metagRoot

F495686

General Info

Members	Datasets	Scaffolds	Average Seq Length
1783	712	1499	256

Family's Representative Sequence

Representative Sequence	3300005614\|Ga0068856_100717839\|Ga0068856_1007178391
Length	267
Sequence	MITLTSAEINQWMISFFWPLARILALVAAAPVLGNTAIPTRVKIGLGALVTFVIAPMIETPPKIDPASLEGLLVLGQQILIGLAMGFAMRIIFSGVEMAGEIAGLQMGLGFATFFSSHSEGSTLVVGKFLGLLATLAFLSVNGHLLMLSVLAESFNAFPISAEPFSVTGWRTLADWGSQIFLAGLKLALPVVATLMIVNLALGILTRAAPQLNIFAVGFPITLMAGMVALMLSLPYFTPVIEQLISEGLQTMLDIANGARATPPKAR

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
4	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
5	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
6	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
7	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
8	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
9	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
10	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
11	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
12	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
13	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
14	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
15	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
16	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
17	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
18	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
19	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
20	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
21	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
22	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
23	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
24	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
25	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
26	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
27	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
28	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
29	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
30	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
31	2565956521	Vibrio rhizosphaerae DSM 18581	Isolate	Rhizosphere
32	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
33	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
34	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
35	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
36	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
37	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
38	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
39	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
40	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
41	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
42	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
43	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
44	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
45	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
46	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
47	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
48	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
49	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
50	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
51	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
52	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
53	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
54	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
55	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
56	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
57	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
58	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
59	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
60	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
61	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
62	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
63	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
64	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
65	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
66	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
67	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
68	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
69	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
70	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
71	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
72	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
73	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
74	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
75	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
76	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
77	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
78	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
79	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
80	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
81	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
82	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
83	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
84	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
85	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
86	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
87	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
88	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
89	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
90	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
91	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
92	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
93	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
94	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
95	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
96	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
97	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
98	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
99	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
100	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
101	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
102	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
103	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
104	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
105	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
106	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
107	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
108	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
109	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
110	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
111	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
112	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
113	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
114	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
115	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
116	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
117	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
118	2690315857	Rheinheimera sp. EpRS3	Isolate	Unclassified
119	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
120	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
121	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
122	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
123	2721755763	Pandoraea thiooxydans ATSB16	Isolate	Rhizosphere
124	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
125	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
126	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
127	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
128	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
129	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
130	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
131	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
132	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
133	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
134	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
135	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
136	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
137	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
138	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
139	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
140	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
141	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
142	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
143	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
144	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
145	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
146	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
147	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
148	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
149	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
150	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
151	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
152	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
153	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
154	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
155	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
156	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
157	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
158	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
159	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
160	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
161	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
162	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
163	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
164	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
165	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
166	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
167	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
168	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
169	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
170	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
171	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
172	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
173	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
174	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
175	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
176	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
177	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
178	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
179	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
180	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
181	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
182	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
183	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
184	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
185	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
186	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
187	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
188	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
189	2887630918	Psychrosphaera haliotis UCD-MCMsp1aY	Isolate	Unclassified
190	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
191	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
192	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
193	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
194	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
195	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
196	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
197	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
198	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
199	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
200	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
201	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
202	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
203	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
204	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
205	2919493220	Aeromonas salmonicida salmonicida 3466	Isolate	Unclassified
206	2919497567	Shewanella putrefaciens 3469	Isolate	Unclassified
207	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
208	2919534386	Rheinheimera pacifica 3879	Isolate	Unclassified
209	2919543075	Aeromonas salmonicida masoucida 4076	Isolate	Unclassified
210	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
211	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
212	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
213	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
214	2923525760	Aeromonas caviae SLBN-129	Isolate	Rhizosphere
215	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
216	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
217	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
218	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
219	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
220	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
221	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
222	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
223	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
224	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
225	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
226	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
227	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
228	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
229	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
230	2952252522	Salinicola sp. DM10	Isolate	Unclassified
231	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
232	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
233	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
234	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
235	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
236	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
237	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
238	2990196909	Pseudomonas mangrovi TC-11	Isolate	Unclassified
239	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
240	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
241	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
242	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
243	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
244	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
245	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
246	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
247	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
248	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
249	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
250	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
251	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
252	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
253	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
254	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
255	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
256	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
257	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
258	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
259	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
260	3300003347	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM	Metagenome	Rhizosphere
261	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
262	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
263	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
264	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
265	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
266	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
267	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
268	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
269	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
270	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
271	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
272	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
273	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
274	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
275	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
276	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
277	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
278	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
279	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
280	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
281	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
282	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
283	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
284	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
285	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
286	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
287	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
288	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
289	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
290	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
291	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
292	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
293	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
294	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
295	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
296	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
297	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
298	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
299	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
300	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
301	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
302	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
303	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
304	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
305	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
306	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
307	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
308	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
309	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
310	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
311	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
312	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
313	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
314	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
315	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
316	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
317	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
318	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
319	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
320	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
321	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
322	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
323	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
324	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
325	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
326	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
327	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
328	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
329	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
330	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
331	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
332	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
333	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
334	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
335	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
336	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
337	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
338	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
339	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
340	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
341	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
342	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
343	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
344	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
345	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
346	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
347	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
348	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
349	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
350	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
351	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
352	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
353	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
354	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
355	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
356	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
357	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
358	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
359	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
360	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
361	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
362	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
363	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
364	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
365	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
366	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
367	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
368	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
369	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
370	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
371	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
372	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
373	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
374	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
375	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
376	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
377	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
378	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
379	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
380	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
381	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
382	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
419	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
420	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
427	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
431	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
432	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
433	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
434	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
435	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
436	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
437	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
438	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
439	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
440	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
441	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
442	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
443	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
444	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
445	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
446	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
447	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
448	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
449	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
450	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
451	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
452	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
453	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
454	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
455	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
456	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
457	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
458	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
459	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
460	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
461	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
462	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
463	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
464	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
465	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
466	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
467	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
468	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
469	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
470	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
471	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
472	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
473	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
474	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
475	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
476	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
477	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
478	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
479	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
480	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
481	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
482	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
483	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
484	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
485	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
486	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
487	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
488	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
489	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
490	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
491	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
492	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
493	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
494	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
495	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
496	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
497	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
498	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
499	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
500	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
501	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
502	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
503	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
504	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
505	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
506	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
507	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
508	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
509	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
510	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
511	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
512	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
513	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
514	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
515	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
516	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
517	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
518	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
519	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
520	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
521	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
522	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
523	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
524	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
525	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
526	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
527	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
528	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
529	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
530	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
531	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
532	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
533	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
534	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
535	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
536	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
537	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
538	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
539	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
540	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
541	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
542	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
543	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
544	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
545	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
546	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
547	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
548	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
549	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
550	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
551	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
552	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
553	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
554	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
555	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
556	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
557	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
558	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
559	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
560	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
561	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
562	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
563	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
564	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
565	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
566	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
567	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
568	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
569	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
570	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
571	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
572	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
573	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
574	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
575	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
576	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
577	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
578	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
579	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
580	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
581	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
582	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
583	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
584	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
585	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
586	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
587	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
588	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
589	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
590	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
591	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
592	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
593	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
594	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
595	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
596	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
597	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
598	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
599	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
600	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
601	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
602	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
603	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
604	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
605	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
606	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
607	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
608	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
609	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
610	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
611	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
612	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
613	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
614	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
615	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
616	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
617	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
618	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
619	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
620	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
621	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
622	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
623	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
624	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
625	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
626	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
627	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
628	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
629	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
630	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
631	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
632	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
633	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
634	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
635	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
636	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
637	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
638	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
639	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
640	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
641	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
642	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
643	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
644	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
645	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
646	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
647	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
648	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
649	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
650	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
651	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
652	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
653	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
654	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
655	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
656	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
657	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
658	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
659	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
660	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
661	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
662	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
663	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
664	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
665	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
666	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
667	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
668	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
669	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
670	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
671	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
672	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
673	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
674	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
675	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
676	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
677	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
678	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
679	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
680	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
681	8001522603	Methylomicrobium sp. RS1	Isolate	Unclassified
682	8002745576	Marinomonas spartinae USM8	Isolate	Rhizosphere
683	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
684	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
685	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
686	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
687	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
688	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
689	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
690	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
691	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
692	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
693	8054357960	Idiomarina rhizosphaerae M1R2S28	Isolate	Rhizosphere
694	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
695	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
696	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
697	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
698	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
699	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
700	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
701	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
702	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
703	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
704	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
705	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
706	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
707	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
708	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
709	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
710	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
711	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
712	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.02
Metatranscriptomes	0.06
Isolates	15.93

Biome Distribution

Category	Percentage (%)
Aerial Root	0.11
Bulb	0
Endosphere	4.04
Nodule	1.63
Rhizoplane	5.05
Rhizosphere	74.59
Stem	0
Stem Tuber	0
Unclassified	14.58

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_7216	2124908027	Bacteria	6618
2	MRS2a_Contig_746	2124908027	Bacteria	35830
3	SwRhRL2b_contig_3653603	2162886007	Bacteria	1324
4	MBSR1b_contig_12794323	2162886012	Bacteria	1153
5	JGI24741J21665_1007627	3300001915	Bacteria	2090
6	JGI25162J39368_1000037	3300002737	Bacteria	179339
7	JGI25162J39368_1000087	3300002737	Bacteria	107005
8	JGI25154J39366_1012078	3300002738	Bacteria	965
9	JGI25163J39215_1000594	3300002771	Bacteria	10093
10	JGI25163J39215_1001754	3300002771	Bacteria	3012
11	JGI25164J39214_1000020	3300002772	Bacteria	179339
12	JGI25164J39214_1000051	3300002772	Bacteria	122377
13	JGI25164J39214_1000065	3300002772	Bacteria	107006
14	JGI25151J46595_10008885	3300003187	Bacteria	4797
15	JGI25165J46597_1000077	3300003214	Bacteria	179339
16	JGI25165J46597_1000091	3300003214	Bacteria	167941
17	JGI26128J50194_1000847	3300003347	Bacteria	1832
18	Ga0055538_1000086	3300003751	Bacteria	80460
19	Ga0055539_1000128	3300003752	Bacteria	80565
20	Ga0055533_1000185	3300003756	Bacteria	52131
21	Ga0055532_1000188	3300003758	Bacteria	51859
22	Ga0055525_1000195	3300003759	Bacteria	71342
23	Ga0055536_1000042	3300003781	Bacteria	125029
24	Ga0055536_1000571	3300003781	Bacteria	25135
25	Ga0055536_1001274	3300003781	Bacteria	15527
26	Ga0055536_1001447	3300003781	Bacteria	14293
27	Ga0055536_1030982	3300003781	Bacteria	1407
28	Ga0055530_10000304	3300003791	Bacteria	44740
29	Ga0055530_10000870	3300003791	Bacteria	24846
30	Ga0055530_10001489	3300003791	Bacteria	17002
31	Ga0055530_10003180	3300003791	Bacteria	9640
32	Ga0055540_1000292	3300003792	Bacteria	44683
33	Ga0055540_1000438	3300003792	Bacteria	33046
34	Ga0055540_1000634	3300003792	Bacteria	24951
35	Ga0055531_10000581	3300003794	Bacteria	31889
36	Ga0055541_1000120	3300003841	Bacteria	52131
37	Ga0065165_1003619	3300005262	Bacteria	10607
38	Ga0065714_10000179	3300005288	Bacteria	8024
39	Ga0065714_10002698	3300005288	Bacteria	12001
40	Ga0065714_10003663	3300005288	Bacteria	6434
41	Ga0065714_10007886	3300005288	Bacteria	7701
42	Ga0065714_10008639	3300005288	Bacteria	3234
43	Ga0065714_10008889	3300005288	Bacteria	2642
44	Ga0065714_10009867	3300005288	Bacteria	4131
45	Ga0065714_10017446	3300005288	Bacteria	2372
46	Ga0065714_10066581	3300005288	Bacteria	6615
47	Ga0065714_10066919	3300005288	Bacteria	6089
48	Ga0065714_10070393	3300005288	Bacteria	3881
49	Ga0065714_10072608	3300005288	Bacteria	3336
50	Ga0065714_10074017	3300005288	Bacteria	3094
51	Ga0065714_10083987	3300005288	Bacteria	2221
52	Ga0065704_10003480	3300005289	Bacteria	4536
53	Ga0065704_10007662	3300005289	Bacteria	5893
54	Ga0065704_10008162	3300005289	Bacteria	2208
55	Ga0065704_10081604	3300005289	Bacteria	3706
56	Ga0065704_10120554	3300005289	Bacteria	1768
57	Ga0065704_10313138	3300005289	Bacteria	865
58	Ga0065712_10004906	3300005290	Bacteria	4330
59	Ga0065712_10006839	3300005290	Bacteria	4786
60	Ga0065712_10067744	3300005290	Bacteria	68998
61	Ga0065715_10129124	3300005293	Bacteria	2051
62	Ga0070670_100000001	3300005331	Bacteria	728788
63	Ga0070670_100001830	3300005331	Bacteria	17312
64	Ga0070670_100053412	3300005331	Bacteria	3470
65	Ga0068869_100092375	3300005334	Bacteria	2278
66	Ga0070666_10108059	3300005335	Bacteria	1922
67	Ga0070661_100000008	3300005344	Bacteria	183494
68	Ga0070668_100075816	3300005347	Bacteria	2626
69	Ga0070669_100006984	3300005353	Bacteria	8113
70	Ga0070669_100017801	3300005353	Bacteria	5072
71	Ga0070669_100272577	3300005353	Bacteria	1354
72	Ga0070671_100000018	3300005355	Bacteria	147427
73	Ga0070674_100021390	3300005356	Bacteria	4152
74	Ga0070659_100404846	3300005366	Bacteria	1152
75	Ga0070659_100543038	3300005366	Bacteria	994
76	Ga0070667_100000331	3300005367	Bacteria	52620
77	Ga0070714_100035000	3300005435	Bacteria	4207
78	Ga0070663_100161473	3300005455	Bacteria	1725
79	Ga0070662_100000056	3300005457	Bacteria	60234
80	Ga0070681_10170120	3300005458	Bacteria	2101
81	Ga0068867_100023879	3300005459	Bacteria	4379
82	Ga0070685_10000049	3300005466	Bacteria	72567
83	Ga0070707_100192415	3300005468	Bacteria	1989
84	Ga0070684_100181994	3300005535	Bacteria	1911
85	Ga0070697_100572080	3300005536	Bacteria	992
86	Ga0068853_100000855	3300005539	Bacteria	21216
87	Ga0068853_100007795	3300005539	Bacteria	8588
88	Ga0070672_100021732	3300005543	Bacteria	4699
89	Ga0070693_100070863	3300005547	Bacteria	2052
90	Ga0070665_100011945	3300005548	Bacteria	8771
91	Ga0070665_100094764	3300005548	Bacteria	2990
92	Ga0070665_100347830	3300005548	Bacteria	1487
93	Ga0070704_100261885	3300005549	Bacteria	1425
94	Ga0070704_100723460	3300005549	Bacteria	884
95	Ga0068855_100015899	3300005563	Bacteria	9053
96	Ga0068855_100140638	3300005563	Bacteria	2752
97	Ga0070664_100000466	3300005564	Bacteria	30705
98	Ga0070664_100207741	3300005564	Bacteria	1749
99	Ga0070664_100421828	3300005564	Bacteria	1222
100	Ga0068857_100135404	3300005577	Bacteria	2224
101	Ga0068857_100220281	3300005577	Bacteria	1733
102	Ga0068854_100006137	3300005578	Bacteria	7626
103	Ga0068854_100187329	3300005578	Bacteria	1620
104	Ga0068856_100331595	3300005614	Bacteria	1539
105	Ga0068856_100717839	3300005614	Bacteria	1020
106	Ga0070702_100388122	3300005615	Unclassified	995
107	Ga0068859_100027399	3300005617	Bacteria	5715
108	Ga0068864_100000012	3300005618	Bacteria	335070
109	Ga0068866_10002548	3300005718	Bacteria	7508
110	Ga0068866_10046005	3300005718	Bacteria	2192
111	Ga0068861_100010826	3300005719	Bacteria	6339
112	Ga0068851_10000028	3300005834	Bacteria	117106
113	Ga0068863_100130245	3300005841	Bacteria	2402
114	Ga0068858_100009868	3300005842	Bacteria	9073
115	Ga0068858_100118037	3300005842	Bacteria	2480
116	Ga0068858_100205480	3300005842	Bacteria	1863
117	Ga0068858_100427408	3300005842	Bacteria	1274
118	Ga0068860_100001710	3300005843	Bacteria	23445
119	Ga0068862_100005719	3300005844	Bacteria	10373
120	Ga0068862_100031831	3300005844	Bacteria	4455
121	Ga0068862_100036098	3300005844	Bacteria	4188
122	Ga0068862_100157422	3300005844	Bacteria	2026
123	Ga0075364_10105605	3300006051	Bacteria	1876
124	Ga0075432_10002375	3300006058	Bacteria	6272
125	Ga0075432_10005427	3300006058	Bacteria	4346
126	Ga0075432_10048795	3300006058	Bacteria	1490
127	Ga0070716_100438116	3300006173	Bacteria	949
128	Ga0075362_10057084	3300006177	Bacteria	1758
129	Ga0075362_10117077	3300006177	Bacteria	1258
130	Ga0075370_10000524	3300006353	Bacteria	14643
131	Ga0068871_100224738	3300006358	Bacteria	1628
132	Ga0075430_100109826	3300006846	Bacteria	2300
133	Ga0075431_100003695	3300006847	Bacteria	14869
134	Ga0075434_100487026	3300006871	Bacteria	1254
135	Ga0075429_100007951	3300006880	Bacteria	9215
136	Ga0068865_100193502	3300006881	Bacteria	1574
137	Ga0075436_100136468	3300006914	Bacteria	1722
138	Ga0097620_100027400	3300006931	Bacteria	5715
139	Ga0099823_1000024	3300006944	Bacteria	74134
140	Ga0079104_1000543	3300006946	Bacteria	39536
141	Ga0079104_1001214	3300006946	Bacteria	18272
142	Ga0079104_1040972	3300006946	Bacteria	1081
143	Ga0099826_10008026	3300006948	Bacteria	7817
144	Ga0105251_10000060	3300009011	Bacteria	102799
145	Ga0105251_10000221	3300009011	Bacteria	57628
146	Ga0105251_10001570	3300009011	Bacteria	19543
147	Ga0105251_10003052	3300009011	Bacteria	12458
148	Ga0105251_10006170	3300009011	Bacteria	7703
149	Ga0105251_10009446	3300009011	Bacteria	5758
150	Ga0105251_10017278	3300009011	Bacteria	3871
151	Ga0105251_10018136	3300009011	Bacteria	3751
152	Ga0105251_10020075	3300009011	Bacteria	3516
153	Ga0105251_10020386	3300009011	Bacteria	3485
154	Ga0105251_10027627	3300009011	Bacteria	2874
155	Ga0105251_10049315	3300009011	Bacteria	2015
156	Ga0105251_10160853	3300009011	Bacteria	1012
157	Ga0105251_10206034	3300009011	Bacteria	886
158	Ga0105244_10004756	3300009036	Bacteria	9243
159	Ga0105244_10005482	3300009036	Bacteria	8426
160	Ga0105244_10005859	3300009036	Bacteria	8070
161	Ga0105244_10008923	3300009036	Bacteria	6208
162	Ga0105244_10018991	3300009036	Bacteria	3847
163	Ga0105244_10024650	3300009036	Bacteria	3281
164	Ga0105244_10025625	3300009036	Bacteria	3203
165	Ga0105244_10036162	3300009036	Bacteria	2589
166	Ga0105244_10036811	3300009036	Bacteria	2561
167	Ga0105244_10045914	3300009036	Bacteria	2246
168	Ga0105244_10046553	3300009036	Bacteria	2228
169	Ga0105244_10077645	3300009036	Bacteria	1647
170	Ga0105244_10084332	3300009036	Bacteria	1569
171	Ga0105244_10106675	3300009036	Bacteria	1366
172	Ga0105244_10139521	3300009036	Bacteria	1167
173	Ga0105244_10152739	3300009036	Bacteria	1106
174	Ga0105250_10000215	3300009092	Bacteria	47921
175	Ga0105250_10002063	3300009092	Bacteria	10309
176	Ga0105250_10008731	3300009092	Bacteria	4291
177	Ga0105250_10012494	3300009092	Bacteria	3504
178	Ga0105250_10017250	3300009092	Bacteria	2935
179	Ga0105250_10021202	3300009092	Bacteria	2623
180	Ga0105250_10029354	3300009092	Bacteria	2213
181	Ga0105250_10038991	3300009092	Bacteria	1905
182	Ga0105250_10092963	3300009092	Bacteria	1228
183	Ga0111539_10019233	3300009094	Bacteria	8434
184	Ga0111539_10040342	3300009094	Bacteria	5621
185	Ga0105247_10155629	3300009101	Bacteria	1510
186	Ga0105243_10000158	3300009148	Bacteria	77305
187	Ga0105243_10001567	3300009148	Bacteria	19974
188	Ga0105243_10040342	3300009148	Bacteria	3645
189	Ga0105243_10056668	3300009148	Bacteria	3117
190	Ga0105243_10107737	3300009148	Bacteria	2325
191	Ga0105243_10111102	3300009148	Bacteria	2293
192	Ga0105243_10215079	3300009148	Bacteria	1695
193	Ga0105243_10364349	3300009148	Bacteria	1331
194	Ga0105243_10440538	3300009148	Bacteria	1220
195	Ga0105241_10086637	3300009174	Bacteria	2463
196	Ga0105242_10001027	3300009176	Bacteria	21973
197	Ga0105242_10140834	3300009176	Bacteria	2092
198	Ga0105248_10104051	3300009177	Bacteria	3200
199	Ga0105237_10000944	3300009545	Bacteria	39047
200	Ga0105249_10042407	3300009553	Bacteria	4138
201	Ga0105249_10097062	3300009553	Bacteria	2766
202	Ga0105239_10242600	3300010375	Bacteria	2022
203	Ga0105246_10001106	3300011119	Bacteria	15659
204	Ga0105246_10009697	3300011119	Bacteria	5934
205	Ga0105246_10032515	3300011119	Bacteria	3460
206	Ga0105246_10130349	3300011119	Bacteria	1877
207	Ga0105246_10214448	3300011119	Bacteria	1505
208	Ga0157345_1000337	3300012498	Bacteria	5588
209	Ga0157373_10001402	3300013100	Bacteria	18435
210	Ga0157373_10001490	3300013100	Bacteria	17849
211	Ga0157373_10006835	3300013100	Bacteria	8493
212	Ga0157373_10011111	3300013100	Bacteria	6628
213	Ga0157373_10033327	3300013100	Bacteria	3706
214	Ga0157373_10042291	3300013100	Bacteria	3257
215	Ga0157373_10183690	3300013100	Bacteria	1473
216	Ga0157373_10257054	3300013100	Bacteria	1236
217	Ga0157371_10000203	3300013102	Bacteria	87175
218	Ga0157371_10001725	3300013102	Bacteria	22189
219	Ga0157371_10006553	3300013102	Bacteria	9574
220	Ga0157371_10011640	3300013102	Bacteria	6761
221	Ga0157371_10106710	3300013102	Bacteria	1987
222	Ga0157371_10130218	3300013102	Bacteria	1790
223	Ga0157371_10201688	3300013102	Bacteria	1426
224	Ga0157370_10005599	3300013104	Bacteria	14064
225	Ga0157370_10018541	3300013104	Bacteria	6996
226	Ga0157370_10033549	3300013104	Bacteria	5005
227	Ga0157370_10059116	3300013104	Bacteria	3643
228	Ga0157370_10070971	3300013104	Bacteria	3287
229	Ga0157370_10092212	3300013104	Bacteria	2843
230	Ga0157370_10096674	3300013104	Bacteria	2771
231	Ga0157370_10100556	3300013104	Bacteria	2709
232	Ga0157369_10020226	3300013105	Bacteria	7442
233	Ga0157369_10030498	3300013105	Bacteria	5946
234	Ga0157369_10035558	3300013105	Bacteria	5461
235	Ga0157369_10037127	3300013105	Bacteria	5335
236	Ga0157369_10207212	3300013105	Bacteria	2056
237	Ga0157369_10693635	3300013105	Bacteria	1049
238	Ga0157369_10884198	3300013105	Bacteria	917
239	Ga0157374_10051401	3300013296	Bacteria	3835
240	Ga0157378_10020973	3300013297	Bacteria	5749
241	Ga0163162_10024300	3300013306	Bacteria	5980
242	Ga0163162_10025717	3300013306	Bacteria	5820
243	Ga0163162_10143382	3300013306	Bacteria	2503
244	Ga0163162_10204447	3300013306	Bacteria	2104
245	Ga0163162_10441608	3300013306	Bacteria	1433
246	Ga0163162_10996033	3300013306	Bacteria	947
247	Ga0157372_10002134	3300013307	Bacteria	21497
248	Ga0157372_10014583	3300013307	Bacteria	8406
249	Ga0157372_10025911	3300013307	Bacteria	6378
250	Ga0157372_10498152	3300013307	Bacteria	1421
251	Ga0157372_10507343	3300013307	Bacteria	1406
252	Ga0157375_10096089	3300013308	Bacteria	3035
253	Ga0157375_10288007	3300013308	Bacteria	1805
254	Ga0163163_10000162	3300014325	Bacteria	69827
255	Ga0163163_10008768	3300014325	Bacteria	9000
256	Ga0157380_10067995	3300014326	Bacteria	2870
257	Ga0182008_10000040	3300014497	Bacteria	120886
258	Ga0182008_10021673	3300014497	Bacteria	3299
259	Ga0182008_10030495	3300014497	Bacteria	2718
260	Ga0182008_10037326	3300014497	Bacteria	2430
261	Ga0182008_10040588	3300014497	Bacteria	2323
262	Ga0182008_10054247	3300014497	Bacteria	1983
263	Ga0182008_10069304	3300014497	Bacteria	1735
264	Ga0157379_10086468	3300014968	Bacteria	2811
265	Ga0157379_10096959	3300014968	Bacteria	2646
266	Ga0182006_1002164	3300015261	Bacteria	10899
267	Ga0182006_1004779	3300015261	Bacteria	6598
268	Ga0182006_1015511	3300015261	Bacteria	3265
269	Ga0182006_1016346	3300015261	Bacteria	3165
270	Ga0182006_1045947	3300015261	Bacteria	1697
271	Ga0182006_1047799	3300015261	Bacteria	1656
272	Ga0182006_1048133	3300015261	Bacteria	1650
273	Ga0182007_10003128	3300015262	Bacteria	7958
274	Ga0182007_10027337	3300015262	Bacteria	1968
275	Ga0182007_10033666	3300015262	Bacteria	1735
276	Ga0182005_1003063	3300015265	Bacteria	5766
277	Ga0182005_1022297	3300015265	Bacteria	1735
278	Ga0182005_1036184	3300015265	Bacteria	1342
279	Ga0182005_1050825	3300015265	Bacteria	1127
280	Ga0182005_1052122	3300015265	Bacteria	1114
281	Ga0163161_10012274	3300017792	Bacteria	5945
282	Ga0163161_10017846	3300017792	Bacteria	4972
283	Ga0163161_10023635	3300017792	Bacteria	4337
284	Ga0163161_10093843	3300017792	Bacteria	2224
285	Ga0163161_10278306	3300017792	Bacteria	1312
286	Ga0213872_10001215	3300021361	Bacteria	17431
287	Ga0213872_10035315	3300021361	Bacteria	2286
288	Ga0209435_100812	3300025206	Bacteria	4981
289	Ga0209760_100022	3300025207	Bacteria	159218
290	Ga0209760_100053	3300025207	Bacteria	103438
291	Ga0209784_100017	3300025224	Bacteria	472003
292	Ga0209566_100014	3300025225	Bacteria	472003
293	Ga0209674_100028	3300025226	Bacteria	472003
294	Ga0209147_100038	3300025229	Bacteria	314497
295	Ga0209563_100032	3300025230	Bacteria	472003
296	Ga0209563_100367	3300025230	Bacteria	16634
297	Ga0207427_100001	3300025231	Bacteria	1410763
298	Ga0207427_100047	3300025231	Bacteria	240409
299	Ga0209437_100003	3300025233	Bacteria	1517827
300	Ga0209437_100009	3300025233	Bacteria	915954
301	Ga0209258_100409	3300025242	Bacteria	51954
302	Ga0209646_1001371	3300025246	Bacteria	6709
303	Ga0209677_100018	3300025253	Bacteria	472003
304	Ga0209759_1002719	3300025256	Bacteria	7534
305	Ga0209233_1000007	3300025261	Bacteria	1411234
306	Ga0209233_1000032	3300025261	Bacteria	623596
307	Ga0209130_1025347	3300025284	Bacteria	1285
308	Ga0209676_1000016	3300025292	Bacteria	655561
309	Ga0209676_1000021	3300025292	Bacteria	609534
310	Ga0209676_1000033	3300025292	Bacteria	463236
311	Ga0209676_1000753	3300025292	Bacteria	43895
312	Ga0209050_1000009	3300025298	Bacteria	1047265
313	Ga0209050_1000036	3300025298	Bacteria	423070
314	Ga0209050_1000107	3300025298	Bacteria	223303
315	Ga0209050_1020305	3300025298	Bacteria	2477
316	Ga0209051_1000043	3300025303	Bacteria	305473
317	Ga0209051_1000053	3300025303	Bacteria	281564
318	Ga0209051_1000474	3300025303	Bacteria	52139
319	Ga0209051_1004467	3300025303	Bacteria	8607
320	Ga0209257_1000098	3300025304	Bacteria	256390
321	Ga0209257_1009275	3300025304	Bacteria	5319
322	Ga0207656_10000119	3300025321	Bacteria	29990
323	Ga0207696_1000010	3300025711	Bacteria	534681
324	Ga0207696_1000043	3300025711	Bacteria	307112
325	Ga0207696_1000101	3300025711	Bacteria	170899
326	Ga0207696_1000175	3300025711	Bacteria	102142
327	Ga0207696_1003416	3300025711	Bacteria	7251
328	Ga0207696_1005667	3300025711	Bacteria	5147
329	Ga0207696_1007727	3300025711	Bacteria	4180
330	Ga0207696_1015790	3300025711	Bacteria	2546
331	Ga0207696_1030543	3300025711	Bacteria	1636
332	Ga0207696_1044334	3300025711	Bacteria	1290
333	Ga0207655_1000019	3300025728	Bacteria	536324
334	Ga0207655_1000095	3300025728	Bacteria	195899
335	Ga0207655_1000402	3300025728	Bacteria	59961
336	Ga0207655_1000562	3300025728	Bacteria	46223
337	Ga0207655_1000619	3300025728	Bacteria	42670
338	Ga0207655_1000670	3300025728	Bacteria	40330
339	Ga0207655_1000825	3300025728	Bacteria	33516
340	Ga0207655_1005875	3300025728	Bacteria	8229
341	Ga0207655_1007976	3300025728	Bacteria	6794
342	Ga0207655_1008317	3300025728	Bacteria	6601
343	Ga0207655_1010144	3300025728	Bacteria	5754
344	Ga0207655_1011027	3300025728	Bacteria	5423
345	Ga0207655_1015056	3300025728	Bacteria	4327
346	Ga0207655_1022350	3300025728	Bacteria	3174
347	Ga0207655_1022468	3300025728	Bacteria	3161
348	Ga0207655_1024406	3300025728	Bacteria	2965
349	Ga0207655_1025777	3300025728	Bacteria	2844
350	Ga0207655_1037736	3300025728	Bacteria	2123
351	Ga0207713_1000150	3300025735	Bacteria	105170
352	Ga0207713_1000207	3300025735	Bacteria	79895
353	Ga0207713_1002393	3300025735	Bacteria	13709
354	Ga0207713_1002430	3300025735	Bacteria	13588
355	Ga0207713_1003445	3300025735	Bacteria	10769
356	Ga0207713_1003756	3300025735	Bacteria	10196
357	Ga0207713_1004068	3300025735	Bacteria	9646
358	Ga0207713_1004396	3300025735	Bacteria	9158
359	Ga0207713_1006140	3300025735	Bacteria	7379
360	Ga0207713_1008180	3300025735	Bacteria	6052
361	Ga0207713_1008868	3300025735	Bacteria	5729
362	Ga0207713_1009854	3300025735	Bacteria	5346
363	Ga0207713_1011406	3300025735	Bacteria	4834
364	Ga0207713_1015726	3300025735	Bacteria	3868
365	Ga0207713_1017866	3300025735	Bacteria	3532
366	Ga0207713_1028157	3300025735	Bacteria	2539
367	Ga0207713_1035664	3300025735	Bacteria	2144
368	Ga0207713_1039634	3300025735	Bacteria	1985
369	Ga0207642_10002846	3300025899	Bacteria	5403
370	Ga0207680_10082488	3300025903	Bacteria	2023
371	Ga0207645_10132647	3300025907	Bacteria	1622
372	Ga0207654_10082391	3300025911	Bacteria	1940
373	Ga0207671_10000035	3300025914	Bacteria	237603
374	Ga0207671_10010328	3300025914	Bacteria	7713
375	Ga0207649_10000017	3300025920	Bacteria	225193
376	Ga0207681_10001458	3300025923	Bacteria	15232
377	Ga0207681_10304370	3300025923	Bacteria	1262
378	Ga0207650_10000002	3300025925	Bacteria	1439222
379	Ga0207650_10000180	3300025925	Bacteria	74406
380	Ga0207650_10000181	3300025925	Bacteria	73955
381	Ga0207664_10076600	3300025929	Bacteria	2708
382	Ga0207644_10000065	3300025931	Bacteria	76549
383	Ga0207690_10429874	3300025932	Bacteria	1058
384	Ga0207706_10003017	3300025933	Bacteria	16230
385	Ga0207706_10014450	3300025933	Bacteria	7156
386	Ga0207706_10030654	3300025933	Bacteria	4796
387	Ga0207686_10001754	3300025934	Bacteria	12056
388	Ga0207686_10308102	3300025934	Bacteria	1178
389	Ga0207709_10000053	3300025935	Bacteria	225514
390	Ga0207709_10003120	3300025935	Bacteria	9965
391	Ga0207709_10027125	3300025935	Bacteria	3296
392	Ga0207709_10041754	3300025935	Bacteria	2754
393	Ga0207709_10081037	3300025935	Bacteria	2091
394	Ga0207709_10094870	3300025935	Bacteria	1959
395	Ga0207709_10170426	3300025935	Bacteria	1527
396	Ga0207709_10217202	3300025935	Bacteria	1376
397	Ga0207669_10268812	3300025937	Bacteria	1279
398	Ga0207704_10026295	3300025938	Bacteria	3191
399	Ga0207691_10012813	3300025940	Bacteria	8026
400	Ga0207711_10001164	3300025941	Bacteria	25047
401	Ga0207679_10000005	3300025945	Bacteria	525011
402	Ga0207679_10073297	3300025945	Bacteria	2590
403	Ga0207679_10168035	3300025945	Bacteria	1803
404	Ga0207712_10057455	3300025961	Bacteria	2745
405	Ga0207668_10061346	3300025972	Bacteria	2644
406	Ga0207640_10071381	3300025981	Bacteria	2339
407	Ga0207658_10000001	3300025986	Bacteria	1439333
408	Ga0207703_10023685	3300026035	Bacteria	4828
409	Ga0207703_10228664	3300026035	Bacteria	1667
410	Ga0207703_10698584	3300026035	Bacteria	964
411	Ga0207639_10001808	3300026041	Bacteria	14378
412	Ga0207639_10005439	3300026041	Bacteria	8600
413	Ga0207678_10073289	3300026067	Bacteria	2935
414	Ga0207678_10270830	3300026067	Bacteria	1456
415	Ga0207702_10277184	3300026078	Bacteria	1584
416	Ga0207702_10673767	3300026078	Bacteria	1018
417	Ga0207648_10000439	3300026089	Bacteria	46028
418	Ga0207676_10000001	3300026095	Bacteria	1439222
419	Ga0207674_10238100	3300026116	Bacteria	1767
420	Ga0207675_100013133	3300026118	Bacteria	7730
421	Ga0207675_100337700	3300026118	Bacteria	1474
422	Ga0207683_10096050	3300026121	Bacteria	2643
423	Ga0209281_1000018	3300027111	Bacteria	579091
424	Ga0209281_1000174	3300027111	Bacteria	151659
425	Ga0209281_1015909	3300027111	Bacteria	1558
426	Ga0209389_1000018	3300027296	Bacteria	179898
427	Ga0209371_1001864	3300027312	Bacteria	12953
428	Ga0209371_1003258	3300027312	Bacteria	8081
429	Ga0209371_1014573	3300027312	Bacteria	2150
430	Ga0209984_1000270	3300027424	Bacteria	5912
431	Ga0209995_1002759	3300027471	Bacteria	2783
432	Ga0209999_1005222	3300027543	Bacteria	2336
433	Ga0209983_1003420	3300027665	Bacteria	3394
434	Ga0209974_10003574	3300027876	Bacteria	5592
435	Ga0207428_10028426	3300027907	Bacteria	4646
436	Ga0207428_10124641	3300027907	Bacteria	1973
437	Ga0207428_10223990	3300027907	Bacteria	1409
438	Ga0207428_10259802	3300027907	Bacteria	1294
439	Ga0268266_10048922	3300028379	Bacteria	3624
440	Ga0268266_10264200	3300028379	Bacteria	1596
441	Ga0268265_10000388	3300028380	Bacteria	46960
442	Ga0268265_10030477	3300028380	Bacteria	3885
443	Ga0268265_10122583	3300028380	Bacteria	2144
444	Ga0268265_10141061	3300028380	Bacteria	2018
445	Ga0268264_10000061	3300028381	Bacteria	303123
446	Ga0268264_10013375	3300028381	Bacteria	6753
447	Ga0268264_10176392	3300028381	Bacteria	1937
448	Ga0265318_10055317	3300028577	Bacteria	1485
449	Ga0265336_10001365	3300028666	Bacteria	11262
450	Ga0307517_10026165	3300028786	Bacteria	7086
451	Ga0265338_10044219	3300028800	Bacteria	4116
452	Ga0265338_10288666	3300028800	Bacteria	1196
453	Ga0265324_10000023	3300029957	Bacteria	164128
454	Ga0265324_10000557	3300029957	Bacteria	25533
455	Ga0268256_1001635	3300030500	Bacteria	12954
456	Ga0268256_1001974	3300030500	Bacteria	11164
457	Ga0268256_1006182	3300030500	Bacteria	4507
458	Ga0307511_10059309	3300030521	Bacteria	2945
459	Ga0314311_1190454	3300030733	Bacteria	7663
460	Ga0316178_1017517	3300030735	Bacteria	19545
461	Ga0316183_1151755	3300030742	Bacteria	1013
462	Ga0265330_10021565	3300031235	Bacteria	2938
463	Ga0265330_10122342	3300031235	Bacteria	1108
464	Ga0265332_10023424	3300031238	Bacteria	2722
465	Ga0265328_10011375	3300031239	Bacteria	3557
466	Ga0265320_10015761	3300031240	Bacteria	4260
467	Ga0265325_10000099	3300031241	Bacteria	61211
468	Ga0265325_10018111	3300031241	Bacteria	3906
469	Ga0265339_10172373	3300031249	Bacteria	1082
470	Ga0265331_10003774	3300031250	Bacteria	9612
471	Ga0265331_10005247	3300031250	Bacteria	7851
472	Ga0265331_10012115	3300031250	Bacteria	4687
473	Ga0265331_10018195	3300031250	Bacteria	3649
474	Ga0265331_10019217	3300031250	Bacteria	3530
475	Ga0265331_10033698	3300031250	Bacteria	2532
476	Ga0265331_10115008	3300031250	Bacteria	1232
477	Ga0265331_10151819	3300031250	Bacteria	1051
478	Ga0265327_10000065	3300031251	Bacteria	225004
479	Ga0265327_10000257	3300031251	Bacteria	105278
480	Ga0265327_10000384	3300031251	Bacteria	83284
481	Ga0265327_10010769	3300031251	Bacteria	6379
482	Ga0265327_10011016	3300031251	Bacteria	6288
483	Ga0265316_10035418	3300031344	Bacteria	4046
484	Ga0265316_10132060	3300031344	Bacteria	1880
485	Ga0307513_10020857	3300031456	Bacteria	7755
486	Ga0307408_100000018	3300031548	Bacteria	346872
487	Ga0307408_100015942	3300031548	Bacteria	5010
488	Ga0307408_100025025	3300031548	Bacteria	4083
489	Ga0307408_100080623	3300031548	Bacteria	2431
490	Ga0307408_100081707	3300031548	Bacteria	2416
491	Ga0307408_100139478	3300031548	Bacteria	1901
492	Ga0307408_100283138	3300031548	Bacteria	1381
493	Ga0307408_100514716	3300031548	Unclassified	1050
494	Ga0316575_10015090	3300031665	Bacteria	2910
495	Ga0316579_10006065	3300031691	Bacteria	4912
496	Ga0316579_10025457	3300031691	Bacteria	2671
497	Ga0265314_10000433	3300031711	Bacteria	55939
498	Ga0265314_10001396	3300031711	Bacteria	27081
499	Ga0265314_10020614	3300031711	Bacteria	5089
500	Ga0265342_10018541	3300031712	Bacteria	4505
501	Ga0316576_10002240	3300031727	Bacteria	10939
502	Ga0316576_10005681	3300031727	Bacteria	7667
503	Ga0316576_10332176	3300031727	Bacteria	1133
504	Ga0316578_10025352	3300031728	Bacteria	3333
505	Ga0316578_10054629	3300031728	Bacteria	2343
506	Ga0307405_10005593	3300031731	Bacteria	6077
507	Ga0307405_10020268	3300031731	Bacteria	3712
508	Ga0307405_10057573	3300031731	Bacteria	2442
509	Ga0307405_10201871	3300031731	Bacteria	1444
510	Ga0316577_10115592	3300031733	Bacteria	1506
511	Ga0307413_10007830	3300031824	Bacteria	4996
512	Ga0307413_10170869	3300031824	Bacteria	1538
513	Ga0307410_10093591	3300031852	Bacteria	2139
514	Ga0307406_10030398	3300031901	Bacteria	3279
515	Ga0307407_10231779	3300031903	Bacteria	1254
516	Ga0307407_10440503	3300031903	Bacteria	943
517	Ga0307412_10026009	3300031911	Bacteria	3632
518	Ga0307412_10069236	3300031911	Bacteria	2401
519	Ga0307412_10169828	3300031911	Bacteria	1629
520	Ga0307412_10204624	3300031911	Bacteria	1501
521	Ga0307409_100027501	3300031995	Bacteria	4032
522	Ga0307409_100169363	3300031995	Bacteria	1921
523	Ga0307416_100151409	3300032002	Bacteria	2128
524	Ga0307416_100315019	3300032002	Bacteria	1563
525	Ga0307414_10074088	3300032004	Bacteria	2465
526	Ga0307414_10234268	3300032004	Bacteria	1516
527	Ga0307411_10013117	3300032005	Bacteria	4556
528	Ga0307411_10022065	3300032005	Bacteria	3740
529	Ga0307411_10070087	3300032005	Bacteria	2371
530	Ga0307411_10124138	3300032005	Bacteria	1874
531	Ga0307411_10447515	3300032005	Bacteria	1080
532	Ga0316583_10006991	3300032133	Bacteria	4060
533	Ga0316593_10002164	3300032168	Bacteria	4583
534	Ga0307510_10017682	3300033180	Bacteria	8403
535	Ga0307510_10091006	3300033180	Bacteria	2895
536	Ga0373955_0045391	3300035172	Bacteria	2371
537	Ga0316574_0008371	3300035398	Bacteria	5743
538	Ga0373927_0299370	3300035695	Bacteria	1058
539	Ga0373937_0042829	3300036401	Bacteria	4132
540	Ga0316582_0011144	3300036647	Bacteria	4961
541	Ga0316582_0095316	3300036647	Bacteria	1964
542	Ga0316582_0101983	3300036647	Bacteria	1902
543	Ga0316582_0210710	3300036647	Bacteria	1328
544	Ga0316584_0035907	3300036712	Bacteria	3677
545	Ga0316584_0068479	3300036712	Bacteria	2660
546	Ga0316584_0078325	3300036712	Bacteria	2475
547	Ga0316584_0205958	3300036712	Bacteria	1450
548	Ga0373925_0034844	3300037068	Bacteria	3712
549	Ga0373925_0642923	3300037068	Bacteria	874
550	Ga0395905_0002001	3300037471	Bacteria	23293
551	Ga0316581_0005837	3300037588	Bacteria	3234
552	Ga0316581_0067070	3300037588	Bacteria	1102
553	Ga0395901_0555632	3300038443	Bacteria	1163
554	Ga0237819_00758	3300038705	Bacteria	10376
555	Ga0400484_02420	3300038725	Bacteria	21755
556	Ga0400484_05024	3300038725	Bacteria	33998
557	Ga0400484_09242	3300038725	Bacteria	12034
558	Ga0400484_17083	3300038725	Bacteria	5833
559	Ga0400484_27281	3300038725	Bacteria	4909
560	Ga0400490_00409	3300038726	Bacteria	12140
561	Ga0400490_00629	3300038726	Bacteria	48863
562	Ga0400490_19114	3300038726	Bacteria	3040
563	Ga0400490_34188	3300038726	Bacteria	18647
564	Ga0400490_41636	3300038726	Bacteria	34374
565	Ga0400490_42931	3300038726	Bacteria	25734
566	Ga0400490_47827	3300038726	Bacteria	7935
567	Ga0400490_56758	3300038726	Bacteria	42832
568	Ga0400491_18134	3300038727	Bacteria	4680
569	Ga0400491_24212	3300038727	Bacteria	1628
570	Ga0400491_26290	3300038727	Bacteria	3634
571	Ga0400485_01446	3300038735	Bacteria	3129
572	Ga0400485_04007	3300038735	Bacteria	30990
573	Ga0400485_07089	3300038735	Bacteria	55387
574	Ga0400485_08390	3300038735	Bacteria	1839
575	Ga0400485_12289	3300038735	Bacteria	1971
576	Ga0400488_08357	3300038741	Bacteria	1318
577	Ga0400488_15610	3300038741	Bacteria	1744
578	Ga0400488_24090	3300038741	Bacteria	17246
579	Ga0400488_35305	3300038741	Bacteria	3369
580	Ga0400488_35681	3300038741	Bacteria	3759
581	Ga0400488_37280	3300038741	Bacteria	3351
582	Ga0400488_38081	3300038741	Bacteria	3210
583	Ga0400488_42106	3300038741	Bacteria	1579
584	Ga0400488_45799	3300038741	Bacteria	4365
585	Ga0400488_46833	3300038741	Bacteria	2211
586	Ga0400488_51714	3300038741	Bacteria	2715
587	Ga0400488_59122	3300038741	Bacteria	1798
588	Ga0400488_59901	3300038741	Bacteria	2885
589	Ga0400486_00610	3300038742	Bacteria	18322
590	Ga0400486_00736	3300038742	Bacteria	47794
591	Ga0400486_11633	3300038742	Bacteria	1179
592	Ga0400486_17202	3300038742	Bacteria	6257
593	Ga0400486_21916	3300038742	Bacteria	3781
594	Ga0400483_015059	3300039062	Unclassified	1338
595	Ga0400483_036281	3300039062	Bacteria	1697
596	Ga0400483_050487	3300039062	Bacteria	45898
597	Ga0400483_061608	3300039062	Bacteria	4113
598	Ga0400483_072960	3300039062	Bacteria	14885
599	Ga0400483_078562	3300039062	Bacteria	1349
600	Ga0400483_082194	3300039062	Bacteria	1560
601	Ga0400483_088943	3300039062	Bacteria	9451
602	Ga0400483_091971	3300039062	Bacteria	2200
603	Ga0400483_117917	3300039062	Bacteria	2224
604	Ga0400483_128929	3300039062	Bacteria	34455
605	Ga0400483_132309	3300039062	Bacteria	2507
606	Ga0400483_141043	3300039062	Bacteria	14921
607	Ga0400483_145588	3300039062	Bacteria	1338
608	Ga0400483_147621	3300039062	Bacteria	10623
609	Ga0400483_153623	3300039062	Bacteria	2073
610	Ga0400483_161094	3300039062	Bacteria	1907
611	Ga0400483_163278	3300039062	Bacteria	2836
612	Ga0400483_170536	3300039062	Bacteria	20327
613	Ga0400483_172133	3300039062	Bacteria	2466
614	Ga0400483_173670	3300039062	Bacteria	14071
615	Ga0400483_176269	3300039062	Bacteria	4804
616	Ga0400483_180135	3300039062	Bacteria	8660
617	Ga0400483_210780	3300039062	Bacteria	10470
618	Ga0400483_219056	3300039062	Bacteria	2595
619	Ga0400483_228091	3300039062	Bacteria	14906
620	Ga0400483_256324	3300039062	Bacteria	3100
621	Ga0400483_266740	3300039062	Bacteria	30755
622	Ga0400483_275518	3300039062	Bacteria	1932
623	Ga0400483_283418	3300039062	Bacteria	4217
624	Ga0400489_00591	3300039093	Bacteria	1958
625	Ga0400489_40355	3300039093	Bacteria	9964
626	Ga0400489_65224	3300039093	Bacteria	3524
627	Ga0400487_02857	3300039110	Bacteria	12480
628	Ga0400487_07641	3300039110	Bacteria	1262
629	Ga0400487_22307	3300039110	Bacteria	3115
630	Ga0400487_24442	3300039110	Bacteria	38481
631	Ga0400487_26069	3300039110	Bacteria	54334
632	Ga0400487_31982	3300039110	Bacteria	24104
633	Ga0400487_36190	3300039110	Bacteria	1460
634	Ga0400487_43518	3300039110	Bacteria	8016
635	Ga0400487_65155	3300039110	Bacteria	2349
636	Ga0436365_1279657	3300039437	Bacteria	8019
637	Ga0436361_0880017	3300039447	Bacteria	8784
638	Ga0439436_0009859	3300041404	Bacteria	2922
639	Ga0439438_001091	3300041405	Bacteria	12109
640	Ga0439438_003173	3300041405	Bacteria	6739
641	Ga0439438_003183	3300041405	Bacteria	6720
642	Ga0439438_004345	3300041405	Bacteria	5461
643	Ga0439438_006363	3300041405	Bacteria	4181
644	Ga0439438_006824	3300041405	Bacteria	3981
645	Ga0439438_006855	3300041405	Bacteria	3967
646	Ga0439438_008224	3300041405	Bacteria	3483
647	Ga0439438_009560	3300041405	Bacteria	3130
648	Ga0439438_014690	3300041405	Bacteria	2324
649	Ga0439438_025999	3300041405	Bacteria	1589
650	Ga0439447_004549	3300041407	Bacteria	4744
651	Ga0439447_004599	3300041407	Bacteria	4706
652	Ga0439447_006753	3300041407	Bacteria	3690
653	Ga0439447_008342	3300041407	Bacteria	3213
654	Ga0439447_029549	3300041407	Bacteria	1386
655	Ga0439447_066602	3300041407	Bacteria	841
656	Ga0439466_0002465	3300041411	Bacteria	7254
657	Ga0439466_0002955	3300041411	Bacteria	6638
658	Ga0439466_0005271	3300041411	Bacteria	4947
659	Ga0439466_0007281	3300041411	Bacteria	4189
660	Ga0439466_0007700	3300041411	Bacteria	4068
661	Ga0439466_0008897	3300041411	Bacteria	3775
662	Ga0439466_0009853	3300041411	Bacteria	3559
663	Ga0439466_0015396	3300041411	Bacteria	2777
664	Ga0439466_0032588	3300041411	Bacteria	1775
665	Ga0439466_0035546	3300041411	Bacteria	1685
666	Ga0439465_0100680	3300041413	Bacteria	997
667	Ga0439431_0009622	3300041997	Bacteria	2183
668	Ga0439431_0026517	3300041997	Bacteria	1420
669	Ga0439431_0061687	3300041997	Bacteria	987
670	Ga0439437_005367	3300042000	Bacteria	1408
671	Ga0439443_015839	3300042003	Bacteria	1147
672	Ga0439445_0019725	3300042004	Bacteria	1682
673	Ga0439432_001383	3300042006	Bacteria	9183
674	Ga0439432_004872	3300042006	Bacteria	4870
675	Ga0439432_005314	3300042006	Bacteria	4648
676	Ga0439432_006716	3300042006	Bacteria	4099
677	Ga0439432_008662	3300042006	Bacteria	3568
678	Ga0439432_045194	3300042006	Bacteria	1385
679	Ga0439432_059236	3300042006	Bacteria	1183
680	Ga0439451_001033	3300042009	Bacteria	5407
681	Ga0439451_002013	3300042009	Bacteria	4079
682	Ga0439451_002283	3300042009	Bacteria	3866
683	Ga0439451_006038	3300042009	Bacteria	2474
684	Ga0439452_000753	3300042010	Bacteria	15525
685	Ga0439452_000764	3300042010	Bacteria	15369
686	Ga0439452_001071	3300042010	Bacteria	12090
687	Ga0439452_004297	3300042010	Bacteria	4807
688	Ga0439452_006545	3300042010	Bacteria	3644
689	Ga0439452_008266	3300042010	Bacteria	3143
690	Ga0439452_011131	3300042010	Bacteria	2593
691	Ga0439452_026007	3300042010	Bacteria	1480
692	Ga0439455_0031169	3300042012	Bacteria	1326
693	Ga0439456_000166	3300042013	Bacteria	19446
694	Ga0439456_001408	3300042013	Bacteria	4826
695	Ga0439456_002609	3300042013	Bacteria	3630
696	Ga0439456_008235	3300042013	Bacteria	2151
697	Ga0439456_016830	3300042013	Bacteria	1530
698	Ga0439456_020087	3300042013	Bacteria	1408
699	Ga0439463_001311	3300042016	Bacteria	6623
700	Ga0439463_002590	3300042016	Bacteria	4584
701	Ga0439463_008995	3300042016	Bacteria	2460
702	Ga0439463_016231	3300042016	Bacteria	1841
703	Ga0450911_000001	3300042115	Bacteria	311012
704	Ga0450911_000864	3300042115	Bacteria	8248
705	Ga0450911_003967	3300042115	Bacteria	2495
706	Ga0450919_004555	3300042121	Bacteria	1690
707	Ga0450900_005266	3300042136	Bacteria	1521
708	Ga0450900_010069	3300042136	Bacteria	1207
709	Ga0450902_002765	3300042137	Bacteria	2507
710	Ga0450902_030102	3300042137	Bacteria	912
711	Ga0450903_002630	3300042138	Bacteria	3171
712	Ga0450903_003594	3300042138	Bacteria	2675
713	Ga0450903_007456	3300042138	Bacteria	1800
714	Ga0450904_000136	3300042139	Bacteria	16261
715	Ga0450905_001380	3300042142	Bacteria	3088
716	Ga0450905_003212	3300042142	Bacteria	2144
717	Ga0450905_012685	3300042142	Bacteria	1188
718	Ga0450906_001310	3300042145	Bacteria	5461
719	Ga0450907_000921	3300042146	Bacteria	7009
720	Ga0450907_002184	3300042146	Bacteria	3834
721	Ga0450907_002615	3300042146	Bacteria	3372
722	Ga0450907_020453	3300042146	Bacteria	1111
723	Ga0450910_002467	3300042147	Bacteria	2429
724	Ga0450910_005672	3300042147	Bacteria	1709
725	Ga0439446_0011393	3300042156	Bacteria	2414
726	Ga0439446_0037950	3300042156	Bacteria	1411
727	Ga0450908_012579	3300042184	Bacteria	1534
728	Ga0450909_001993	3300042185	Bacteria	2880
729	Ga0450909_002887	3300042185	Bacteria	2440
730	Ga0439434_0005074	3300042435	Bacteria	3848
731	Ga0439434_0007032	3300042435	Bacteria	3288
732	Ga0439459_0002611	3300042438	Bacteria	2792
733	Ga0439464_0000157	3300042439	Bacteria	11190
734	Ga0439460_0000703	3300042461	Bacteria	7442
735	Ga0439460_0001560	3300042461	Bacteria	5402
736	Ga0439460_0006439	3300042461	Bacteria	2912
737	Ga0450916_002557	3300042530	Bacteria	1942
738	Ga0450918_008548	3300042531	Bacteria	1798
739	Ga0450918_027855	3300042531	Bacteria	994
740	Ga0450893_0005568	3300042532	Bacteria	2023
741	Ga0450893_0014720	3300042532	Bacteria	1314
742	Ga0450901_001308	3300042533	Bacteria	2869
743	Ga0451577_0000013	3300042876	Bacteria	550689
744	Ga0451577_0055837	3300042876	Bacteria	3522
745	Ga0451577_0094281	3300042876	Bacteria	2673
746	Ga0451577_0190883	3300042876	Bacteria	1848
747	Ga0451577_0213673	3300042876	Bacteria	1743
748	Ga0451577_0219365	3300042876	Bacteria	1719
749	Ga0466972_0046599	3300044658	Bacteria	2098
750	Ga0466977_0000151	3300044666	Bacteria	16992
751	Ga0453683_0000033	3300044673	Bacteria	241479
752	Ga0466961_0043879	3300044693	Bacteria	2863
753	Ga0453684_0000029	3300044712	Bacteria	757969
754	Ga0453684_0000085	3300044712	Bacteria	397817
755	Ga0453684_0006406	3300044712	Bacteria	22410
756	Ga0453684_0014629	3300044712	Bacteria	12524
757	Ga0453684_0131943	3300044712	Bacteria	2996
758	Ga0453684_0332819	3300044712	Bacteria	1717
759	Ga0466970_0074937	3300044765	Bacteria	1822
760	Ga0451576_0000018	3300045051	Bacteria	550689
761	Ga0451576_0000320	3300045051	Bacteria	116612
762	Ga0451576_0001448	3300045051	Bacteria	40341
763	Ga0451576_0016908	3300045051	Bacteria	8033
764	Ga0451576_0025846	3300045051	Bacteria	6324
765	Ga0466967_0770704	3300045976	Bacteria	954
766	Ga0495617_002271	3300046452	Bacteria	7782
767	Ga0495617_005844	3300046452	Bacteria	4340
768	Ga0495617_013432	3300046452	Bacteria	2787
769	Ga0495617_019513	3300046452	Bacteria	2293
770	Ga0495617_035856	3300046452	Bacteria	1664
771	Ga0495617_041863	3300046452	Bacteria	1530
772	Ga0495627_000013	3300046453	Bacteria	332765
773	Ga0495627_001540	3300046453	Bacteria	13194
774	Ga0495627_001543	3300046453	Bacteria	13164
775	Ga0495627_002603	3300046453	Bacteria	8507
776	Ga0495627_005677	3300046453	Bacteria	4984
777	Ga0495627_006905	3300046453	Bacteria	4410
778	Ga0495627_008854	3300046453	Bacteria	3732
779	Ga0495627_028737	3300046453	Bacteria	1775
780	Ga0495627_033024	3300046453	Bacteria	1625
781	Ga0495627_045155	3300046453	Bacteria	1343
782	Ga0495592_0203159	3300046454	Bacteria	1336
783	Ga0495603_0044895	3300046455	Bacteria	2636
784	Ga0495603_0087342	3300046455	Bacteria	1825
785	Ga0495603_0147459	3300046455	Bacteria	1367
786	Ga0495590_0003161	3300046457	Bacteria	6733
787	Ga0495590_0006189	3300046457	Bacteria	4687
788	Ga0495590_0031095	3300046457	Bacteria	1869
789	Ga0495590_0038108	3300046457	Bacteria	1675
790	Ga0495590_0065604	3300046457	Bacteria	1271
791	Ga0495590_0101052	3300046457	Bacteria	1024
792	Ga0495591_000020	3300046458	Bacteria	217845
793	Ga0495591_000376	3300046458	Bacteria	37950
794	Ga0495591_000959	3300046458	Bacteria	19736
795	Ga0495591_003817	3300046458	Bacteria	7618
796	Ga0495591_003863	3300046458	Bacteria	7571
797	Ga0495591_003878	3300046458	Bacteria	7539
798	Ga0495591_004517	3300046458	Bacteria	6762
799	Ga0495591_008934	3300046458	Bacteria	4040
800	Ga0495591_009968	3300046458	Bacteria	3727
801	Ga0495591_010153	3300046458	Bacteria	3673
802	Ga0495591_012752	3300046458	Bacteria	3111
803	Ga0495591_013718	3300046458	Bacteria	2948
804	Ga0495591_015190	3300046458	Bacteria	2730
805	Ga0495591_016860	3300046458	Bacteria	2527
806	Ga0495638_0010589	3300046460	Bacteria	6389
807	Ga0495638_0013958	3300046460	Bacteria	5447
808	Ga0495638_0016718	3300046460	Bacteria	4905
809	Ga0495638_0017681	3300046460	Bacteria	4747
810	Ga0495638_0020383	3300046460	Bacteria	4381
811	Ga0495638_0022970	3300046460	Bacteria	4086
812	Ga0495638_0026186	3300046460	Bacteria	3783
813	Ga0495638_0056369	3300046460	Bacteria	2438
814	Ga0495638_0056709	3300046460	Bacteria	2430
815	Ga0495638_0063189	3300046460	Bacteria	2283
816	Ga0495638_0091879	3300046460	Bacteria	1827
817	Ga0495653_0002537	3300046463	Bacteria	14547
818	Ga0495653_0031492	3300046463	Bacteria	4215
819	Ga0495653_0043635	3300046463	Bacteria	3485
820	Ga0495650_0000221	3300046471	Bacteria	118284
821	Ga0495650_0010761	3300046471	Bacteria	5080
822	Ga0495650_0015410	3300046471	Bacteria	3921
823	Ga0495650_0015935	3300046471	Bacteria	3831
824	Ga0495650_0016280	3300046471	Bacteria	3773
825	Ga0495650_0017300	3300046471	Bacteria	3618
826	Ga0495650_0017951	3300046471	Bacteria	3531
827	Ga0495650_0022429	3300046471	Bacteria	3027
828	Ga0495650_0026218	3300046471	Bacteria	2715
829	Ga0495650_0044939	3300046471	Bacteria	1863
830	Ga0495650_0053516	3300046471	Bacteria	1652
831	Ga0495650_0069701	3300046471	Bacteria	1382
832	Ga0495605_0000032	3300046474	Bacteria	210550
833	Ga0495605_0000047	3300046474	Bacteria	171270
834	Ga0495605_0001592	3300046474	Bacteria	14699
835	Ga0495605_0007134	3300046474	Bacteria	6359
836	Ga0495605_0016876	3300046474	Bacteria	3944
837	Ga0495605_0017142	3300046474	Bacteria	3908
838	Ga0495605_0020200	3300046474	Bacteria	3542
839	Ga0495605_0025388	3300046474	Bacteria	3087
840	Ga0495605_0029459	3300046474	Bacteria	2824
841	Ga0495605_0034743	3300046474	Bacteria	2551
842	Ga0495605_0035412	3300046474	Bacteria	2522
843	Ga0495605_0050199	3300046474	Bacteria	2036
844	Ga0495605_0050995	3300046474	Bacteria	2016
845	Ga0495605_0051001	3300046474	Bacteria	2016
846	Ga0495605_0067482	3300046474	Bacteria	1697
847	Ga0495639_0001688	3300046475	Bacteria	9795
848	Ga0495639_0021967	3300046475	Bacteria	2796
849	Ga0495639_0117623	3300046475	Bacteria	1266
850	Ga0495584_0005692	3300046491	Bacteria	6582
851	Ga0495584_0007770	3300046491	Bacteria	5580
852	Ga0495584_0011026	3300046491	Bacteria	4634
853	Ga0495584_0014019	3300046491	Bacteria	4083
854	Ga0495584_0021856	3300046491	Bacteria	3248
855	Ga0495584_0023054	3300046491	Bacteria	3157
856	Ga0495584_0027603	3300046491	Bacteria	2876
857	Ga0495584_0031122	3300046491	Bacteria	2701
858	Ga0495584_0075348	3300046491	Bacteria	1696
859	Ga0495584_0088276	3300046491	Bacteria	1563
860	Ga0495584_0121597	3300046491	Bacteria	1322
861	Ga0495585_0000483	3300046492	Bacteria	37827
862	Ga0495585_0008886	3300046492	Bacteria	6062
863	Ga0495585_0011164	3300046492	Bacteria	5323
864	Ga0495585_0011393	3300046492	Bacteria	5263
865	Ga0495585_0013809	3300046492	Bacteria	4719
866	Ga0495585_0022993	3300046492	Bacteria	3578
867	Ga0495585_0025024	3300046492	Bacteria	3420
868	Ga0495585_0102150	3300046492	Bacteria	1532
869	Ga0495585_0129285	3300046492	Bacteria	1330
870	Ga0495594_0000489	3300046499	Bacteria	20211
871	Ga0495594_0012490	3300046499	Bacteria	4424
872	Ga0495594_0022396	3300046499	Bacteria	3379
873	Ga0495594_0259413	3300046499	Bacteria	990
874	Ga0495596_0000231	3300046500	Bacteria	37776
875	Ga0495596_0015010	3300046500	Bacteria	3254
876	Ga0495607_0000129	3300046501	Bacteria	80548
877	Ga0495607_0000281	3300046501	Bacteria	54632
878	Ga0495607_0002338	3300046501	Bacteria	15520
879	Ga0495607_0003653	3300046501	Bacteria	11680
880	Ga0495607_0003762	3300046501	Bacteria	11471
881	Ga0495607_0006147	3300046501	Bacteria	8493
882	Ga0495607_0007868	3300046501	Bacteria	7335
883	Ga0495607_0009865	3300046501	Bacteria	6438
884	Ga0495607_0009959	3300046501	Bacteria	6400
885	Ga0495607_0012067	3300046501	Bacteria	5718
886	Ga0495607_0018409	3300046501	Bacteria	4453
887	Ga0495607_0020217	3300046501	Bacteria	4214
888	Ga0495607_0022260	3300046501	Bacteria	3982
889	Ga0495607_0057665	3300046501	Bacteria	2224
890	Ga0495607_0059064	3300046501	Bacteria	2189
891	Ga0495607_0072070	3300046501	Bacteria	1924
892	Ga0495607_0095090	3300046501	Bacteria	1606
893	Ga0495607_0100857	3300046501	Bacteria	1546
894	Ga0495607_0150582	3300046501	Bacteria	1191
895	Ga0495607_0152553	3300046501	Bacteria	1181
896	Ga0495607_0159233	3300046501	Bacteria	1148
897	Ga0495607_0172156	3300046501	Bacteria	1092
898	Ga0495607_0202809	3300046501	Bacteria	980
899	Ga0495583_0000052	3300046506	Bacteria	211902
900	Ga0495583_0001185	3300046506	Bacteria	28074
901	Ga0495583_0005780	3300046506	Bacteria	8271
902	Ga0495583_0008659	3300046506	Bacteria	6190
903	Ga0495583_0009370	3300046506	Bacteria	5859
904	Ga0495583_0011883	3300046506	Bacteria	4969
905	Ga0495583_0023592	3300046506	Bacteria	3109
906	Ga0495583_0023648	3300046506	Bacteria	3104
907	Ga0495583_0085198	3300046506	Bacteria	1368
908	Ga0495583_0108403	3300046506	Bacteria	1178
909	Ga0495606_0000669	3300046507	Bacteria	53621
910	Ga0495606_0002501	3300046507	Bacteria	21231
911	Ga0495606_0003264	3300046507	Bacteria	17392
912	Ga0495606_0005069	3300046507	Bacteria	12815
913	Ga0495606_0014464	3300046507	Bacteria	6155
914	Ga0495606_0021674	3300046507	Bacteria	4701
915	Ga0495606_0025275	3300046507	Bacteria	4256
916	Ga0495606_0028239	3300046507	Bacteria	3962
917	Ga0495606_0042575	3300046507	Bacteria	3035
918	Ga0495606_0045629	3300046507	Bacteria	2903
919	Ga0495606_0045634	3300046507	Bacteria	2902
920	Ga0495606_0061965	3300046507	Bacteria	2390
921	Ga0495606_0078029	3300046507	Bacteria	2066
922	Ga0495606_0170421	3300046507	Bacteria	1263
923	Ga0495610_0008711	3300046512	Bacteria	6525
924	Ga0495610_0009928	3300046512	Bacteria	5954
925	Ga0495610_0011456	3300046512	Bacteria	5420
926	Ga0495610_0014936	3300046512	Bacteria	4538
927	Ga0495610_0021977	3300046512	Bacteria	3498
928	Ga0495610_0023134	3300046512	Bacteria	3385
929	Ga0495610_0026436	3300046512	Bacteria	3098
930	Ga0495610_0033337	3300046512	Bacteria	2664
931	Ga0495610_0040827	3300046512	Bacteria	2334
932	Ga0495610_0044649	3300046512	Bacteria	2198
933	Ga0495610_0127116	3300046512	Bacteria	1110
934	Ga0495610_0132532	3300046512	Bacteria	1080
935	Ga0495616_0004932	3300046513	Bacteria	8334
936	Ga0495616_0006463	3300046513	Bacteria	7088
937	Ga0495616_0010373	3300046513	Bacteria	5397
938	Ga0495616_0015102	3300046513	Bacteria	4297
939	Ga0495616_0018806	3300046513	Bacteria	3782
940	Ga0495616_0032842	3300046513	Bacteria	2708
941	Ga0495620_0000002	3300046515	Bacteria	373737
942	Ga0495620_0000019	3300046515	Bacteria	150014
943	Ga0495620_0001475	3300046515	Bacteria	14075
944	Ga0495620_0002415	3300046515	Bacteria	10822
945	Ga0495620_0008232	3300046515	Bacteria	5606
946	Ga0495620_0013369	3300046515	Bacteria	4203
947	Ga0495620_0017199	3300046515	Bacteria	3610
948	Ga0495620_0025420	3300046515	Bacteria	2801
949	Ga0495620_0037121	3300046515	Bacteria	2173
950	Ga0495620_0097952	3300046515	Bacteria	1171
951	Ga0495620_0126572	3300046515	Bacteria	1004
952	Ga0495628_0014937	3300046516	Bacteria	6494
953	Ga0495628_0124008	3300046516	Bacteria	1980
954	Ga0495630_0060721	3300046517	Bacteria	2838
955	Ga0495630_0064876	3300046517	Bacteria	2744
956	Ga0495631_0003575	3300046518	Bacteria	8481
957	Ga0495631_0004375	3300046518	Bacteria	7528
958	Ga0495631_0019406	3300046518	Bacteria	3188
959	Ga0495631_0021543	3300046518	Bacteria	3001
960	Ga0495631_0035235	3300046518	Bacteria	2240
961	Ga0495631_0063462	3300046518	Bacteria	1599
962	Ga0495631_0084006	3300046518	Bacteria	1372
963	Ga0495632_0001503	3300046519	Bacteria	19285
964	Ga0495632_0005232	3300046519	Bacteria	8643
965	Ga0495632_0006113	3300046519	Bacteria	7804
966	Ga0495632_0006454	3300046519	Bacteria	7539
967	Ga0495632_0006699	3300046519	Bacteria	7365
968	Ga0495632_0006844	3300046519	Bacteria	7270
969	Ga0495632_0009876	3300046519	Bacteria	5707
970	Ga0495632_0012140	3300046519	Bacteria	4979
971	Ga0495632_0013249	3300046519	Bacteria	4713
972	Ga0495632_0019096	3300046519	Bacteria	3741
973	Ga0495632_0022612	3300046519	Bacteria	3367
974	Ga0495632_0022985	3300046519	Bacteria	3335
975	Ga0495632_0031695	3300046519	Bacteria	2729
976	Ga0495632_0047460	3300046519	Bacteria	2129
977	Ga0495632_0063457	3300046519	Bacteria	1788
978	Ga0495632_0075076	3300046519	Bacteria	1618
979	Ga0495632_0077643	3300046519	Bacteria	1587
980	Ga0495632_0143206	3300046519	Bacteria	1108
981	Ga0495637_0000594	3300046520	Bacteria	25884
982	Ga0495637_0001738	3300046520	Bacteria	12494
983	Ga0495637_0004300	3300046520	Bacteria	7395
984	Ga0495637_0004996	3300046520	Bacteria	6823
985	Ga0495637_0006530	3300046520	Bacteria	5842
986	Ga0495637_0015582	3300046520	Bacteria	3566
987	Ga0495637_0018438	3300046520	Bacteria	3236
988	Ga0495637_0018494	3300046520	Bacteria	3231
989	Ga0495637_0018614	3300046520	Bacteria	3219
990	Ga0495637_0023034	3300046520	Bacteria	2835
991	Ga0495637_0027077	3300046520	Bacteria	2568
992	Ga0495637_0027372	3300046520	Bacteria	2551
993	Ga0495637_0034309	3300046520	Bacteria	2222
994	Ga0495637_0040098	3300046520	Bacteria	2017
995	Ga0495637_0041085	3300046520	Bacteria	1986
996	Ga0495637_0058651	3300046520	Bacteria	1586
997	Ga0495637_0076474	3300046520	Bacteria	1341
998	Ga0495643_0000272	3300046522	Bacteria	75135
999	Ga0495643_0000640	3300046522	Bacteria	41491
1000	Ga0495643_0003942	3300046522	Bacteria	10627
1001	Ga0495643_0004751	3300046522	Bacteria	9389
1002	Ga0495643_0012511	3300046522	Bacteria	5116
1003	Ga0495643_0019888	3300046522	Bacteria	3880
1004	Ga0495643_0022853	3300046522	Bacteria	3561
1005	Ga0495643_0028918	3300046522	Bacteria	3103
1006	Ga0495643_0032593	3300046522	Bacteria	2891
1007	Ga0495643_0035123	3300046522	Bacteria	2761
1008	Ga0495643_0048043	3300046522	Bacteria	2308
1009	Ga0495643_0071049	3300046522	Bacteria	1827
1010	Ga0495643_0110464	3300046522	Bacteria	1398
1011	Ga0495644_0003180	3300046523	Bacteria	6490
1012	Ga0495644_0008888	3300046523	Bacteria	3863
1013	Ga0495644_0022160	3300046523	Bacteria	2421
1014	Ga0495644_0076496	3300046523	Bacteria	1261
1015	Ga0495644_0144380	3300046523	Bacteria	909
1016	Ga0495648_0001346	3300046524	Bacteria	24261
1017	Ga0495648_0002370	3300046524	Bacteria	17496
1018	Ga0495648_0004086	3300046524	Bacteria	12590
1019	Ga0495648_0008572	3300046524	Bacteria	8027
1020	Ga0495648_0009557	3300046524	Bacteria	7485
1021	Ga0495648_0011579	3300046524	Bacteria	6633
1022	Ga0495648_0019025	3300046524	Bacteria	4843
1023	Ga0495648_0019797	3300046524	Bacteria	4715
1024	Ga0495648_0032635	3300046524	Bacteria	3413
1025	Ga0495648_0038460	3300046524	Bacteria	3059
1026	Ga0495648_0043477	3300046524	Bacteria	2815
1027	Ga0495648_0047808	3300046524	Bacteria	2640
1028	Ga0495648_0064471	3300046524	Bacteria	2158
1029	Ga0495648_0067937	3300046524	Bacteria	2082
1030	Ga0495648_0074826	3300046524	Bacteria	1949
1031	Ga0495648_0090667	3300046524	Bacteria	1712
1032	Ga0495648_0117279	3300046524	Bacteria	1437
1033	Ga0495648_0196486	3300046524	Bacteria	1013
1034	Ga0495666_0013202	3300046526	Bacteria	4118
1035	Ga0495666_0028873	3300046526	Bacteria	2728
1036	Ga0495666_0072634	3300046526	Bacteria	1633
1037	Ga0495642_0001439	3300046528	Bacteria	10672
1038	Ga0495642_0001517	3300046528	Bacteria	10320
1039	Ga0495642_0007727	3300046528	Bacteria	4120
1040	Ga0495642_0008591	3300046528	Bacteria	3906
1041	Ga0495652_0143017	3300046529	Bacteria	1879
1042	Ga0495654_0000925	3300046530	Bacteria	21823
1043	Ga0495654_0001885	3300046530	Bacteria	13938
1044	Ga0495654_0007272	3300046530	Bacteria	6202
1045	Ga0495654_0007276	3300046530	Bacteria	6199
1046	Ga0495654_0010122	3300046530	Bacteria	5143
1047	Ga0495654_0010429	3300046530	Bacteria	5056
1048	Ga0495654_0015766	3300046530	Bacteria	4008
1049	Ga0495654_0016015	3300046530	Bacteria	3972
1050	Ga0495654_0038557	3300046530	Bacteria	2388
1051	Ga0495654_0043519	3300046530	Bacteria	2225
1052	Ga0495654_0045201	3300046530	Bacteria	2173
1053	Ga0495654_0047960	3300046530	Bacteria	2098
1054	Ga0495654_0061945	3300046530	Bacteria	1794
1055	Ga0495654_0102643	3300046530	Bacteria	1314
1056	Ga0495654_0104369	3300046530	Bacteria	1300
1057	Ga0495654_0106785	3300046530	Bacteria	1281
1058	Ga0495654_0251481	3300046530	Bacteria	736
1059	Ga0495640_0049330	3300046533	Bacteria	2904
1060	Ga0495586_0002705	3300046535	Bacteria	9587
1061	Ga0495586_0020317	3300046535	Bacteria	3537
1062	Ga0495587_0009417	3300046536	Bacteria	6259
1063	Ga0495587_0064163	3300046536	Bacteria	2146
1064	Ga0495609_0000032	3300046538	Bacteria	211021
1065	Ga0495609_0000187	3300046538	Bacteria	61967
1066	Ga0495609_0000563	3300046538	Bacteria	29276
1067	Ga0495609_0003267	3300046538	Bacteria	9367
1068	Ga0495609_0005350	3300046538	Bacteria	6776
1069	Ga0495609_0022356	3300046538	Bacteria	2912
1070	Ga0495609_0029563	3300046538	Bacteria	2495
1071	Ga0495609_0048994	3300046538	Bacteria	1886
1072	Ga0495609_0052289	3300046538	Bacteria	1817
1073	Ga0495597_0000004	3300046542	Bacteria	307496
1074	Ga0495597_0005721	3300046542	Bacteria	6532
1075	Ga0495597_0006383	3300046542	Bacteria	6102
1076	Ga0495597_0010493	3300046542	Bacteria	4525
1077	Ga0495597_0012939	3300046542	Bacteria	4007
1078	Ga0495597_0019019	3300046542	Bacteria	3218
1079	Ga0495597_0027400	3300046542	Bacteria	2612
1080	Ga0495597_0061997	3300046542	Bacteria	1628
1081	Ga0495597_0068452	3300046542	Bacteria	1534
1082	Ga0495597_0123804	3300046542	Bacteria	1076
1083	Ga0495645_0131802	3300046543	Bacteria	1751
1084	Ga0495622_0001828	3300046557	Bacteria	10497
1085	Ga0495622_0002145	3300046557	Bacteria	9616
1086	Ga0495622_0002533	3300046557	Bacteria	8825
1087	Ga0495622_0020085	3300046557	Bacteria	3110
1088	Ga0495622_0031561	3300046557	Bacteria	2475
1089	Ga0495622_0161187	3300046557	Bacteria	1011
1090	Ga0495633_0000040	3300046558	Bacteria	177876
1091	Ga0495633_0010871	3300046558	Bacteria	4948
1092	Ga0495633_0019399	3300046558	Bacteria	3439
1093	Ga0495633_0079139	3300046558	Bacteria	1530
1094	Ga0495656_0059682	3300046615	Bacteria	1660
1095	Ga0495668_0017610	3300046616	Bacteria	4140
1096	Ga0495668_0019466	3300046616	Bacteria	3911
1097	Ga0495668_0019934	3300046616	Bacteria	3858
1098	Ga0495668_0036480	3300046616	Bacteria	2754
1099	Ga0495668_0082868	3300046616	Bacteria	1759
1100	Ga0495668_0102069	3300046616	Bacteria	1569
1101	Ga0495634_0048385	3300046642	Bacteria	2863
1102	Ga0495634_0153915	3300046642	Bacteria	1452
1103	Ga0495611_0000814	3300046648	Bacteria	17283
1104	Ga0495611_0001050	3300046648	Bacteria	14600
1105	Ga0495611_0004555	3300046648	Bacteria	5977
1106	Ga0495611_0021523	3300046648	Bacteria	2785
1107	Ga0495611_0038974	3300046648	Bacteria	2115
1108	Ga0495611_0081260	3300046648	Bacteria	1490
1109	Ga0495625_0000010	3300046660	Bacteria	381775
1110	Ga0495625_0028113	3300046660	Bacteria	4220
1111	Ga0495625_0028954	3300046660	Bacteria	4146
1112	Ga0495625_0032031	3300046660	Bacteria	3904
1113	Ga0495625_0034383	3300046660	Bacteria	3741
1114	Ga0495625_0048330	3300046660	Bacteria	3064
1115	Ga0495625_0103159	3300046660	Bacteria	1956
1116	Ga0495625_0304113	3300046660	Bacteria	1019
1117	Ga0495625_0339840	3300046660	Bacteria	951
1118	Ga0495635_0007004	3300046663	Bacteria	7874
1119	Ga0495635_0051084	3300046663	Bacteria	2850
1120	Ga0495659_0001077	3300046664	Bacteria	9502
1121	Ga0495659_0007439	3300046664	Bacteria	3474
1122	Ga0495661_0000037	3300046665	Bacteria	164234
1123	Ga0495661_0000095	3300046665	Bacteria	109100
1124	Ga0495661_0000208	3300046665	Bacteria	67762
1125	Ga0495661_0001285	3300046665	Bacteria	21497
1126	Ga0495661_0005778	3300046665	Bacteria	8749
1127	Ga0495661_0020607	3300046665	Bacteria	4302
1128	Ga0495661_0037263	3300046665	Bacteria	3037
1129	Ga0495661_0042258	3300046665	Bacteria	2810
1130	Ga0495661_0052498	3300046665	Bacteria	2456
1131	Ga0495661_0108991	3300046665	Bacteria	1546
1132	Ga0495661_0113929	3300046665	Bacteria	1503
1133	Ga0495661_0227440	3300046665	Bacteria	963
1134	Ga0495661_0261593	3300046665	Bacteria	879
1135	Ga0495588_0021148	3300046674	Bacteria	3202
1136	Ga0495588_0077324	3300046674	Bacteria	1735
1137	Ga0495623_0024631	3300046679	Bacteria	3875
1138	Ga0495658_0074888	3300046683	Bacteria	1974
1139	Ga0495669_0008510	3300046684	Bacteria	4316
1140	Ga0495613_0099630	3300046689	Bacteria	2099
1141	Ga0495613_0407986	3300046689	Bacteria	926
1142	Ga0495624_0011291	3300046690	Bacteria	6140
1143	Ga0495670_0001570	3300046691	Bacteria	11169
1144	Ga0495670_0004104	3300046691	Bacteria	7147
1145	Ga0495670_0025568	3300046691	Bacteria	2920
1146	Ga0495670_0027884	3300046691	Bacteria	2799
1147	Ga0495670_0065527	3300046691	Bacteria	1831
1148	Ga0495670_0117768	3300046691	Bacteria	1378
1149	Ga0495671_0001786	3300046692	Bacteria	13910
1150	Ga0495671_0002715	3300046692	Bacteria	11076
1151	Ga0495671_0008100	3300046692	Bacteria	5931
1152	Ga0495671_0012661	3300046692	Bacteria	4598
1153	Ga0495671_0014408	3300046692	Bacteria	4256
1154	Ga0495671_0016365	3300046692	Bacteria	3960
1155	Ga0495671_0020690	3300046692	Bacteria	3465
1156	Ga0495671_0024151	3300046692	Bacteria	3169
1157	Ga0495671_0025353	3300046692	Bacteria	3083
1158	Ga0495671_0028131	3300046692	Bacteria	2898
1159	Ga0495671_0028202	3300046692	Bacteria	2894
1160	Ga0495671_0029075	3300046692	Bacteria	2841
1161	Ga0495671_0032166	3300046692	Bacteria	2678
1162	Ga0495671_0053335	3300046692	Bacteria	2007
1163	Ga0495671_0157130	3300046692	Bacteria	1106
1164	Ga0495649_0000947	3300046694	Bacteria	22926
1165	Ga0495649_0009366	3300046694	Bacteria	5827
1166	Ga0495649_0010080	3300046694	Bacteria	5584
1167	Ga0495649_0012004	3300046694	Bacteria	5059
1168	Ga0495649_0019023	3300046694	Bacteria	3858
1169	Ga0495649_0020998	3300046694	Bacteria	3660
1170	Ga0495649_0021252	3300046694	Bacteria	3636
1171	Ga0495649_0027552	3300046694	Bacteria	3151
1172	Ga0495649_0040077	3300046694	Bacteria	2566
1173	Ga0495649_0056458	3300046694	Bacteria	2119
1174	Ga0495649_0060394	3300046694	Bacteria	2039
1175	Ga0495649_0127404	3300046694	Bacteria	1344
1176	Ga0495589_0002228	3300046794	Bacteria	10902
1177	Ga0495589_0002536	3300046794	Bacteria	10164
1178	Ga0495589_0003006	3300046794	Bacteria	9276
1179	Ga0495589_0012264	3300046794	Bacteria	4444
1180	Ga0495589_0026864	3300046794	Bacteria	2914
1181	Ga0495589_0040630	3300046794	Bacteria	2321
1182	Ga0495589_0051265	3300046794	Bacteria	2040
1183	Ga0495589_0081462	3300046794	Bacteria	1575
1184	Ga0495589_0083315	3300046794	Bacteria	1554
1185	Ga0495600_0060791	3300046809	Bacteria	2467
1186	Ga0495600_0175113	3300046809	Bacteria	1383
1187	Ga0495660_0001556	3300046810	Bacteria	15425
1188	Ga0495660_0010294	3300046810	Bacteria	5436
1189	Ga0495660_0010989	3300046810	Bacteria	5258
1190	Ga0495660_0011476	3300046810	Bacteria	5141
1191	Ga0495660_0014523	3300046810	Bacteria	4555
1192	Ga0495660_0014720	3300046810	Bacteria	4524
1193	Ga0495660_0014764	3300046810	Bacteria	4516
1194	Ga0495660_0022502	3300046810	Bacteria	3599
1195	Ga0495660_0022655	3300046810	Bacteria	3585
1196	Ga0495660_0038528	3300046810	Bacteria	2657
1197	Ga0495660_0041184	3300046810	Bacteria	2559
1198	Ga0495660_0060826	3300046810	Bacteria	2027
1199	Ga0495660_0142667	3300046810	Bacteria	1190
1200	Ga0495660_0189361	3300046810	Bacteria	989
1201	Ga0495660_0209456	3300046810	Bacteria	925
1202	Ga0495604_0026431	3300047317	Bacteria	4620
1203	Ga0495604_0036787	3300047317	Bacteria	3858
1204	Ga0495604_0074966	3300047317	Bacteria	2548
1205	Ga0495604_0300872	3300047317	Bacteria	1077
1206	Ga0495636_0008220	3300047318	Bacteria	4116
1207	Ga0495674_0095378	3300047319	Bacteria	2536
1208	Ga0495672_0002942	3300047320	Bacteria	15019
1209	Ga0495672_0010001	3300047320	Bacteria	6802
1210	Ga0495672_0011385	3300047320	Bacteria	6283
1211	Ga0495672_0012759	3300047320	Bacteria	5841
1212	Ga0495672_0014999	3300047320	Bacteria	5279
1213	Ga0495672_0016828	3300047320	Bacteria	4907
1214	Ga0495672_0017581	3300047320	Bacteria	4779
1215	Ga0495672_0023302	3300047320	Bacteria	4008
1216	Ga0495672_0029537	3300047320	Bacteria	3451
1217	Ga0495672_0031749	3300047320	Bacteria	3295
1218	Ga0495672_0045762	3300047320	Bacteria	2615
1219	Ga0495672_0051231	3300047320	Bacteria	2432
1220	Ga0495672_0082673	3300047320	Bacteria	1785
1221	Ga0495672_0122856	3300047320	Bacteria	1377
1222	Ga0495672_0160839	3300047320	Bacteria	1155
1223	Ga0495676_0000002	3300047321	Bacteria	373918
1224	Ga0495676_0013290	3300047321	Bacteria	7399
1225	Ga0495676_0126713	3300047321	Bacteria	1849
1226	Ga0495680_0024428	3300047322	Bacteria	5013
1227	Ga0495680_0039482	3300047322	Bacteria	3765
1228	Ga0495680_0051783	3300047322	Bacteria	3203
1229	Ga0495680_0062937	3300047322	Bacteria	2850
1230	Ga0495680_0085465	3300047322	Bacteria	2375
1231	Ga0495683_0000011	3300047323	Bacteria	212053
1232	Ga0495683_0000089	3300047323	Bacteria	92081
1233	Ga0495683_0003963	3300047323	Bacteria	8517
1234	Ga0495683_0007287	3300047323	Bacteria	5998
1235	Ga0495683_0014227	3300047323	Bacteria	4144
1236	Ga0495683_0021191	3300047323	Bacteria	3350
1237	Ga0495683_0050460	3300047323	Bacteria	2082
1238	Ga0495683_0069872	3300047323	Bacteria	1725
1239	Ga0495683_0166114	3300047323	Bacteria	1017
1240	Ga0495687_010990	3300047443	Bacteria	4907
1241	Ga0495687_013802	3300047443	Bacteria	4192
1242	Ga0495687_032472	3300047443	Bacteria	2381
1243	Ga0495687_033653	3300047443	Bacteria	2322
1244	Ga0495677_0008561	3300047445	Bacteria	3798
1245	Ga0495679_002295	3300047446	Bacteria	9852
1246	Ga0495679_002642	3300047446	Bacteria	8998
1247	Ga0495679_003615	3300047446	Bacteria	7385
1248	Ga0495679_011865	3300047446	Bacteria	3346
1249	Ga0495679_013862	3300047446	Bacteria	3007
1250	Ga0495679_014617	3300047446	Bacteria	2900
1251	Ga0495679_021746	3300047446	Bacteria	2207
1252	Ga0495679_051669	3300047446	Bacteria	1232
1253	Ga0495679_056153	3300047446	Bacteria	1167
1254	Ga0495673_0000573	3300047469	Bacteria	37094
1255	Ga0495673_0003056	3300047469	Bacteria	11246
1256	Ga0495673_0004805	3300047469	Bacteria	8360
1257	Ga0495673_0005998	3300047469	Bacteria	7224
1258	Ga0495673_0007572	3300047469	Bacteria	6214
1259	Ga0495673_0007854	3300047469	Bacteria	6066
1260	Ga0495673_0009619	3300047469	Bacteria	5331
1261	Ga0495673_0012468	3300047469	Bacteria	4504
1262	Ga0495673_0013191	3300047469	Bacteria	4351
1263	Ga0495673_0015791	3300047469	Bacteria	3879
1264	Ga0495673_0025079	3300047469	Bacteria	2869
1265	Ga0495673_0030569	3300047469	Bacteria	2528
1266	Ga0495673_0032618	3300047469	Bacteria	2425
1267	Ga0495673_0040500	3300047469	Bacteria	2104
1268	Ga0495673_0042538	3300047469	Bacteria	2038
1269	Ga0495673_0086144	3300047469	Bacteria	1291
1270	Ga0495673_0123847	3300047469	Bacteria	1021
1271	Ga0495673_0148604	3300047469	Bacteria	907
1272	Ga0495681_0002515	3300047470	Bacteria	13058
1273	Ga0495681_0004285	3300047470	Bacteria	9772
1274	Ga0495681_0006105	3300047470	Bacteria	7961
1275	Ga0495681_0006355	3300047470	Bacteria	7778
1276	Ga0495681_0007065	3300047470	Bacteria	7247
1277	Ga0495681_0007894	3300047470	Bacteria	6730
1278	Ga0495681_0009655	3300047470	Bacteria	5925
1279	Ga0495681_0011886	3300047470	Bacteria	5146
1280	Ga0495681_0014289	3300047470	Bacteria	4558
1281	Ga0495681_0019776	3300047470	Bacteria	3667
1282	Ga0495681_0027875	3300047470	Bacteria	2916
1283	Ga0495681_0041553	3300047470	Bacteria	2231
1284	Ga0495681_0050320	3300047470	Bacteria	1964
1285	Ga0495681_0083805	3300047470	Bacteria	1418
1286	Ga0495686_0003332	3300047472	Bacteria	14020
1287	Ga0495686_0017065	3300047472	Bacteria	4901
1288	Ga0495686_0021370	3300047472	Bacteria	4299
1289	Ga0495686_0047518	3300047472	Bacteria	2709
1290	Ga0495686_0110888	3300047472	Bacteria	1645
1291	Ga0495686_0155524	3300047472	Bacteria	1339
1292	Ga0495686_0203436	3300047472	Bacteria	1135
1293	Ga0495593_0022979	3300047673	Bacteria	3469
1294	Ga0495593_0032827	3300047673	Bacteria	2828
1295	Ga0495593_0243870	3300047673	Bacteria	900
1296	Ga0495593_0245923	3300047673	Bacteria	896
1297	Ga0495602_0087907	3300048088	Bacteria	2588
1298	Ga0495626_0000007	3300048091	Bacteria	276374
1299	Ga0495626_0000246	3300048091	Bacteria	62872
1300	Ga0495626_0003502	3300048091	Bacteria	10051
1301	Ga0495626_0009950	3300048091	Bacteria	5111
1302	Ga0495626_0010191	3300048091	Bacteria	5038
1303	Ga0495626_0010869	3300048091	Bacteria	4834
1304	Ga0495626_0014076	3300048091	Bacteria	4137
1305	Ga0495626_0019958	3300048091	Bacteria	3343
1306	Ga0495626_0058363	3300048091	Bacteria	1763
1307	Ga0495626_0064015	3300048091	Bacteria	1666
1308	Ga0495626_0072012	3300048091	Bacteria	1551
1309	Ga0496100_0462024	3300048903	Bacteria	974
1310	Ga0496101_0216052	3300048904	Bacteria	1487
1311	Ga0496101_0336456	3300048904	Bacteria	1185
1312	Ga0496102_0018098	3300048905	Bacteria	6184
1313	Ga0496102_0335475	3300048905	Bacteria	1424
1314	Ga0496102_0572291	3300048905	Bacteria	1052
1315	Ga0496104_0234067	3300048907	Bacteria	1749
1316	Ga0496104_0410133	3300048907	Bacteria	1267
1317	Ga0496105_0260500	3300048908	Bacteria	1402
1318	Ga0496108_0466655	3300048911	Unclassified	1103
1319	Ga0496109_0240926	3300048912	Bacteria	1702
1320	Ga0496109_0454706	3300048912	Unclassified	1209
1321	Ga0496110_0328304	3300048913	Bacteria	1393
1322	Ga0496111_0098269	3300048914	Bacteria	2150
1323	Ga0496111_0113818	3300048914	Bacteria	1994
1324	Ga0496114_0000303	3300048917	Bacteria	36267
1325	Ga0496114_0006503	3300048917	Bacteria	9207
1326	Ga0496114_0014654	3300048917	Bacteria	6300
1327	Ga0496114_0086640	3300048917	Bacteria	2655
1328	Ga0496114_0124852	3300048917	Bacteria	2218
1329	Ga0496115_0174592	3300048918	Bacteria	1777
1330	Ga0496116_0000085	3300048919	Bacteria	219553
1331	Ga0496116_0001765	3300048919	Bacteria	23575
1332	Ga0496116_0006943	3300048919	Bacteria	10149
1333	Ga0496116_0009249	3300048919	Bacteria	8430
1334	Ga0496116_0026314	3300048919	Bacteria	4259
1335	Ga0496116_0034158	3300048919	Bacteria	3593
1336	Ga0496116_0131054	3300048919	Bacteria	1429
1337	Ga0496117_0002373	3300048920	Bacteria	24010
1338	Ga0496117_0007298	3300048920	Bacteria	10860
1339	Ga0496117_0018516	3300048920	Bacteria	5762
1340	Ga0496117_0018978	3300048920	Bacteria	5668
1341	Ga0496117_0023927	3300048920	Bacteria	4849
1342	Ga0496117_0036246	3300048920	Bacteria	3693
1343	Ga0496117_0047138	3300048920	Bacteria	3094
1344	Ga0496117_0118652	3300048920	Bacteria	1630
1345	Ga0496117_0144823	3300048920	Bacteria	1416
1346	Ga0496117_0236909	3300048920	Bacteria	1004
1347	Ga0496118_0004346	3300048921	Bacteria	16869
1348	Ga0496118_0019359	3300048921	Bacteria	6086
1349	Ga0496118_0031366	3300048921	Bacteria	4407
1350	Ga0496118_0034014	3300048921	Bacteria	4169
1351	Ga0496118_0041389	3300048921	Bacteria	3648
1352	Ga0496118_0064444	3300048921	Bacteria	2689
1353	Ga0496118_0085212	3300048921	Bacteria	2201
1354	Ga0496118_0147697	3300048921	Bacteria	1477
1355	Ga0496118_0150084	3300048921	Bacteria	1460
1356	Ga0496119_0000536	3300048922	Bacteria	51614
1357	Ga0496119_0183550	3300048922	Bacteria	1095
1358	Ga0496120_0002323	3300048923	Bacteria	19584
1359	Ga0496120_0076845	3300048923	Bacteria	1818
1360	Ga0496120_0204234	3300048923	Bacteria	954
1361	Ga0496121_0000505	3300048924	Bacteria	74599
1362	Ga0496121_0015365	3300048924	Bacteria	8028
1363	Ga0496121_0020861	3300048924	Bacteria	6455
1364	Ga0496121_0052342	3300048924	Bacteria	3430
1365	Ga0496121_0066940	3300048924	Bacteria	2914
1366	Ga0496121_0117410	3300048924	Bacteria	2016
1367	Ga0496121_0166028	3300048924	Bacteria	1609
1368	Ga0496121_0176115	3300048924	Bacteria	1548
1369	Ga0496122_0000945	3300048925	Bacteria	52642
1370	Ga0496122_0005538	3300048925	Bacteria	14992
1371	Ga0496122_0006020	3300048925	Bacteria	14148
1372	Ga0496122_0007437	3300048925	Bacteria	12172
1373	Ga0496122_0060147	3300048925	Bacteria	2800
1374	Ga0496122_0123740	3300048925	Bacteria	1661
1375	Ga0496122_0126741	3300048925	Bacteria	1632
1376	Ga0496123_0000437	3300048926	Bacteria	74882
1377	Ga0496123_0000888	3300048926	Bacteria	47314
1378	Ga0496123_0003233	3300048926	Bacteria	18540
1379	Ga0496123_0025952	3300048926	Bacteria	4403
1380	Ga0496123_0060800	3300048926	Bacteria	2432
1381	Ga0496123_0100683	3300048926	Bacteria	1682
1382	Ga0496123_0137759	3300048926	Bacteria	1340
1383	Ga0496124_0000807	3300048927	Bacteria	50885
1384	Ga0496124_0004554	3300048927	Bacteria	16116
1385	Ga0496124_0008283	3300048927	Bacteria	10891
1386	Ga0496124_0010386	3300048927	Bacteria	9434
1387	Ga0496124_0010673	3300048927	Bacteria	9268
1388	Ga0496124_0018964	3300048927	Bacteria	6422
1389	Ga0496124_0078335	3300048927	Bacteria	2724
1390	Ga0496124_0095099	3300048927	Bacteria	2422
1391	Ga0496124_0095644	3300048927	Bacteria	2414
1392	Ga0496124_0156018	3300048927	Bacteria	1785
1393	Ga0496124_0160210	3300048927	Bacteria	1754
1394	Ga0496124_0173286	3300048927	Bacteria	1668
1395	Ga0496124_0182327	3300048927	Bacteria	1614
1396	Ga0496124_0321103	3300048927	Bacteria	1108
1397	Ga0496125_0000861	3300048928	Bacteria	48649
1398	Ga0496125_0016758	3300048928	Bacteria	7025
1399	Ga0496125_0041313	3300048928	Bacteria	3944
1400	Ga0496125_0049834	3300048928	Bacteria	3474
1401	Ga0496125_0082868	3300048928	Bacteria	2442
1402	Ga0496125_0097371	3300048928	Bacteria	2180
1403	Ga0496125_0137948	3300048928	Bacteria	1702
1404	Ga0496125_0172347	3300048928	Bacteria	1452
1405	Ga0496125_0179356	3300048928	Bacteria	1413
1406	Ga0496125_0309013	3300048928	Bacteria	964
1407	Ga0496126_0031973	3300048929	Bacteria	4964
1408	Ga0496126_0256089	3300048929	Bacteria	1457
1409	Ga0496126_0283466	3300048929	Bacteria	1372
1410	Ga0495678_000033	3300049459	Bacteria	211804
1411	Ga0495678_002996	3300049459	Bacteria	10766
1412	Ga0495678_007050	3300049459	Bacteria	5887
1413	Ga0495678_007571	3300049459	Bacteria	5608
1414	Ga0495678_008995	3300049459	Bacteria	4987
1415	Ga0495678_012399	3300049459	Bacteria	4045
1416	Ga0495678_015114	3300049459	Bacteria	3564
1417	Ga0495678_015250	3300049459	Bacteria	3543
1418	Ga0495678_016562	3300049459	Bacteria	3365
1419	Ga0495678_040305	3300049459	Bacteria	1878
1420	Ga0495678_044785	3300049459	Bacteria	1748
1421	Ga0495678_045075	3300049459	Bacteria	1741
1422	Ga0495678_048426	3300049459	Bacteria	1657
1423	Ga0495678_067619	3300049459	Bacteria	1319
1424	Ga0495678_089914	3300049459	Bacteria	1083
1425	Ga0495682_0000072	3300049460	Bacteria	93119
1426	Ga0495682_0000213	3300049460	Bacteria	46502
1427	Ga0495682_0001612	3300049460	Bacteria	11625
1428	Ga0495682_0022268	3300049460	Bacteria	2370
1429	Ga0495682_0024940	3300049460	Bacteria	2226
1430	Ga0495682_0026801	3300049460	Bacteria	2138
1431	Ga0495682_0032643	3300049460	Bacteria	1923
1432	Ga0501032_0000544	3300049569	Bacteria	30544
1433	Ga0501032_0015477	3300049569	Bacteria	5379
1434	Ga0501032_0074656	3300049569	Bacteria	2259
1435	Ga0501032_0103378	3300049569	Bacteria	1887
1436	Ga0501033_0010735	3300049570	Bacteria	7021
1437	Ga0501033_0113376	3300049570	Bacteria	1971
1438	Ga0501033_0300594	3300049570	Bacteria	1130
1439	Ga0501034_0000041	3300049571	Bacteria	229264
1440	Ga0501034_0022786	3300049571	Bacteria	6380
1441	Ga0501036_0027523	3300049572	Bacteria	4803
1442	Ga0501036_0034801	3300049572	Bacteria	4261
1443	Ga0501036_0181536	3300049572	Bacteria	1771
1444	Ga0501037_0002860	3300049573	Bacteria	12517
1445	Ga0501037_0020086	3300049573	Bacteria	4931
1446	Ga0501037_0049458	3300049573	Bacteria	3078
1447	Ga0501037_0116790	3300049573	Bacteria	1920
1448	Ga0501037_0145203	3300049573	Bacteria	1697
1449	Ga0501038_0003152	3300049574	Bacteria	15392
1450	Ga0501038_0023378	3300049574	Bacteria	5526
1451	Ga0501038_0036619	3300049574	Bacteria	4305
1452	Ga0501038_0069163	3300049574	Bacteria	2999
1453	Ga0501038_0231891	3300049574	Bacteria	1469
1454	Ga0501038_0344047	3300049574	Unclassified	1162
1455	Ga0501039_0012138	3300049575	Bacteria	6569
1456	Ga0501039_0204654	3300049575	Bacteria	1552
1457	Ga0501039_0262791	3300049575	Bacteria	1357
1458	Ga0501040_0000770	3300049576	Bacteria	19940
1459	Ga0501042_0069563	3300049578	Bacteria	2517
1460	Ga0501043_0040439	3300049579	Bacteria	3664
1461	Ga0501043_0072241	3300049579	Bacteria	2710
1462	Ga0501046_0032971	3300049580	Bacteria	4190
1463	Ga0501046_0058657	3300049580	Bacteria	3017
1464	Ga0501047_0028905	3300049581	Bacteria	5347
1465	Ga0501047_0159945	3300049581	Bacteria	2124
1466	Ga0501047_0411821	3300049581	Bacteria	1184
1467	Ga0501068_0178444	3300049584	Bacteria	1342
1468	Ga0501073_0004960	3300049589	Bacteria	9984
1469	Ga0501079_0105110	3300049741	Bacteria	2191
1470	Ga0501080_0002132	3300049742	Bacteria	17194
1471	Ga0501083_0011559	3300049744	Bacteria	6192
1472	Ga0501241_000578	3300049758	Bacteria	7863
1473	Ga0501035_0007405	3300049822	Bacteria	10254
1474	Ga0501035_0025130	3300049822	Bacteria	5461
1475	Ga0501035_0230568	3300049822	Bacteria	1578
1476	Ga0501044_0001523	3300049823	Bacteria	27175
1477	Ga0501044_0004461	3300049823	Bacteria	15650
1478	Ga0501044_0015312	3300049823	Bacteria	8260
1479	Ga0501045_0110258	3300049824	Bacteria	2040
1480	Ga0501226_000014	3300049853	Bacteria	166091
1481	nmdc:mga03683_43263_c1	3300050489	Bacteria	1857
1482	nmdc:mga09592_35615_c1	3300050508	Bacteria	4167
1483	nmdc:mga0qj67_42002_c1	3300050509	Bacteria	3599
1484	nmdc:mga06r32_4263_c1	3300050510	Bacteria	12804
1485	nmdc:mga08y16_8514_c1	3300050511	Bacteria	10743
1486	nmdc:mga08y16_95174_c1	3300050511	Bacteria	3102
1487	nmdc:mga0n895_670605_c1	3300050512	Bacteria	1034
1488	nmdc:mga08x19_277914_c1	3300050514	Bacteria	1160
1489	Ga0495612_0126842	3300053078	Bacteria	1100
1490	Ga0500572_026825	3300053111	Bacteria	1573
1491	Ga0500618_003225	3300053125	Bacteria	5682
1492	Ga0500618_022347	3300053125	Bacteria	1537
1493	Ga0500659_0013561	3300053135	Bacteria	4447
1494	Ga0500564_032295	3300053138	Bacteria	2414
1495	Ga0500586_171215	3300053145	Bacteria	730
1496	Ga0501084_0057454	3300054114	Bacteria	3256
1497	Ga0590071_005784	3300059421	Bacteria	2964
1498	Ga0590074_013959	3300059423	Bacteria	1358
1499	Ga0501082_0074396	3300060353	Bacteria	2926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046522	Ga0495643_0032593	Ga0495643_0032593_1787_2575	187
2	3300046616	Ga0495668_0082868	Ga0495668_0082868_354_1142	187
3	3300046665	Ga0495661_0020607	Ga0495661_0020607_905_1693	187
4	3300048907	Ga0496104_0410133	Ga0496104_0410133_322_1113	210
5	3300038741	Ga0400488_15610	Ga0400488_15610_1056_1700	212
6	3300048903	Ga0496100_0462024	Ga0496100_0462024_43_834	213
7	3300048904	Ga0496101_0336456	Ga0496101_0336456_306_1097	213
8	3300048917	Ga0496114_0000303	Ga0496114_0000303_27209_28000	213
9	3300048918	Ga0496115_0174592	Ga0496115_0174592_56_847	213
10	3300036401	Ga0373937_0042829	Ga0373937_0042829_2286_3074	214
11	3300046516	Ga0495628_0124008	Ga0495628_0124008_921_1709	214
12	3300053078	Ga0495612_0126842	Ga0495612_0126842_282_1070	214
13	3300048908	Ga0496105_0260500	Ga0496105_0260500_22_669	215
14	3300053125	Ga0500618_022347	Ga0500618_022347_866_1513	215
15	3300005334	Ga0068869_100092375	Ga0068869_1000923752	216
16	3300005549	Ga0070704_100723460	Ga0070704_1007234601	216
17	3300005564	Ga0070664_100207741	Ga0070664_1002077412	216
18	3300005577	Ga0068857_100135404	Ga0068857_1001354042	216
19	3300005614	Ga0068856_100331595	Ga0068856_1003315952	216
20	3300005842	Ga0068858_100427408	Ga0068858_1004274082	216
21	3300005844	Ga0068862_100157422	Ga0068862_1001574223	216
22	3300025945	Ga0207679_10073297	Ga0207679_100732972	216
23	3300026035	Ga0207703_10228664	Ga0207703_102286641	216
24	3300026067	Ga0207678_10270830	Ga0207678_102708301	216
25	3300026078	Ga0207702_10277184	Ga0207702_102771842	216
26	3300026116	Ga0207674_10238100	Ga0207674_102381003	216
27	3300028380	Ga0268265_10141061	Ga0268265_101410613	216
28	3300048905	Ga0496102_0335475	Ga0496102_0335475_178_972	216
29	3300005548	Ga0070665_100094764	Ga0070665_1000947644	217
30	3300005578	Ga0068854_100187329	Ga0068854_1001873293	217
31	3300005718	Ga0068866_10046005	Ga0068866_100460053	217
32	3300013296	Ga0157374_10051401	Ga0157374_100514013	217
33	3300025935	Ga0207709_10081037	Ga0207709_100810372	217
34	3300026121	Ga0207683_10096050	Ga0207683_100960503	217
35	3300028379	Ga0268266_10264200	Ga0268266_102642001	217
36	3300049822	Ga0501035_0230568	Ga0501035_0230568_29_688	218
37	3300014968	Ga0157379_10086468	Ga0157379_100864684	220
38	3300028381	Ga0268264_10176392	Ga0268264_101763922	220
39	3300046507	Ga0495606_0170421	Ga0495606_0170421_36_698	220
40	3300038443	Ga0395901_0555632	Ga0395901_0555632_11_799	221
41	3300046471	Ga0495650_0010761	Ga0495650_0010761_757_1542	221
42	3300046506	Ga0495583_0001185	Ga0495583_0001185_2633_3418	221
43	3300046512	Ga0495610_0011456	Ga0495610_0011456_4123_4908	221
44	3300046519	Ga0495632_0001503	Ga0495632_0001503_578_1363	221
45	3300046520	Ga0495637_0023034	Ga0495637_0023034_630_1415	221
46	3300046665	Ga0495661_0000208	Ga0495661_0000208_36804_37589	221
47	3300046810	Ga0495660_0142667	Ga0495660_0142667_21_806	221
48	3300048913	Ga0496110_0328304	Ga0496110_0328304_10_675	221
49	3300021361	Ga0213872_10001215	Ga0213872_100012152	222
50	3300036712	Ga0316584_0035907	Ga0316584_0035907_2948_3667	222
51	3300039447	Ga0436361_0880017	Ga0436361_0880017_1284_2063	222
52	3300005435	Ga0070714_100035000	Ga0070714_1000350002	223
53	3300025929	Ga0207664_10076600	Ga0207664_100766002	223
54	3300049569	Ga0501032_0074656	Ga0501032_0074656_931_1728	223
55	3300005615	Ga0070702_100388122	Ga0070702_1003881221	224
56	3300048907	Ga0496104_0234067	Ga0496104_0234067_250_1017	224
57	3300048911	Ga0496108_0466655	Ga0496108_0466655_56_823	224
58	3300048917	Ga0496114_0124852	Ga0496114_0124852_363_1130	224
59	3300009094	Ga0111539_10040342	Ga0111539_100403421	225
60	3300013104	Ga0157370_10070971	Ga0157370_100709714	225
61	3300046506	Ga0495583_0011883	Ga0495583_0011883_2452_3237	225
62	3300006173	Ga0070716_100438116	Ga0070716_1004381161	226
63	3300048912	Ga0496109_0240926	Ga0496109_0240926_134_922	226
64	3300048917	Ga0496114_0014654	Ga0496114_0014654_3258_4046	226
65	3300049572	Ga0501036_0034801	Ga0501036_0034801_1072_1878	226
66	3300049574	Ga0501038_0003152	Ga0501038_0003152_840_1646	226
67	3300049579	Ga0501043_0072241	Ga0501043_0072241_813_1619	226
68	3300049580	Ga0501046_0058657	Ga0501046_0058657_2271_3005	226
69	3300049822	Ga0501035_0025130	Ga0501035_0025130_487_1293	226
70	3300049823	Ga0501044_0001523	Ga0501044_0001523_7440_8246	226
71	3300050511	nmdc:mga08y16_95174_c1	nmdc:mga08y16_95174_c1_1142_1930	226
72	3300039437	Ga0436365_1279657	Ga0436365_1279657_6113_6901	227
73	3300044765	Ga0466970_0074937	Ga0466970_0074937_868_1656	228
74	3300049569	Ga0501032_0000544	Ga0501032_0000544_10214_11020	229
75	3300049569	Ga0501032_0015477	Ga0501032_0015477_3523_4329	229
76	3300049570	Ga0501033_0010735	Ga0501033_0010735_5227_6033	229
77	3300049570	Ga0501033_0113376	Ga0501033_0113376_987_1793	229
78	3300049572	Ga0501036_0027523	Ga0501036_0027523_1712_2518	229
79	3300049573	Ga0501037_0020086	Ga0501037_0020086_1865_2671	229
80	3300049573	Ga0501037_0049458	Ga0501037_0049458_216_1022	229
81	3300049573	Ga0501037_0145203	Ga0501037_0145203_348_1154	229
82	3300049574	Ga0501038_0023378	Ga0501038_0023378_324_1130	229
83	3300049574	Ga0501038_0344047	Ga0501038_0344047_179_985	229
84	3300049575	Ga0501039_0012138	Ga0501039_0012138_5209_6015	229
85	3300049576	Ga0501040_0000770	Ga0501040_0000770_17849_18655	229
86	3300049578	Ga0501042_0069563	Ga0501042_0069563_1247_2053	229
87	3300049579	Ga0501043_0040439	Ga0501043_0040439_464_1270	229
88	3300049580	Ga0501046_0032971	Ga0501046_0032971_3023_3829	229
89	3300049581	Ga0501047_0028905	Ga0501047_0028905_2261_3067	229
90	3300049584	Ga0501068_0178444	Ga0501068_0178444_517_1323	229
91	3300049822	Ga0501035_0007405	Ga0501035_0007405_5241_6047	229
92	3300049823	Ga0501044_0004461	Ga0501044_0004461_8088_8894	229
93	3300049824	Ga0501045_0110258	Ga0501045_0110258_106_912	229
94	3300046474	Ga0495605_0051001	Ga0495605_0051001_673_1458	231
95	3300046520	Ga0495637_0034309	Ga0495637_0034309_23_718	231
96	3300046524	Ga0495648_0067937	Ga0495648_0067937_1364_2059	231
97	3300046530	Ga0495654_0251481	Ga0495654_0251481_20_715	231
98	3300046660	Ga0495625_0304113	Ga0495625_0304113_301_996	231
99	3300049570	Ga0501033_0300594	Ga0501033_0300594_279_1076	231
100	3300053145	Ga0500586_171215	Ga0500586_171215_15_710	231
101	3300037471	Ga0395905_0002001	Ga0395905_0002001_12296_13057	232
102	3300049574	Ga0501038_0231891	Ga0501038_0231891_646_1428	232
103	3300005841	Ga0068863_100130245	Ga0068863_1001302452	233
104	3300038735	Ga0400485_08390	Ga0400485_08390_1114_1821	233
105	3300041405	Ga0439438_025999	Ga0439438_025999_840_1568	233
106	3300046501	Ga0495607_0152553	Ga0495607_0152553_377_1162	233
107	3300046522	Ga0495643_0110464	Ga0495643_0110464_472_1173	233
108	3300046538	Ga0495609_0000187	Ga0495609_0000187_7600_8385	233
109	3300042876	Ga0451577_0000013	Ga0451577_0000013_260882_261670	234
110	3300044673	Ga0453683_0000033	Ga0453683_0000033_139725_140513	234
111	3300044712	Ga0453684_0000085	Ga0453684_0000085_136148_136936	234
112	3300045051	Ga0451576_0000018	Ga0451576_0000018_289020_289808	234
113	3300046474	Ga0495605_0050199	Ga0495605_0050199_20_724	234
114	3300045051	Ga0451576_0025846	Ga0451576_0025846_1527_2315	235
115	3300039062	Ga0400483_015059	Ga0400483_015059_261_1040	236
116	3300046522	Ga0495643_0000272	Ga0495643_0000272_5763_6539	236
117	3300046692	Ga0495671_0001786	Ga0495671_0001786_9758_10534	236
118	3300047472	Ga0495686_0203436	Ga0495686_0203436_261_1037	236
119	3300005563	Ga0068855_100140638	Ga0068855_1001406383	238
120	3300005842	Ga0068858_100009868	Ga0068858_1000098684	238
121	3300014325	Ga0163163_10008768	Ga0163163_100087686	238
122	3300026035	Ga0207703_10023685	Ga0207703_100236852	238
123	3300032005	Ga0307411_10447515	Ga0307411_104475152	238
124	3300013104	Ga0157370_10096674	Ga0157370_100966744	239
125	3300044712	Ga0453684_0000029	Ga0453684_0000029_106214_107002	239
126	3300046694	Ga0495649_0040077	Ga0495649_0040077_361_1137	239
127	3300038741	Ga0400488_35305	Ga0400488_35305_2487_3266	240
128	3300042016	Ga0439463_001311	Ga0439463_001311_2837_3622	240
129	3300048919	Ga0496116_0001765	Ga0496116_0001765_18490_19275	240
130	3300006871	Ga0075434_100487026	Ga0075434_1004870262	241
131	3300031727	Ga0316576_10002240	Ga0316576_100022409	241
132	3300031727	Ga0316576_10005681	Ga0316576_100056813	241
133	3300031727	Ga0316576_10332176	Ga0316576_103321762	241
134	3300031728	Ga0316578_10025352	Ga0316578_100253522	241
135	3300031728	Ga0316578_10054629	Ga0316578_100546292	241
136	3300035398	Ga0316574_0008371	Ga0316574_0008371_524_1300	241
137	3300036647	Ga0316582_0095316	Ga0316582_0095316_44_820	241
138	3300005288	Ga0065714_10072608	Ga0065714_100726082	242
139	3300009011	Ga0105251_10006170	Ga0105251_100061703	242
140	3300009036	Ga0105244_10152739	Ga0105244_101527392	242
141	3300013100	Ga0157373_10183690	Ga0157373_101836903	242
142	3300013102	Ga0157371_10006553	Ga0157371_1000655312	242
143	3300013105	Ga0157369_10020226	Ga0157369_100202263	242
144	3300013307	Ga0157372_10002134	Ga0157372_100021345	242
145	3300013307	Ga0157372_10498152	Ga0157372_104981523	242
146	3300025728	Ga0207655_1024406	Ga0207655_10244065	242
147	3300027312	Ga0209371_1014573	Ga0209371_10145732	242
148	3300030500	Ga0268256_1006182	Ga0268256_10061824	242
149	3300031250	Ga0265331_10018195	Ga0265331_100181952	242
150	3300031251	Ga0265327_10000065	Ga0265327_10000065166	242
151	3300041407	Ga0439447_066602	Ga0439447_066602_75_803	242
152	3300042013	Ga0439456_020087	Ga0439456_020087_653_1381	242
153	3300046460	Ga0495638_0010589	Ga0495638_0010589_15_743	242
154	3300046474	Ga0495605_0007134	Ga0495605_0007134_3153_3884	242
155	3300046474	Ga0495605_0067482	Ga0495605_0067482_938_1666	242
156	3300046492	Ga0495585_0011164	Ga0495585_0011164_13_741	242
157	3300046506	Ga0495583_0085198	Ga0495583_0085198_10_738	242
158	3300048905	Ga0496102_0572291	Ga0496102_0572291_27_755	242
159	3300048922	Ga0496119_0000536	Ga0496119_0000536_22783_23559	242
160	3300048923	Ga0496120_0002323	Ga0496120_0002323_9849_10625	242
161	3300048923	Ga0496120_0204234	Ga0496120_0204234_23_751	242
162	3300048924	Ga0496121_0166028	Ga0496121_0166028_592_1368	242
163	3300005468	Ga0070707_100192415	Ga0070707_1001924152	244
164	3300005536	Ga0070697_100572080	Ga0070697_1005720802	244
165	3300005549	Ga0070704_100261885	Ga0070704_1002618851	244
166	3300009094	Ga0111539_10019233	Ga0111539_1001923310	244
167	3300027907	Ga0207428_10124641	Ga0207428_101246412	244
168	3300031548	Ga0307408_100514716	Ga0307408_1005147161	244
169	3300032005	Ga0307411_10124138	Ga0307411_101241381	244
170	3300035172	Ga0373955_0045391	Ga0373955_0045391_1296_2084	244
171	3300046454	Ga0495592_0203159	Ga0495592_0203159_371_1159	244
172	3300046474	Ga0495605_0000047	Ga0495605_0000047_102429_103217	244
173	3300046499	Ga0495594_0259413	Ga0495594_0259413_100_888	244
174	3300046516	Ga0495628_0014937	Ga0495628_0014937_705_1493	244
175	3300046517	Ga0495630_0060721	Ga0495630_0060721_322_1110	244
176	3300046517	Ga0495630_0064876	Ga0495630_0064876_1660_2448	244
177	3300046533	Ga0495640_0049330	Ga0495640_0049330_1162_1950	244
178	3300046535	Ga0495586_0002705	Ga0495586_0002705_2041_2829	244
179	3300046642	Ga0495634_0153915	Ga0495634_0153915_597_1385	244
180	3300046683	Ga0495658_0074888	Ga0495658_0074888_610_1398	244
181	3300046689	Ga0495613_0407986	Ga0495613_0407986_11_799	244
182	3300050511	nmdc:mga08y16_8514_c1	nmdc:mga08y16_8514_c1_8180_8968	244
183	3300050512	nmdc:mga0n895_670605_c1	nmdc:mga0n895_670605_c1_168_962	244
184	3300031824	Ga0307413_10170869	Ga0307413_101708692	245
185	3300031995	Ga0307409_100169363	Ga0307409_1001693632	245
186	3300005288	Ga0065714_10070393	Ga0065714_100703932	246
187	3300006177	Ga0075362_10057084	Ga0075362_100570843	246
188	3300006914	Ga0075436_100136468	Ga0075436_1001364683	246
189	3300006946	Ga0079104_1001214	Ga0079104_10012146	246
190	3300027111	Ga0209281_1000174	Ga0209281_100017466	246
191	3300031251	Ga0265327_10011016	Ga0265327_100110162	246
192	3300047470	Ga0495681_0006105	Ga0495681_0006105_2301_3083	246
193	3300048922	Ga0496119_0183550	Ga0496119_0183550_188_964	246
194	3300048923	Ga0496120_0076845	Ga0496120_0076845_447_1223	246
195	3300050489	nmdc:mga03683_43263_c1	nmdc:mga03683_43263_c1_937_1719	246
196	3300050514	nmdc:mga08x19_277914_c1	nmdc:mga08x19_277914_c1_359_1141	246
197	3300005262	Ga0065165_1003619	Ga0065165_100361911	247
198	3300005347	Ga0070668_100075816	Ga0070668_1000758162	247
199	3300005353	Ga0070669_100272577	Ga0070669_1002725773	247
200	3300005356	Ga0070674_100021390	Ga0070674_1000213902	247
201	3300005459	Ga0068867_100023879	Ga0068867_1000238793	247
202	3300005543	Ga0070672_100021732	Ga0070672_1000217323	247
203	3300005548	Ga0070665_100347830	Ga0070665_1003478302	247
204	3300005718	Ga0068866_10002548	Ga0068866_1000254810	247
205	3300005719	Ga0068861_100010826	Ga0068861_1000108263	247
206	3300005842	Ga0068858_100118037	Ga0068858_1001180373	247
207	3300005843	Ga0068860_100001710	Ga0068860_10000171028	247
208	3300005844	Ga0068862_100031831	Ga0068862_1000318315	247
209	3300005844	Ga0068862_100036098	Ga0068862_1000360983	247
210	3300006353	Ga0075370_10000524	Ga0075370_100005246	247
211	3300006358	Ga0068871_100224738	Ga0068871_1002247382	247
212	3300006881	Ga0068865_100193502	Ga0068865_1001935022	247
213	3300009011	Ga0105251_10018136	Ga0105251_100181364	247
214	3300009148	Ga0105243_10040342	Ga0105243_100403423	247
215	3300009148	Ga0105243_10107737	Ga0105243_101077374	247
216	3300009176	Ga0105242_10140834	Ga0105242_101408343	247
217	3300009553	Ga0105249_10042407	Ga0105249_100424076	247
218	3300011119	Ga0105246_10214448	Ga0105246_102144481	247
219	3300013297	Ga0157378_10020973	Ga0157378_100209738	247
220	3300013306	Ga0163162_10024300	Ga0163162_100243008	247
221	3300013306	Ga0163162_10143382	Ga0163162_101433822	247
222	3300013307	Ga0157372_10507343	Ga0157372_105073432	247
223	3300014326	Ga0157380_10067995	Ga0157380_100679952	247
224	3300014968	Ga0157379_10096959	Ga0157379_100969595	247
225	3300025728	Ga0207655_1000825	Ga0207655_100082515	247
226	3300025735	Ga0207713_1017866	Ga0207713_10178664	247
227	3300025899	Ga0207642_10002846	Ga0207642_100028468	247
228	3300025907	Ga0207645_10132647	Ga0207645_101326472	247
229	3300025923	Ga0207681_10304370	Ga0207681_103043701	247
230	3300025933	Ga0207706_10014450	Ga0207706_1001445011	247
231	3300025935	Ga0207709_10027125	Ga0207709_100271255	247
232	3300025935	Ga0207709_10170426	Ga0207709_101704262	247
233	3300025937	Ga0207669_10268812	Ga0207669_102688122	247
234	3300025938	Ga0207704_10026295	Ga0207704_100262952	247
235	3300025940	Ga0207691_10012813	Ga0207691_100128133	247
236	3300025972	Ga0207668_10061346	Ga0207668_100613463	247
237	3300026067	Ga0207678_10073289	Ga0207678_100732893	247
238	3300026089	Ga0207648_10000439	Ga0207648_1000043941	247
239	3300026118	Ga0207675_100013133	Ga0207675_10001313310	247
240	3300026118	Ga0207675_100337700	Ga0207675_1003377002	247
241	3300028380	Ga0268265_10030477	Ga0268265_100304773	247
242	3300028380	Ga0268265_10122583	Ga0268265_101225832	247
243	3300028381	Ga0268264_10013375	Ga0268264_100133754	247
244	3300028786	Ga0307517_10026165	Ga0307517_100261655	247
245	3300031456	Ga0307513_10020857	Ga0307513_100208575	247
246	3300032004	Ga0307414_10234268	Ga0307414_102342682	247
247	3300035695	Ga0373927_0299370	Ga0373927_0299370_278_1039	247
248	3300037068	Ga0373925_0034844	Ga0373925_0034844_844_1605	247
249	3300041404	Ga0439436_0009859	Ga0439436_0009859_1685_2461	247
250	3300041405	Ga0439438_008224	Ga0439438_008224_800_1576	247
251	3300041407	Ga0439447_029549	Ga0439447_029549_409_1185	247
252	3300042006	Ga0439432_006716	Ga0439432_006716_481_1257	247
253	3300042010	Ga0439452_026007	Ga0439452_026007_500_1276	247
254	3300042012	Ga0439455_0031169	Ga0439455_0031169_278_1039	247
255	3300042156	Ga0439446_0011393	Ga0439446_0011393_704_1480	247
256	3300042435	Ga0439434_0007032	Ga0439434_0007032_232_1008	247
257	3300042876	Ga0451577_0219365	Ga0451577_0219365_697_1458	247
258	3300044658	Ga0466972_0046599	Ga0466972_0046599_736_1497	247
259	3300044693	Ga0466961_0043879	Ga0466961_0043879_378_1139	247
260	3300044712	Ga0453684_0131943	Ga0453684_0131943_102_863	247
261	3300045051	Ga0451576_0016908	Ga0451576_0016908_3700_4461	247
262	3300048920	Ga0496117_0007298	Ga0496117_0007298_7800_8576	247
263	3300048927	Ga0496124_0010673	Ga0496124_0010673_6189_6965	247
264	3300048927	Ga0496124_0078335	Ga0496124_0078335_1538_2323	247
265	3300048928	Ga0496125_0049834	Ga0496125_0049834_432_1208	247
266	3300049581	Ga0501047_0411821	Ga0501047_0411821_37_798	247
267	3300059421	Ga0590071_005784	Ga0590071_005784_587_1348	247
268	3300059423	Ga0590074_013959	Ga0590074_013959_401_1162	247
269	3300003347	JGI26128J50194_1000847	JGI26128J50194_10008471	248
270	3300009092	Ga0105250_10021202	Ga0105250_100212023	249
271	3300027907	Ga0207428_10223990	Ga0207428_102239902	249
272	3300042461	Ga0439460_0001560	Ga0439460_0001560_2224_3006	249
273	3300046526	Ga0495666_0028873	Ga0495666_0028873_470_1255	249
274	3300046536	Ga0495587_0009417	Ga0495587_0009417_4828_5613	249
275	3300046558	Ga0495633_0079139	Ga0495633_0079139_152_934	249
276	3300046642	Ga0495634_0048385	Ga0495634_0048385_294_1079	249
277	3300046663	Ga0495635_0051084	Ga0495635_0051084_1758_2543	249
278	3300047317	Ga0495604_0026431	Ga0495604_0026431_1002_1787	249
279	3300047319	Ga0495674_0095378	Ga0495674_0095378_251_1036	249
280	3300047322	Ga0495680_0039482	Ga0495680_0039482_263_1048	249
281	3300048905	Ga0496102_0018098	Ga0496102_0018098_2618_3403	249
282	3300048921	Ga0496118_0034014	Ga0496118_0034014_198_983	249
283	3300006846	Ga0075430_100109826	Ga0075430_1001098263	250
284	3300006847	Ga0075431_100003695	Ga0075431_10000369511	250
285	3300006880	Ga0075429_100007951	Ga0075429_1000079517	250
286	3300013102	Ga0157371_10011640	Ga0157371_100116403	250
287	3300015265	Ga0182005_1050825	Ga0182005_10508251	250
288	3300027424	Ga0209984_1000270	Ga0209984_10002707	250
289	3300027471	Ga0209995_1002759	Ga0209995_10027593	250
290	3300027543	Ga0209999_1005222	Ga0209999_10052222	250
291	3300027665	Ga0209983_1003420	Ga0209983_10034203	250
292	3300027876	Ga0209974_10003574	Ga0209974_100035744	250
293	3300038735	Ga0400485_07089	Ga0400485_07089_18847_19638	250
294	3300038741	Ga0400488_24090	Ga0400488_24090_16075_16866	250
295	3300038742	Ga0400486_00736	Ga0400486_00736_16075_16866	250
296	3300039062	Ga0400483_163278	Ga0400483_163278_1020_1799	250
297	3300039110	Ga0400487_31982	Ga0400487_31982_17842_18633	250
298	3300046474	Ga0495605_0050995	Ga0495605_0050995_1100_1885	250
299	3300049459	Ga0495678_040305	Ga0495678_040305_737_1519	250
300	3300050508	nmdc:mga09592_35615_c1	nmdc:mga09592_35615_c1_13_786	250
301	3300050509	nmdc:mga0qj67_42002_c1	nmdc:mga0qj67_42002_c1_95_868	250
302	3300050510	nmdc:mga06r32_4263_c1	nmdc:mga06r32_4263_c1_2325_3098	250
303	3300006058	Ga0075432_10048795	Ga0075432_100487953	251
304	3300017792	Ga0163161_10093843	Ga0163161_100938433	251
305	3300025728	Ga0207655_1037736	Ga0207655_10377362	251
306	3300027907	Ga0207428_10028426	Ga0207428_100284265	251
307	3300041405	Ga0439438_006824	Ga0439438_006824_2244_3026	251
308	3300042010	Ga0439452_011131	Ga0439452_011131_415_1197	251
309	3300042138	Ga0450903_003594	Ga0450903_003594_1318_2100	251
310	3300042146	Ga0450907_020453	Ga0450907_020453_233_1015	251
311	3300046452	Ga0495617_005844	Ga0495617_005844_1759_2541	251
312	3300046460	Ga0495638_0056369	Ga0495638_0056369_174_956	251
313	3300046491	Ga0495584_0007770	Ga0495584_0007770_4531_5316	251
314	3300046491	Ga0495584_0027603	Ga0495584_0027603_1787_2569	251
315	3300046501	Ga0495607_0150582	Ga0495607_0150582_340_1122	251
316	3300046512	Ga0495610_0008711	Ga0495610_0008711_3558_4340	251
317	3300046515	Ga0495620_0037121	Ga0495620_0037121_1327_2109	251
318	3300046520	Ga0495637_0027077	Ga0495637_0027077_311_1093	251
319	3300046524	Ga0495648_0117279	Ga0495648_0117279_229_1011	251
320	3300046530	Ga0495654_0043519	Ga0495654_0043519_264_1046	251
321	3300046660	Ga0495625_0028954	Ga0495625_0028954_544_1326	251
322	3300046691	Ga0495670_0027884	Ga0495670_0027884_1718_2500	251
323	3300046692	Ga0495671_0157130	Ga0495671_0157130_88_870	251
324	3300046694	Ga0495649_0021252	Ga0495649_0021252_2756_3538	251
325	3300046794	Ga0495589_0026864	Ga0495589_0026864_1655_2437	251
326	3300047323	Ga0495683_0007287	Ga0495683_0007287_2277_3059	251
327	3300047443	Ga0495687_010990	Ga0495687_010990_1835_2617	251
328	3300047470	Ga0495681_0027875	Ga0495681_0027875_409_1191	251
329	3300047472	Ga0495686_0021370	Ga0495686_0021370_1229_2011	251
330	iso_pu_bacteria	2690315857	2691331740	251
331	iso_pu_bacteria	2887630918	2887632366	251
332	iso_pu_bacteria	2916178963	2916181165	251
333	iso_pu_bacteria	2919534386	2919536999	251
334	iso_pu_bacteria	2919688452	2919688611	251
335	iso_pu_bacteria	637000220	637318992	251
336	3300039062	Ga0400483_091971	Ga0400483_091971_192_971	252
337	3300039062	Ga0400483_172133	Ga0400483_172133_1363_2142	252
338	iso_pu_bacteria	8001522603	8001523369	252
339	iso_pu_bacteria	8002745576	8002746424	252
340	3300046460	Ga0495638_0056709	Ga0495638_0056709_222_1004	253
341	iso_pu_bacteria	2565956521	2566035718	253
342	iso_pu_bacteria	2648501241	2649122610	253
343	iso_pu_bacteria	2651869818	2652974066	253
344	iso_pu_bacteria	2808606384	2808971279	253
345	iso_pu_bacteria	2808606390	2809006337	253
346	iso_pu_bacteria	2808606391	2809013246	253
347	iso_pu_bacteria	2919493220	2919494181	253
348	iso_pu_bacteria	2919497567	2919498514	253
349	iso_pu_bacteria	2919543075	2919543813	253
350	iso_pu_bacteria	2923525760	2923527663	253
351	iso_pu_bacteria	8054357960	8054358469	253
352	3300001915	JGI24741J21665_1007627	JGI24741J21665_10076272	254
353	3300005288	Ga0065714_10009867	Ga0065714_100098676	254
354	3300005288	Ga0065714_10066919	Ga0065714_100669192	254
355	3300005353	Ga0070669_100006984	Ga0070669_1000069842	254
356	3300005457	Ga0070662_100000056	Ga0070662_10000005614	254
357	3300005539	Ga0068853_100000855	Ga0068853_1000008558	254
358	3300005578	Ga0068854_100006137	Ga0068854_1000061378	254
359	3300005834	Ga0068851_10000028	Ga0068851_1000002859	254
360	3300009011	Ga0105251_10001570	Ga0105251_1000157015	254
361	3300009148	Ga0105243_10440538	Ga0105243_104405382	254
362	3300013105	Ga0157369_10037127	Ga0157369_100371276	254
363	3300025321	Ga0207656_10000119	Ga0207656_100001193	254
364	3300025735	Ga0207713_1008180	Ga0207713_10081806	254
365	3300025923	Ga0207681_10001458	Ga0207681_100014589	254
366	3300025933	Ga0207706_10003017	Ga0207706_1000301713	254
367	3300025945	Ga0207679_10168035	Ga0207679_101680353	254
368	3300025981	Ga0207640_10071381	Ga0207640_100713812	254
369	3300026041	Ga0207639_10001808	Ga0207639_100018082	254
370	iso_pu_bacteria	2510065053	2510281295	254
371	iso_pu_bacteria	2510065055	2510294419	254
372	iso_pu_bacteria	2510065058	2510309443	254
373	iso_pu_bacteria	2511231024	2511374725	254
374	iso_pu_bacteria	2554235132	2554816288	254
375	iso_pu_bacteria	2554235231	2555247903	254
376	iso_pu_bacteria	2599185212	2599615680	254
377	iso_pu_bacteria	2599185302	2599941916	254
378	iso_pu_bacteria	2599185304	2599952564	254
379	iso_pu_bacteria	2599185309	2599982080	254
380	iso_pu_bacteria	2599185310	2599987990	254
381	iso_pu_bacteria	2599185312	2599998120	254
382	iso_pu_bacteria	2599185316	2600025488	254
383	iso_pu_bacteria	2599185317	2600030372	254
384	iso_pu_bacteria	2599185318	2600034527	254
385	iso_pu_bacteria	2599185320	2600046318	254
386	iso_pu_bacteria	2599185322	2600057695	254
387	iso_pu_bacteria	2599185325	2600078806	254
388	iso_pu_bacteria	2600254930	2600360804	254
389	iso_pu_bacteria	2600254954	2600446778	254
390	iso_pu_bacteria	2600255389	2602010684	254
391	iso_pu_bacteria	2606217733	2608380312	254
392	iso_pu_bacteria	2651869719	2652544712	254
393	iso_pu_bacteria	2667528176	2671125889	254
394	iso_pu_bacteria	2721755763	2723879815	254
395	iso_pu_bacteria	2728369097	2729148349	254
396	iso_pu_bacteria	2738543020	2739287783	254
397	iso_pu_bacteria	2738543021	2739293095	254
398	iso_pu_bacteria	2765235841	2765582795	254
399	iso_pu_bacteria	2773857672	2774131676	254
400	iso_pu_bacteria	2806310737	2807409461	254
401	iso_pu_bacteria	2806310745	2807457762	254
402	iso_pu_bacteria	2808606361	2808856107	254
403	iso_pu_bacteria	2808606373	2808904073	254
404	iso_pu_bacteria	2808606376	2808923575	254
405	iso_pu_bacteria	2808606378	2808936142	254
406	iso_pu_bacteria	2808606379	2808939219	254
407	iso_pu_bacteria	2808606380	2808945662	254
408	iso_pu_bacteria	2808606383	2808964612	254
409	iso_pu_bacteria	2808606389	2808999500	254
410	iso_pu_bacteria	2811994881	2812365888	254
411	iso_pu_bacteria	2823421272	2823423247	254
412	iso_pu_bacteria	2842805378	2842809578	254
413	iso_pu_bacteria	2842854478	2842854541	254
414	iso_pu_bacteria	2912963787	2912965338	254
415	iso_pu_bacteria	2913036834	2913038459	254
416	iso_pu_bacteria	2917832318	2917833536	254
417	iso_pu_bacteria	2919125081	2919129438	254
418	iso_pu_bacteria	2919155634	2919157730	254
419	iso_pu_bacteria	2919501602	2919505399	254
420	iso_pu_bacteria	2923519811	2923519909	254
421	iso_pu_bacteria	2926063275	2926067076	254
422	iso_pu_bacteria	2939651529	2939655162	254
423	iso_pu_bacteria	2945961074	2945965212	254
424	iso_pu_bacteria	2952252522	2952252975	254
425	iso_pu_bacteria	2974298342	2974300796	254
426	iso_pu_bacteria	2984499530	2984503266	254
427	iso_pu_bacteria	2984504281	2984508260	254
428	iso_pu_bacteria	2990196909	2990198870	254
429	iso_pu_bacteria	3007252601	3007256784	254
430	iso_pu_bacteria	3007315729	3007318976	254
431	iso_pu_bacteria	3007803356	3007805274	254
432	iso_pu_bacteria	3007866637	3007870445	254
433	iso_pu_bacteria	3007872151	3007875615	254
434	iso_pu_bacteria	640427133	640488519	254
435	iso_pu_bacteria	651053060	651176556	254
436	iso_pu_bacteria	8011350971	8011354418	254
437	iso_pu_bacteria	8016728285	8016729533	254
438	iso_pu_bacteria	8034962539	8034963836	254
439	iso_pu_bacteria	8052494512	8052498477	254
440	iso_pu_bacteria	8054929484	8054930120	254
441	iso_pu_bacteria	8055878733	8055879022	254
442	iso_pu_bacteria	8056115690	8056119782	254
443	iso_pu_bacteria	8056120720	8056122383	254
444	iso_pu_bacteria	8056137416	8056141409	254
445	iso_pu_bacteria	8056143049	8056147373	254
446	3300013100	Ga0157373_10001490	Ga0157373_1000149015	255
447	3300031852	Ga0307410_10093591	Ga0307410_100935913	255
448	3300032002	Ga0307416_100151409	Ga0307416_1001514093	255
449	3300032005	Ga0307411_10070087	Ga0307411_100700873	255
450	3300039062	Ga0400483_082194	Ga0400483_082194_682_1455	255
451	3300046457	Ga0495590_0003161	Ga0495590_0003161_586_1368	255
452	3300046474	Ga0495605_0016876	Ga0495605_0016876_856_1623	255
453	3300005331	Ga0070670_100000001	Ga0070670_100000001623	256
454	3300005335	Ga0070666_10108059	Ga0070666_101080591	256
455	3300005355	Ga0070671_100000018	Ga0070671_10000001811	256
456	3300005367	Ga0070667_100000331	Ga0070667_10000033155	256
457	3300005466	Ga0070685_10000049	Ga0070685_1000004927	256
458	3300005548	Ga0070665_100011945	Ga0070665_1000119454	256
459	3300005617	Ga0068859_100027399	Ga0068859_1000273993	256
460	3300005618	Ga0068864_100000012	Ga0068864_100000012265	256
461	3300005842	Ga0068858_100205480	Ga0068858_1002054802	256
462	3300005844	Ga0068862_100005719	Ga0068862_10000571914	256
463	3300006931	Ga0097620_100027400	Ga0097620_1000274003	256
464	3300009101	Ga0105247_10155629	Ga0105247_101556292	256
465	3300009177	Ga0105248_10104051	Ga0105248_101040513	256
466	3300014325	Ga0163163_10000162	Ga0163163_1000016256	256
467	3300025903	Ga0207680_10082488	Ga0207680_100824882	256
468	3300025925	Ga0207650_10000002	Ga0207650_100000021298	256
469	3300025931	Ga0207644_10000065	Ga0207644_1000006586	256
470	3300025941	Ga0207711_10001164	Ga0207711_1000116413	256
471	3300025986	Ga0207658_10000001	Ga0207658_1000000157	256
472	3300026035	Ga0207703_10698584	Ga0207703_106985841	256
473	3300026095	Ga0207676_10000001	Ga0207676_100000011298	256
474	3300028379	Ga0268266_10048922	Ga0268266_100489226	256
475	3300028380	Ga0268265_10000388	Ga0268265_1000038833	256
476	3300028381	Ga0268264_10000061	Ga0268264_1000006152	256
477	3300031250	Ga0265331_10033698	Ga0265331_100336983	256
478	3300031251	Ga0265327_10000257	Ga0265327_1000025777	256
479	3300039062	Ga0400483_036281	Ga0400483_036281_567_1355	256
480	3300048927	Ga0496124_0004554	Ga0496124_0004554_11050_11820	256
481	3300048928	Ga0496125_0097371	Ga0496125_0097371_655_1425	256
482	3300048929	Ga0496126_0256089	Ga0496126_0256089_553_1323	256
483	3300049571	Ga0501034_0022786	Ga0501034_0022786_5473_6246	256
484	3300049572	Ga0501036_0181536	Ga0501036_0181536_73_846	256
485	3300049573	Ga0501037_0002860	Ga0501037_0002860_6454_7227	256
486	3300049574	Ga0501038_0069163	Ga0501038_0069163_17_790	256
487	3300049575	Ga0501039_0204654	Ga0501039_0204654_546_1319	256
488	3300049581	Ga0501047_0159945	Ga0501047_0159945_206_979	256
489	3300049589	Ga0501073_0004960	Ga0501073_0004960_3821_4594	256
490	3300049741	Ga0501079_0105110	Ga0501079_0105110_268_1041	256
491	3300049742	Ga0501080_0002132	Ga0501080_0002132_10850_11623	256
492	3300049744	Ga0501083_0011559	Ga0501083_0011559_246_1019	256
493	3300049823	Ga0501044_0015312	Ga0501044_0015312_5092_5865	256
494	3300054114	Ga0501084_0057454	Ga0501084_0057454_2197_2970	256
495	3300060353	Ga0501082_0074396	Ga0501082_0074396_993_1766	256
496	iso_pu_bacteria	2511231004	2511252459	256
497	iso_pu_bacteria	2511231006	2511263917	256
498	iso_pu_bacteria	2511231007	2511272065	256
499	iso_pu_bacteria	2511231014	2511312199	256
500	iso_pu_bacteria	2511231016	2511324521	256
501	iso_pu_bacteria	2511231017	2511334399	256
502	iso_pu_bacteria	2511231020	2511352325	256
503	iso_pu_bacteria	2511231022	2511363648	256
504	iso_pu_bacteria	2511231156	2511823566	256
505	iso_pu_bacteria	2512047018	2512324920	256
506	iso_pu_bacteria	2554235341	2555668634	256
507	iso_pu_bacteria	2582580891	2583791045	256
508	iso_pu_bacteria	2597489887	2597856810	256
509	iso_pu_bacteria	2599185160	2599357004	256
510	iso_pu_bacteria	2599185161	2599362209	256
511	iso_pu_bacteria	2599185162	2599368529	256
512	iso_pu_bacteria	2599185163	2599375318	256
513	iso_pu_bacteria	2599185164	2599382109	256
514	iso_pu_bacteria	2599185165	2599388556	256
515	iso_pu_bacteria	2599185166	2599394176	256
516	iso_pu_bacteria	2599185168	2599405941	256
517	iso_pu_bacteria	2599185181	2599464491	256
518	iso_pu_bacteria	2599185182	2599468815	256
519	iso_pu_bacteria	2599185185	2599483833	256
520	iso_pu_bacteria	2599185186	2599493514	256
521	iso_pu_bacteria	2599185188	2599504057	256
522	iso_pu_bacteria	2599185248	2599770157	256
523	iso_pu_bacteria	2599185257	2599801479	256
524	iso_pu_bacteria	2599185289	2599887643	256
525	iso_pu_bacteria	2599185291	2599899878	256
526	iso_pu_bacteria	2599185300	2599932018	256
527	iso_pu_bacteria	2599185305	2599960455	256
528	iso_pu_bacteria	2599185306	2599965361	256
529	iso_pu_bacteria	2599185308	2599978500	256
530	iso_pu_bacteria	2599185311	2599995692	256
531	iso_pu_bacteria	2599185313	2600008597	256
532	iso_pu_bacteria	2599185314	2600010593	256
533	iso_pu_bacteria	2599185315	2600017505	256
534	iso_pu_bacteria	2599185319	2600041634	256
535	iso_pu_bacteria	2599185321	2600052329	256
536	iso_pu_bacteria	2599185323	2600065098	256
537	iso_pu_bacteria	2599185324	2600073725	256
538	iso_pu_bacteria	2599185356	2600216768	256
539	iso_pu_bacteria	2600254931	2600365780	256
540	iso_pu_bacteria	2600255313	2601776635	256
541	iso_pu_bacteria	2623620446	2624493608	256
542	iso_pu_bacteria	2643221589	2643952537	256
543	iso_pu_bacteria	2643221602	2644022299	256
544	iso_pu_bacteria	2643221633	2644187191	256
545	iso_pu_bacteria	2643221650	2644281748	256
546	iso_pu_bacteria	2667528170	2671090304	256
547	iso_pu_bacteria	2667528171	2671098848	256
548	iso_pu_bacteria	2671180172	2671768428	256
549	iso_pu_bacteria	2675903515	2678262487	256
550	iso_pu_bacteria	2738543004	2739200822	256
551	iso_pu_bacteria	2740892503	2743736238	256
552	iso_pu_bacteria	2744054620	2745008830	256
553	iso_pu_bacteria	2773857670	2774122840	256
554	iso_pu_bacteria	2784132072	2784315198	256
555	iso_pu_bacteria	2791355520	2794596295	256
556	iso_pu_bacteria	2808606382	2808957653	256
557	iso_pu_bacteria	2808606445	2809216335	256
558	iso_pu_bacteria	2818991464	2819703969	256
559	iso_pu_bacteria	2825651385	2825653154	256
560	iso_pu_bacteria	2844665904	2844669142	256
561	iso_pu_bacteria	2904550169	2904553235	256
562	iso_pu_bacteria	2917070673	2917072405	256
563	iso_pu_bacteria	2919481497	2919481743	256
564	iso_pu_bacteria	2919697872	2919702908	256
565	iso_pu_bacteria	2923153595	2923155252	256
566	iso_pu_bacteria	2923586266	2923587421	256
567	iso_pu_bacteria	2929144301	2929145917	256
568	iso_pu_bacteria	2931369376	2931370742	256
569	iso_pu_bacteria	2935353572	2935354569	256
570	iso_pu_bacteria	2939636861	2939639775	256
571	iso_pu_bacteria	2984286254	2984290786	256
572	iso_pu_bacteria	2988728565	2988733455	256
573	iso_pu_bacteria	3007395558	3007400793	256
574	iso_pu_bacteria	3007419365	3007421250	256
575	iso_pu_bacteria	3007511990	3007512968	256
576	iso_pu_bacteria	3007619802	3007622380	256
577	iso_pu_bacteria	8015687852	8015689473	256
578	iso_pu_bacteria	8019769354	8019774124	256
579	iso_pu_bacteria	8019775933	8019780211	256
580	iso_pu_bacteria	8055770955	8055772607	256
581	iso_pu_bacteria	8056125926	8056130224	256
582	iso_pu_bacteria	8056155041	8056156268	256
583	iso_pu_bacteria	8057798959	8057799034	256
584	3300028577	Ga0265318_10055317	Ga0265318_100553171	257
585	3300028800	Ga0265338_10288666	Ga0265338_102886662	257
586	3300031235	Ga0265330_10021565	Ga0265330_100215651	257
587	3300031235	Ga0265330_10122342	Ga0265330_101223422	257
588	3300031238	Ga0265332_10023424	Ga0265332_100234242	257
589	3300031239	Ga0265328_10011375	Ga0265328_100113756	257
590	3300031240	Ga0265320_10015761	Ga0265320_100157617	257
591	3300031249	Ga0265339_10172373	Ga0265339_101723731	257
592	3300031250	Ga0265331_10003774	Ga0265331_100037747	257
593	3300031250	Ga0265331_10151819	Ga0265331_101518192	257
594	3300031344	Ga0265316_10035418	Ga0265316_100354184	257
595	3300031665	Ga0316575_10015090	Ga0316575_100150904	257
596	3300031691	Ga0316579_10006065	Ga0316579_100060652	257
597	3300031691	Ga0316579_10025457	Ga0316579_100254572	257
598	3300031711	Ga0265314_10001396	Ga0265314_1000139617	257
599	3300031712	Ga0265342_10018541	Ga0265342_100185417	257
600	3300031733	Ga0316577_10115592	Ga0316577_101155922	257
601	3300032133	Ga0316583_10006991	Ga0316583_100069913	257
602	3300032168	Ga0316593_10002164	Ga0316593_100021644	257
603	3300036647	Ga0316582_0011144	Ga0316582_0011144_3407_4186	257
604	3300036647	Ga0316582_0210710	Ga0316582_0210710_352_1131	257
605	3300036712	Ga0316584_0068479	Ga0316584_0068479_493_1269	257
606	3300036712	Ga0316584_0078325	Ga0316584_0078325_1133_1912	257
607	3300036712	Ga0316584_0205958	Ga0316584_0205958_351_1130	257
608	3300037588	Ga0316581_0005837	Ga0316581_0005837_1202_1978	257
609	3300037588	Ga0316581_0067070	Ga0316581_0067070_21_800	257
610	3300038725	Ga0400484_02420	Ga0400484_02420_3145_3924	257
611	3300038725	Ga0400484_05024	Ga0400484_05024_10126_10905	257
612	3300038725	Ga0400484_09242	Ga0400484_09242_3295_4074	257
613	3300038725	Ga0400484_17083	Ga0400484_17083_166_945	257
614	3300038725	Ga0400484_27281	Ga0400484_27281_1632_2411	257
615	3300038726	Ga0400490_00409	Ga0400490_00409_5019_5798	257
616	3300038726	Ga0400490_00629	Ga0400490_00629_47735_48514	257
617	3300038726	Ga0400490_19114	Ga0400490_19114_603_1382	257
618	3300038726	Ga0400490_34188	Ga0400490_34188_7422_8201	257
619	3300038726	Ga0400490_41636	Ga0400490_41636_23509_24288	257
620	3300038726	Ga0400490_42931	Ga0400490_42931_15165_15944	257
621	3300038726	Ga0400490_47827	Ga0400490_47827_199_978	257
622	3300038726	Ga0400490_56758	Ga0400490_56758_19213_19992	257
623	3300038727	Ga0400491_18134	Ga0400491_18134_1530_2309	257
624	3300038727	Ga0400491_24212	Ga0400491_24212_12_791	257
625	3300038727	Ga0400491_26290	Ga0400491_26290_2417_3196	257
626	3300038735	Ga0400485_01446	Ga0400485_01446_2196_2975	257
627	3300038735	Ga0400485_04007	Ga0400485_04007_11445_12224	257
628	3300038735	Ga0400485_12289	Ga0400485_12289_633_1412	257
629	3300038741	Ga0400488_08357	Ga0400488_08357_232_1011	257
630	3300038741	Ga0400488_35681	Ga0400488_35681_1703_2482	257
631	3300038741	Ga0400488_37280	Ga0400488_37280_177_956	257
632	3300038741	Ga0400488_38081	Ga0400488_38081_185_964	257
633	3300038741	Ga0400488_42106	Ga0400488_42106_218_997	257
634	3300038741	Ga0400488_45799	Ga0400488_45799_2998_3777	257
635	3300038741	Ga0400488_46833	Ga0400488_46833_302_1081	257
636	3300038741	Ga0400488_51714	Ga0400488_51714_1901_2680	257
637	3300038741	Ga0400488_59122	Ga0400488_59122_916_1695	257
638	3300038741	Ga0400488_59901	Ga0400488_59901_1471_2250	257
639	3300038742	Ga0400486_00610	Ga0400486_00610_6099_6878	257
640	3300038742	Ga0400486_11633	Ga0400486_11633_321_1100	257
641	3300038742	Ga0400486_17202	Ga0400486_17202_5268_6047	257
642	3300038742	Ga0400486_21916	Ga0400486_21916_26_805	257
643	3300039062	Ga0400483_050487	Ga0400483_050487_45058_45843	257
644	3300039062	Ga0400483_061608	Ga0400483_061608_1783_2562	257
645	3300039062	Ga0400483_072960	Ga0400483_072960_1760_2539	257
646	3300039062	Ga0400483_078562	Ga0400483_078562_335_1114	257
647	3300039062	Ga0400483_088943	Ga0400483_088943_499_1278	257
648	3300039062	Ga0400483_117917	Ga0400483_117917_1073_1852	257
649	3300039062	Ga0400483_128929	Ga0400483_128929_16732_17511	257
650	3300039062	Ga0400483_132309	Ga0400483_132309_635_1414	257
651	3300039062	Ga0400483_141043	Ga0400483_141043_566_1342	257
652	3300039062	Ga0400483_145588	Ga0400483_145588_97_876	257
653	3300039062	Ga0400483_147621	Ga0400483_147621_7918_8703	257
654	3300039062	Ga0400483_153623	Ga0400483_153623_218_997	257
655	3300039062	Ga0400483_161094	Ga0400483_161094_641_1420	257
656	3300039062	Ga0400483_170536	Ga0400483_170536_18021_18800	257
657	3300039062	Ga0400483_173670	Ga0400483_173670_6510_7289	257
658	3300039062	Ga0400483_176269	Ga0400483_176269_1972_2751	257
659	3300039062	Ga0400483_180135	Ga0400483_180135_2253_3032	257
660	3300039062	Ga0400483_210780	Ga0400483_210780_7987_8766	257
661	3300039062	Ga0400483_219056	Ga0400483_219056_169_948	257
662	3300039062	Ga0400483_228091	Ga0400483_228091_2159_2938	257
663	3300039062	Ga0400483_256324	Ga0400483_256324_61_840	257
664	3300039062	Ga0400483_266740	Ga0400483_266740_16946_17725	257
665	3300039062	Ga0400483_275518	Ga0400483_275518_751_1530	257
666	3300039062	Ga0400483_283418	Ga0400483_283418_2699_3475	257
667	3300039093	Ga0400489_00591	Ga0400489_00591_941_1720	257
668	3300039093	Ga0400489_40355	Ga0400489_40355_8539_9318	257
669	3300039093	Ga0400489_65224	Ga0400489_65224_778_1557	257
670	3300039110	Ga0400487_02857	Ga0400487_02857_4732_5511	257
671	3300039110	Ga0400487_07641	Ga0400487_07641_157_936	257
672	3300039110	Ga0400487_22307	Ga0400487_22307_831_1610	257
673	3300039110	Ga0400487_24442	Ga0400487_24442_12339_13118	257
674	3300039110	Ga0400487_26069	Ga0400487_26069_32229_33008	257
675	3300039110	Ga0400487_36190	Ga0400487_36190_406_1185	257
676	3300039110	Ga0400487_43518	Ga0400487_43518_6199_6978	257
677	3300039110	Ga0400487_65155	Ga0400487_65155_686_1465	257
678	3300042876	Ga0451577_0190883	Ga0451577_0190883_21_800	257
679	3300042876	Ga0451577_0213673	Ga0451577_0213673_455_1234	257
680	3300044712	Ga0453684_0014629	Ga0453684_0014629_10374_11153	257
681	3300045976	Ga0466967_0770704	Ga0466967_0770704_70_849	257
682	3300053138	Ga0500564_032295	Ga0500564_032295_31_804	257
683	iso_pu_bacteria	2511231008	2511280524	257
684	iso_pu_bacteria	2511231010	2511288565	257
685	iso_pu_bacteria	2511231011	2511296783	257
686	iso_pu_bacteria	2511231012	2511302176	257
687	iso_pu_bacteria	2511231015	2511321983	257
688	iso_pu_bacteria	2511231018	2511336029	257
689	iso_pu_bacteria	2511231019	2511344255	257
690	iso_pu_bacteria	2511231021	2511356212	257
691	iso_pu_bacteria	2511231023	2511366860	257
692	iso_pu_bacteria	2511231031	2511416326	257
693	iso_pu_bacteria	2597489888	2597865114	257
694	iso_pu_bacteria	2597489889	2597870973	257
695	iso_pu_bacteria	2599185155	2599330433	257
696	iso_pu_bacteria	2599185167	2599400244	257
697	iso_pu_bacteria	2599185179	2599451425	257
698	iso_pu_bacteria	2599185189	2599508738	257
699	iso_pu_bacteria	2599185190	2599512598	257
700	iso_pu_bacteria	2599185191	2599519948	257
701	iso_pu_bacteria	2599185288	2599878456	257
702	iso_pu_bacteria	2599185290	2599891274	257
703	iso_pu_bacteria	2599185303	2599947659	257
704	iso_pu_bacteria	2599185307	2599971570	257
705	iso_pu_bacteria	2600255283	2601625188	257
706	iso_pu_bacteria	2600255296	2601689629	257
707	iso_pu_bacteria	2600255318	2601795462	257
708	iso_pu_bacteria	2603880185	2606075531	257
709	iso_pu_bacteria	2603880199	2606128557	257
710	iso_pu_bacteria	2619619299	2621298329	257
711	iso_pu_bacteria	2623620443	2624479397	257
712	iso_pu_bacteria	2643221565	2643841796	257
713	iso_pu_bacteria	2643221571	2643874287	257
714	iso_pu_bacteria	2643221713	2644621947	257
715	iso_pu_bacteria	2675903420	2677899898	257
716	iso_pu_bacteria	2713897148	2715751917	257
717	iso_pu_bacteria	2713897149	2715754964	257
718	iso_pu_bacteria	2718217725	2718633243	257
719	iso_pu_bacteria	2721755607	2723249868	257
720	iso_pu_bacteria	2738541265	2738671286	257
721	iso_pu_bacteria	2738541271	2738691771	257
722	iso_pu_bacteria	2738541282	2738749680	257
723	iso_pu_bacteria	2738541294	2738808459	257
724	iso_pu_bacteria	2738541303	2738858720	257
725	iso_pu_bacteria	2738541309	2738895819	257
726	iso_pu_bacteria	2738543015	2739261072	257
727	iso_pu_bacteria	2738543016	2739267545	257
728	iso_pu_bacteria	2738543025	2739316065	257
729	iso_pu_bacteria	2773857673	2774137555	257
730	iso_pu_bacteria	2784132063	2784265697	257
731	iso_pu_bacteria	2808606377	2808927329	257
732	iso_pu_bacteria	2808606381	2808950132	257
733	iso_pu_bacteria	2808606385	2808977823	257
734	iso_pu_bacteria	2808606388	2808993303	257
735	iso_pu_bacteria	2816332298	2817492526	257
736	iso_pu_bacteria	2818991456	2819654047	257
737	iso_pu_bacteria	2826581358	2826583340	257
738	iso_pu_bacteria	2834028612	2834031881	257
739	iso_pu_bacteria	2842815866	2842817336	257
740	iso_pu_bacteria	2842826826	2842827660	257
741	iso_pu_bacteria	2842832357	2842832732	257
742	iso_pu_bacteria	2842837860	2842841230	257
743	iso_pu_bacteria	2842843487	2842848180	257
744	iso_pu_bacteria	2842849001	2842850414	257
745	iso_pu_bacteria	2852612431	2852613106	257
746	iso_pu_bacteria	2852657418	2852658878	257
747	iso_pu_bacteria	2852667396	2852669159	257
748	iso_pu_bacteria	2860339153	2860340056	257
749	iso_pu_bacteria	2860867994	2860871618	257
750	iso_pu_bacteria	2878029506	2878031402	257
751	iso_pu_bacteria	2880230671	2880232267	257
752	iso_pu_bacteria	2904518522	2904521837	257
753	iso_pu_bacteria	2908446538	2908451023	257
754	iso_pu_bacteria	2919063839	2919064126	257
755	iso_pu_bacteria	2919385768	2919386363	257
756	iso_pu_bacteria	2919456309	2919457145	257
757	iso_pu_bacteria	2919487758	2919491360	257
758	iso_pu_bacteria	2929189879	2929193655	257
759	iso_pu_bacteria	2931390751	2931394979	257
760	iso_pu_bacteria	2931396565	2931400052	257
761	iso_pu_bacteria	2945928738	2945932328	257
762	iso_pu_bacteria	2946006987	2946008518	257
763	iso_pu_bacteria	2946027586	2946032120	257
764	iso_pu_bacteria	2947233263	2947238954	257
765	iso_pu_bacteria	2969304461	2969306185	257
766	iso_pu_bacteria	2974289157	2974292167	257
767	iso_pu_bacteria	2998139840	2998141575	257
768	iso_pu_bacteria	3007614139	3007617093	257
769	iso_pu_bacteria	3007718800	3007722831	257
770	iso_pu_bacteria	3007855910	3007856173	257
771	iso_pu_bacteria	3007861166	3007863185	257
772	iso_pu_bacteria	8029995093	8029999173	257
773	iso_pu_bacteria	8054285046	8054289118	257
774	iso_pu_bacteria	8054347763	8054350761	257
775	iso_pu_bacteria	8054503363	8054507487	257
776	iso_pu_bacteria	8055817908	8055822427	257
777	iso_pu_bacteria	8056131705	8056135884	257
778	iso_pu_bacteria	8056148874	8056153208	257
779	iso_pu_bacteria	8056161164	8056162093	257
780	iso_pu_bacteria	8056166840	8056169412	257
781	iso_pu_bacteria	8056172158	8056175590	257
782	iso_pu_bacteria	8056177738	8056181096	257
783	iso_pu_bacteria	8056569372	8056573263	257
784	3300002738	JGI25154J39366_1012078	JGI25154J39366_10120781	258
785	3300003187	JGI25151J46595_10008885	JGI25151J46595_100088853	258
786	3300003781	Ga0055536_1030982	Ga0055536_10309821	258
787	3300005288	Ga0065714_10002698	Ga0065714_100026988	258
788	3300005289	Ga0065704_10003480	Ga0065704_100034806	258
789	3300005289	Ga0065704_10007662	Ga0065704_100076624	258
790	3300005289	Ga0065704_10081604	Ga0065704_100816044	258
791	3300005366	Ga0070659_100543038	Ga0070659_1005430382	258
792	3300005455	Ga0070663_100161473	Ga0070663_1001614732	258
793	3300005458	Ga0070681_10170120	Ga0070681_101701204	258
794	3300005535	Ga0070684_100181994	Ga0070684_1001819943	258
795	3300005539	Ga0068853_100007795	Ga0068853_1000077959	258
796	3300005547	Ga0070693_100070863	Ga0070693_1000708632	258
797	3300005563	Ga0068855_100015899	Ga0068855_1000158994	258
798	3300005564	Ga0070664_100421828	Ga0070664_1004218282	258
799	3300005577	Ga0068857_100220281	Ga0068857_1002202811	258
800	3300005614	Ga0068856_100717839	Ga0068856_1007178391	258
801	3300006944	Ga0099823_1000024	Ga0099823_10000243	258
802	3300006946	Ga0079104_1000543	Ga0079104_100054332	258
803	3300006948	Ga0099826_10008026	Ga0099826_100080265	258
804	3300009011	Ga0105251_10027627	Ga0105251_100276273	258
805	3300009011	Ga0105251_10160853	Ga0105251_101608531	258
806	3300009036	Ga0105244_10018991	Ga0105244_100189912	258
807	3300009036	Ga0105244_10025625	Ga0105244_100256253	258
808	3300009036	Ga0105244_10036162	Ga0105244_100361623	258
809	3300009036	Ga0105244_10084332	Ga0105244_100843323	258
810	3300009092	Ga0105250_10017250	Ga0105250_100172504	258
811	3300009092	Ga0105250_10029354	Ga0105250_100293544	258
812	3300009148	Ga0105243_10056668	Ga0105243_100566682	258
813	3300009148	Ga0105243_10215079	Ga0105243_102150793	258
814	3300009174	Ga0105241_10086637	Ga0105241_100866372	258
815	3300010375	Ga0105239_10242600	Ga0105239_102426002	258
816	3300013102	Ga0157371_10000203	Ga0157371_100002032	258
817	3300013102	Ga0157371_10130218	Ga0157371_101302182	258
818	3300013104	Ga0157370_10005599	Ga0157370_100055993	258
819	3300013307	Ga0157372_10025911	Ga0157372_100259112	258
820	3300014497	Ga0182008_10037326	Ga0182008_100373263	258
821	3300021361	Ga0213872_10035315	Ga0213872_100353151	258
822	3300025292	Ga0209676_1000753	Ga0209676_100075345	258
823	3300025298	Ga0209050_1000009	Ga0209050_1000009238	258
824	3300025303	Ga0209051_1000053	Ga0209051_1000053238	258
825	3300025304	Ga0209257_1009275	Ga0209257_10092753	258
826	3300025711	Ga0207696_1000010	Ga0207696_1000010326	258
827	3300025711	Ga0207696_1005667	Ga0207696_10056671	258
828	3300025711	Ga0207696_1015790	Ga0207696_10157903	258
829	3300025728	Ga0207655_1000562	Ga0207655_100056247	258
830	3300025728	Ga0207655_1000670	Ga0207655_10006703	258
831	3300025728	Ga0207655_1022350	Ga0207655_10223501	258
832	3300025735	Ga0207713_1002393	Ga0207713_100239316	258
833	3300025735	Ga0207713_1015726	Ga0207713_10157264	258
834	3300025735	Ga0207713_1028157	Ga0207713_10281572	258
835	3300025735	Ga0207713_1035664	Ga0207713_10356641	258
836	3300025735	Ga0207713_1039634	Ga0207713_10396342	258
837	3300025911	Ga0207654_10082391	Ga0207654_100823913	258
838	3300025914	Ga0207671_10010328	Ga0207671_100103286	258
839	3300025932	Ga0207690_10429874	Ga0207690_104298741	258
840	3300025935	Ga0207709_10041754	Ga0207709_100417542	258
841	3300026041	Ga0207639_10005439	Ga0207639_100054394	258
842	3300026078	Ga0207702_10673767	Ga0207702_106737671	258
843	3300027111	Ga0209281_1000018	Ga0209281_1000018457	258
844	3300027296	Ga0209389_1000018	Ga0209389_100001881	258
845	3300027312	Ga0209371_1001864	Ga0209371_100186412	258
846	3300027312	Ga0209371_1003258	Ga0209371_10032588	258
847	3300028666	Ga0265336_10001365	Ga0265336_1000136513	258
848	3300028800	Ga0265338_10044219	Ga0265338_100442192	258
849	3300029957	Ga0265324_10000023	Ga0265324_1000002355	258
850	3300029957	Ga0265324_10000557	Ga0265324_1000055720	258
851	3300030500	Ga0268256_1001635	Ga0268256_100163512	258
852	3300030500	Ga0268256_1001974	Ga0268256_100197411	258
853	3300030733	Ga0314311_1190454	Ga0314311_11904545	258
854	3300030742	Ga0316183_1151755	Ga0316183_11517552	258
855	3300031241	Ga0265325_10000099	Ga0265325_1000009932	258
856	3300031241	Ga0265325_10018111	Ga0265325_100181114	258
857	3300031250	Ga0265331_10005247	Ga0265331_100052473	258
858	3300031250	Ga0265331_10012115	Ga0265331_100121152	258
859	3300031250	Ga0265331_10019217	Ga0265331_100192173	258
860	3300031250	Ga0265331_10115008	Ga0265331_101150082	258
861	3300031251	Ga0265327_10000384	Ga0265327_1000038441	258
862	3300031251	Ga0265327_10010769	Ga0265327_100107694	258
863	3300031344	Ga0265316_10132060	Ga0265316_101320603	258
864	3300031548	Ga0307408_100000018	Ga0307408_10000001873	258
865	3300031548	Ga0307408_100025025	Ga0307408_1000250253	258
866	3300031548	Ga0307408_100080623	Ga0307408_1000806233	258
867	3300031548	Ga0307408_100081707	Ga0307408_1000817071	258
868	3300031711	Ga0265314_10000433	Ga0265314_1000043337	258
869	3300031711	Ga0265314_10020614	Ga0265314_100206142	258
870	3300031731	Ga0307405_10005593	Ga0307405_100055935	258
871	3300031731	Ga0307405_10020268	Ga0307405_100202683	258
872	3300031731	Ga0307405_10057573	Ga0307405_100575733	258
873	3300031824	Ga0307413_10007830	Ga0307413_100078303	258
874	3300031901	Ga0307406_10030398	Ga0307406_100303982	258
875	3300031911	Ga0307412_10026009	Ga0307412_100260092	258
876	3300031911	Ga0307412_10069236	Ga0307412_100692363	258
877	3300031911	Ga0307412_10169828	Ga0307412_101698283	258
878	3300031911	Ga0307412_10204624	Ga0307412_102046242	258
879	3300032004	Ga0307414_10074088	Ga0307414_100740883	258
880	3300032005	Ga0307411_10013117	Ga0307411_100131173	258
881	3300032005	Ga0307411_10022065	Ga0307411_100220653	258
882	3300037068	Ga0373925_0642923	Ga0373925_0642923_41_838	258
883	3300041405	Ga0439438_014690	Ga0439438_014690_43_819	258
884	3300041411	Ga0439466_0002955	Ga0439466_0002955_332_1108	258
885	3300041997	Ga0439431_0026517	Ga0439431_0026517_78_854	258
886	3300041997	Ga0439431_0061687	Ga0439431_0061687_162_938	258
887	3300042000	Ga0439437_005367	Ga0439437_005367_238_1014	258
888	3300042003	Ga0439443_015839	Ga0439443_015839_241_1017	258
889	3300042115	Ga0450911_000001	Ga0450911_000001_232924_233700	258
890	3300042137	Ga0450902_002765	Ga0450902_002765_579_1355	258
891	3300042139	Ga0450904_000136	Ga0450904_000136_8869_9645	258
892	3300042142	Ga0450905_001380	Ga0450905_001380_1125_1901	258
893	3300042156	Ga0439446_0037950	Ga0439446_0037950_447_1223	258
894	3300042438	Ga0439459_0002611	Ga0439459_0002611_1553_2329	258
895	3300042439	Ga0439464_0000157	Ga0439464_0000157_2500_3276	258
896	3300042530	Ga0450916_002557	Ga0450916_002557_333_1109	258
897	3300042532	Ga0450893_0005568	Ga0450893_0005568_648_1424	258
898	3300042532	Ga0450893_0014720	Ga0450893_0014720_305_1081	258
899	3300042533	Ga0450901_001308	Ga0450901_001308_648_1424	258
900	3300042876	Ga0451577_0055837	Ga0451577_0055837_640_1428	258
901	3300042876	Ga0451577_0094281	Ga0451577_0094281_1293_2081	258
902	3300044666	Ga0466977_0000151	Ga0466977_0000151_10443_11234	258
903	3300044712	Ga0453684_0006406	Ga0453684_0006406_5749_6537	258
904	3300044712	Ga0453684_0332819	Ga0453684_0332819_103_891	258
905	3300045051	Ga0451576_0000320	Ga0451576_0000320_1943_2731	258
906	3300045051	Ga0451576_0001448	Ga0451576_0001448_21580_22368	258
907	3300046453	Ga0495627_001540	Ga0495627_001540_9048_9824	258
908	3300046453	Ga0495627_033024	Ga0495627_033024_706_1482	258
909	3300046455	Ga0495603_0087342	Ga0495603_0087342_824_1600	258
910	3300046458	Ga0495591_008934	Ga0495591_008934_140_916	258
911	3300046458	Ga0495591_016860	Ga0495591_016860_743_1519	258
912	3300046463	Ga0495653_0002537	Ga0495653_0002537_5247_6023	258
913	3300046471	Ga0495650_0044939	Ga0495650_0044939_327_1103	258
914	3300046492	Ga0495585_0008886	Ga0495585_0008886_1736_2512	258
915	3300046501	Ga0495607_0003653	Ga0495607_0003653_1681_2457	258
916	3300046501	Ga0495607_0057665	Ga0495607_0057665_1221_1997	258
917	3300046507	Ga0495606_0000669	Ga0495606_0000669_23603_24379	258
918	3300046507	Ga0495606_0005069	Ga0495606_0005069_9701_10477	258
919	3300046507	Ga0495606_0078029	Ga0495606_0078029_559_1335	258
920	3300046515	Ga0495620_0000002	Ga0495620_0000002_9682_10458	258
921	3300046519	Ga0495632_0006699	Ga0495632_0006699_1223_1999	258
922	3300046519	Ga0495632_0009876	Ga0495632_0009876_4578_5354	258
923	3300046519	Ga0495632_0022985	Ga0495632_0022985_631_1407	258
924	3300046522	Ga0495643_0000640	Ga0495643_0000640_10257_11033	258
925	3300046522	Ga0495643_0004751	Ga0495643_0004751_7776_8552	258
926	3300046524	Ga0495648_0002370	Ga0495648_0002370_11187_11963	258
927	3300046530	Ga0495654_0001885	Ga0495654_0001885_11130_11906	258
928	3300046665	Ga0495661_0000095	Ga0495661_0000095_91012_91788	258
929	3300046665	Ga0495661_0005778	Ga0495661_0005778_5683_6459	258
930	3300046692	Ga0495671_0014408	Ga0495671_0014408_1028_1804	258
931	3300046694	Ga0495649_0000947	Ga0495649_0000947_4198_4974	258
932	3300046694	Ga0495649_0009366	Ga0495649_0009366_491_1267	258
933	3300046794	Ga0495589_0081462	Ga0495589_0081462_572_1348	258
934	3300047320	Ga0495672_0014999	Ga0495672_0014999_526_1302	258
935	3300047321	Ga0495676_0126713	Ga0495676_0126713_94_870	258
936	3300047323	Ga0495683_0000089	Ga0495683_0000089_33576_34352	258
937	3300048912	Ga0496109_0454706	Ga0496109_0454706_142_945	258
938	3300048917	Ga0496114_0006503	Ga0496114_0006503_1611_2387	258
939	3300048917	Ga0496114_0086640	Ga0496114_0086640_1116_1892	258
940	3300048919	Ga0496116_0026314	Ga0496116_0026314_1365_2141	258
941	3300048920	Ga0496117_0018516	Ga0496117_0018516_2470_3246	258
942	3300048920	Ga0496117_0018978	Ga0496117_0018978_2303_3079	258
943	3300048920	Ga0496117_0023927	Ga0496117_0023927_404_1180	258
944	3300048921	Ga0496118_0004346	Ga0496118_0004346_9217_9993	258
945	3300048921	Ga0496118_0031366	Ga0496118_0031366_2339_3115	258
946	3300048924	Ga0496121_0117410	Ga0496121_0117410_712_1488	258
947	3300048925	Ga0496122_0006020	Ga0496122_0006020_9276_10052	258
948	3300048926	Ga0496123_0000437	Ga0496123_0000437_57853_58629	258
949	3300048926	Ga0496123_0025952	Ga0496123_0025952_2403_3179	258
950	3300048927	Ga0496124_0008283	Ga0496124_0008283_643_1419	258
951	3300048927	Ga0496124_0010386	Ga0496124_0010386_1844_2620	258
952	3300048927	Ga0496124_0095099	Ga0496124_0095099_106_882	258
953	3300048927	Ga0496124_0095644	Ga0496124_0095644_273_1049	258
954	3300048927	Ga0496124_0156018	Ga0496124_0156018_490_1266	258
955	3300048927	Ga0496124_0173286	Ga0496124_0173286_439_1215	258
956	3300048928	Ga0496125_0000861	Ga0496125_0000861_7898_8674	258
957	3300048928	Ga0496125_0016758	Ga0496125_0016758_6080_6856	258
958	3300048928	Ga0496125_0082868	Ga0496125_0082868_1255_2031	258
959	3300048928	Ga0496125_0137948	Ga0496125_0137948_817_1593	258
960	3300048929	Ga0496126_0031973	Ga0496126_0031973_1313_2089	258
961	3300049459	Ga0495678_012399	Ga0495678_012399_2834_3610	258
962	3300049569	Ga0501032_0103378	Ga0501032_0103378_348_1124	258
963	3300049571	Ga0501034_0000041	Ga0501034_0000041_191405_192181	258
964	3300049573	Ga0501037_0116790	Ga0501037_0116790_1003_1779	258
965	3300049574	Ga0501038_0036619	Ga0501038_0036619_3391_4167	258
966	3300049575	Ga0501039_0262791	Ga0501039_0262791_22_798	258
967	3300049853	Ga0501226_000014	Ga0501226_000014_75054_75830	258
968	3300053125	Ga0500618_003225	Ga0500618_003225_3680_4456	258
969	3300053135	Ga0500659_0013561	Ga0500659_0013561_2262_3038	258
970	2124908027	MRS2a_Contig_7216	MRS2a_00118960	260
971	2124908027	MRS2a_Contig_746	MRS2a_00603710	260
972	2162886007	SwRhRL2b_contig_3653603	SwRhRL2b_0635.00004060	260
973	2162886012	MBSR1b_contig_12794323	MBSR1b_0239.00000410	260
974	3300002737	JGI25162J39368_1000037	JGI25162J39368_100003756	260
975	3300002737	JGI25162J39368_1000087	JGI25162J39368_1000087114	260
976	3300002771	JGI25163J39215_1000594	JGI25163J39215_10005946	260
977	3300002771	JGI25163J39215_1001754	JGI25163J39215_10017542	260
978	3300002772	JGI25164J39214_1000020	JGI25164J39214_100002056	260
979	3300002772	JGI25164J39214_1000051	JGI25164J39214_100005166	260
980	3300002772	JGI25164J39214_1000065	JGI25164J39214_1000065113	260
981	3300003214	JGI25165J46597_1000077	JGI25165J46597_100007756	260
982	3300003214	JGI25165J46597_1000091	JGI25165J46597_100009166	260
983	3300003751	Ga0055538_1000086	Ga0055538_100008662	260
984	3300003752	Ga0055539_1000128	Ga0055539_100012862	260
985	3300003756	Ga0055533_1000185	Ga0055533_100018534	260
986	3300003758	Ga0055532_1000188	Ga0055532_100018822	260
987	3300003759	Ga0055525_1000195	Ga0055525_100019511	260
988	3300003781	Ga0055536_1000042	Ga0055536_10000429	260
989	3300003781	Ga0055536_1000571	Ga0055536_100057118	260
990	3300003781	Ga0055536_1001274	Ga0055536_100127413	260
991	3300003781	Ga0055536_1001447	Ga0055536_100144713	260
992	3300003791	Ga0055530_10000304	Ga0055530_100003047	260
993	3300003791	Ga0055530_10000870	Ga0055530_1000087020	260
994	3300003791	Ga0055530_10001489	Ga0055530_1000148916	260
995	3300003791	Ga0055530_10003180	Ga0055530_100031806	260
996	3300003792	Ga0055540_1000292	Ga0055540_10002927	260
997	3300003792	Ga0055540_1000438	Ga0055540_100043825	260
998	3300003792	Ga0055540_1000634	Ga0055540_100063420	260
999	3300003794	Ga0055531_10000581	Ga0055531_1000058128	260
1000	3300003841	Ga0055541_1000120	Ga0055541_100012034	260
1001	3300005288	Ga0065714_10000179	Ga0065714_100001792	260
1002	3300005288	Ga0065714_10003663	Ga0065714_100036633	260
1003	3300005288	Ga0065714_10007886	Ga0065714_100078866	260
1004	3300005288	Ga0065714_10008639	Ga0065714_100086396	260
1005	3300005288	Ga0065714_10008889	Ga0065714_100088892	260
1006	3300005288	Ga0065714_10017446	Ga0065714_100174464	260
1007	3300005288	Ga0065714_10066581	Ga0065714_100665813	260
1008	3300005288	Ga0065714_10074017	Ga0065714_100740172	260
1009	3300005288	Ga0065714_10083987	Ga0065714_100839874	260
1010	3300005289	Ga0065704_10008162	Ga0065704_100081622	260
1011	3300005289	Ga0065704_10120554	Ga0065704_101205542	260
1012	3300005289	Ga0065704_10313138	Ga0065704_103131381	260
1013	3300005290	Ga0065712_10004906	Ga0065712_100049063	260
1014	3300005290	Ga0065712_10006839	Ga0065712_100068392	260
1015	3300005290	Ga0065712_10067744	Ga0065712_1006774458	260
1016	3300005293	Ga0065715_10129124	Ga0065715_101291242	260
1017	3300005331	Ga0070670_100001830	Ga0070670_10000183015	260
1018	3300005331	Ga0070670_100053412	Ga0070670_1000534121	260
1019	3300005344	Ga0070661_100000008	Ga0070661_1000000089	260
1020	3300005353	Ga0070669_100017801	Ga0070669_1000178013	260
1021	3300005366	Ga0070659_100404846	Ga0070659_1004048461	260
1022	3300005564	Ga0070664_100000466	Ga0070664_10000046610	260
1023	3300006051	Ga0075364_10105605	Ga0075364_101056052	260
1024	3300006058	Ga0075432_10002375	Ga0075432_100023755	260
1025	3300006058	Ga0075432_10005427	Ga0075432_100054272	260
1026	3300006177	Ga0075362_10117077	Ga0075362_101170773	260
1027	3300006946	Ga0079104_1040972	Ga0079104_10409722	260
1028	3300009011	Ga0105251_10000060	Ga0105251_1000006057	260
1029	3300009011	Ga0105251_10000221	Ga0105251_1000022140	260
1030	3300009011	Ga0105251_10003052	Ga0105251_100030529	260
1031	3300009011	Ga0105251_10009446	Ga0105251_100094466	260
1032	3300009011	Ga0105251_10017278	Ga0105251_100172783	260
1033	3300009011	Ga0105251_10020075	Ga0105251_100200753	260
1034	3300009011	Ga0105251_10020386	Ga0105251_100203866	260
1035	3300009011	Ga0105251_10049315	Ga0105251_100493152	260
1036	3300009011	Ga0105251_10206034	Ga0105251_102060341	260
1037	3300009036	Ga0105244_10004756	Ga0105244_1000475611	260
1038	3300009036	Ga0105244_10005482	Ga0105244_100054822	260
1039	3300009036	Ga0105244_10005859	Ga0105244_100058595	260
1040	3300009036	Ga0105244_10008923	Ga0105244_100089232	260
1041	3300009036	Ga0105244_10024650	Ga0105244_100246503	260
1042	3300009036	Ga0105244_10036811	Ga0105244_100368113	260
1043	3300009036	Ga0105244_10045914	Ga0105244_100459142	260
1044	3300009036	Ga0105244_10046553	Ga0105244_100465532	260
1045	3300009036	Ga0105244_10077645	Ga0105244_100776452	260
1046	3300009036	Ga0105244_10106675	Ga0105244_101066751	260
1047	3300009036	Ga0105244_10139521	Ga0105244_101395212	260
1048	3300009092	Ga0105250_10000215	Ga0105250_100002158	260
1049	3300009092	Ga0105250_10002063	Ga0105250_100020636	260
1050	3300009092	Ga0105250_10008731	Ga0105250_100087312	260
1051	3300009092	Ga0105250_10012494	Ga0105250_100124944	260
1052	3300009092	Ga0105250_10038991	Ga0105250_100389913	260
1053	3300009092	Ga0105250_10092963	Ga0105250_100929632	260
1054	3300009148	Ga0105243_10000158	Ga0105243_1000015854	260
1055	3300009148	Ga0105243_10001567	Ga0105243_100015678	260
1056	3300009148	Ga0105243_10111102	Ga0105243_101111022	260
1057	3300009148	Ga0105243_10364349	Ga0105243_103643491	260
1058	3300009176	Ga0105242_10001027	Ga0105242_1000102723	260
1059	3300009545	Ga0105237_10000944	Ga0105237_100009447	260
1060	3300009553	Ga0105249_10097062	Ga0105249_100970624	260
1061	3300011119	Ga0105246_10001106	Ga0105246_1000110611	260
1062	3300011119	Ga0105246_10009697	Ga0105246_100096973	260
1063	3300011119	Ga0105246_10032515	Ga0105246_100325153	260
1064	3300011119	Ga0105246_10130349	Ga0105246_101303492	260
1065	3300012498	Ga0157345_1000337	Ga0157345_10003374	260
1066	3300013100	Ga0157373_10001402	Ga0157373_1000140218	260
1067	3300013100	Ga0157373_10006835	Ga0157373_100068353	260
1068	3300013100	Ga0157373_10011111	Ga0157373_100111116	260
1069	3300013100	Ga0157373_10033327	Ga0157373_100333273	260
1070	3300013100	Ga0157373_10042291	Ga0157373_100422912	260
1071	3300013100	Ga0157373_10257054	Ga0157373_102570543	260
1072	3300013102	Ga0157371_10001725	Ga0157371_1000172513	260
1073	3300013102	Ga0157371_10106710	Ga0157371_101067102	260
1074	3300013102	Ga0157371_10201688	Ga0157371_102016882	260
1075	3300013104	Ga0157370_10018541	Ga0157370_100185416	260
1076	3300013104	Ga0157370_10033549	Ga0157370_100335495	260
1077	3300013104	Ga0157370_10059116	Ga0157370_100591166	260
1078	3300013104	Ga0157370_10092212	Ga0157370_100922122	260
1079	3300013104	Ga0157370_10100556	Ga0157370_101005563	260
1080	3300013105	Ga0157369_10030498	Ga0157369_100304986	260
1081	3300013105	Ga0157369_10035558	Ga0157369_100355582	260
1082	3300013105	Ga0157369_10207212	Ga0157369_102072122	260
1083	3300013105	Ga0157369_10693635	Ga0157369_106936352	260
1084	3300013105	Ga0157369_10884198	Ga0157369_108841981	260
1085	3300013306	Ga0163162_10025717	Ga0163162_100257174	260
1086	3300013306	Ga0163162_10204447	Ga0163162_102044473	260
1087	3300013306	Ga0163162_10441608	Ga0163162_104416083	260
1088	3300013306	Ga0163162_10996033	Ga0163162_109960331	260
1089	3300013307	Ga0157372_10014583	Ga0157372_100145835	260
1090	3300013308	Ga0157375_10096089	Ga0157375_100960892	260
1091	3300013308	Ga0157375_10288007	Ga0157375_102880071	260
1092	3300014497	Ga0182008_10000040	Ga0182008_1000004061	260
1093	3300014497	Ga0182008_10021673	Ga0182008_100216733	260
1094	3300014497	Ga0182008_10030495	Ga0182008_100304955	260
1095	3300014497	Ga0182008_10040588	Ga0182008_100405883	260
1096	3300014497	Ga0182008_10054247	Ga0182008_100542472	260
1097	3300014497	Ga0182008_10069304	Ga0182008_100693042	260
1098	3300015261	Ga0182006_1002164	Ga0182006_10021647	260
1099	3300015261	Ga0182006_1004779	Ga0182006_10047795	260
1100	3300015261	Ga0182006_1015511	Ga0182006_10155112	260
1101	3300015261	Ga0182006_1016346	Ga0182006_10163463	260
1102	3300015261	Ga0182006_1045947	Ga0182006_10459471	260
1103	3300015261	Ga0182006_1047799	Ga0182006_10477992	260
1104	3300015261	Ga0182006_1048133	Ga0182006_10481332	260
1105	3300015262	Ga0182007_10003128	Ga0182007_100031284	260
1106	3300015262	Ga0182007_10027337	Ga0182007_100273373	260
1107	3300015262	Ga0182007_10033666	Ga0182007_100336662	260
1108	3300015265	Ga0182005_1003063	Ga0182005_10030634	260
1109	3300015265	Ga0182005_1022297	Ga0182005_10222972	260
1110	3300015265	Ga0182005_1036184	Ga0182005_10361843	260
1111	3300015265	Ga0182005_1052122	Ga0182005_10521222	260
1112	3300017792	Ga0163161_10012274	Ga0163161_100122744	260
1113	3300017792	Ga0163161_10017846	Ga0163161_100178464	260
1114	3300017792	Ga0163161_10023635	Ga0163161_100236353	260
1115	3300017792	Ga0163161_10278306	Ga0163161_102783062	260
1116	3300025206	Ga0209435_100812	Ga0209435_1008126	260
1117	3300025207	Ga0209760_100022	Ga0209760_100022107	260
1118	3300025207	Ga0209760_100053	Ga0209760_10005339	260
1119	3300025224	Ga0209784_100017	Ga0209784_100017183	260
1120	3300025225	Ga0209566_100014	Ga0209566_100014183	260
1121	3300025226	Ga0209674_100028	Ga0209674_100028183	260
1122	3300025229	Ga0209147_100038	Ga0209147_10003838	260
1123	3300025230	Ga0209563_100032	Ga0209563_100032183	260
1124	3300025230	Ga0209563_100367	Ga0209563_1003673	260
1125	3300025231	Ga0207427_100001	Ga0207427_100001899	260
1126	3300025231	Ga0207427_100047	Ga0207427_100047143	260
1127	3300025233	Ga0209437_100003	Ga0209437_100003473	260
1128	3300025233	Ga0209437_100009	Ga0209437_100009143	260
1129	3300025242	Ga0209258_100409	Ga0209258_10040921	260
1130	3300025246	Ga0209646_1001371	Ga0209646_10013713	260
1131	3300025253	Ga0209677_100018	Ga0209677_100018183	260
1132	3300025256	Ga0209759_1002719	Ga0209759_10027193	260
1133	3300025261	Ga0209233_1000007	Ga0209233_1000007899	260
1134	3300025261	Ga0209233_1000032	Ga0209233_1000032143	260
1135	3300025284	Ga0209130_1025347	Ga0209130_10253472	260
1136	3300025292	Ga0209676_1000016	Ga0209676_1000016503	260
1137	3300025292	Ga0209676_1000021	Ga0209676_1000021199	260
1138	3300025292	Ga0209676_1000033	Ga0209676_1000033323	260
1139	3300025298	Ga0209050_1000036	Ga0209050_100003655	260
1140	3300025298	Ga0209050_1000107	Ga0209050_1000107198	260
1141	3300025298	Ga0209050_1020305	Ga0209050_10203052	260
1142	3300025303	Ga0209051_1000043	Ga0209051_1000043127	260
1143	3300025303	Ga0209051_1000474	Ga0209051_100047444	260
1144	3300025303	Ga0209051_1004467	Ga0209051_10044676	260
1145	3300025304	Ga0209257_1000098	Ga0209257_1000098186	260
1146	3300025711	Ga0207696_1000043	Ga0207696_1000043120	260
1147	3300025711	Ga0207696_1000101	Ga0207696_100010162	260
1148	3300025711	Ga0207696_1000175	Ga0207696_100017560	260
1149	3300025711	Ga0207696_1003416	Ga0207696_10034163	260
1150	3300025711	Ga0207696_1007727	Ga0207696_10077273	260
1151	3300025711	Ga0207696_1030543	Ga0207696_10305432	260
1152	3300025711	Ga0207696_1044334	Ga0207696_10443342	260
1153	3300025728	Ga0207655_1000019	Ga0207655_1000019315	260
1154	3300025728	Ga0207655_1000095	Ga0207655_100009526	260
1155	3300025728	Ga0207655_1000402	Ga0207655_10004026	260
1156	3300025728	Ga0207655_1000619	Ga0207655_10006196	260
1157	3300025728	Ga0207655_1005875	Ga0207655_10058754	260
1158	3300025728	Ga0207655_1007976	Ga0207655_10079766	260
1159	3300025728	Ga0207655_1008317	Ga0207655_10083172	260
1160	3300025728	Ga0207655_1010144	Ga0207655_10101443	260
1161	3300025728	Ga0207655_1011027	Ga0207655_10110274	260
1162	3300025728	Ga0207655_1015056	Ga0207655_10150563	260
1163	3300025728	Ga0207655_1022468	Ga0207655_10224682	260
1164	3300025728	Ga0207655_1025777	Ga0207655_10257773	260
1165	3300025735	Ga0207713_1000150	Ga0207713_100015043	260
1166	3300025735	Ga0207713_1000207	Ga0207713_100020742	260
1167	3300025735	Ga0207713_1002430	Ga0207713_10024309	260
1168	3300025735	Ga0207713_1003445	Ga0207713_10034456	260
1169	3300025735	Ga0207713_1003756	Ga0207713_10037565	260
1170	3300025735	Ga0207713_1004068	Ga0207713_100406811	260
1171	3300025735	Ga0207713_1004396	Ga0207713_100439611	260
1172	3300025735	Ga0207713_1006140	Ga0207713_10061404	260
1173	3300025735	Ga0207713_1008868	Ga0207713_10088686	260
1174	3300025735	Ga0207713_1009854	Ga0207713_10098543	260
1175	3300025735	Ga0207713_1011406	Ga0207713_10114063	260
1176	3300025914	Ga0207671_10000035	Ga0207671_1000003526	260
1177	3300025920	Ga0207649_10000017	Ga0207649_10000017151	260
1178	3300025925	Ga0207650_10000180	Ga0207650_1000018068	260
1179	3300025925	Ga0207650_10000181	Ga0207650_100001816	260
1180	3300025933	Ga0207706_10030654	Ga0207706_100306542	260
1181	3300025934	Ga0207686_10001754	Ga0207686_1000175414	260
1182	3300025934	Ga0207686_10308102	Ga0207686_103081022	260
1183	3300025935	Ga0207709_10000053	Ga0207709_1000005398	260
1184	3300025935	Ga0207709_10003120	Ga0207709_100031208	260
1185	3300025935	Ga0207709_10094870	Ga0207709_100948702	260
1186	3300025935	Ga0207709_10217202	Ga0207709_102172023	260
1187	3300025945	Ga0207679_10000005	Ga0207679_10000005104	260
1188	3300025961	Ga0207712_10057455	Ga0207712_100574552	260
1189	3300027111	Ga0209281_1015909	Ga0209281_10159092	260
1190	3300027907	Ga0207428_10259802	Ga0207428_102598023	260
1191	3300030521	Ga0307511_10059309	Ga0307511_100593095	260
1192	3300030735	Ga0316178_1017517	Ga0316178_101751720	260
1193	3300031548	Ga0307408_100015942	Ga0307408_1000159426	260
1194	3300031548	Ga0307408_100139478	Ga0307408_1001394782	260
1195	3300031548	Ga0307408_100283138	Ga0307408_1002831381	260
1196	3300031731	Ga0307405_10201871	Ga0307405_102018712	260
1197	3300031903	Ga0307407_10231779	Ga0307407_102317792	260
1198	3300031903	Ga0307407_10440503	Ga0307407_104405031	260
1199	3300031995	Ga0307409_100027501	Ga0307409_1000275013	260
1200	3300032002	Ga0307416_100315019	Ga0307416_1003150192	260
1201	3300033180	Ga0307510_10017682	Ga0307510_100176823	260
1202	3300033180	Ga0307510_10091006	Ga0307510_100910062	260
1203	3300036647	Ga0316582_0101983	Ga0316582_0101983_649_1434	260
1204	3300038705	Ga0237819_00758	Ga0237819_00758_6850_7635	260
1205	3300041405	Ga0439438_001091	Ga0439438_001091_2376_3161	260
1206	3300041405	Ga0439438_003173	Ga0439438_003173_3144_3926	260
1207	3300041405	Ga0439438_003183	Ga0439438_003183_876_1661	260
1208	3300041405	Ga0439438_004345	Ga0439438_004345_2287_3072	260
1209	3300041405	Ga0439438_006363	Ga0439438_006363_3087_3869	260
1210	3300041405	Ga0439438_006855	Ga0439438_006855_1182_1964	260
1211	3300041405	Ga0439438_009560	Ga0439438_009560_1223_2005	260
1212	3300041407	Ga0439447_004549	Ga0439447_004549_3727_4512	260
1213	3300041407	Ga0439447_004599	Ga0439447_004599_1382_2164	260
1214	3300041407	Ga0439447_006753	Ga0439447_006753_515_1300	260
1215	3300041407	Ga0439447_008342	Ga0439447_008342_1801_2583	260
1216	3300041411	Ga0439466_0002465	Ga0439466_0002465_1428_2210	260
1217	3300041411	Ga0439466_0005271	Ga0439466_0005271_2489_3271	260
1218	3300041411	Ga0439466_0007281	Ga0439466_0007281_3225_4010	260
1219	3300041411	Ga0439466_0007700	Ga0439466_0007700_2350_3135	260
1220	3300041411	Ga0439466_0008897	Ga0439466_0008897_2913_3695	260
1221	3300041411	Ga0439466_0009853	Ga0439466_0009853_740_1525	260
1222	3300041411	Ga0439466_0015396	Ga0439466_0015396_1126_1908	260
1223	3300041411	Ga0439466_0032588	Ga0439466_0032588_919_1701	260
1224	3300041411	Ga0439466_0035546	Ga0439466_0035546_181_966	260
1225	3300041413	Ga0439465_0100680	Ga0439465_0100680_166_948	260
1226	3300041997	Ga0439431_0009622	Ga0439431_0009622_793_1575	260
1227	3300042004	Ga0439445_0019725	Ga0439445_0019725_131_913	260
1228	3300042006	Ga0439432_001383	Ga0439432_001383_8379_9164	260
1229	3300042006	Ga0439432_004872	Ga0439432_004872_1269_2051	260
1230	3300042006	Ga0439432_005314	Ga0439432_005314_2003_2785	260
1231	3300042006	Ga0439432_008662	Ga0439432_008662_255_1040	260
1232	3300042006	Ga0439432_045194	Ga0439432_045194_121_906	260
1233	3300042006	Ga0439432_059236	Ga0439432_059236_331_1113	260
1234	3300042009	Ga0439451_001033	Ga0439451_001033_2306_3088	260
1235	3300042009	Ga0439451_002013	Ga0439451_002013_2650_3432	260
1236	3300042009	Ga0439451_002283	Ga0439451_002283_1104_1886	260
1237	3300042009	Ga0439451_006038	Ga0439451_006038_1428_2210	260
1238	3300042010	Ga0439452_000753	Ga0439452_000753_12135_12920	260
1239	3300042010	Ga0439452_000764	Ga0439452_000764_3555_4340	260
1240	3300042010	Ga0439452_001071	Ga0439452_001071_2574_3359	260
1241	3300042010	Ga0439452_004297	Ga0439452_004297_1396_2178	260
1242	3300042010	Ga0439452_006545	Ga0439452_006545_1774_2556	260
1243	3300042010	Ga0439452_008266	Ga0439452_008266_1691_2473	260
1244	3300042013	Ga0439456_000166	Ga0439456_000166_16996_17787	260
1245	3300042013	Ga0439456_001408	Ga0439456_001408_4002_4787	260
1246	3300042013	Ga0439456_002609	Ga0439456_002609_2534_3316	260
1247	3300042013	Ga0439456_008235	Ga0439456_008235_554_1336	260
1248	3300042013	Ga0439456_016830	Ga0439456_016830_112_894	260
1249	3300042016	Ga0439463_002590	Ga0439463_002590_3759_4541	260
1250	3300042016	Ga0439463_008995	Ga0439463_008995_468_1253	260
1251	3300042016	Ga0439463_016231	Ga0439463_016231_321_1103	260
1252	3300042115	Ga0450911_000864	Ga0450911_000864_5154_5939	260
1253	3300042115	Ga0450911_003967	Ga0450911_003967_275_1057	260
1254	3300042121	Ga0450919_004555	Ga0450919_004555_748_1530	260
1255	3300042136	Ga0450900_005266	Ga0450900_005266_387_1178	260
1256	3300042136	Ga0450900_010069	Ga0450900_010069_310_1095	260
1257	3300042137	Ga0450902_030102	Ga0450902_030102_83_865	260
1258	3300042138	Ga0450903_002630	Ga0450903_002630_1531_2313	260
1259	3300042138	Ga0450903_007456	Ga0450903_007456_925_1707	260
1260	3300042142	Ga0450905_003212	Ga0450905_003212_478_1260	260
1261	3300042142	Ga0450905_012685	Ga0450905_012685_270_1061	260
1262	3300042145	Ga0450906_001310	Ga0450906_001310_2418_3200	260
1263	3300042146	Ga0450907_000921	Ga0450907_000921_2773_3555	260
1264	3300042146	Ga0450907_002184	Ga0450907_002184_1148_1930	260
1265	3300042146	Ga0450907_002615	Ga0450907_002615_979_1761	260
1266	3300042147	Ga0450910_002467	Ga0450910_002467_1148_1930	260
1267	3300042147	Ga0450910_005672	Ga0450910_005672_553_1335	260
1268	3300042184	Ga0450908_012579	Ga0450908_012579_357_1139	260
1269	3300042185	Ga0450909_001993	Ga0450909_001993_894_1676	260
1270	3300042185	Ga0450909_002887	Ga0450909_002887_364_1146	260
1271	3300042435	Ga0439434_0005074	Ga0439434_0005074_748_1530	260
1272	3300042461	Ga0439460_0000703	Ga0439460_0000703_2681_3463	260
1273	3300042461	Ga0439460_0006439	Ga0439460_0006439_1696_2478	260
1274	3300042531	Ga0450918_008548	Ga0450918_008548_308_1090	260
1275	3300042531	Ga0450918_027855	Ga0450918_027855_134_916	260
1276	3300046452	Ga0495617_002271	Ga0495617_002271_1061_1843	260
1277	3300046452	Ga0495617_013432	Ga0495617_013432_77_862	260
1278	3300046452	Ga0495617_019513	Ga0495617_019513_1204_1989	260
1279	3300046452	Ga0495617_035856	Ga0495617_035856_826_1611	260
1280	3300046452	Ga0495617_041863	Ga0495617_041863_445_1230	260
1281	3300046453	Ga0495627_000013	Ga0495627_000013_238626_239411	260
1282	3300046453	Ga0495627_001543	Ga0495627_001543_2457_3242	260
1283	3300046453	Ga0495627_002603	Ga0495627_002603_2529_3314	260
1284	3300046453	Ga0495627_005677	Ga0495627_005677_4125_4910	260
1285	3300046453	Ga0495627_006905	Ga0495627_006905_3527_4312	260
1286	3300046453	Ga0495627_008854	Ga0495627_008854_2464_3249	260
1287	3300046453	Ga0495627_028737	Ga0495627_028737_71_853	260
1288	3300046453	Ga0495627_045155	Ga0495627_045155_286_1071	260
1289	3300046455	Ga0495603_0044895	Ga0495603_0044895_1526_2308	260
1290	3300046455	Ga0495603_0147459	Ga0495603_0147459_61_846	260
1291	3300046457	Ga0495590_0006189	Ga0495590_0006189_3641_4423	260
1292	3300046457	Ga0495590_0031095	Ga0495590_0031095_303_1088	260
1293	3300046457	Ga0495590_0038108	Ga0495590_0038108_365_1150	260
1294	3300046457	Ga0495590_0065604	Ga0495590_0065604_415_1200	260
1295	3300046457	Ga0495590_0101052	Ga0495590_0101052_66_848	260
1296	3300046458	Ga0495591_000020	Ga0495591_000020_132015_132800	260
1297	3300046458	Ga0495591_000376	Ga0495591_000376_31523_32308	260
1298	3300046458	Ga0495591_000959	Ga0495591_000959_12715_13500	260
1299	3300046458	Ga0495591_003817	Ga0495591_003817_3235_4020	260
1300	3300046458	Ga0495591_003863	Ga0495591_003863_6466_7251	260
1301	3300046458	Ga0495591_003878	Ga0495591_003878_51_836	260
1302	3300046458	Ga0495591_004517	Ga0495591_004517_5342_6127	260
1303	3300046458	Ga0495591_009968	Ga0495591_009968_627_1412	260
1304	3300046458	Ga0495591_010153	Ga0495591_010153_2838_3623	260
1305	3300046458	Ga0495591_012752	Ga0495591_012752_539_1324	260
1306	3300046458	Ga0495591_013718	Ga0495591_013718_407_1192	260
1307	3300046458	Ga0495591_015190	Ga0495591_015190_382_1164	260
1308	3300046460	Ga0495638_0013958	Ga0495638_0013958_2126_2908	260
1309	3300046460	Ga0495638_0016718	Ga0495638_0016718_4010_4795	260
1310	3300046460	Ga0495638_0017681	Ga0495638_0017681_2670_3455	260
1311	3300046460	Ga0495638_0020383	Ga0495638_0020383_1930_2715	260
1312	3300046460	Ga0495638_0022970	Ga0495638_0022970_2972_3757	260
1313	3300046460	Ga0495638_0026186	Ga0495638_0026186_46_828	260
1314	3300046460	Ga0495638_0063189	Ga0495638_0063189_1341_2123	260
1315	3300046460	Ga0495638_0091879	Ga0495638_0091879_253_1038	260
1316	3300046463	Ga0495653_0031492	Ga0495653_0031492_1080_1862	260
1317	3300046463	Ga0495653_0043635	Ga0495653_0043635_345_1127	260
1318	3300046471	Ga0495650_0000221	Ga0495650_0000221_35170_35955	260
1319	3300046471	Ga0495650_0015410	Ga0495650_0015410_1724_2509	260
1320	3300046471	Ga0495650_0015935	Ga0495650_0015935_263_1048	260
1321	3300046471	Ga0495650_0016280	Ga0495650_0016280_2204_2986	260
1322	3300046471	Ga0495650_0017300	Ga0495650_0017300_2696_3481	260
1323	3300046471	Ga0495650_0017951	Ga0495650_0017951_2357_3142	260
1324	3300046471	Ga0495650_0022429	Ga0495650_0022429_540_1325	260
1325	3300046471	Ga0495650_0026218	Ga0495650_0026218_1037_1822	260
1326	3300046471	Ga0495650_0053516	Ga0495650_0053516_181_966	260
1327	3300046471	Ga0495650_0069701	Ga0495650_0069701_338_1123	260
1328	3300046474	Ga0495605_0000032	Ga0495605_0000032_123508_124293	260
1329	3300046474	Ga0495605_0001592	Ga0495605_0001592_3889_4674	260
1330	3300046474	Ga0495605_0017142	Ga0495605_0017142_2341_3123	260
1331	3300046474	Ga0495605_0020200	Ga0495605_0020200_2325_3110	260
1332	3300046474	Ga0495605_0025388	Ga0495605_0025388_677_1459	260
1333	3300046474	Ga0495605_0029459	Ga0495605_0029459_614_1399	260
1334	3300046474	Ga0495605_0034743	Ga0495605_0034743_260_1045	260
1335	3300046474	Ga0495605_0035412	Ga0495605_0035412_1004_1786	260
1336	3300046475	Ga0495639_0001688	Ga0495639_0001688_6491_7273	260
1337	3300046475	Ga0495639_0021967	Ga0495639_0021967_925_1707	260
1338	3300046475	Ga0495639_0117623	Ga0495639_0117623_400_1182	260
1339	3300046491	Ga0495584_0005692	Ga0495584_0005692_1633_2418	260
1340	3300046491	Ga0495584_0011026	Ga0495584_0011026_1527_2312	260
1341	3300046491	Ga0495584_0014019	Ga0495584_0014019_898_1680	260
1342	3300046491	Ga0495584_0021856	Ga0495584_0021856_2376_3161	260
1343	3300046491	Ga0495584_0023054	Ga0495584_0023054_290_1072	260
1344	3300046491	Ga0495584_0031122	Ga0495584_0031122_1733_2518	260
1345	3300046491	Ga0495584_0075348	Ga0495584_0075348_457_1242	260
1346	3300046491	Ga0495584_0088276	Ga0495584_0088276_666_1451	260
1347	3300046491	Ga0495584_0121597	Ga0495584_0121597_65_850	260
1348	3300046492	Ga0495585_0000483	Ga0495585_0000483_30614_31399	260
1349	3300046492	Ga0495585_0011393	Ga0495585_0011393_1831_2616	260
1350	3300046492	Ga0495585_0013809	Ga0495585_0013809_2250_3035	260
1351	3300046492	Ga0495585_0022993	Ga0495585_0022993_158_943	260
1352	3300046492	Ga0495585_0025024	Ga0495585_0025024_2157_2939	260
1353	3300046492	Ga0495585_0102150	Ga0495585_0102150_208_993	260
1354	3300046492	Ga0495585_0129285	Ga0495585_0129285_431_1216	260
1355	3300046499	Ga0495594_0000489	Ga0495594_0000489_11033_11818	260
1356	3300046499	Ga0495594_0012490	Ga0495594_0012490_2976_3758	260
1357	3300046499	Ga0495594_0022396	Ga0495594_0022396_1066_1848	260
1358	3300046500	Ga0495596_0000231	Ga0495596_0000231_5348_6133	260
1359	3300046500	Ga0495596_0015010	Ga0495596_0015010_1249_2034	260
1360	3300046501	Ga0495607_0000129	Ga0495607_0000129_71350_72135	260
1361	3300046501	Ga0495607_0000281	Ga0495607_0000281_40687_41472	260
1362	3300046501	Ga0495607_0002338	Ga0495607_0002338_12149_12934	260
1363	3300046501	Ga0495607_0003762	Ga0495607_0003762_2359_3144	260
1364	3300046501	Ga0495607_0006147	Ga0495607_0006147_3221_4006	260
1365	3300046501	Ga0495607_0007868	Ga0495607_0007868_2607_3392	260
1366	3300046501	Ga0495607_0009865	Ga0495607_0009865_3277_4062	260
1367	3300046501	Ga0495607_0009959	Ga0495607_0009959_3226_4008	260
1368	3300046501	Ga0495607_0012067	Ga0495607_0012067_2404_3186	260
1369	3300046501	Ga0495607_0018409	Ga0495607_0018409_2860_3645	260
1370	3300046501	Ga0495607_0020217	Ga0495607_0020217_792_1577	260
1371	3300046501	Ga0495607_0022260	Ga0495607_0022260_150_935	260
1372	3300046501	Ga0495607_0059064	Ga0495607_0059064_254_1036	260
1373	3300046501	Ga0495607_0072070	Ga0495607_0072070_875_1660	260
1374	3300046501	Ga0495607_0095090	Ga0495607_0095090_89_874	260
1375	3300046501	Ga0495607_0100857	Ga0495607_0100857_271_1056	260
1376	3300046501	Ga0495607_0159233	Ga0495607_0159233_60_845	260
1377	3300046501	Ga0495607_0172156	Ga0495607_0172156_74_859	260
1378	3300046501	Ga0495607_0202809	Ga0495607_0202809_152_937	260
1379	3300046506	Ga0495583_0000052	Ga0495583_0000052_124868_125653	260
1380	3300046506	Ga0495583_0005780	Ga0495583_0005780_4637_5422	260
1381	3300046506	Ga0495583_0008659	Ga0495583_0008659_2749_3531	260
1382	3300046506	Ga0495583_0009370	Ga0495583_0009370_2625_3410	260
1383	3300046506	Ga0495583_0023592	Ga0495583_0023592_1874_2659	260
1384	3300046506	Ga0495583_0023648	Ga0495583_0023648_236_1021	260
1385	3300046506	Ga0495583_0108403	Ga0495583_0108403_75_860	260
1386	3300046507	Ga0495606_0002501	Ga0495606_0002501_18516_19301	260
1387	3300046507	Ga0495606_0003264	Ga0495606_0003264_14546_15331	260
1388	3300046507	Ga0495606_0014464	Ga0495606_0014464_2461_3246	260
1389	3300046507	Ga0495606_0021674	Ga0495606_0021674_1639_2424	260
1390	3300046507	Ga0495606_0025275	Ga0495606_0025275_3202_3987	260
1391	3300046507	Ga0495606_0028239	Ga0495606_0028239_2193_2978	260
1392	3300046507	Ga0495606_0042575	Ga0495606_0042575_20_805	260
1393	3300046507	Ga0495606_0045629	Ga0495606_0045629_411_1196	260
1394	3300046507	Ga0495606_0045634	Ga0495606_0045634_2053_2838	260
1395	3300046507	Ga0495606_0061965	Ga0495606_0061965_433_1218	260
1396	3300046512	Ga0495610_0009928	Ga0495610_0009928_2526_3311	260
1397	3300046512	Ga0495610_0014936	Ga0495610_0014936_2307_3092	260
1398	3300046512	Ga0495610_0021977	Ga0495610_0021977_1717_2502	260
1399	3300046512	Ga0495610_0023134	Ga0495610_0023134_2450_3235	260
1400	3300046512	Ga0495610_0026436	Ga0495610_0026436_2054_2839	260
1401	3300046512	Ga0495610_0033337	Ga0495610_0033337_1506_2288	260
1402	3300046512	Ga0495610_0040827	Ga0495610_0040827_1093_1878	260
1403	3300046512	Ga0495610_0044649	Ga0495610_0044649_940_1725	260
1404	3300046512	Ga0495610_0127116	Ga0495610_0127116_51_836	260
1405	3300046512	Ga0495610_0132532	Ga0495610_0132532_51_836	260
1406	3300046513	Ga0495616_0004932	Ga0495616_0004932_303_1088	260
1407	3300046513	Ga0495616_0006463	Ga0495616_0006463_40_825	260
1408	3300046513	Ga0495616_0010373	Ga0495616_0010373_4365_5150	260
1409	3300046513	Ga0495616_0015102	Ga0495616_0015102_388_1173	260
1410	3300046513	Ga0495616_0018806	Ga0495616_0018806_2911_3693	260
1411	3300046513	Ga0495616_0032842	Ga0495616_0032842_268_1053	260
1412	3300046515	Ga0495620_0000019	Ga0495620_0000019_124188_124973	260
1413	3300046515	Ga0495620_0001475	Ga0495620_0001475_10623_11408	260
1414	3300046515	Ga0495620_0002415	Ga0495620_0002415_1549_2334	260
1415	3300046515	Ga0495620_0008232	Ga0495620_0008232_2346_3131	260
1416	3300046515	Ga0495620_0013369	Ga0495620_0013369_550_1335	260
1417	3300046515	Ga0495620_0017199	Ga0495620_0017199_282_1067	260
1418	3300046515	Ga0495620_0025420	Ga0495620_0025420_1712_2497	260
1419	3300046515	Ga0495620_0097952	Ga0495620_0097952_114_899	260
1420	3300046515	Ga0495620_0126572	Ga0495620_0126572_19_801	260
1421	3300046518	Ga0495631_0003575	Ga0495631_0003575_5295_6080	260
1422	3300046518	Ga0495631_0004375	Ga0495631_0004375_5105_5890	260
1423	3300046518	Ga0495631_0019406	Ga0495631_0019406_548_1333	260
1424	3300046518	Ga0495631_0021543	Ga0495631_0021543_399_1184	260
1425	3300046518	Ga0495631_0035235	Ga0495631_0035235_1219_2004	260
1426	3300046518	Ga0495631_0063462	Ga0495631_0063462_469_1251	260
1427	3300046518	Ga0495631_0084006	Ga0495631_0084006_410_1195	260
1428	3300046519	Ga0495632_0005232	Ga0495632_0005232_6453_7238	260
1429	3300046519	Ga0495632_0006113	Ga0495632_0006113_2437_3219	260
1430	3300046519	Ga0495632_0006454	Ga0495632_0006454_3528_4313	260
1431	3300046519	Ga0495632_0006844	Ga0495632_0006844_1014_1796	260
1432	3300046519	Ga0495632_0012140	Ga0495632_0012140_1796_2581	260
1433	3300046519	Ga0495632_0013249	Ga0495632_0013249_3417_4202	260
1434	3300046519	Ga0495632_0019096	Ga0495632_0019096_2844_3629	260
1435	3300046519	Ga0495632_0022612	Ga0495632_0022612_158_943	260
1436	3300046519	Ga0495632_0031695	Ga0495632_0031695_952_1737	260
1437	3300046519	Ga0495632_0047460	Ga0495632_0047460_51_836	260
1438	3300046519	Ga0495632_0063457	Ga0495632_0063457_715_1500	260
1439	3300046519	Ga0495632_0075076	Ga0495632_0075076_384_1169	260
1440	3300046519	Ga0495632_0077643	Ga0495632_0077643_14_799	260
1441	3300046519	Ga0495632_0143206	Ga0495632_0143206_101_886	260
1442	3300046520	Ga0495637_0000594	Ga0495637_0000594_18429_19214	260
1443	3300046520	Ga0495637_0001738	Ga0495637_0001738_3629_4414	260
1444	3300046520	Ga0495637_0004300	Ga0495637_0004300_6309_7094	260
1445	3300046520	Ga0495637_0004996	Ga0495637_0004996_462_1247	260
1446	3300046520	Ga0495637_0006530	Ga0495637_0006530_2516_3298	260
1447	3300046520	Ga0495637_0015582	Ga0495637_0015582_93_878	260
1448	3300046520	Ga0495637_0018438	Ga0495637_0018438_299_1081	260
1449	3300046520	Ga0495637_0018494	Ga0495637_0018494_1173_1958	260
1450	3300046520	Ga0495637_0018614	Ga0495637_0018614_227_1009	260
1451	3300046520	Ga0495637_0027372	Ga0495637_0027372_32_817	260
1452	3300046520	Ga0495637_0040098	Ga0495637_0040098_873_1658	260
1453	3300046520	Ga0495637_0041085	Ga0495637_0041085_355_1140	260
1454	3300046520	Ga0495637_0058651	Ga0495637_0058651_716_1501	260
1455	3300046520	Ga0495637_0076474	Ga0495637_0076474_250_1035	260
1456	3300046522	Ga0495643_0003942	Ga0495643_0003942_9674_10459	260
1457	3300046522	Ga0495643_0012511	Ga0495643_0012511_1059_1841	260
1458	3300046522	Ga0495643_0019888	Ga0495643_0019888_664_1446	260
1459	3300046522	Ga0495643_0022853	Ga0495643_0022853_745_1530	260
1460	3300046522	Ga0495643_0028918	Ga0495643_0028918_1769_2554	260
1461	3300046522	Ga0495643_0035123	Ga0495643_0035123_1671_2456	260
1462	3300046522	Ga0495643_0048043	Ga0495643_0048043_1380_2165	260
1463	3300046522	Ga0495643_0071049	Ga0495643_0071049_638_1423	260
1464	3300046523	Ga0495644_0003180	Ga0495644_0003180_2133_2918	260
1465	3300046523	Ga0495644_0008888	Ga0495644_0008888_3031_3816	260
1466	3300046523	Ga0495644_0022160	Ga0495644_0022160_1039_1821	260
1467	3300046523	Ga0495644_0076496	Ga0495644_0076496_152_937	260
1468	3300046523	Ga0495644_0144380	Ga0495644_0144380_31_816	260
1469	3300046524	Ga0495648_0001346	Ga0495648_0001346_6519_7301	260
1470	3300046524	Ga0495648_0004086	Ga0495648_0004086_51_836	260
1471	3300046524	Ga0495648_0008572	Ga0495648_0008572_3015_3800	260
1472	3300046524	Ga0495648_0009557	Ga0495648_0009557_6480_7265	260
1473	3300046524	Ga0495648_0011579	Ga0495648_0011579_1658_2443	260
1474	3300046524	Ga0495648_0019025	Ga0495648_0019025_1452_2237	260
1475	3300046524	Ga0495648_0019797	Ga0495648_0019797_1379_2164	260
1476	3300046524	Ga0495648_0032635	Ga0495648_0032635_663_1445	260
1477	3300046524	Ga0495648_0038460	Ga0495648_0038460_1681_2466	260
1478	3300046524	Ga0495648_0043477	Ga0495648_0043477_1568_2350	260
1479	3300046524	Ga0495648_0047808	Ga0495648_0047808_198_983	260
1480	3300046524	Ga0495648_0064471	Ga0495648_0064471_1353_2138	260
1481	3300046524	Ga0495648_0074826	Ga0495648_0074826_160_945	260
1482	3300046524	Ga0495648_0090667	Ga0495648_0090667_167_952	260
1483	3300046524	Ga0495648_0196486	Ga0495648_0196486_54_839	260
1484	3300046526	Ga0495666_0013202	Ga0495666_0013202_2790_3572	260
1485	3300046526	Ga0495666_0072634	Ga0495666_0072634_73_855	260
1486	3300046528	Ga0495642_0001439	Ga0495642_0001439_2388_3170	260
1487	3300046528	Ga0495642_0001517	Ga0495642_0001517_2309_3091	260
1488	3300046528	Ga0495642_0007727	Ga0495642_0007727_943_1725	260
1489	3300046528	Ga0495642_0008591	Ga0495642_0008591_399_1184	260
1490	3300046529	Ga0495652_0143017	Ga0495652_0143017_147_932	260
1491	3300046530	Ga0495654_0000925	Ga0495654_0000925_17712_18497	260
1492	3300046530	Ga0495654_0007272	Ga0495654_0007272_2405_3190	260
1493	3300046530	Ga0495654_0007276	Ga0495654_0007276_2927_3712	260
1494	3300046530	Ga0495654_0010122	Ga0495654_0010122_2277_3062	260
1495	3300046530	Ga0495654_0010429	Ga0495654_0010429_3528_4313	260
1496	3300046530	Ga0495654_0015766	Ga0495654_0015766_1735_2517	260
1497	3300046530	Ga0495654_0016015	Ga0495654_0016015_281_1063	260
1498	3300046530	Ga0495654_0038557	Ga0495654_0038557_396_1181	260
1499	3300046530	Ga0495654_0045201	Ga0495654_0045201_27_812	260
1500	3300046530	Ga0495654_0047960	Ga0495654_0047960_349_1131	260
1501	3300046530	Ga0495654_0061945	Ga0495654_0061945_263_1048	260
1502	3300046530	Ga0495654_0102643	Ga0495654_0102643_327_1112	260
1503	3300046530	Ga0495654_0104369	Ga0495654_0104369_371_1156	260
1504	3300046530	Ga0495654_0106785	Ga0495654_0106785_233_1018	260
1505	3300046535	Ga0495586_0020317	Ga0495586_0020317_2352_3134	260
1506	3300046536	Ga0495587_0064163	Ga0495587_0064163_458_1240	260
1507	3300046538	Ga0495609_0000032	Ga0495609_0000032_86232_87017	260
1508	3300046538	Ga0495609_0000563	Ga0495609_0000563_27081_27866	260
1509	3300046538	Ga0495609_0003267	Ga0495609_0003267_8454_9239	260
1510	3300046538	Ga0495609_0005350	Ga0495609_0005350_595_1380	260
1511	3300046538	Ga0495609_0022356	Ga0495609_0022356_1127_1909	260
1512	3300046538	Ga0495609_0029563	Ga0495609_0029563_620_1405	260
1513	3300046538	Ga0495609_0048994	Ga0495609_0048994_265_1047	260
1514	3300046538	Ga0495609_0052289	Ga0495609_0052289_726_1511	260
1515	3300046542	Ga0495597_0000004	Ga0495597_0000004_235474_236259	260
1516	3300046542	Ga0495597_0005721	Ga0495597_0005721_221_1006	260
1517	3300046542	Ga0495597_0006383	Ga0495597_0006383_2391_3176	260
1518	3300046542	Ga0495597_0010493	Ga0495597_0010493_2366_3151	260
1519	3300046542	Ga0495597_0012939	Ga0495597_0012939_1014_1796	260
1520	3300046542	Ga0495597_0019019	Ga0495597_0019019_792_1577	260
1521	3300046542	Ga0495597_0027400	Ga0495597_0027400_397_1182	260
1522	3300046542	Ga0495597_0061997	Ga0495597_0061997_637_1422	260
1523	3300046542	Ga0495597_0068452	Ga0495597_0068452_311_1096	260
1524	3300046542	Ga0495597_0123804	Ga0495597_0123804_56_841	260
1525	3300046543	Ga0495645_0131802	Ga0495645_0131802_79_864	260
1526	3300046557	Ga0495622_0001828	Ga0495622_0001828_2658_3440	260
1527	3300046557	Ga0495622_0002145	Ga0495622_0002145_2366_3148	260
1528	3300046557	Ga0495622_0002533	Ga0495622_0002533_5664_6449	260
1529	3300046557	Ga0495622_0020085	Ga0495622_0020085_2171_2956	260
1530	3300046557	Ga0495622_0031561	Ga0495622_0031561_1264_2049	260
1531	3300046557	Ga0495622_0161187	Ga0495622_0161187_175_957	260
1532	3300046558	Ga0495633_0000040	Ga0495633_0000040_52565_53350	260
1533	3300046558	Ga0495633_0010871	Ga0495633_0010871_1614_2399	260
1534	3300046558	Ga0495633_0019399	Ga0495633_0019399_350_1135	260
1535	3300046615	Ga0495656_0059682	Ga0495656_0059682_227_1009	260
1536	3300046616	Ga0495668_0017610	Ga0495668_0017610_684_1469	260
1537	3300046616	Ga0495668_0019466	Ga0495668_0019466_2785_3570	260
1538	3300046616	Ga0495668_0019934	Ga0495668_0019934_1604_2389	260
1539	3300046616	Ga0495668_0036480	Ga0495668_0036480_1333_2118	260
1540	3300046616	Ga0495668_0102069	Ga0495668_0102069_156_938	260
1541	3300046648	Ga0495611_0000814	Ga0495611_0000814_15371_16156	260
1542	3300046648	Ga0495611_0001050	Ga0495611_0001050_11411_12196	260
1543	3300046648	Ga0495611_0004555	Ga0495611_0004555_2151_2936	260
1544	3300046648	Ga0495611_0021523	Ga0495611_0021523_108_893	260
1545	3300046648	Ga0495611_0038974	Ga0495611_0038974_926_1708	260
1546	3300046648	Ga0495611_0081260	Ga0495611_0081260_156_938	260
1547	3300046660	Ga0495625_0000010	Ga0495625_0000010_294418_295203	260
1548	3300046660	Ga0495625_0028113	Ga0495625_0028113_1929_2714	260
1549	3300046660	Ga0495625_0032031	Ga0495625_0032031_2927_3712	260
1550	3300046660	Ga0495625_0034383	Ga0495625_0034383_2501_3286	260
1551	3300046660	Ga0495625_0048330	Ga0495625_0048330_747_1532	260
1552	3300046660	Ga0495625_0103159	Ga0495625_0103159_340_1122	260
1553	3300046660	Ga0495625_0339840	Ga0495625_0339840_157_939	260
1554	3300046663	Ga0495635_0007004	Ga0495635_0007004_6197_6979	260
1555	3300046664	Ga0495659_0001077	Ga0495659_0001077_2276_3058	260
1556	3300046664	Ga0495659_0007439	Ga0495659_0007439_2333_3115	260
1557	3300046665	Ga0495661_0000037	Ga0495661_0000037_122930_123715	260
1558	3300046665	Ga0495661_0001285	Ga0495661_0001285_18419_19204	260
1559	3300046665	Ga0495661_0037263	Ga0495661_0037263_1613_2398	260
1560	3300046665	Ga0495661_0042258	Ga0495661_0042258_480_1265	260
1561	3300046665	Ga0495661_0052498	Ga0495661_0052498_1416_2201	260
1562	3300046665	Ga0495661_0108991	Ga0495661_0108991_576_1361	260
1563	3300046665	Ga0495661_0113929	Ga0495661_0113929_656_1441	260
1564	3300046665	Ga0495661_0227440	Ga0495661_0227440_96_878	260
1565	3300046665	Ga0495661_0261593	Ga0495661_0261593_22_807	260
1566	3300046674	Ga0495588_0021148	Ga0495588_0021148_312_1097	260
1567	3300046674	Ga0495588_0077324	Ga0495588_0077324_664_1446	260
1568	3300046679	Ga0495623_0024631	Ga0495623_0024631_2495_3277	260
1569	3300046684	Ga0495669_0008510	Ga0495669_0008510_767_1549	260
1570	3300046689	Ga0495613_0099630	Ga0495613_0099630_907_1689	260
1571	3300046690	Ga0495624_0011291	Ga0495624_0011291_4716_5501	260
1572	3300046691	Ga0495670_0001570	Ga0495670_0001570_793_1578	260
1573	3300046691	Ga0495670_0004104	Ga0495670_0004104_437_1219	260
1574	3300046691	Ga0495670_0025568	Ga0495670_0025568_1778_2560	260
1575	3300046691	Ga0495670_0065527	Ga0495670_0065527_760_1545	260
1576	3300046691	Ga0495670_0117768	Ga0495670_0117768_171_956	260
1577	3300046692	Ga0495671_0002715	Ga0495671_0002715_1646_2431	260
1578	3300046692	Ga0495671_0008100	Ga0495671_0008100_2463_3245	260
1579	3300046692	Ga0495671_0012661	Ga0495671_0012661_1374_2156	260
1580	3300046692	Ga0495671_0016365	Ga0495671_0016365_2637_3422	260
1581	3300046692	Ga0495671_0020690	Ga0495671_0020690_588_1373	260
1582	3300046692	Ga0495671_0024151	Ga0495671_0024151_54_839	260
1583	3300046692	Ga0495671_0025353	Ga0495671_0025353_316_1101	260
1584	3300046692	Ga0495671_0028131	Ga0495671_0028131_677_1462	260
1585	3300046692	Ga0495671_0028202	Ga0495671_0028202_314_1099	260
1586	3300046692	Ga0495671_0029075	Ga0495671_0029075_79_864	260
1587	3300046692	Ga0495671_0032166	Ga0495671_0032166_1776_2561	260
1588	3300046692	Ga0495671_0053335	Ga0495671_0053335_77_859	260
1589	3300046694	Ga0495649_0010080	Ga0495649_0010080_1291_2076	260
1590	3300046694	Ga0495649_0012004	Ga0495649_0012004_2134_2919	260
1591	3300046694	Ga0495649_0019023	Ga0495649_0019023_2707_3489	260
1592	3300046694	Ga0495649_0020998	Ga0495649_0020998_343_1128	260
1593	3300046694	Ga0495649_0027552	Ga0495649_0027552_1196_1981	260
1594	3300046694	Ga0495649_0056458	Ga0495649_0056458_81_863	260
1595	3300046694	Ga0495649_0060394	Ga0495649_0060394_1053_1838	260
1596	3300046694	Ga0495649_0127404	Ga0495649_0127404_128_913	260
1597	3300046794	Ga0495589_0002228	Ga0495589_0002228_7679_8464	260
1598	3300046794	Ga0495589_0002536	Ga0495589_0002536_6701_7486	260
1599	3300046794	Ga0495589_0003006	Ga0495589_0003006_2393_3175	260
1600	3300046794	Ga0495589_0012264	Ga0495589_0012264_3375_4160	260
1601	3300046794	Ga0495589_0040630	Ga0495589_0040630_536_1318	260
1602	3300046794	Ga0495589_0051265	Ga0495589_0051265_739_1524	260
1603	3300046794	Ga0495589_0083315	Ga0495589_0083315_726_1511	260
1604	3300046809	Ga0495600_0060791	Ga0495600_0060791_689_1474	260
1605	3300046809	Ga0495600_0175113	Ga0495600_0175113_387_1169	260
1606	3300046810	Ga0495660_0001556	Ga0495660_0001556_10935_11720	260
1607	3300046810	Ga0495660_0010294	Ga0495660_0010294_972_1757	260
1608	3300046810	Ga0495660_0010989	Ga0495660_0010989_3550_4335	260
1609	3300046810	Ga0495660_0011476	Ga0495660_0011476_4307_5092	260
1610	3300046810	Ga0495660_0014523	Ga0495660_0014523_617_1402	260
1611	3300046810	Ga0495660_0014720	Ga0495660_0014720_33_818	260
1612	3300046810	Ga0495660_0014764	Ga0495660_0014764_2489_3274	260
1613	3300046810	Ga0495660_0022502	Ga0495660_0022502_1034_1819	260
1614	3300046810	Ga0495660_0022655	Ga0495660_0022655_265_1050	260
1615	3300046810	Ga0495660_0038528	Ga0495660_0038528_124_909	260
1616	3300046810	Ga0495660_0041184	Ga0495660_0041184_1184_1969	260
1617	3300046810	Ga0495660_0060826	Ga0495660_0060826_910_1695	260
1618	3300046810	Ga0495660_0189361	Ga0495660_0189361_73_858	260
1619	3300046810	Ga0495660_0209456	Ga0495660_0209456_33_818	260
1620	3300047317	Ga0495604_0036787	Ga0495604_0036787_1222_2004	260
1621	3300047317	Ga0495604_0074966	Ga0495604_0074966_586_1371	260
1622	3300047317	Ga0495604_0300872	Ga0495604_0300872_182_964	260
1623	3300047318	Ga0495636_0008220	Ga0495636_0008220_978_1760	260
1624	3300047320	Ga0495672_0002942	Ga0495672_0002942_11637_12422	260
1625	3300047320	Ga0495672_0010001	Ga0495672_0010001_5699_6484	260
1626	3300047320	Ga0495672_0011385	Ga0495672_0011385_2311_3096	260
1627	3300047320	Ga0495672_0012759	Ga0495672_0012759_2727_3512	260
1628	3300047320	Ga0495672_0016828	Ga0495672_0016828_1681_2463	260
1629	3300047320	Ga0495672_0017581	Ga0495672_0017581_2067_2849	260
1630	3300047320	Ga0495672_0023302	Ga0495672_0023302_2240_3025	260
1631	3300047320	Ga0495672_0029537	Ga0495672_0029537_1584_2369	260
1632	3300047320	Ga0495672_0031749	Ga0495672_0031749_756_1541	260
1633	3300047320	Ga0495672_0045762	Ga0495672_0045762_1570_2352	260
1634	3300047320	Ga0495672_0051231	Ga0495672_0051231_419_1201	260
1635	3300047320	Ga0495672_0082673	Ga0495672_0082673_350_1135	260
1636	3300047320	Ga0495672_0122856	Ga0495672_0122856_563_1348	260
1637	3300047320	Ga0495672_0160839	Ga0495672_0160839_96_881	260
1638	3300047321	Ga0495676_0000002	Ga0495676_0000002_89427_90212	260
1639	3300047321	Ga0495676_0013290	Ga0495676_0013290_6393_7178	260
1640	3300047322	Ga0495680_0024428	Ga0495680_0024428_2380_3162	260
1641	3300047322	Ga0495680_0051783	Ga0495680_0051783_2317_3099	260
1642	3300047322	Ga0495680_0062937	Ga0495680_0062937_1466_2251	260
1643	3300047322	Ga0495680_0085465	Ga0495680_0085465_165_947	260
1644	3300047323	Ga0495683_0000011	Ga0495683_0000011_125033_125818	260
1645	3300047323	Ga0495683_0003963	Ga0495683_0003963_2528_3313	260
1646	3300047323	Ga0495683_0014227	Ga0495683_0014227_3157_3942	260
1647	3300047323	Ga0495683_0021191	Ga0495683_0021191_2068_2850	260
1648	3300047323	Ga0495683_0050460	Ga0495683_0050460_809_1594	260
1649	3300047323	Ga0495683_0069872	Ga0495683_0069872_297_1082	260
1650	3300047323	Ga0495683_0166114	Ga0495683_0166114_121_903	260
1651	3300047443	Ga0495687_013802	Ga0495687_013802_2760_3542	260
1652	3300047443	Ga0495687_032472	Ga0495687_032472_1540_2322	260
1653	3300047443	Ga0495687_033653	Ga0495687_033653_1357_2142	260
1654	3300047445	Ga0495677_0008561	Ga0495677_0008561_250_1032	260
1655	3300047446	Ga0495679_002295	Ga0495679_002295_7878_8663	260
1656	3300047446	Ga0495679_002642	Ga0495679_002642_6768_7553	260
1657	3300047446	Ga0495679_003615	Ga0495679_003615_6403_7188	260
1658	3300047446	Ga0495679_011865	Ga0495679_011865_23_808	260
1659	3300047446	Ga0495679_013862	Ga0495679_013862_21_806	260
1660	3300047446	Ga0495679_014617	Ga0495679_014617_1797_2582	260
1661	3300047446	Ga0495679_021746	Ga0495679_021746_368_1153	260
1662	3300047446	Ga0495679_051669	Ga0495679_051669_110_892	260
1663	3300047446	Ga0495679_056153	Ga0495679_056153_55_840	260
1664	3300047469	Ga0495673_0000573	Ga0495673_0000573_8047_8832	260
1665	3300047469	Ga0495673_0003056	Ga0495673_0003056_2412_3197	260
1666	3300047469	Ga0495673_0004805	Ga0495673_0004805_2318_3103	260
1667	3300047469	Ga0495673_0005998	Ga0495673_0005998_4066_4851	260
1668	3300047469	Ga0495673_0007572	Ga0495673_0007572_4240_5025	260
1669	3300047469	Ga0495673_0007854	Ga0495673_0007854_4928_5713	260
1670	3300047469	Ga0495673_0009619	Ga0495673_0009619_3658_4440	260
1671	3300047469	Ga0495673_0012468	Ga0495673_0012468_1320_2105	260
1672	3300047469	Ga0495673_0013191	Ga0495673_0013191_2824_3606	260
1673	3300047469	Ga0495673_0015791	Ga0495673_0015791_460_1245	260
1674	3300047469	Ga0495673_0025079	Ga0495673_0025079_306_1091	260
1675	3300047469	Ga0495673_0030569	Ga0495673_0030569_1258_2043	260
1676	3300047469	Ga0495673_0032618	Ga0495673_0032618_1344_2129	260
1677	3300047469	Ga0495673_0040500	Ga0495673_0040500_860_1645	260
1678	3300047469	Ga0495673_0042538	Ga0495673_0042538_354_1139	260
1679	3300047469	Ga0495673_0086144	Ga0495673_0086144_321_1106	260
1680	3300047469	Ga0495673_0123847	Ga0495673_0123847_51_836	260
1681	3300047469	Ga0495673_0148604	Ga0495673_0148604_25_807	260
1682	3300047470	Ga0495681_0002515	Ga0495681_0002515_9819_10604	260
1683	3300047470	Ga0495681_0004285	Ga0495681_0004285_3149_3934	260
1684	3300047470	Ga0495681_0006355	Ga0495681_0006355_6687_7472	260
1685	3300047470	Ga0495681_0007065	Ga0495681_0007065_4938_5723	260
1686	3300047470	Ga0495681_0007894	Ga0495681_0007894_2388_3173	260
1687	3300047470	Ga0495681_0009655	Ga0495681_0009655_402_1184	260
1688	3300047470	Ga0495681_0011886	Ga0495681_0011886_1848_2633	260
1689	3300047470	Ga0495681_0014289	Ga0495681_0014289_2360_3145	260
1690	3300047470	Ga0495681_0019776	Ga0495681_0019776_649_1434	260
1691	3300047470	Ga0495681_0041553	Ga0495681_0041553_117_902	260
1692	3300047470	Ga0495681_0050320	Ga0495681_0050320_190_975	260
1693	3300047470	Ga0495681_0083805	Ga0495681_0083805_457_1242	260
1694	3300047472	Ga0495686_0003332	Ga0495686_0003332_10882_11667	260
1695	3300047472	Ga0495686_0017065	Ga0495686_0017065_1721_2506	260
1696	3300047472	Ga0495686_0047518	Ga0495686_0047518_1657_2442	260
1697	3300047472	Ga0495686_0110888	Ga0495686_0110888_508_1293	260
1698	3300047472	Ga0495686_0155524	Ga0495686_0155524_132_917	260
1699	3300047673	Ga0495593_0022979	Ga0495593_0022979_2629_3411	260
1700	3300047673	Ga0495593_0032827	Ga0495593_0032827_1296_2081	260
1701	3300047673	Ga0495593_0243870	Ga0495593_0243870_100_882	260
1702	3300047673	Ga0495593_0245923	Ga0495593_0245923_64_846	260
1703	3300048088	Ga0495602_0087907	Ga0495602_0087907_315_1100	260
1704	3300048091	Ga0495626_0000007	Ga0495626_0000007_88393_89178	260
1705	3300048091	Ga0495626_0000246	Ga0495626_0000246_30898_31683	260
1706	3300048091	Ga0495626_0003502	Ga0495626_0003502_6939_7724	260
1707	3300048091	Ga0495626_0009950	Ga0495626_0009950_1442_2227	260
1708	3300048091	Ga0495626_0010191	Ga0495626_0010191_2164_2949	260
1709	3300048091	Ga0495626_0010869	Ga0495626_0010869_2305_3090	260
1710	3300048091	Ga0495626_0014076	Ga0495626_0014076_487_1272	260
1711	3300048091	Ga0495626_0019958	Ga0495626_0019958_2481_3263	260
1712	3300048091	Ga0495626_0058363	Ga0495626_0058363_766_1548	260
1713	3300048091	Ga0495626_0064015	Ga0495626_0064015_849_1634	260
1714	3300048091	Ga0495626_0072012	Ga0495626_0072012_749_1531	260
1715	3300048904	Ga0496101_0216052	Ga0496101_0216052_527_1312	260
1716	3300048914	Ga0496111_0098269	Ga0496111_0098269_77_862	260
1717	3300048914	Ga0496111_0113818	Ga0496111_0113818_235_1017	260
1718	3300048919	Ga0496116_0000085	Ga0496116_0000085_156445_157227	260
1719	3300048919	Ga0496116_0006943	Ga0496116_0006943_6997_7782	260
1720	3300048919	Ga0496116_0009249	Ga0496116_0009249_528_1313	260
1721	3300048919	Ga0496116_0034158	Ga0496116_0034158_2649_3434	260
1722	3300048919	Ga0496116_0131054	Ga0496116_0131054_413_1198	260
1723	3300048920	Ga0496117_0002373	Ga0496117_0002373_11613_12395	260
1724	3300048920	Ga0496117_0036246	Ga0496117_0036246_2702_3487	260
1725	3300048920	Ga0496117_0047138	Ga0496117_0047138_434_1219	260
1726	3300048920	Ga0496117_0118652	Ga0496117_0118652_720_1505	260
1727	3300048920	Ga0496117_0144823	Ga0496117_0144823_532_1317	260
1728	3300048920	Ga0496117_0236909	Ga0496117_0236909_57_842	260
1729	3300048921	Ga0496118_0019359	Ga0496118_0019359_516_1298	260
1730	3300048921	Ga0496118_0041389	Ga0496118_0041389_2698_3483	260
1731	3300048921	Ga0496118_0064444	Ga0496118_0064444_322_1107	260
1732	3300048921	Ga0496118_0085212	Ga0496118_0085212_474_1259	260
1733	3300048921	Ga0496118_0147697	Ga0496118_0147697_302_1087	260
1734	3300048921	Ga0496118_0150084	Ga0496118_0150084_43_828	260
1735	3300048924	Ga0496121_0000505	Ga0496121_0000505_11509_12291	260
1736	3300048924	Ga0496121_0015365	Ga0496121_0015365_76_861	260
1737	3300048924	Ga0496121_0020861	Ga0496121_0020861_2904_3689	260
1738	3300048924	Ga0496121_0052342	Ga0496121_0052342_2543_3328	260
1739	3300048924	Ga0496121_0066940	Ga0496121_0066940_1594_2385	260
1740	3300048924	Ga0496121_0176115	Ga0496121_0176115_628_1413	260
1741	3300048925	Ga0496122_0000945	Ga0496122_0000945_7075_7860	260
1742	3300048925	Ga0496122_0005538	Ga0496122_0005538_969_1754	260
1743	3300048925	Ga0496122_0007437	Ga0496122_0007437_671_1453	260
1744	3300048925	Ga0496122_0060147	Ga0496122_0060147_1138_1923	260
1745	3300048925	Ga0496122_0123740	Ga0496122_0123740_476_1261	260
1746	3300048925	Ga0496122_0126741	Ga0496122_0126741_140_925	260
1747	3300048926	Ga0496123_0000888	Ga0496123_0000888_44593_45378	260
1748	3300048926	Ga0496123_0003233	Ga0496123_0003233_17090_17872	260
1749	3300048926	Ga0496123_0060800	Ga0496123_0060800_1031_1816	260
1750	3300048926	Ga0496123_0100683	Ga0496123_0100683_789_1574	260
1751	3300048926	Ga0496123_0137759	Ga0496123_0137759_62_847	260
1752	3300048927	Ga0496124_0000807	Ga0496124_0000807_2576_3361	260
1753	3300048927	Ga0496124_0018964	Ga0496124_0018964_2895_3680	260
1754	3300048927	Ga0496124_0160210	Ga0496124_0160210_671_1456	260
1755	3300048927	Ga0496124_0182327	Ga0496124_0182327_11_796	260
1756	3300048927	Ga0496124_0321103	Ga0496124_0321103_85_870	260
1757	3300048928	Ga0496125_0041313	Ga0496125_0041313_2518_3300	260
1758	3300048928	Ga0496125_0172347	Ga0496125_0172347_630_1415	260
1759	3300048928	Ga0496125_0179356	Ga0496125_0179356_100_885	260
1760	3300048928	Ga0496125_0309013	Ga0496125_0309013_123_908	260
1761	3300048929	Ga0496126_0283466	Ga0496126_0283466_73_858	260
1762	3300049459	Ga0495678_000033	Ga0495678_000033_86819_87604	260
1763	3300049459	Ga0495678_002996	Ga0495678_002996_2343_3128	260
1764	3300049459	Ga0495678_007050	Ga0495678_007050_2864_3649	260
1765	3300049459	Ga0495678_007571	Ga0495678_007571_2311_3093	260
1766	3300049459	Ga0495678_008995	Ga0495678_008995_3955_4740	260
1767	3300049459	Ga0495678_015114	Ga0495678_015114_1656_2441	260
1768	3300049459	Ga0495678_015250	Ga0495678_015250_1114_1896	260
1769	3300049459	Ga0495678_016562	Ga0495678_016562_303_1088	260
1770	3300049459	Ga0495678_044785	Ga0495678_044785_184_969	260
1771	3300049459	Ga0495678_045075	Ga0495678_045075_619_1404	260
1772	3300049459	Ga0495678_048426	Ga0495678_048426_358_1143	260
1773	3300049459	Ga0495678_067619	Ga0495678_067619_94_879	260
1774	3300049459	Ga0495678_089914	Ga0495678_089914_36_821	260
1775	3300049460	Ga0495682_0000072	Ga0495682_0000072_9650_10435	260
1776	3300049460	Ga0495682_0000213	Ga0495682_0000213_2622_3407	260
1777	3300049460	Ga0495682_0001612	Ga0495682_0001612_8520_9305	260
1778	3300049460	Ga0495682_0022268	Ga0495682_0022268_364_1146	260
1779	3300049460	Ga0495682_0024940	Ga0495682_0024940_991_1773	260
1780	3300049460	Ga0495682_0026801	Ga0495682_0026801_737_1519	260
1781	3300049460	Ga0495682_0032643	Ga0495682_0032643_172_954	260
1782	3300049758	Ga0501241_000578	Ga0501241_000578_222_1007	260
1783	3300053111	Ga0500572_026825	Ga0500572_026825_77_862	260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01311

Bac_export_1

Bacterial export proteins, family 1

13

248

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6s3l-assembly1.cif.gz_F	structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex.	0.855	14	257
6s3l-assembly1.cif.gz_F	structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex.	0.8298	14	257
6s3r-assembly1.cif.gz_F	structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi.	0.8283	10	259
6s3r-assembly1.cif.gz_F	structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi.	0.8196	10	259
7bin-assembly1.cif.gz_F	salmonella export gate and rod refined in focussed c1 map	0.8152	7	257

ID	Description	Score	Start	End	Superfamily
af_P35462_32_400_1.20.1070.10	Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins	0.3729	14	213	1.20.1070.10
af_Q6NP72_1_153_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.3281	89	246	1.10.10.1740
af_A0A1D6K380_240_374_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.31	82	259	1.20.140.10
af_K7KEP5_99_290_1.20.120.340	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS	0.3083	154	255	1.20.120.340
af_O94756_40_250_1.20.1270.60	Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain	0.3039	82	257	1.20.1270.60

ID	Description	Score	Start	End	GO Terms
AF-A0A3S4J2Q0-F1-model_v4	Flagellar biosynthesis protein FliR	0.9286	10	219	GO:0005886 GO:0006605
AF-A0A2D6PVB3-F1-model_v4	Flagellar biosynthetic protein FliR	0.9033	11	256	GO:0005886 GO:0006605
AF-A0A7C7CJY5-F1-model_v4	Flagellar biosynthetic protein FliR	0.9007	4	256	GO:0005886 GO:0006605 GO:0009425 GO:0044780
AF-A0A2E2G5R2-F1-model_v4	deleted	0.8977	3	256
AF-A0A5A8EZL6-F1-model_v4	Flagellar biosynthetic protein FliR	0.8974	13	256	GO:0005886 GO:0006605 GO:0009425 GO:0044780

Feature Viewer

pLDDT	pTM	Quality
88.03	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495686

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01311

Bac_export_1

Bacterial export proteins, family 1

13

248

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map