798 3300013307 Ga0157372_10022638 Ga0157372_100226384 272
799 3300014325 Ga0163163_10422563 Ga0163163_104225632 272
800 3300014326 Ga0157380_10005164 Ga0157380_100051642 272
801 3300014326 Ga0157380_10285507 Ga0157380_102855072 272
802 3300017792 Ga0163161_10147680 Ga0163161_101476802 272
803 3300025903 Ga0207680_10011759 Ga0207680_100117592 272
804 3300025906 Ga0207699_10096777 Ga0207699_100967772 272
805 3300025908 Ga0207643_10003541 Ga0207643_100035414 272
806 3300025908 Ga0207643_10129307 Ga0207643_101293072 272
807 3300025913 Ga0207695_10000868 Ga0207695_1000086815 272
808 3300025913 Ga0207695_10026577 Ga0207695_100265774 272
809 3300025915 Ga0207693_10209203 Ga0207693_102092032 272
810 3300025916 Ga0207663_10012965 Ga0207663_100129652 272
811 3300025918 Ga0207662_10001682 Ga0207662_100016822 272
812 3300025919 Ga0207657_10001329 Ga0207657_100013294 272
813 3300025920 Ga0207649_10012035 Ga0207649_100120352 272
814 3300025920 Ga0207649_10030162 Ga0207649_100301623 272
815 3300025923 Ga0207681_10035282 Ga0207681_100352823 272
816 3300025925 Ga0207650_10026571 Ga0207650_100265712 272
817 3300025925 Ga0207650_10029958 Ga0207650_100299582 272
818 3300025926 Ga0207659_10013525 Ga0207659_100135253 272
819 3300025926 Ga0207659_10176585 Ga0207659_101765852 272
820 3300025928 Ga0207700_10000303 Ga0207700_100003032 272
821 3300025928 Ga0207700_10125722 Ga0207700_101257221 272
822 3300025929 Ga0207664_10002862 Ga0207664_100028625 272
823 3300025931 Ga0207644_10011002 Ga0207644_100110023 272
824 3300025931 Ga0207644_10055555 Ga0207644_100555552 272
825 3300025932 Ga0207690_10003928 Ga0207690_100039284 272
826 3300025932 Ga0207690_10050325 Ga0207690_100503253 272
827 3300025933 Ga0207706_10000024 Ga0207706_1000002454 272
828 3300025933 Ga0207706_10004120 Ga0207706_100041204 272
829 3300025933 Ga0207706_10035147 Ga0207706_100351474 272
830 3300025933 Ga0207706_10153108 Ga0207706_101531082 272
831 3300025935 Ga0207709_10009213 Ga0207709_100092133 272
832 3300025935 Ga0207709_10016347 Ga0207709_100163473 272
833 3300025935 Ga0207709_10115869 Ga0207709_101158692 272
834 3300025936 Ga0207670_10015774 Ga0207670_100157744 272
835 3300025938 Ga0207704_10050222 Ga0207704_100502222 272
836 3300025941 Ga0207711_10012368 Ga0207711_100123683 272
837 3300025941 Ga0207711_10239770 Ga0207711_102397702 272
838 3300025942 Ga0207689_10014817 Ga0207689_100148172 272
839 3300025945 Ga0207679_10010501 Ga0207679_100105014 272
840 3300025945 Ga0207679_10404030 Ga0207679_104040302 272
841 3300025949 Ga0207667_10016073 Ga0207667_100160735 272
842 3300025949 Ga0207667_10248203 Ga0207667_102482032 272
843 3300025960 Ga0207651_10396422 Ga0207651_103964222 272
844 3300025961 Ga0207712_10010920 Ga0207712_100109204 272
845 3300025961 Ga0207712_10030600 Ga0207712_100306003 272
846 3300025961 Ga0207712_10036140 Ga0207712_100361402 272
847 3300025972 Ga0207668_10008778 Ga0207668_100087784 272
848 3300025972 Ga0207668_10036852 Ga0207668_100368523 272
849 3300025986 Ga0207658_10062639 Ga0207658_100626392 272
850 3300026023 Ga0207677_10043471 Ga0207677_100434712 272
851 3300026035 Ga0207703_10244461 Ga0207703_102444612 272
852 3300026035 Ga0207703_10319513 Ga0207703_103195131 272
853 3300026041 Ga0207639_10051442 Ga0207639_100514422 272
854 3300026067 Ga0207678_10185125 Ga0207678_101851252 272
855 3300026075 Ga0207708_10003604 Ga0207708_100036043 272
856 3300026075 Ga0207708_10025674 Ga0207708_100256743 272
857 3300026078 Ga0207702_10007015 Ga0207702_100070153 272
858 3300026078 Ga0207702_10266296 Ga0207702_102662962 272
859 3300026088 Ga0207641_10020666 Ga0207641_100206662 272
860 3300026089 Ga0207648_10013979 Ga0207648_100139794 272
861 3300026089 Ga0207648_10142883 Ga0207648_101428832 272
862 3300026095 Ga0207676_10001211 Ga0207676_100012116 272
863 3300026095 Ga0207676_10290758 Ga0207676_102907582 272
864 3300026116 Ga0207674_10045600 Ga0207674_100456002 272
865 3300026116 Ga0207674_10402495 Ga0207674_104024951 272
866 3300026118 Ga0207675_100000498 Ga0207675_10000049818 272
867 3300026118 Ga0207675_100010157 Ga0207675_1000101574 272
868 3300026118 Ga0207675_100073772 Ga0207675_1000737722 272
869 3300026118 Ga0207675_100295845 Ga0207675_1002958451 272
870 3300026121 Ga0207683_10194378 Ga0207683_101943782 272
871 3300027907 Ga0207428_10006327 Ga0207428_100063272 272
872 3300027907 Ga0207428_10020960 Ga0207428_100209603 272
873 3300028379 Ga0268266_10011510 Ga0268266_100115104 272
874 3300028379 Ga0268266_10017062 Ga0268266_100170624 272
875 3300028380 Ga0268265_10000343 Ga0268265_1000034333 272
876 3300028380 Ga0268265_10089431 Ga0268265_100894313 272
877 3300028381 Ga0268264_10015691 Ga0268264_100156914 272
878 3300028800 Ga0265338_10013018 Ga0265338_100130188 272
879 3300031344 Ga0265316_10044605 Ga0265316_100446053 272
880 3300031507 Ga0307509_10006311 Ga0307509_100063119 272
881 3300031548 Ga0307408_100011237 Ga0307408_1000112373 272
882 3300031548 Ga0307408_100053696 Ga0307408_1000536963 272
883 3300031852 Ga0307410_10176716 Ga0307410_101767161 272
884 3300031901 Ga0307406_10346564 Ga0307406_103465642 272
885 3300031903 Ga0307407_10028569 Ga0307407_100285692 272
886 3300031911 Ga0307412_10151275 Ga0307412_101512752 272
887 3300031995 Ga0307409_100037023 Ga0307409_1000370233 272
888 3300032002 Ga0307416_100017093 Ga0307416_1000170933 272
889 3300032002 Ga0307416_100115623 Ga0307416_1001156232 272
890 3300032005 Ga0307411_10026522 Ga0307411_100265222 272
891 3300032005 Ga0307411_10614844 Ga0307411_106148441 272
892 3300032126 Ga0307415_100030508 Ga0307415_1000305082 272
893 3300032126 Ga0307415_100048359 Ga0307415_1000483592 272
894 3300039447 Ga0436361_0650497 Ga0436361_0650497_2188_3009 272
895 3300042876 Ga0451577_0012876 Ga0451577_0012876_6245_7099 272
896 3300042876 Ga0451577_0370301 Ga0451577_0370301_418_1239 272
897 3300042993 Ga0439440_0041521 Ga0439440_0041521_248_1069 272
898 3300044712 Ga0453684_0000169 Ga0453684_0000169_152565_153416 272
899 3300044712 Ga0453684_0036851 Ga0453684_0036851_1448_2269 272
900 3300044712 Ga0453684_0039790 Ga0453684_0039790_3854_4708 272
901 3300044712 Ga0453684_0041174 Ga0453684_0041174_345_1166 272
902 3300044712 Ga0453684_0130197 Ga0453684_0130197_583_1434 272
903 3300044712 Ga0453684_0328661 Ga0453684_0328661_647_1468 272
904 3300044712 Ga0453684_0632785 Ga0453684_0632785_42_863 272
905 3300045051 Ga0451576_0077413 Ga0451576_0077413_2388_3209 272
906 3300045051 Ga0451576_0847390 Ga0451576_0847390_119_940 272
907 3300045976 Ga0466967_0267229 Ga0466967_0267229_145_966 272
908 3300046460 Ga0495638_0003431 Ga0495638_0003431_3791_4612 272
909 3300046460 Ga0495638_0102782 Ga0495638_0102782_543_1364 272
910 3300046660 Ga0495625_0064471 Ga0495625_0064471_1460_2281 272
911 3300048904 Ga0496101_0008732 Ga0496101_0008732_5001_5819 272
912 3300048905 Ga0496102_0098708 Ga0496102_0098708_296_1114 272
913 3300048909 Ga0496106_0219044 Ga0496106_0219044_600_1421 272
914 3300048923 Ga0496120_0001757 Ga0496120_0001757_20717_21562 272
915 3300048924 Ga0496121_0003381 Ga0496121_0003381_4339_5211 272
916 3300048924 Ga0496121_0100899 Ga0496121_0100899_1137_1958 272
917 3300049581 Ga0501047_0215593 Ga0501047_0215593_937_1758 272
918 3300049592 Ga0501076_0202805 Ga0501076_0202805_361_1218 272
919 3300049679 Ga0501249_006180 Ga0501249_006180_588_1409 272
920 3300050507 nmdc:mga05p37_100669_c1 nmdc:mga05p37_100669_c1_1283_2140 272
921 3300050507 nmdc:mga05p37_312822_c1 nmdc:mga05p37_312822_c1_201_1022 272
922 3300050507 nmdc:mga05p37_4635_c1 nmdc:mga05p37_4635_c1_14821_15672 272
923 3300050507 nmdc:mga05p37_5320_c1 nmdc:mga05p37_5320_c1_1492_2313 272
924 3300050507 nmdc:mga05p37_64790_c1 nmdc:mga05p37_64790_c1_3126_3977 272
925 3300050508 nmdc:mga09592_12537_c1 nmdc:mga09592_12537_c1_1861_2712 272
926 3300050508 nmdc:mga09592_13076_c1 nmdc:mga09592_13076_c1_2195_3049 272
927 3300050508 nmdc:mga09592_1452_c1 nmdc:mga09592_1452_c1_5700_6521 272
928 3300050508 nmdc:mga09592_162496_c1 nmdc:mga09592_162496_c1_797_1648 272
929 3300050508 nmdc:mga09592_3369_c1 nmdc:mga09592_3369_c1_8090_8911 272
930 3300050508 nmdc:mga09592_693711_c1 nmdc:mga09592_693711_c1_38_856 272
931 3300050508 nmdc:mga09592_9039_c1 nmdc:mga09592_9039_c1_6984_7838 272
932 3300050508 nmdc:mga09592_9619_c1 nmdc:mga09592_9619_c1_3574_4425 272
933 3300050509 nmdc:mga0qj67_10385_c1 nmdc:mga0qj67_10385_c1_4824_5645 272
934 3300050509 nmdc:mga0qj67_19885_c1 nmdc:mga0qj67_19885_c1_3667_4488 272
935 3300050509 nmdc:mga0qj67_2242_c1 nmdc:mga0qj67_2242_c1_6950_7771 272
936 3300050509 nmdc:mga0qj67_63723_c1 nmdc:mga0qj67_63723_c1_1913_2734 272
937 3300050509 nmdc:mga0qj67_84526_c1 nmdc:mga0qj67_84526_c1_1236_2090 272
938 3300050510 nmdc:mga06r32_2463_c1 nmdc:mga06r32_2463_c1_5066_5887 272
939 3300050510 nmdc:mga06r32_3884_c2 nmdc:mga06r32_3884_c2_5185_6006 272
940 3300050510 nmdc:mga06r32_84_c1 nmdc:mga06r32_84_c1_2083_2904 272
941 3300050510 nmdc:mga06r32_98329_c1 nmdc:mga06r32_98329_c1_1032_1883 272
942 3300050511 nmdc:mga08y16_1683_c1 nmdc:mga08y16_1683_c1_18733_19554 272
943 3300050511 nmdc:mga08y16_723_c1 nmdc:mga08y16_723_c1_25346_26167 272
944 3300050512 nmdc:mga0n895_118080_c1 nmdc:mga0n895_118080_c1_1788_2609 272
945 3300050512 nmdc:mga0n895_178716_c1 nmdc:mga0n895_178716_c1_72_893 272
946 3300050513 nmdc:mga0rr50_184572_c1 nmdc:mga0rr50_184572_c1_239_1060 272
947 3300053124 Ga0500617_021014 Ga0500617_021014_232_1053 272
948 3300053146 Ga0500588_0038796 Ga0500588_0038796_295_1116 272
949 3300053156 Ga0500622_0001090 Ga0500622_0001090_9455_10276 272
950 3300053156 Ga0500622_0013309 Ga0500622_0013309_2268_3089 272
951 iso_pu_bacteria 2643221624 2644136465 272
952 iso_pu_bacteria 2857720070 2857720379 272
953 iso_pu_bacteria 2919395869 2919399133 272
954 iso_pu_bacteria 2928090899 2928092534 272
955 iso_pu_bacteria 2984580707 2984583932 272
956 3300001978 JGI24747J21853_1005997 JGI24747J21853_10059972 273
957 3300002074 JGI24748J21848_1009022 JGI24748J21848_10090222 273
958 3300002076 JGI24749J21850_1002994 JGI24749J21850_10029943 273
959 3300002239 JGI24034J26672_10003696 JGI24034J26672_100036961 273
960 3300002737 JGI25162J39368_1000901 JGI25162J39368_10009015 273
961 3300003322 rootL2_10047765 rootL2_100477653 273
962 3300003775 Ga0055524_1030846 Ga0055524_10308462 273
963 3300005293 Ga0065715_10111046 Ga0065715_101110463 273
964 3300005295 Ga0065707_10106911 Ga0065707_101069111 273
965 3300005327 Ga0070658_10367575 Ga0070658_103675752 273
966 3300005327 Ga0070658_10475911 Ga0070658_104759112 273
967 3300005328 Ga0070676_10000834 Ga0070676_100008346 273
968 3300005328 Ga0070676_10011250 Ga0070676_100112502 273
969 3300005330 Ga0070690_100067068 Ga0070690_1000670682 273
970 3300005330 Ga0070690_100405913 Ga0070690_1004059131 273
971 3300005331 Ga0070670_100004679 Ga0070670_1000046792 273
972 3300005331 Ga0070670_100024723 Ga0070670_1000247233 273
973 3300005331 Ga0070670_100108371 Ga0070670_1001083712 273
974 3300005331 Ga0070670_100128152 Ga0070670_1001281521 273
975 3300005331 Ga0070670_100175294 Ga0070670_1001752942 273
976 3300005331 Ga0070670_100357457 Ga0070670_1003574571 273
977 3300005331 Ga0070670_100394812 Ga0070670_1003948121 273
978 3300005331 Ga0070670_100489761 Ga0070670_1004897611 273
979 3300005333 Ga0070677_10000899 Ga0070677_100008996 273
980 3300005333 Ga0070677_10007855 Ga0070677_100078552 273
981 3300005333 Ga0070677_10010637 Ga0070677_100106373 273
982 3300005334 Ga0068869_100010913 Ga0068869_1000109133 273
983 3300005334 Ga0068869_100017478 Ga0068869_1000174782 273
984 3300005335 Ga0070666_10009663 Ga0070666_100096633 273
985 3300005335 Ga0070666_10026167 Ga0070666_100261672 273
986 3300005335 Ga0070666_10098776 Ga0070666_100987762 273
987 3300005336 Ga0070680_100015220 Ga0070680_1000152204 273
988 3300005338 Ga0068868_100002161 Ga0068868_1000021617 273
989 3300005338 Ga0068868_100034387 Ga0068868_1000343873 273
990 3300005338 Ga0068868_100048891 Ga0068868_1000488913 273
991 3300005339 Ga0070660_100010603 Ga0070660_1000106034 273
992 3300005339 Ga0070660_100047704 Ga0070660_1000477042 273
993 3300005339 Ga0070660_100334785 Ga0070660_1003347852 273
994 3300005340 Ga0070689_100021356 Ga0070689_1000213562 273
995 3300005340 Ga0070689_100251961 Ga0070689_1002519612 273
996 3300005343 Ga0070687_100078676 Ga0070687_1000786762 273
997 3300005344 Ga0070661_100045364 Ga0070661_1000453642 273
998 3300005345 Ga0070692_10045636 Ga0070692_100456363 273
999 3300005347 Ga0070668_100004755 Ga0070668_1000047556 273
1000 3300005347 Ga0070668_100040962 Ga0070668_1000409622 273
1001 3300005347 Ga0070668_100081807 Ga0070668_1000818073 273
1002 3300005347 Ga0070668_100158360 Ga0070668_1001583602 273
1003 3300005353 Ga0070669_100212910 Ga0070669_1002129102 273
1004 3300005354 Ga0070675_100000787 Ga0070675_1000007875 273
1005 3300005354 Ga0070675_100001895 Ga0070675_1000018955 273
1006 3300005354 Ga0070675_100028390 Ga0070675_1000283903 273
1007 3300005354 Ga0070675_100079325 Ga0070675_1000793252 273
1008 3300005355 Ga0070671_100004353 Ga0070671_1000043532 273
1009 3300005355 Ga0070671_100006355 Ga0070671_1000063555 273
1010 3300005355 Ga0070671_100063813 Ga0070671_1000638132 273
1011 3300005355 Ga0070671_100099729 Ga0070671_1000997291 273
1012 3300005355 Ga0070671_100121315 Ga0070671_1001213152 273
1013 3300005355 Ga0070671_100129696 Ga0070671_1001296961 273
1014 3300005356 Ga0070674_100001341 Ga0070674_1000013414 273
1015 3300005356 Ga0070674_100019087 Ga0070674_1000190872 273
1016 3300005356 Ga0070674_100034972 Ga0070674_1000349723 273
1017 3300005356 Ga0070674_100154780 Ga0070674_1001547802 273
1018 3300005364 Ga0070673_100002952 Ga0070673_1000029523 273
1019 3300005364 Ga0070673_100025219 Ga0070673_1000252193 273
1020 3300005364 Ga0070673_100062891 Ga0070673_1000628912 273
1021 3300005365 Ga0070688_100002852 Ga0070688_1000028524 273
1022 3300005366 Ga0070659_100006667 Ga0070659_1000066675 273
1023 3300005366 Ga0070659_100036258 Ga0070659_1000362582 273
1024 3300005367 Ga0070667_100039573 Ga0070667_1000395732 273
1025 3300005367 Ga0070667_100076147 Ga0070667_1000761473 273
1026 3300005367 Ga0070667_100099286 Ga0070667_1000992862 273
1027 3300005367 Ga0070667_100437103 Ga0070667_1004371032 273
1028 3300005438 Ga0070701_10016430 Ga0070701_100164302 273
1029 3300005438 Ga0070701_10054793 Ga0070701_100547932 273
1030 3300005441 Ga0070700_100082130 Ga0070700_1000821302 273
1031 3300005441 Ga0070700_100273987 Ga0070700_1002739871 273
1032 3300005455 Ga0070663_100004597 Ga0070663_1000045975 273
1033 3300005455 Ga0070663_100010776 Ga0070663_1000107764 273
1034 3300005455 Ga0070663_100375302 Ga0070663_1003753022 273
1035 3300005456 Ga0070678_100003595 Ga0070678_1000035952 273
1036 3300005456 Ga0070678_100006528 Ga0070678_1000065284 273
1037 3300005456 Ga0070678_100138649 Ga0070678_1001386492 273
1038 3300005456 Ga0070678_100139608 Ga0070678_1001396082 273
1039 3300005457 Ga0070662_100029025 Ga0070662_1000290252 273
1040 3300005457 Ga0070662_100107429 Ga0070662_1001074292 273
1041 3300005458 Ga0070681_10204918 Ga0070681_102049182 273
1042 3300005459 Ga0068867_100002745 Ga0068867_1000027455 273
1043 3300005459 Ga0068867_100010756 Ga0068867_1000107563 273
1044 3300005466 Ga0070685_10001540 Ga0070685_100015403 273
1045 3300005466 Ga0070685_10171912 Ga0070685_101719122 273
1046 3300005467 Ga0070706_100004892 Ga0070706_1000048922 273
1047 3300005468 Ga0070707_100023290 Ga0070707_1000232902 273
1048 3300005518 Ga0070699_100122061 Ga0070699_1001220612 273
1049 3300005518 Ga0070699_100375434 Ga0070699_1003754341 273
1050 3300005539 Ga0068853_100001138 Ga0068853_1000011385 273
1051 3300005539 Ga0068853_100012919 Ga0068853_1000129195 273
1052 3300005539 Ga0068853_100028355 Ga0068853_1000283552 273
1053 3300005539 Ga0068853_100049554 Ga0068853_1000495542 273
1054 3300005543 Ga0070672_100000414 Ga0070672_10000041411 273
1055 3300005543 Ga0070672_100000486 Ga0070672_10000048612 273
1056 3300005543 Ga0070672_100118952 Ga0070672_1001189522 273
1057 3300005544 Ga0070686_100009361 Ga0070686_1000093612 273
1058 3300005545 Ga0070695_100125071 Ga0070695_1001250712 273
1059 3300005546 Ga0070696_100370959 Ga0070696_1003709592 273
1060 3300005547 Ga0070693_100156990 Ga0070693_1001569902 273
1061 3300005548 Ga0070665_100008988 Ga0070665_1000089883 273
1062 3300005548 Ga0070665_100028180 Ga0070665_1000281802 273
1063 3300005548 Ga0070665_100029890 Ga0070665_1000298902 273
1064 3300005548 Ga0070665_100055565 Ga0070665_1000555652 273
1065 3300005563 Ga0068855_100033476 Ga0068855_1000334765 273
1066 3300005563 Ga0068855_100093730 Ga0068855_1000937302 273
1067 3300005564 Ga0070664_100034938 Ga0070664_1000349382 273
1068 3300005564 Ga0070664_100081217 Ga0070664_1000812172 273
1069 3300005564 Ga0070664_100289486 Ga0070664_1002894862 273
1070 3300005577 Ga0068857_100046312 Ga0068857_1000463123 273
1071 3300005578 Ga0068854_100026833 Ga0068854_1000268332 273
1072 3300005578 Ga0068854_100451711 Ga0068854_1004517112 273
1073 3300005614 Ga0068856_100023876 Ga0068856_1000238765 273
1074 3300005614 Ga0068856_100187288 Ga0068856_1001872882 273
1075 3300005615 Ga0070702_100162288 Ga0070702_1001622882 273
1076 3300005616 Ga0068852_100001602 Ga0068852_10000160213 273
1077 3300005616 Ga0068852_100009962 Ga0068852_1000099624 273
1078 3300005616 Ga0068852_100061379 Ga0068852_1000613792 273
1079 3300005616 Ga0068852_100598153 Ga0068852_1005981532 273
1080 3300005617 Ga0068859_100028111 Ga0068859_1000281113 273
1081 3300005617 Ga0068859_100280537 Ga0068859_1002805372 273
1082 3300005618 Ga0068864_100012827 Ga0068864_1000128272 273
1083 3300005718 Ga0068866_10003961 Ga0068866_100039612 273
1084 3300005719 Ga0068861_100003776 Ga0068861_1000037767 273
1085 3300005719 Ga0068861_100023045 Ga0068861_1000230452 273
1086 3300005834 Ga0068851_10002365 Ga0068851_100023652 273
1087 3300005834 Ga0068851_10076538 Ga0068851_100765382 273
1088 3300005834 Ga0068851_10171127 Ga0068851_101711272 273
1089 3300005840 Ga0068870_10005059 Ga0068870_100050594 273
1090 3300005840 Ga0068870_10074218 Ga0068870_100742182 273
1091 3300005841 Ga0068863_100011674 Ga0068863_1000116744 273
1092 3300005841 Ga0068863_100030463 Ga0068863_1000304633 273
1093 3300005841 Ga0068863_100099173 Ga0068863_1000991733 273
1094 3300005841 Ga0068863_100112653 Ga0068863_1001126533 273
1095 3300005841 Ga0068863_100261421 Ga0068863_1002614212 273
1096 3300005842 Ga0068858_100047736 Ga0068858_1000477362 273
1097 3300005842 Ga0068858_100069531 Ga0068858_1000695313 273
1098 3300005842 Ga0068858_100095644 Ga0068858_1000956443 273
1099 3300005842 Ga0068858_100194731 Ga0068858_1001947312 273
1100 3300005843 Ga0068860_100047070 Ga0068860_1000470702 273
1101 3300005843 Ga0068860_100235175 Ga0068860_1002351752 273
1102 3300005844 Ga0068862_100009443 Ga0068862_1000094434 273
1103 3300005844 Ga0068862_100251899 Ga0068862_1002518992 273
1104 3300005937 Ga0081455_10005634 Ga0081455_1000563414 273
1105 3300006195 Ga0075366_10188498 Ga0075366_101884982 273
1106 3300006237 Ga0097621_100017172 Ga0097621_1000171722 273
1107 3300006237 Ga0097621_100054448 Ga0097621_1000544482 273
1108 3300006237 Ga0097621_100058650 Ga0097621_1000586503 273
1109 3300006237 Ga0097621_100060218 Ga0097621_1000602181 273
1110 3300006237 Ga0097621_100065182 Ga0097621_1000651822 273
1111 3300006353 Ga0075370_10009295 Ga0075370_100092954 273
1112 3300006358 Ga0068871_100006211 Ga0068871_1000062116 273
1113 3300006358 Ga0068871_100077819 Ga0068871_1000778192 273
1114 3300006358 Ga0068871_100219868 Ga0068871_1002198681 273
1115 3300006844 Ga0075428_100200678 Ga0075428_1002006783 273
1116 3300006844 Ga0075428_100843395 Ga0075428_1008433951 273
1117 3300006881 Ga0068865_100076095 Ga0068865_1000760952 273
1118 3300006931 Ga0097620_100028111 Ga0097620_1000281113 273
1119 3300006931 Ga0097620_100280547 Ga0097620_1002805472 273
1120 3300009093 Ga0105240_10025318 Ga0105240_100253186 273
1121 3300009094 Ga0111539_10226404 Ga0111539_102264042 273
1122 3300009101 Ga0105247_10364351 Ga0105247_103643511 273
1123 3300009147 Ga0114129_10018631 Ga0114129_100186314 273
1124 3300009148 Ga0105243_10229910 Ga0105243_102299102 273
1125 3300009177 Ga0105248_10005709 Ga0105248_100057092 273
1126 3300009177 Ga0105248_10259488 Ga0105248_102594882 273
1127 3300009177 Ga0105248_10425554 Ga0105248_104255542 273
1128 3300009545 Ga0105237_10164163 Ga0105237_101641632 273
1129 3300009545 Ga0105237_10366260 Ga0105237_103662602 273
1130 3300009551 Ga0105238_10337555 Ga0105238_103375552 273
1131 3300009551 Ga0105238_10551981 Ga0105238_105519812 273
1132 3300009553 Ga0105249_10144972 Ga0105249_101449722 273
1133 3300010159 Ga0099796_10034850 Ga0099796_100348502 273
1134 3300013104 Ga0157370_10037832 Ga0157370_100378322 273
1135 3300013104 Ga0157370_10695434 Ga0157370_106954341 273
1136 3300013105 Ga0157369_10046030 Ga0157369_100460302 273
1137 3300013296 Ga0157374_10118321 Ga0157374_101183212 273
1138 3300013297 Ga0157378_10130776 Ga0157378_101307762 273
1139 3300013297 Ga0157378_10165204 Ga0157378_101652042 273
1140 3300013297 Ga0157378_10166723 Ga0157378_101667232 273
1141 3300013297 Ga0157378_10212644 Ga0157378_102126442 273
1142 3300013306 Ga0163162_10030312 Ga0163162_100303122 273
1143 3300013306 Ga0163162_10118890 Ga0163162_101188902 273
1144 3300013306 Ga0163162_10211746 Ga0163162_102117462 273
1145 3300013306 Ga0163162_10277191 Ga0163162_102771912 273
1146 3300013306 Ga0163162_10855916 Ga0163162_108559162 273
1147 3300013307 Ga0157372_10187040 Ga0157372_101870402 273
1148 3300013308 Ga0157375_10006843 Ga0157375_100068434 273
1149 3300013308 Ga0157375_10017904 Ga0157375_100179043 273
1150 3300013308 Ga0157375_10136388 Ga0157375_101363883 273
1151 3300013308 Ga0157375_10204122 Ga0157375_102041222 273
1152 3300013308 Ga0157375_10206506 Ga0157375_102065062 273
1153 3300013308 Ga0157375_10223663 Ga0157375_102236632 273
1154 3300014325 Ga0163163_10050890 Ga0163163_100508903 273
1155 3300014325 Ga0163163_10377757 Ga0163163_103777572 273
1156 3300014325 Ga0163163_10784384 Ga0163163_107843842 273
1157 3300014326 Ga0157380_10001539 Ga0157380_100015396 273
1158 3300014745 Ga0157377_10000062 Ga0157377_1000006269 273
1159 3300014745 Ga0157377_10008372 Ga0157377_100083724 273
1160 3300014968 Ga0157379_10008849 Ga0157379_100088493 273
1161 3300014968 Ga0157379_10036665 Ga0157379_100366653 273
1162 3300014969 Ga0157376_10015154 Ga0157376_100151543 273
1163 3300014969 Ga0157376_10093301 Ga0157376_100933013 273
1164 3300014969 Ga0157376_10265210 Ga0157376_102652102 273
1165 3300015685 Ga0183369_1015 Ga0183369_1015149 273
1166 3300017792 Ga0163161_10152835 Ga0163161_101528352 273
1167 3300021361 Ga0213872_10000198 Ga0213872_1000019822 273
1168 3300025271 Ga0207666_1005762 Ga0207666_10057622 273
1169 3300025290 Ga0207673_1005002 Ga0207673_10050022 273
1170 3300025299 Ga0209256_1002825 Ga0209256_10028258 273
1171 3300025315 Ga0207697_10000964 Ga0207697_100009647 273
1172 3300025315 Ga0207697_10020151 Ga0207697_100201513 273
1173 3300025321 Ga0207656_10000979 Ga0207656_100009795 273
1174 3300025321 Ga0207656_10123922 Ga0207656_101239222 273
1175 3300025728 Ga0207655_1000988 Ga0207655_10009883 273
1176 3300025893 Ga0207682_10000782 Ga0207682_100007827 273
1177 3300025893 Ga0207682_10000895 Ga0207682_100008955 273
1178 3300025893 Ga0207682_10001163 Ga0207682_100011634 273
1179 3300025893 Ga0207682_10012609 Ga0207682_100126092 273
1180 3300025901 Ga0207688_10008843 Ga0207688_100088432 273
1181 3300025901 Ga0207688_10032129 Ga0207688_100321293 273
1182 3300025903 Ga0207680_10005628 Ga0207680_100056283 273
1183 3300025903 Ga0207680_10019884 Ga0207680_100198843 273
1184 3300025904 Ga0207647_10066191 Ga0207647_100661912 273
1185 3300025907 Ga0207645_10000982 Ga0207645_100009824 273
1186 3300025907 Ga0207645_10003714 Ga0207645_100037147 273
1187 3300025908 Ga0207643_10000251 Ga0207643_1000025130 273
1188 3300025908 Ga0207643_10056067 Ga0207643_100560672 273
1189 3300025908 Ga0207643_10120490 Ga0207643_101204902 273
1190 3300025908 Ga0207643_10135694 Ga0207643_101356942 273
1191 3300025909 Ga0207705_10415303 Ga0207705_104153031 273
1192 3300025910 Ga0207684_10002367 Ga0207684_1000236711 273
1193 3300025915 Ga0207693_10045157 Ga0207693_100451572 273
1194 3300025915 Ga0207693_10367455 Ga0207693_103674551 273
1195 3300025918 Ga0207662_10075188 Ga0207662_100751883 273
1196 3300025919 Ga0207657_10013585 Ga0207657_100135852 273
1197 3300025919 Ga0207657_10041951 Ga0207657_100419513 273
1198 3300025920 Ga0207649_10014334 Ga0207649_100143342 273
1199 3300025921 Ga0207652_10008090 Ga0207652_100080902 273
1200 3300025922 Ga0207646_10097038 Ga0207646_100970383 273
1201 3300025923 Ga0207681_10002886 Ga0207681_100028863 273
1202 3300025923 Ga0207681_10015126 Ga0207681_100151265 273
1203 3300025923 Ga0207681_10048471 Ga0207681_100484713 273
1204 3300025923 Ga0207681_10142637 Ga0207681_101426372 273
1205 3300025924 Ga0207694_10009665 Ga0207694_100096652 273
1206 3300025925 Ga0207650_10000326 Ga0207650_1000032623 273
1207 3300025925 Ga0207650_10002489 Ga0207650_100024895 273
1208 3300025925 Ga0207650_10050356 Ga0207650_100503562 273
1209 3300025925 Ga0207650_10079054 Ga0207650_100790542 273
1210 3300025925 Ga0207650_10421027 Ga0207650_104210272 273
1211 3300025926 Ga0207659_10000299 Ga0207659_1000029911 273
1212 3300025926 Ga0207659_10004977 Ga0207659_100049774 273
1213 3300025926 Ga0207659_10012477 Ga0207659_100124771 273
1214 3300025926 Ga0207659_10045257 Ga0207659_100452572 273
1215 3300025927 Ga0207687_10049359 Ga0207687_100493592 273
1216 3300025927 Ga0207687_10187134 Ga0207687_101871342 273
1217 3300025927 Ga0207687_10265957 Ga0207687_102659572 273
1218 3300025931 Ga0207644_10004733 Ga0207644_100047335 273
1219 3300025931 Ga0207644_10005112 Ga0207644_100051122 273
1220 3300025931 Ga0207644_10011363 Ga0207644_100113633 273
1221 3300025931 Ga0207644_10018324 Ga0207644_100183242 273
1222 3300025931 Ga0207644_10031694 Ga0207644_100316943 273
1223 3300025932 Ga0207690_10163136 Ga0207690_101631362 273
1224 3300025933 Ga0207706_10003902 Ga0207706_100039024 273
1225 3300025933 Ga0207706_10051386 Ga0207706_100513862 273
1226 3300025933 Ga0207706_10094240 Ga0207706_100942403 273
1227 3300025933 Ga0207706_10384206 Ga0207706_103842062 273
1228 3300025937 Ga0207669_10009725 Ga0207669_100097252 273
1229 3300025937 Ga0207669_10041059 Ga0207669_100410593 273
1230 3300025937 Ga0207669_10077087 Ga0207669_100770873 273
1231 3300025937 Ga0207669_10077657 Ga0207669_100776573 273
1232 3300025937 Ga0207669_10182315 Ga0207669_101823152 273
1233 3300025937 Ga0207669_10405995 Ga0207669_104059952 273
1234 3300025938 Ga0207704_10060879 Ga0207704_100608793 273
1235 3300025938 Ga0207704_10135012 Ga0207704_101350122 273
1236 3300025938 Ga0207704_10172406 Ga0207704_101724062 273
1237 3300025940 Ga0207691_10000040 Ga0207691_1000004066 273
1238 3300025940 Ga0207691_10000049 Ga0207691_1000004914 273
1239 3300025940 Ga0207691_10015297 Ga0207691_100152975 273
1240 3300025940 Ga0207691_10039565 Ga0207691_100395652 273
1241 3300025940 Ga0207691_10052205 Ga0207691_100522052 273
1242 3300025941 Ga0207711_10011444 Ga0207711_100114444 273
1243 3300025941 Ga0207711_10011756 Ga0207711_100117566 273
1244 3300025941 Ga0207711_10040127 Ga0207711_100401273 273
1245 3300025941 Ga0207711_10279330 Ga0207711_102793302 273
1246 3300025942 Ga0207689_10002070 Ga0207689_1000207011 273
1247 3300025945 Ga0207679_10019569 Ga0207679_100195692 273
1248 3300025949 Ga0207667_10270694 Ga0207667_102706942 273
1249 3300025960 Ga0207651_10011167 Ga0207651_100111673 273
1250 3300025960 Ga0207651_10012398 Ga0207651_100123983 273
1251 3300025960 Ga0207651_10039426 Ga0207651_100394262 273
1252 3300025960 Ga0207651_10157211 Ga0207651_101572112 273
1253 3300025960 Ga0207651_10589862 Ga0207651_105898621 273
1254 3300025961 Ga0207712_10031124 Ga0207712_100311242 273
1255 3300025961 Ga0207712_10048418 Ga0207712_100484183 273
1256 3300025972 Ga0207668_10030189 Ga0207668_100301892 273
1257 3300025972 Ga0207668_10053376 Ga0207668_100533763 273
1258 3300025972 Ga0207668_10067860 Ga0207668_100678602 273
1259 3300025972 Ga0207668_10151595 Ga0207668_101515952 273
1260 3300025972 Ga0207668_10649080 Ga0207668_106490801 273
1261 3300025981 Ga0207640_10073632 Ga0207640_100736322 273
1262 3300025981 Ga0207640_10123832 Ga0207640_101238322 273
1263 3300025981 Ga0207640_10196646 Ga0207640_101966462 273
1264 3300025981 Ga0207640_10276713 Ga0207640_102767132 273
1265 3300025986 Ga0207658_10021763 Ga0207658_100217633 273
1266 3300025986 Ga0207658_10037942 Ga0207658_100379422 273
1267 3300025986 Ga0207658_10076767 Ga0207658_100767671 273
1268 3300025986 Ga0207658_10111955 Ga0207658_101119552 273
1269 3300025986 Ga0207658_10184957 Ga0207658_101849571 273
1270 3300026023 Ga0207677_10007343 Ga0207677_100073432 273
1271 3300026023 Ga0207677_10032110 Ga0207677_100321102 273
1272 3300026023 Ga0207677_10234008 Ga0207677_102340082 273
1273 3300026035 Ga0207703_10011452 Ga0207703_100114525 273
1274 3300026035 Ga0207703_10043818 Ga0207703_100438182 273
1275 3300026035 Ga0207703_10050520 Ga0207703_100505202 273
1276 3300026035 Ga0207703_10265607 Ga0207703_102656072 273
1277 3300026041 Ga0207639_10000020 Ga0207639_1000002053 273
1278 3300026041 Ga0207639_10116158 Ga0207639_101161583 273
1279 3300026067 Ga0207678_10002787 Ga0207678_100027877 273
1280 3300026067 Ga0207678_10006003 Ga0207678_100060035 273
1281 3300026075 Ga0207708_10000568 Ga0207708_1000056823 273
1282 3300026075 Ga0207708_10265712 Ga0207708_102657122 273
1283 3300026078 Ga0207702_10024746 Ga0207702_100247462 273
1284 3300026088 Ga0207641_10046684 Ga0207641_100466842 273
1285 3300026088 Ga0207641_10255594 Ga0207641_102555942 273
1286 3300026089 Ga0207648_10002748 Ga0207648_1000274816 273
1287 3300026089 Ga0207648_10003734 Ga0207648_1000373410 273
1288 3300026089 Ga0207648_10003955 Ga0207648_100039556 273
1289 3300026095 Ga0207676_10010158 Ga0207676_100101583 273
1290 3300026095 Ga0207676_10097268 Ga0207676_100972682 273
1291 3300026095 Ga0207676_10146827 Ga0207676_101468272 273
1292 3300026116 Ga0207674_10012490 Ga0207674_100124904 273
1293 3300026118 Ga0207675_100002397 Ga0207675_10000239710 273
1294 3300026118 Ga0207675_100036708 Ga0207675_1000367082 273
1295 3300026121 Ga0207683_10000059 Ga0207683_100000595 273
1296 3300026121 Ga0207683_10007743 Ga0207683_100077435 273
1297 3300026121 Ga0207683_10008998 Ga0207683_100089984 273
1298 3300026121 Ga0207683_10011053 Ga0207683_100110532 273
1299 3300026121 Ga0207683_10323044 Ga0207683_103230442 273
1300 3300026121 Ga0207683_10367790 Ga0207683_103677901 273
1301 3300026142 Ga0207698_10091662 Ga0207698_100916623 273
1302 3300026142 Ga0207698_10120511 Ga0207698_101205113 273
1303 3300026142 Ga0207698_10304589 Ga0207698_103045892 273
1304 3300026142 Ga0207698_10681245 Ga0207698_106812452 273
1305 3300027364 Ga0209967_1001326 Ga0209967_10013262 273
1306 3300027471 Ga0209995_1003612 Ga0209995_10036122 273
1307 3300027526 Ga0209968_1002148 Ga0209968_10021482 273
1308 3300027552 Ga0209982_1003364 Ga0209982_10033642 273
1309 3300027552 Ga0209982_1013949 Ga0209982_10139492 273
1310 3300027617 Ga0210002_1011020 Ga0210002_10110202 273
1311 3300027665 Ga0209983_1003543 Ga0209983_10035432 273
1312 3300027682 Ga0209971_1001813 Ga0209971_10018134 273
1313 3300027717 Ga0209998_10000570 Ga0209998_100005704 273
1314 3300027876 Ga0209974_10002425 Ga0209974_100024255 273
1315 3300028379 Ga0268266_10011697 Ga0268266_100116972 273
1316 3300028379 Ga0268266_10065188 Ga0268266_100651882 273
1317 3300028379 Ga0268266_10141091 Ga0268266_101410912 273
1318 3300028380 Ga0268265_10314851 Ga0268265_103148512 273
1319 3300028381 Ga0268264_10012516 Ga0268264_100125162 273
1320 3300028381 Ga0268264_10019508 Ga0268264_100195083 273
1321 3300028381 Ga0268264_10098017 Ga0268264_100980173 273
1322 3300028794 Ga0307515_10021160 Ga0307515_100211604 273
1323 3300031344 Ga0265316_10186525 Ga0265316_101865252 273
1324 3300031456 Ga0307513_10094735 Ga0307513_100947352 273
1325 3300031507 Ga0307509_10000698 Ga0307509_1000069815 273
1326 3300031548 Ga0307408_100148434 Ga0307408_1001484342 273
1327 3300031616 Ga0307508_10034390 Ga0307508_100343902 273
1328 3300031649 Ga0307514_10077055 Ga0307514_100770553 273
1329 3300031649 Ga0307514_10120466 Ga0307514_101204662 273
1330 3300031731 Ga0307405_10020368 Ga0307405_100203683 273
1331 3300031731 Ga0307405_10043117 Ga0307405_100431173 273
1332 3300031824 Ga0307413_10035633 Ga0307413_100356332 273
1333 3300031852 Ga0307410_10013077 Ga0307410_100130773 273
1334 3300031901 Ga0307406_10026484 Ga0307406_100264843 273
1335 3300031903 Ga0307407_10033376 Ga0307407_100333763 273
1336 3300031903 Ga0307407_10397588 Ga0307407_103975882 273
1337 3300031911 Ga0307412_10051004 Ga0307412_100510042 273
1338 3300031911 Ga0307412_10158999 Ga0307412_101589992 273
1339 3300031911 Ga0307412_10525166 Ga0307412_105251662 273
1340 3300031995 Ga0307409_100010225 Ga0307409_1000102252 273
1341 3300031995 Ga0307409_100135804 Ga0307409_1001358042 273
1342 3300031995 Ga0307409_100734134 Ga0307409_1007341342 273
1343 3300032002 Ga0307416_100007531 Ga0307416_1000075316 273
1344 3300032002 Ga0307416_100118633 Ga0307416_1001186332 273
1345 3300032004 Ga0307414_10021655 Ga0307414_100216552 273
1346 3300032005 Ga0307411_10014468 Ga0307411_100144682 273
1347 3300032126 Ga0307415_100015145 Ga0307415_1000151452 273
1348 3300032126 Ga0307415_100216025 Ga0307415_1002160252 273
1349 3300033180 Ga0307510_10039557 Ga0307510_100395572 273
1350 3300035111 Ga0373923_0100378 Ga0373923_0100378_379_1200 273
1351 3300035170 Ga0373943_0118293 Ga0373943_0118293_38_859 273
1352 3300035170 Ga0373943_0150030 Ga0373943_0150030_395_1216 273
1353 3300035171 Ga0373946_0060994 Ga0373946_0060994_484_1305 273
1354 3300035410 Ga0373924_0016783 Ga0373924_0016783_1952_2773 273
1355 3300035692 Ga0373935_0001592 Ga0373935_0001592_10767_11588 273
1356 3300035692 Ga0373935_0069111 Ga0373935_0069111_1267_2088 273
1357 3300035725 Ga0373947_0031609 Ga0373947_0031609_416_1237 273
1358 3300036401 Ga0373937_0008582 Ga0373937_0008582_1862_2683 273
1359 3300036401 Ga0373937_0035437 Ga0373937_0035437_702_1523 273
1360 3300037068 Ga0373925_0115201 Ga0373925_0115201_523_1344 273
1361 3300037068 Ga0373925_0324992 Ga0373925_0324992_171_992 273
1362 3300037312 Ga0395899_0120886 Ga0395899_0120886_612_1433 273
1363 3300037418 Ga0395900_0229424 Ga0395900_0229424_104_925 273
1364 3300037466 Ga0395898_0587024 Ga0395898_0587024_178_999 273
1365 3300037471 Ga0395905_0051696 Ga0395905_0051696_1111_1932 273
1366 3300038443 Ga0395901_0001119 Ga0395901_0001119_1345_2166 273
1367 3300039447 Ga0436361_0692684 Ga0436361_0692684_51374_52204 273
1368 3300041443 Ga0451789_0950072 Ga0451789_0950072_318_1139 273
1369 3300042876 Ga0451577_0150046 Ga0451577_0150046_576_1397 273
1370 3300042876 Ga0451577_0285562 Ga0451577_0285562_381_1202 273
1371 3300046454 Ga0495592_0000499 Ga0495592_0000499_21506_22327 273
1372 3300046459 Ga0495629_0087597 Ga0495629_0087597_160_1041 273
1373 3300046462 Ga0495651_0067681 Ga0495651_0067681_842_1663 273
1374 3300046472 Ga0495580_0085420 Ga0495580_0085420_1106_1927 273
1375 3300046512 Ga0495610_0047983 Ga0495610_0047983_1036_1857 273
1376 3300046519 Ga0495632_0119089 Ga0495632_0119089_289_1110 273
1377 3300046533 Ga0495640_0308789 Ga0495640_0308789_14_835 273
1378 3300046535 Ga0495586_0033087 Ga0495586_0033087_1188_2009 273
1379 3300046536 Ga0495587_0013216 Ga0495587_0013216_2462_3283 273
1380 3300046543 Ga0495645_0052938 Ga0495645_0052938_35_856 273
1381 3300046559 Ga0495667_0012571 Ga0495667_0012571_3760_4581 273
1382 3300046660 Ga0495625_0066389 Ga0495625_0066389_344_1165 273
1383 3300046675 Ga0495657_0083707 Ga0495657_0083707_386_1207 273
1384 3300046678 Ga0495599_0003454 Ga0495599_0003454_5190_6011 273
1385 3300046683 Ga0495658_0044878 Ga0495658_0044878_867_1688 273
1386 3300046683 Ga0495658_0258889 Ga0495658_0258889_252_1073 273
1387 3300046689 Ga0495613_0127011 Ga0495613_0127011_683_1504 273
1388 3300048907 Ga0496104_0038022 Ga0496104_0038022_1315_2136 273
1389 3300048907 Ga0496104_0123553 Ga0496104_0123553_523_1344 273
1390 3300048907 Ga0496104_0319935 Ga0496104_0319935_511_1332 273
1391 3300048908 Ga0496105_0031134 Ga0496105_0031134_2805_3626 273
1392 3300048908 Ga0496105_0210862 Ga0496105_0210862_171_992 273
1393 3300048908 Ga0496105_0224579 Ga0496105_0224579_693_1514 273
1394 3300048909 Ga0496106_0111284 Ga0496106_0111284_663_1484 273
1395 3300048909 Ga0496106_0475459 Ga0496106_0475459_103_924 273
1396 3300048910 Ga0496107_0021038 Ga0496107_0021038_2481_3302 273
1397 3300048911 Ga0496108_0002995 Ga0496108_0002995_5939_6760 273
1398 3300048911 Ga0496108_0612334 Ga0496108_0612334_47_868 273
1399 3300048912 Ga0496109_0001654 Ga0496109_0001654_11793_12614 273
1400 3300048913 Ga0496110_0001296 Ga0496110_0001296_11737_12558 273
1401 3300048914 Ga0496111_0356971 Ga0496111_0356971_77_898 273
1402 3300048917 Ga0496114_0000211 Ga0496114_0000211_9904_10725 273
1403 3300048917 Ga0496114_0008157 Ga0496114_0008157_4242_5063 273
1404 3300048917 Ga0496114_0015107 Ga0496114_0015107_5338_6159 273
1405 3300048917 Ga0496114_0461964 Ga0496114_0461964_140_961 273
1406 3300048918 Ga0496115_0055897 Ga0496115_0055897_454_1299 273
1407 3300048919 Ga0496116_0024931 Ga0496116_0024931_1878_2732 273
1408 3300048920 Ga0496117_0015584 Ga0496117_0015584_2564_3418 273
1409 3300048921 Ga0496118_0020747 Ga0496118_0020747_2673_3527 273
1410 3300048925 Ga0496122_0000022 Ga0496122_0000022_28345_29199 273
1411 3300048926 Ga0496123_0000016 Ga0496123_0000016_75292_76146 273
1412 3300048927 Ga0496124_0038734 Ga0496124_0038734_583_1437 273
1413 3300048928 Ga0496125_0004417 Ga0496125_0004417_3850_4704 273
1414 3300048929 Ga0496126_0221845 Ga0496126_0221845_279_1133 273
1415 3300049577 Ga0501041_0137975 Ga0501041_0137975_26_931 273
1416 3300049583 Ga0501067_0009340 Ga0501067_0009340_3612_4433 273
1417 3300049584 Ga0501068_0013843 Ga0501068_0013843_2759_3580 273
1418 3300049591 Ga0501075_0002675 Ga0501075_0002675_6190_7011 273
1419 3300049591 Ga0501075_0069723 Ga0501075_0069723_542_1447 273
1420 3300049592 Ga0501076_0171982 Ga0501076_0171982_190_1095 273
1421 3300049593 Ga0501077_0000141 Ga0501077_0000141_30756_31577 273
1422 3300049742 Ga0501080_0003355 Ga0501080_0003355_13312_14133 273
1423 3300049823 Ga0501044_0102000 Ga0501044_0102000_1885_2706 273
1424 3300050493 nmdc:mga0k408_43076_c1 nmdc:mga0k408_43076_c1_1520_2341 273
1425 3300050494 nmdc:mga06z11_33920_c1 nmdc:mga06z11_33920_c1_864_1685 273
1426 3300050507 nmdc:mga05p37_106302_c1 nmdc:mga05p37_106302_c1_1582_2496 273
1427 3300050511 nmdc:mga08y16_155351_c1 nmdc:mga08y16_155351_c1_80_901 273
1428 3300050511 nmdc:mga08y16_38334_c1 nmdc:mga08y16_38334_c1_213_1034 273
1429 3300050513 nmdc:mga0rr50_325243_c1 nmdc:mga0rr50_325243_c1_365_1189 273
1430 3300053077 Ga0495601_0091612 Ga0495601_0091612_991_1812 273
1431 3300053084 Ga0495595_0021586 Ga0495595_0021586_1334_2155 273
1432 3300053085 Ga0495619_0330320 Ga0495619_0330320_134_955 273
1433 3300053088 Ga0500644_0033300 Ga0500644_0033300_610_1431 273
1434 3300053093 Ga0500651_0005499 Ga0500651_0005499_344_1165 273
1435 3300053093 Ga0500651_0193478 Ga0500651_0193478_226_1047 273
1436 3300053126 Ga0500621_035915 Ga0500621_035915_1119_1940 273
1437 3300053136 Ga0500559_0000097 Ga0500559_0000097_46806_47627 273
1438 3300053154 Ga0500619_003928 Ga0500619_003928_1465_2286 273
1439 3300053156 Ga0500622_0016140 Ga0500622_0016140_3090_3911 273
1440 3300054114 Ga0501084_0106887 Ga0501084_0106887_864_1769 273
1441 3300060353 Ga0501082_0000838 Ga0501082_0000838_12690_13511 273
1442 iso_pu_bacteria 2643221711 2644608166 273
1443 iso_pu_bacteria 2811994882 2812372782 273
1444 iso_pu_bacteria 2818991469 2819726750 273
1445 iso_pu_bacteria 2919059106 2919062975 273
1446 iso_pu_bacteria 2945941187 2945945091 273
1447 iso_pu_bacteria 2946041624 2946043797 273
1448 iso_pu_bacteria 2946059875 2946062976 273
1449 iso_pu_bacteria 8054107350 8054108054 273
1450 iso_pu_bacteria 8054107350 8054110684 273
1451 3300002773 JGI25152J39213_1001221 JGI25152J39213_10012218 274
1452 3300003187 JGI25151J46595_10027910 JGI25151J46595_100279102 274
1453 3300005336 Ga0070680_100025917 Ga0070680_1000259174 274
1454 3300005344 Ga0070661_100104250 Ga0070661_1001042502 274
1455 3300005434 Ga0070709_10249537 Ga0070709_102495372 274
1456 3300005435 Ga0070714_100124934 Ga0070714_1001249342 274
1457 3300005458 Ga0070681_10011971 Ga0070681_100119712 274
1458 3300005530 Ga0070679_100003207 Ga0070679_10000320713 274
1459 3300005544 Ga0070686_100221669 Ga0070686_1002216692 274
1460 3300005549 Ga0070704_100110977 Ga0070704_1001109772 274
1461 3300005563 Ga0068855_100055211 Ga0068855_1000552112 274
1462 3300005614 Ga0068856_100011558 Ga0068856_1000115584 274
1463 3300006028 Ga0070717_10016913 Ga0070717_100169132 274
1464 3300006846 Ga0075430_100549682 Ga0075430_1005496821 274
1465 3300006852 Ga0075433_10061356 Ga0075433_100613562 274
1466 3300006871 Ga0075434_100037527 Ga0075434_1000375272 274
1467 3300009147 Ga0114129_10492033 Ga0114129_104920332 274
1468 3300013104 Ga0157370_10166936 Ga0157370_101669362 274
1469 3300013105 Ga0157369_10003584 Ga0157369_100035849 274
1470 3300013105 Ga0157369_10101144 Ga0157369_101011442 274
1471 3300013307 Ga0157372_10089089 Ga0157372_100890893 274
1472 3300013307 Ga0157372_10181570 Ga0157372_101815702 274
1473 3300025258 Ga0209129_1000064 Ga0209129_100006499 274
1474 3300025294 Ga0209025_1001016 Ga0209025_100101612 274
1475 3300025304 Ga0209257_1003684 Ga0209257_10036848 274
1476 3300025912 Ga0207707_10002784 Ga0207707_100027844 274
1477 3300025915 Ga0207693_10101165 Ga0207693_101011653 274
1478 3300025917 Ga0207660_10071694 Ga0207660_100716942 274
1479 3300025921 Ga0207652_10063451 Ga0207652_100634513 274
1480 3300025929 Ga0207664_10015333 Ga0207664_100153336 274
1481 3300025949 Ga0207667_10090555 Ga0207667_100905552 274
1482 3300025949 Ga0207667_10290758 Ga0207667_102907582 274
1483 3300026067 Ga0207678_10037151 Ga0207678_100371512 274
1484 3300026078 Ga0207702_10137135 Ga0207702_101371352 274
1485 3300028379 Ga0268266_10473981 Ga0268266_104739812 274
1486 3300030522 Ga0307512_10010700 Ga0307512_100107004 274
1487 3300035114 Ga0373939_0028187 Ga0373939_0028187_71_949 274
1488 3300037312 Ga0395899_0007299 Ga0395899_0007299_3846_4751 274
1489 3300039438 Ga0436360_0229645 Ga0436360_0229645_454_1335 274
1490 3300042876 Ga0451577_0318253 Ga0451577_0318253_90_914 274
1491 3300045051 Ga0451576_0048685 Ga0451576_0048685_2118_2942 274
1492 3300048905 Ga0496102_0064873 Ga0496102_0064873_1999_2826 274
1493 3300048908 Ga0496105_0041480 Ga0496105_0041480_153_1061 274
1494 3300048909 Ga0496106_0117926 Ga0496106_0117926_298_1137 274
1495 3300048909 Ga0496106_0150215 Ga0496106_0150215_518_1345 274
1496 3300048912 Ga0496109_0346041 Ga0496109_0346041_273_1100 274
1497 3300048914 Ga0496111_0082418 Ga0496111_0082418_1284_2192 274
1498 3300048916 Ga0496113_0066413 Ga0496113_0066413_823_1731 274
1499 3300048920 Ga0496117_0000061 Ga0496117_0000061_50483_51382 274
1500 3300048922 Ga0496119_0013217 Ga0496119_0013217_4746_5645 274
1501 3300048923 Ga0496120_0008021 Ga0496120_0008021_761_1660 274
1502 3300048925 Ga0496122_0032798 Ga0496122_0032798_923_1822 274
1503 3300048926 Ga0496123_0031861 Ga0496123_0031861_967_1866 274
1504 3300048927 Ga0496124_0004974 Ga0496124_0004974_917_1816 274
1505 3300048927 Ga0496124_0010274 Ga0496124_0010274_5592_6476 274
1506 3300048928 Ga0496125_0007394 Ga0496125_0007394_10074_10973 274
1507 3300048929 Ga0496126_0019041 Ga0496126_0019041_5140_6039 274
1508 3300050507 nmdc:mga05p37_225575_c1 nmdc:mga05p37_225575_c1_684_1508 274
1509 3300050515 nmdc:mga0a205_22164_c1 nmdc:mga0a205_22164_c1_3810_4634 274
1510 iso_pu_bacteria 2547132130 2547499973 274
1511 iso_pu_bacteria 2738543027 2739325447 274
1512 iso_pu_bacteria 2747842428 2747949135 274
1513 iso_pu_bacteria 2747842501 2748016080 274
1514 iso_pu_bacteria 2765235840 2765579713 274
1515 iso_pu_bacteria 2818991457 2819659884 274
1516 iso_pu_bacteria 2842757796 2842760084 274
1517 iso_pu_bacteria 2842780639 2842783783 274
1518 iso_pu_bacteria 2852649853 2852650222 274
1519 iso_pu_bacteria 2874220319 2874222404 274
1520 iso_pu_bacteria 2919089067 2919090342 274
1521 iso_pu_bacteria 2919134579 2919138506 274
1522 iso_pu_bacteria 2928496128 2928497729 274
1523 iso_pu_bacteria 2931380184 2931384138 274
1524 iso_pu_bacteria 2937610967 2937614698 274
1525 iso_pu_bacteria 2939589442 2939590934 274
1526 iso_pu_bacteria 2939626828 2939630617 274
1527 iso_pu_bacteria 2941475908 2941476476 274
1528 iso_pu_bacteria 2961047084 2961049169 274
1529 iso_pu_bacteria 2974307012 2974308391 274
1530 iso_pu_bacteria 2977247770 2977249148 274
1531 iso_pu_bacteria 2977251589 2977253428 274
1532 iso_pu_bacteria 2984514374 2984516399 274
1533 iso_pu_bacteria 2987605356 2987606273 274
1534 iso_pu_bacteria 8002869464 8002871808 274
1535 3300005439 Ga0070711_100143737 Ga0070711_1001437372 275
1536 3300006028 Ga0070717_10007851 Ga0070717_100078512 275
1537 3300013306 Ga0163162_10017618 Ga0163162_100176184 275
1538 3300014325 Ga0163163_10040136 Ga0163163_100401364 275
1539 3300025929 Ga0207664_10123808 Ga0207664_101238082 275
1540 3300031456 Ga0307513_10109823 Ga0307513_101098233 275
1541 3300037418 Ga0395900_0000148 Ga0395900_0000148_104310_105140 275
1542 3300039437 Ga0436365_0618531 Ga0436365_0618531_202_1029 275
1543 3300042002 Ga0439442_000649 Ga0439442_000649_3634_4527 275
1544 3300045051 Ga0451576_0446894 Ga0451576_0446894_310_1140 275
1545 3300046536 Ga0495587_0097249 Ga0495587_0097249_650_1531 275
1546 3300047317 Ga0495604_0125255 Ga0495604_0125255_316_1197 275
1547 3300048903 Ga0496100_0147076 Ga0496100_0147076_538_1437 275
1548 3300048907 Ga0496104_0011782 Ga0496104_0011782_3957_4838 275
1549 3300048907 Ga0496104_0014068 Ga0496104_0014068_3565_4464 275
1550 3300048908 Ga0496105_0031392 Ga0496105_0031392_2383_3264 275
1551 3300048908 Ga0496105_0063389 Ga0496105_0063389_2070_2969 275
1552 3300048917 Ga0496114_0028642 Ga0496114_0028642_653_1552 275
1553 3300048917 Ga0496114_0171323 Ga0496114_0171323_126_1007 275
1554 3300048925 Ga0496122_0003449 Ga0496122_0003449_3646_4542 275
1555 3300048926 Ga0496123_0001609 Ga0496123_0001609_28793_29689 275
1556 3300048927 Ga0496124_0001486 Ga0496124_0001486_4220_5116 275
1557 3300048928 Ga0496125_0000579 Ga0496125_0000579_19195_20085 275
1558 3300005337 Ga0070682_100005980 Ga0070682_1000059803 276
1559 3300005364 Ga0070673_100074611 Ga0070673_1000746112 276
1560 3300005366 Ga0070659_100065471 Ga0070659_1000654712 276
1561 3300005366 Ga0070659_100164349 Ga0070659_1001643492 276
1562 3300005458 Ga0070681_10157808 Ga0070681_101578082 276
1563 3300005471 Ga0070698_100349176 Ga0070698_1003491762 276
1564 3300005518 Ga0070699_100069868 Ga0070699_1000698682 276
1565 3300005518 Ga0070699_100239802 Ga0070699_1002398022 276
1566 3300005539 Ga0068853_100026476 Ga0068853_1000264762 276
1567 3300005543 Ga0070672_100018497 Ga0070672_1000184972 276
1568 3300005549 Ga0070704_100123588 Ga0070704_1001235882 276
1569 3300005563 Ga0068855_100260062 Ga0068855_1002600623 276
1570 3300005577 Ga0068857_100301231 Ga0068857_1003012312 276
1571 3300005834 Ga0068851_10115309 Ga0068851_101153092 276
1572 3300005844 Ga0068862_100284723 Ga0068862_1002847232 276
1573 3300006048 Ga0075363_100015519 Ga0075363_1000155192 276
1574 3300006051 Ga0075364_10049854 Ga0075364_100498542 276
1575 3300006051 Ga0075364_10137913 Ga0075364_101379132 276
1576 3300006178 Ga0075367_10020625 Ga0075367_100206253 276
1577 3300006880 Ga0075429_100232722 Ga0075429_1002327222 276
1578 3300009036 Ga0105244_10064169 Ga0105244_100641692 276
1579 3300009148 Ga0105243_10430632 Ga0105243_104306321 276
1580 3300009174 Ga0105241_10428828 Ga0105241_104288282 276
1581 3300011119 Ga0105246_10040446 Ga0105246_100404463 276
1582 3300011119 Ga0105246_10086451 Ga0105246_100864512 276
1583 3300013100 Ga0157373_10000950 Ga0157373_1000095022 276
1584 3300013102 Ga0157371_10000354 Ga0157371_1000035418 276
1585 3300013105 Ga0157369_10060944 Ga0157369_100609442 276
1586 3300013307 Ga0157372_10002030 Ga0157372_100020303 276
1587 3300025728 Ga0207655_1036302 Ga0207655_10363022 276
1588 3300025898 Ga0207692_10075658 Ga0207692_100756582 276
1589 3300025901 Ga0207688_10033800 Ga0207688_100338002 276
1590 3300025921 Ga0207652_10036760 Ga0207652_100367602 276
1591 3300025923 Ga0207681_10327334 Ga0207681_103273342 276
1592 3300025933 Ga0207706_10078143 Ga0207706_100781434 276
1593 3300025934 Ga0207686_10412338 Ga0207686_104123381 276
1594 3300025935 Ga0207709_10430110 Ga0207709_104301101 276
1595 3300025960 Ga0207651_10032655 Ga0207651_100326552 276
1596 3300026116 Ga0207674_10246968 Ga0207674_102469682 276
1597 3300026121 Ga0207683_10040913 Ga0207683_100409134 276
1598 3300026121 Ga0207683_10048843 Ga0207683_100488433 276
1599 3300026142 Ga0207698_10219953 Ga0207698_102199531 276
1600 3300027614 Ga0209970_1012207 Ga0209970_10122072 276
1601 3300027876 Ga0209974_10013601 Ga0209974_100136013 276
1602 3300028380 Ga0268265_10142366 Ga0268265_101423662 276
1603 3300031456 Ga0307513_10009488 Ga0307513_1000948813 276
1604 3300031548 Ga0307408_100202846 Ga0307408_1002028462 276
1605 3300031731 Ga0307405_10009584 Ga0307405_100095842 276
1606 3300031824 Ga0307413_10005238 Ga0307413_100052383 276
1607 3300031824 Ga0307413_10073741 Ga0307413_100737412 276
1608 3300031852 Ga0307410_10001046 Ga0307410_100010465 276
1609 3300031901 Ga0307406_10015841 Ga0307406_100158412 276
1610 3300031903 Ga0307407_10004639 Ga0307407_100046395 276
1611 3300031911 Ga0307412_10100758 Ga0307412_101007582 276
1612 3300031995 Ga0307409_100018761 Ga0307409_1000187612 276
1613 3300031995 Ga0307409_100081819 Ga0307409_1000818192 276
1614 3300032002 Ga0307416_100001305 Ga0307416_10000130512 276
1615 3300032005 Ga0307411_10009621 Ga0307411_100096213 276
1616 3300032126 Ga0307415_100053735 Ga0307415_1000537352 276
1617 3300035112 Ga0373932_0055320 Ga0373932_0055320_241_1104 276
1618 3300037418 Ga0395900_0000103 Ga0395900_0000103_64997_65830 276
1619 3300037418 Ga0395900_0125307 Ga0395900_0125307_1708_2619 276
1620 3300037418 Ga0395900_0287913 Ga0395900_0287913_651_1487 276
1621 3300037466 Ga0395898_0159657 Ga0395898_0159657_1050_1961 276
1622 3300037466 Ga0395898_0163496 Ga0395898_0163496_586_1422 276
1623 3300037466 Ga0395898_0544068 Ga0395898_0544068_64_897 276
1624 3300037471 Ga0395905_0028613 Ga0395905_0028613_2197_3108 276
1625 3300038443 Ga0395901_0025740 Ga0395901_0025740_4299_5210 276
1626 3300041441 Ga0451787_065400 Ga0451787_065400_1696_2589 276
1627 3300041443 Ga0451789_0257034 Ga0451789_0257034_1705_2598 276
1628 3300041451 Ga0451791_0042636 Ga0451791_0042636_723_1616 276
1629 3300041453 Ga0451797_1364848 Ga0451797_1364848_1073_1966 276
1630 3300041456 Ga0451795_0305657 Ga0451795_0305657_1281_2174 276
1631 3300041498 Ga0451841_0635676 Ga0451841_0635676_3742_4635 276
1632 3300041509 Ga0451843_0339065 Ga0451843_0339065_3177_4070 276
1633 3300041999 Ga0439433_0001035 Ga0439433_0001035_4342_5238 276
1634 3300042002 Ga0439442_000181 Ga0439442_000181_10374_11273 276
1635 3300042002 Ga0439442_000263 Ga0439442_000263_9453_10349 276
1636 3300042006 Ga0439432_010445 Ga0439432_010445_2297_3196 276
1637 3300042121 Ga0450919_004053 Ga0450919_004053_204_1103 276
1638 3300042122 Ga0450920_000124 Ga0450920_000124_7598_8497 276
1639 3300042122 Ga0450920_003529 Ga0450920_003529_51_947 276
1640 3300042146 Ga0450907_000239 Ga0450907_000239_17872_18771 276
1641 3300042435 Ga0439434_0000223 Ga0439434_0000223_6750_7649 276
1642 3300042439 Ga0439464_0007697 Ga0439464_0007697_388_1299 276
1643 3300042531 Ga0450918_000791 Ga0450918_000791_131_1030 276
1644 3300042876 Ga0451577_0144627 Ga0451577_0144627_346_1209 276
1645 3300045836 Ga0466958_0022949 Ga0466958_0022949_1142_2029 276
1646 3300046453 Ga0495627_008122 Ga0495627_008122_1751_2644 276
1647 3300048903 Ga0496100_0103170 Ga0496100_0103170_606_1469 276
1648 3300048904 Ga0496101_0044083 Ga0496101_0044083_955_1818 276
1649 3300048905 Ga0496102_0001232 Ga0496102_0001232_3069_3932 276
1650 3300048906 Ga0496103_0011352 Ga0496103_0011352_3313_4176 276
1651 3300048907 Ga0496104_0392591 Ga0496104_0392591_61_957 276
1652 3300048909 Ga0496106_0000802 Ga0496106_0000802_7325_8188 276
1653 3300048911 Ga0496108_0294990 Ga0496108_0294990_419_1312 276
1654 3300048917 Ga0496114_0086316 Ga0496114_0086316_254_1150 276
1655 3300048917 Ga0496114_0105197 Ga0496114_0105197_459_1322 276
1656 3300048927 Ga0496124_0086465 Ga0496124_0086465_536_1438 276
1657 3300048929 Ga0496126_0367948 Ga0496126_0367948_24_911 276
1658 3300049585 Ga0501069_0153591 Ga0501069_0153591_66_974 276
1659 3300049822 Ga0501035_0061092 Ga0501035_0061092_1918_2751 276
1660 3300050492 nmdc:mga0yw44_45073_c1 nmdc:mga0yw44_45073_c1_190_1095 276
1661 3300050492 nmdc:mga0yw44_92227_c1 nmdc:mga0yw44_92227_c1_659_1570 276
1662 3300053139 Ga0500568_0045052 Ga0500568_0045052_513_1406 276
1663 iso_pu_bacteria 2868088558 2868088733 276
1664 3300013306 Ga0163162_10000004 Ga0163162_10000004339 277
1665 3300031616 Ga0307508_10028702 Ga0307508_100287021 277
1666 3300044694 Ga0466963_0152430 Ga0466963_0152430_333_1325 277
1667 2162886007 SwRhRL2b_contig_2631437 SwRhRL2b_0109.00000050 278
1668 3300003323 rootH1_10114839 rootH1_101148392 278
1669 3300003773 Ga0055537_1000164 Ga0055537_100016410 278
1670 3300003775 Ga0055524_1023138 Ga0055524_10231381 278
1671 3300003784 Ga0055534_1000026 Ga0055534_100002670 278
1672 3300003790 Ga0055528_1000748 Ga0055528_10007485 278
1673 3300003856 Ga0058692_1000012 Ga0058692_1000012134 278
1674 3300005289 Ga0065704_10070355 Ga0065704_100703558 278
1675 3300005331 Ga0070670_100018426 Ga0070670_1000184264 278
1676 3300005336 Ga0070680_100093034 Ga0070680_1000930343 278
1677 3300005337 Ga0070682_100020067 Ga0070682_1000200672 278
1678 3300005344 Ga0070661_100165207 Ga0070661_1001652072 278
1679 3300005347 Ga0070668_100038675 Ga0070668_1000386752 278
1680 3300005366 Ga0070659_100101324 Ga0070659_1001013242 278
1681 3300005435 Ga0070714_100004155 Ga0070714_1000041553 278
1682 3300005455 Ga0070663_100076510 Ga0070663_1000765103 278
1683 3300005456 Ga0070678_100168595 Ga0070678_1001685952 278
1684 3300005530 Ga0070679_100213343 Ga0070679_1002133432 278
1685 3300005535 Ga0070684_100009746 Ga0070684_1000097462 278
1686 3300005539 Ga0068853_100329938 Ga0068853_1003299382 278
1687 3300005547 Ga0070693_100055546 Ga0070693_1000555462 278
1688 3300005548 Ga0070665_100198905 Ga0070665_1001989052 278
1689 3300005564 Ga0070664_100005148 Ga0070664_1000051482 278
1690 3300005564 Ga0070664_100039326 Ga0070664_1000393262 278
1691 3300005578 Ga0068854_100010432 Ga0068854_1000104324 278
1692 3300005834 Ga0068851_10002104 Ga0068851_100021043 278
1693 3300009011 Ga0105251_10000261 Ga0105251_1000026124 278
1694 3300009011 Ga0105251_10036316 Ga0105251_100363161 278
1695 3300009093 Ga0105240_10016657 Ga0105240_100166574 278
1696 3300009148 Ga0105243_10030466 Ga0105243_100304662 278
1697 3300009174 Ga0105241_10001727 Ga0105241_1000172716 278
1698 3300009545 Ga0105237_10004560 Ga0105237_1000456013 278
1699 3300009551 Ga0105238_10040924 Ga0105238_100409243 278
1700 3300010375 Ga0105239_10062626 Ga0105239_100626262 278
1701 3300013100 Ga0157373_10002118 Ga0157373_100021183 278
1702 3300013102 Ga0157371_10003827 Ga0157371_100038274 278
1703 3300013102 Ga0157371_10012445 Ga0157371_100124454 278
1704 3300013104 Ga0157370_10114930 Ga0157370_101149302 278
1705 3300013104 Ga0157370_10168518 Ga0157370_101685182 278
1706 3300013104 Ga0157370_10230755 Ga0157370_102307552 278
1707 3300013105 Ga0157369_10031499 Ga0157369_100314994 278
1708 3300013307 Ga0157372_10140568 Ga0157372_101405682 278
1709 3300015261 Ga0182006_1013303 Ga0182006_10133032 278
1710 3300015261 Ga0182006_1078273 Ga0182006_10782732 278
1711 3300015262 Ga0182007_10000098 Ga0182007_1000009815 278
1712 3300015265 Ga0182005_1000311 Ga0182005_100031115 278
1713 3300017792 Ga0163161_10004013 Ga0163161_100040134 278
1714 3300025245 Ga0207425_1029520 Ga0207425_10295202 278
1715 3300025263 Ga0209565_1000022 Ga0209565_1000022133 278
1716 3300025273 Ga0209673_1000110 Ga0209673_1000110123 278
1717 3300025291 Ga0209675_1000060 Ga0209675_100006091 278
1718 3300025292 Ga0209676_1000219 Ga0209676_100021916 278
1719 3300025292 Ga0209676_1000279 Ga0209676_100027953 278
1720 3300025292 Ga0209676_1000969 Ga0209676_100096926 278
1721 3300025295 Ga0209564_1000304 Ga0209564_100030432 278
1722 3300025298 Ga0209050_1000542 Ga0209050_100054251 278
1723 3300025298 Ga0209050_1000825 Ga0209050_10008254 278
1724 3300025299 Ga0209256_1004280 Ga0209256_10042805 278
1725 3300025299 Ga0209256_1008488 Ga0209256_10084883 278
1726 3300025304 Ga0209257_1000251 Ga0209257_100025149 278
1727 3300025304 Ga0209257_1000726 Ga0209257_100072630 278
1728 3300025321 Ga0207656_10075918 Ga0207656_100759182 278
1729 3300025735 Ga0207713_1000598 Ga0207713_10005985 278
1730 3300025735 Ga0207713_1037313 Ga0207713_10373132 278
1731 3300025912 Ga0207707_10146648 Ga0207707_101466482 278
1732 3300025917 Ga0207660_10039944 Ga0207660_100399443 278
1733 3300025919 Ga0207657_10000428 Ga0207657_1000042815 278
1734 3300025920 Ga0207649_10077838 Ga0207649_100778382 278
1735 3300025921 Ga0207652_10144493 Ga0207652_101444932 278
1736 3300025924 Ga0207694_10036163 Ga0207694_100361632 278
1737 3300025925 Ga0207650_10275025 Ga0207650_102750251 278
1738 3300025929 Ga0207664_10039542 Ga0207664_100395422 278
1739 3300025935 Ga0207709_10004948 Ga0207709_100049484 278
1740 3300025944 Ga0207661_10008625 Ga0207661_100086253 278
1741 3300025945 Ga0207679_10071814 Ga0207679_100718143 278
1742 3300025949 Ga0207667_10016262 Ga0207667_100162624 278
1743 3300025949 Ga0207667_10324556 Ga0207667_103245562 278
1744 3300025972 Ga0207668_10042295 Ga0207668_100422952 278
1745 3300025981 Ga0207640_10006727 Ga0207640_100067272 278
1746 3300026041 Ga0207639_10085356 Ga0207639_100853562 278
1747 3300026041 Ga0207639_10131912 Ga0207639_101319122 278
1748 3300026067 Ga0207678_10026479 Ga0207678_100264793 278
1749 3300026116 Ga0207674_10001026 Ga0207674_1000102611 278
1750 3300026142 Ga0207698_10003455 Ga0207698_100034554 278
1751 3300027312 Ga0209371_1000007 Ga0209371_1000007255 278
1752 3300028379 Ga0268266_10057844 Ga0268266_100578444 278
1753 3300030500 Ga0268256_1000008 Ga0268256_1000008695 278
1754 3300031730 Ga0307516_10028409 Ga0307516_100284093 278
1755 3300031911 Ga0307412_10005496 Ga0307412_100054964 278
1756 3300032004 Ga0307414_10038086 Ga0307414_100380862 278
1757 3300037471 Ga0395905_0178394 Ga0395905_0178394_1030_1908 278
1758 3300039145 Ga0237816_00249 Ga0237816_00249_3546_4397 278
1759 3300046518 Ga0495631_0023857 Ga0495631_0023857_56_892 278
1760 3300046525 Ga0495663_0013748 Ga0495663_0013748_398_1234 278
1761 3300046558 Ga0495633_0014316 Ga0495633_0014316_615_1451 278
1762 3300046660 Ga0495625_0179990 Ga0495625_0179990_490_1326 278
1763 3300047320 Ga0495672_0000456 Ga0495672_0000456_38008_38844 278
1764 3300048919 Ga0496116_0006836 Ga0496116_0006836_6181_7017 278
1765 3300048919 Ga0496116_0046994 Ga0496116_0046994_588_1424 278
1766 3300048920 Ga0496117_0002609 Ga0496117_0002609_13708_14544 278
1767 3300048920 Ga0496117_0007748 Ga0496117_0007748_2621_3457 278
1768 3300048921 Ga0496118_0003212 Ga0496118_0003212_1197_2033 278
1769 3300048921 Ga0496118_0095065 Ga0496118_0095065_745_1581 278
1770 3300048922 Ga0496119_0000495 Ga0496119_0000495_17456_18292 278
1771 3300048922 Ga0496119_0002457 Ga0496119_0002457_13458_14294 278
1772 3300048923 Ga0496120_0000523 Ga0496120_0000523_30093_30929 278
1773 3300048923 Ga0496120_0000685 Ga0496120_0000685_13656_14492 278
1774 3300048925 Ga0496122_0000372 Ga0496122_0000372_9490_10326 278
1775 3300048925 Ga0496122_0002465 Ga0496122_0002465_11696_12532 278
1776 3300048925 Ga0496122_0166365 Ga0496122_0166365_195_1031 278
1777 3300048926 Ga0496123_0000436 Ga0496123_0000436_13731_14567 278
1778 3300048926 Ga0496123_0002295 Ga0496123_0002295_9381_10217 278
1779 3300048926 Ga0496123_0010540 Ga0496123_0010540_7001_7837 278
1780 3300048927 Ga0496124_0003225 Ga0496124_0003225_18929_19765 278
1781 3300048927 Ga0496124_0006648 Ga0496124_0006648_6055_6891 278
1782 3300048927 Ga0496124_0010942 Ga0496124_0010942_8228_9064 278
1783 3300048927 Ga0496124_0230670 Ga0496124_0230670_56_892 278
1784 3300048928 Ga0496125_0010844 Ga0496125_0010844_441_1277 278
1785 3300048928 Ga0496125_0015873 Ga0496125_0015873_21_857 278
1786 3300048929 Ga0496126_0002496 Ga0496126_0002496_6422_7258 278
1787 3300049585 Ga0501069_0007921 Ga0501069_0007921_3191_4042 278
1788 3300053161 Ga0500634_0000198 Ga0500634_0000198_6810_7646 278
1789 iso_pu_bacteria 2816332119 2816427727 278
1790 iso_pu_bacteria 2945968032 2945970013 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

132

314

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8657 12 267
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8564 12 278
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8487 1 268
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8393 8 278
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8387 1 266
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9541 12 268 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.944 1 268 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.94 9 265 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9386 6 268 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9383 5 268 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3N5QJ42-F1-model_v4 Carbohydrate ABC transporter permease 0.9832 12 260 GO:0005886
GO:0055085
AF-A0A7V4KIJ1-F1-model_v4 Carbohydrate ABC transporter permease 0.9739 27 278 GO:0005886
GO:0055085
AF-A0A538EI26-F1-model_v4 Carbohydrate ABC transporter permease 0.9735 26 278 GO:0005886
GO:0055085
AF-A0A7C5IJK5-F1-model_v4 Carbohydrate ABC transporter permease 0.9728 24 269 GO:0005886
GO:0055085
AF-A0A482TCG0-F1-model_v4 Carbohydrate ABC transporter permease 0.9717 23 278 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
91.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map