F495524
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1736 | 888 | 1303 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10085268|Ga0065704_100852682 |
| Length | 205 |
| Sequence | MRYELTRIDPDAVNDQYPIGQRETVSDSQLEDQVHKNSLWPYNFGLSCCYVEMTTAFTAPHDIARFGAEVIRASPRQADFMVVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDVYVPGCPPRPEAFLQALMLLQDSIGEERRPLSWVVGDQGIYRAEMPAQRDVRREQRIQVTNLRSPDEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 9 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 10 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 11 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 12 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 13 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 14 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 15 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 16 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 17 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 18 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 19 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 20 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 21 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 22 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 23 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 24 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 25 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 26 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 27 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 28 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 29 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 30 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 31 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 32 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 33 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 34 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 35 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 36 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 37 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 38 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 39 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 40 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 41 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 42 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 43 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 44 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 45 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 46 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 47 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 48 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 49 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 50 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 51 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 52 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 53 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 54 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 55 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 56 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 57 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 58 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 59 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 60 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 61 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 62 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 63 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 64 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 65 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 66 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 67 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 68 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 69 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 70 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 71 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 72 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 73 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 74 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 75 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 76 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 77 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 78 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 79 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 80 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 81 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 82 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 83 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 84 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 85 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 86 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 87 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 88 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 89 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 90 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 91 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 92 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 93 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 94 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 95 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 96 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 97 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 98 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 99 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 100 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 101 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 102 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 103 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 104 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 105 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 106 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 107 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 108 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 109 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 110 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 111 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 112 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 113 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 114 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 115 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 116 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 117 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 118 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 119 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 120 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 121 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 122 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 123 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 124 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 125 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 126 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 127 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 128 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 129 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 130 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 131 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 132 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 133 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 134 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 135 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 136 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 137 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 138 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 139 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 140 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 141 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 142 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 143 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 144 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 145 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 146 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 147 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 148 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 149 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 150 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 151 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 152 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 153 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 154 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 155 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 156 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 157 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 158 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 159 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 160 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 161 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 162 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 163 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 164 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 165 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 166 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 167 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 168 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 169 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 170 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 171 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 172 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 173 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 174 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 175 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 176 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 177 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 178 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 179 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 180 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 181 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 182 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 183 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 184 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 185 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 186 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 187 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 188 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 189 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 190 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 191 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 192 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 193 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 194 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 195 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 196 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 197 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 198 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 199 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 200 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 201 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 202 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 203 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 204 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 205 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 206 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 207 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 208 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 209 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 210 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 211 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 212 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 213 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 214 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 215 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 216 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 217 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 218 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 219 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 220 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 221 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 222 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 223 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 224 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 225 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 226 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 227 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 228 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 229 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 230 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 231 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 232 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 233 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 234 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 235 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 236 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 237 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 238 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 239 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 240 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 241 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 242 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 243 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 244 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 245 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 246 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 247 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 248 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 249 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 250 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 251 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 252 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 253 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 254 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 255 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 256 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 257 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 258 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 259 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 260 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 261 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 262 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 263 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 264 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 265 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 266 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 267 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 268 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 269 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 270 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 271 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 272 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 273 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 274 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 275 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 276 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 277 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 278 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 279 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 280 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 281 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 282 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 283 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 284 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 285 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 286 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 287 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 288 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 289 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 290 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 291 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 292 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 293 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 294 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 295 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 296 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 297 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 298 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 299 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 300 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 301 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 302 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 303 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 304 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 305 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 306 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 307 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 308 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 309 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 310 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 311 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 312 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 313 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 314 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 315 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 316 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 317 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 318 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 319 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 320 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 321 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 322 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 323 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 324 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 325 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 326 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 327 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 328 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 329 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 330 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 331 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 332 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 333 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 334 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 335 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 336 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 337 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 338 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 339 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 340 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 341 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 342 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 343 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 344 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 345 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 346 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 347 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 348 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 349 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 350 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 351 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 352 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 353 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 354 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 355 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 356 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 357 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 358 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 359 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 360 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 361 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 362 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 363 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 364 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 365 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 366 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 367 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 368 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 369 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 370 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 371 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 372 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 373 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 374 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 375 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 376 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 377 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 378 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 379 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 380 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 381 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 382 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 383 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 384 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 385 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 386 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 387 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 388 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 389 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 390 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 391 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 392 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 393 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 394 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 395 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 396 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 397 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 398 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 399 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 400 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 401 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 402 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 403 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 404 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 405 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 406 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 407 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 408 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 409 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 410 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 411 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 412 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 416 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 417 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 418 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 419 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 420 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 421 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 422 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 423 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 424 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 425 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 426 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 427 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 428 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 429 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 430 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 431 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 432 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 433 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 434 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 435 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 436 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 437 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 438 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 439 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 440 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 441 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 442 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 443 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 444 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 445 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 446 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 447 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 448 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 449 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 450 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 451 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 452 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 453 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 454 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 455 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 456 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 457 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 458 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 459 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 460 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 461 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 462 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 463 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 464 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 465 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 466 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 467 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 468 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 469 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 470 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 471 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 472 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 473 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 474 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 475 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 477 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 478 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 479 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 480 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 481 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 482 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 483 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 484 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 485 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 486 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 488 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 489 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 490 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 491 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 492 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 493 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 494 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 495 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 496 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 497 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 499 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 500 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 502 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 503 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 504 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 505 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 506 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 507 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 508 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 509 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 510 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 511 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 512 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 513 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 514 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 515 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 516 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 517 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 518 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 519 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 520 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 521 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 522 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 523 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 524 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 525 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 526 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 527 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 528 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 529 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 530 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 531 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 532 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 533 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 534 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 535 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 536 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 537 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 538 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 539 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 540 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 541 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 542 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 543 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 544 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 545 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 547 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 549 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 550 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 551 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 553 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 554 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 555 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 556 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 557 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 558 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 560 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 561 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 562 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 616 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 617 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 630 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 634 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 635 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 636 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 637 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 638 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 639 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 640 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 641 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 642 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 643 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 644 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 645 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 646 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 647 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 648 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 649 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 650 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 651 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 652 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 653 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 654 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 655 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 656 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 657 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 658 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 659 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 660 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 661 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 662 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 663 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 664 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 665 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 666 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 667 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 668 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 669 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 670 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 671 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 672 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 673 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 674 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 675 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 676 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 677 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 678 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 679 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 680 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 681 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 682 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 683 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 684 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 685 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 686 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 687 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 688 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 689 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 690 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 691 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 692 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 693 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 694 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 695 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 696 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 697 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 698 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 778 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 779 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 780 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 781 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 782 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 783 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 784 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 785 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 786 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 787 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 788 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 789 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 790 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 791 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 792 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 793 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 794 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 795 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 796 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 797 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 798 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 799 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 800 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 801 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 804 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 805 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 806 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 807 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 808 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 809 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 810 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 811 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 812 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 813 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 814 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 815 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 816 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 817 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 818 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 819 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 820 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 821 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 822 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 823 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 824 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 825 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 826 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 827 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 828 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 829 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 830 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 831 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 832 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 833 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 834 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 835 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 836 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 837 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 838 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 839 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 840 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 841 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 842 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 843 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 844 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 845 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 846 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 847 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 848 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 849 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 850 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 851 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 852 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 853 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 854 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 855 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 856 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 857 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 858 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 859 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 860 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 861 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 862 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 863 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 864 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 865 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 866 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 867 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 868 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 869 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 870 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 871 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 872 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 873 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 874 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 875 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 876 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 877 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 878 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 879 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 880 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 881 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 882 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 883 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 884 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 885 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 886 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 887 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 888 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.93 |
| Metatranscriptomes | 2.07 |
| Isolates | 25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0.06 |
| Endosphere | 5.53 |
| Nodule | 2.65 |
| Rhizoplane | 8.53 |
| Rhizosphere | 68.61 |
| Stem | 0.06 |
| Stem Tuber | 0.29 |
| Unclassified | 13.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_29 | 2124908027 | Bacteria | 60739 |
| 2 | SwRhRL2b_contig_297133 | 2162886007 | Bacteria | 2675 |
| 3 | JGI25162J39368_1000002 | 3300002737 | Bacteria | 663004 |
| 4 | JGI25162J39368_1005314 | 3300002737 | Bacteria | 2587 |
| 5 | JGI25154J39366_1012551 | 3300002738 | Bacteria | 932 |
| 6 | JGI25163J39215_1000024 | 3300002771 | Bacteria | 70395 |
| 7 | JGI25163J39215_1003812 | 3300002771 | Bacteria | 1144 |
| 8 | JGI25164J39214_1000006 | 3300002772 | Bacteria | 342675 |
| 9 | JGI25164J39214_1000069 | 3300002772 | Bacteria | 103125 |
| 10 | JGI25164J39214_1000228 | 3300002772 | Bacteria | 43827 |
| 11 | JGI25152J39213_1000602 | 3300002773 | Bacteria | 19375 |
| 12 | JGI25165J46597_1000168 | 3300003214 | Bacteria | 103125 |
| 13 | JGI25165J46597_1000424 | 3300003214 | Bacteria | 43827 |
| 14 | rootH2_10052056 | 3300003320 | Bacteria | 13419 |
| 15 | rootH2_10085512 | 3300003320 | Bacteria | 13406 |
| 16 | rootL2_10021840 | 3300003322 | Bacteria | 9126 |
| 17 | rootH1_10005050 | 3300003316 | Bacteria | 9926 |
| 18 | rootH1_10005050 | 3300003323 | Bacteria | 27642 |
| 19 | Ga0006562J51391_1025316 | 3300003578 | Bacteria | 1702 |
| 20 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 21 | Ga0055538_1000088 | 3300003751 | Bacteria | 78763 |
| 22 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 23 | Ga0055539_1000132 | 3300003752 | Bacteria | 78763 |
| 24 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 25 | Ga0055533_1000135 | 3300003756 | Bacteria | 78763 |
| 26 | Ga0055532_1000178 | 3300003758 | Bacteria | 54660 |
| 27 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 28 | Ga0055525_1000449 | 3300003759 | Bacteria | 23656 |
| 29 | Ga0055535_1016059 | 3300003761 | Bacteria | 1033 |
| 30 | Ga0055536_1015762 | 3300003781 | Bacteria | 2568 |
| 31 | Ga0055536_1022882 | 3300003781 | Bacteria | 1851 |
| 32 | Ga0055536_1024507 | 3300003781 | Bacteria | 1746 |
| 33 | Ga0055536_1031303 | 3300003781 | Bacteria | 1395 |
| 34 | Ga0055536_1049300 | 3300003781 | Bacteria | 936 |
| 35 | Ga0055530_10021619 | 3300003791 | Bacteria | 1890 |
| 36 | Ga0055530_10023625 | 3300003791 | Bacteria | 1761 |
| 37 | Ga0055530_10049125 | 3300003791 | Bacteria | 988 |
| 38 | Ga0055530_10060716 | 3300003791 | Bacteria | 844 |
| 39 | Ga0055540_1005526 | 3300003792 | Bacteria | 5284 |
| 40 | Ga0055540_1013134 | 3300003792 | Bacteria | 2550 |
| 41 | Ga0055540_1020296 | 3300003792 | Bacteria | 1761 |
| 42 | Ga0055531_10004591 | 3300003794 | Bacteria | 8330 |
| 43 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 44 | Ga0055541_1000087 | 3300003841 | Bacteria | 78763 |
| 45 | Ga0058692_1000092 | 3300003856 | Bacteria | 60796 |
| 46 | Ga0058692_1000734 | 3300003856 | Bacteria | 13270 |
| 47 | Ga0058692_1007969 | 3300003856 | Bacteria | 2758 |
| 48 | Ga0058692_1020156 | 3300003856 | Bacteria | 1407 |
| 49 | Ga0058692_1020519 | 3300003856 | Bacteria | 1387 |
| 50 | JGI25405J52794_10011315 | 3300003911 | Bacteria | 1707 |
| 51 | Ga0058863_11745031 | 3300004799 | Bacteria | 1651 |
| 52 | Ga0058861_11992559 | 3300004800 | Bacteria | 1795 |
| 53 | Ga0058862_10209510 | 3300004803 | Bacteria | 1442 |
| 54 | Ga0058862_12840720 | 3300004803 | Bacteria | 1834 |
| 55 | Ga0065703_1000185 | 3300005272 | Bacteria | 19705 |
| 56 | Ga0065703_1020317 | 3300005272 | Bacteria | 1880 |
| 57 | Ga0065714_10000291 | 3300005288 | Bacteria | 6107 |
| 58 | Ga0065714_10022500 | 3300005288 | Bacteria | 1049 |
| 59 | Ga0065714_10024032 | 3300005288 | Bacteria | 1619 |
| 60 | Ga0065714_10042677 | 3300005288 | Bacteria | 1125 |
| 61 | Ga0065704_10000641 | 3300005289 | Bacteria | 21869 |
| 62 | Ga0065704_10001523 | 3300005289 | Bacteria | 7440 |
| 63 | Ga0065704_10007486 | 3300005289 | Bacteria | 3780 |
| 64 | Ga0065704_10014544 | 3300005289 | Bacteria | 2654 |
| 65 | Ga0065704_10071962 | 3300005289 | Bacteria | 9503 |
| 66 | Ga0065704_10085268 | 3300005289 | Bacteria | 3239 |
| 67 | Ga0065704_10110828 | 3300005289 | Bacteria | 1971 |
| 68 | Ga0065704_10314531 | 3300005289 | Bacteria | 863 |
| 69 | Ga0065712_10085148 | 3300005290 | Bacteria | 2716 |
| 70 | Ga0065712_10090299 | 3300005290 | Bacteria | 2427 |
| 71 | Ga0065712_10166150 | 3300005290 | Bacteria | 1272 |
| 72 | Ga0065712_10177747 | 3300005290 | Bacteria | 1209 |
| 73 | Ga0065715_10009777 | 3300005293 | Bacteria | 2631 |
| 74 | Ga0065715_10100728 | 3300005293 | Bacteria | 3272 |
| 75 | Ga0065715_10358674 | 3300005293 | Bacteria | 939 |
| 76 | Ga0065715_10582615 | 3300005293 | Bacteria | 719 |
| 77 | Ga0065707_10054040 | 3300005295 | Bacteria | 889 |
| 78 | Ga0070658_10078582 | 3300005327 | Bacteria | 2708 |
| 79 | Ga0070658_10174300 | 3300005327 | Bacteria | 1808 |
| 80 | Ga0070683_100294876 | 3300005329 | Bacteria | 1542 |
| 81 | Ga0070670_100000054 | 3300005331 | Bacteria | 127396 |
| 82 | Ga0070666_10009694 | 3300005335 | Bacteria | 6016 |
| 83 | Ga0070680_100182953 | 3300005336 | Bacteria | 1765 |
| 84 | Ga0070660_100001518 | 3300005339 | Bacteria | 15915 |
| 85 | Ga0070661_100000221 | 3300005344 | Bacteria | 47122 |
| 86 | Ga0070661_100335890 | 3300005344 | Bacteria | 1183 |
| 87 | Ga0070692_10331813 | 3300005345 | Bacteria | 939 |
| 88 | Ga0070669_100004838 | 3300005353 | Bacteria | 9719 |
| 89 | Ga0070669_100005396 | 3300005353 | Bacteria | 9223 |
| 90 | Ga0070669_100017073 | 3300005353 | Bacteria | 5177 |
| 91 | Ga0070669_100442327 | 3300005353 | Bacteria | 1070 |
| 92 | Ga0070671_100000037 | 3300005355 | Bacteria | 95248 |
| 93 | Ga0070688_100004371 | 3300005365 | Bacteria | 7353 |
| 94 | Ga0070659_100191861 | 3300005366 | Bacteria | 1679 |
| 95 | Ga0070659_100401584 | 3300005366 | Bacteria | 1157 |
| 96 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 97 | Ga0070709_10069602 | 3300005434 | Bacteria | 2267 |
| 98 | Ga0070709_10482606 | 3300005434 | Bacteria | 939 |
| 99 | Ga0070714_100002772 | 3300005435 | Bacteria | 12911 |
| 100 | Ga0070714_100067450 | 3300005435 | Bacteria | 3085 |
| 101 | Ga0070714_100109240 | 3300005435 | Bacteria | 2446 |
| 102 | Ga0070714_100139294 | 3300005435 | Bacteria | 2176 |
| 103 | Ga0070714_100793847 | 3300005435 | Bacteria | 917 |
| 104 | Ga0070713_100006711 | 3300005436 | Bacteria | 8010 |
| 105 | Ga0070713_100258329 | 3300005436 | Bacteria | 1591 |
| 106 | Ga0070711_100191254 | 3300005439 | Bacteria | 1573 |
| 107 | Ga0070711_100425488 | 3300005439 | Bacteria | 1083 |
| 108 | Ga0070711_100601621 | 3300005439 | Bacteria | 917 |
| 109 | Ga0070700_100440784 | 3300005441 | Bacteria | 989 |
| 110 | Ga0070708_100000392 | 3300005445 | Bacteria | 33124 |
| 111 | Ga0070678_100412312 | 3300005456 | Bacteria | 1176 |
| 112 | Ga0070681_10031259 | 3300005458 | Bacteria | 5344 |
| 113 | Ga0070681_10068202 | 3300005458 | Bacteria | 3524 |
| 114 | Ga0070681_10093609 | 3300005458 | Bacteria | 2954 |
| 115 | Ga0070681_10106869 | 3300005458 | Bacteria | 2740 |
| 116 | Ga0070681_10132687 | 3300005458 | Bacteria | 2422 |
| 117 | Ga0070681_10170524 | 3300005458 | Bacteria | 2098 |
| 118 | Ga0070681_10821945 | 3300005458 | Bacteria | 846 |
| 119 | Ga0068867_100092572 | 3300005459 | Bacteria | 2296 |
| 120 | Ga0070685_10000014 | 3300005466 | Bacteria | 120530 |
| 121 | Ga0070706_100001692 | 3300005467 | Bacteria | 22966 |
| 122 | Ga0070707_100000351 | 3300005468 | Bacteria | 45175 |
| 123 | Ga0070707_100004546 | 3300005468 | Bacteria | 12991 |
| 124 | Ga0070698_100000922 | 3300005471 | Bacteria | 32132 |
| 125 | Ga0070698_100019643 | 3300005471 | Bacteria | 7087 |
| 126 | Ga0070699_100000502 | 3300005518 | Bacteria | 37239 |
| 127 | Ga0070699_100037730 | 3300005518 | Bacteria | 4183 |
| 128 | Ga0070699_100203295 | 3300005518 | Bacteria | 1762 |
| 129 | Ga0070679_100000945 | 3300005530 | Bacteria | 25224 |
| 130 | Ga0070679_100031038 | 3300005530 | Bacteria | 5279 |
| 131 | Ga0070679_100094428 | 3300005530 | Bacteria | 2978 |
| 132 | Ga0070679_100168821 | 3300005530 | Bacteria | 2161 |
| 133 | Ga0070679_100330768 | 3300005530 | Bacteria | 1472 |
| 134 | Ga0070679_100360345 | 3300005530 | Bacteria | 1401 |
| 135 | Ga0070679_100957878 | 3300005530 | Bacteria | 799 |
| 136 | Ga0070684_100033892 | 3300005535 | Bacteria | 4363 |
| 137 | Ga0070684_100066556 | 3300005535 | Bacteria | 3163 |
| 138 | Ga0070684_100535110 | 3300005535 | Bacteria | 1086 |
| 139 | Ga0070697_100002721 | 3300005536 | Bacteria | 13623 |
| 140 | Ga0070697_100189545 | 3300005536 | Bacteria | 1745 |
| 141 | Ga0070697_100414222 | 3300005536 | Bacteria | 1170 |
| 142 | Ga0068853_100016299 | 3300005539 | Bacteria | 6114 |
| 143 | Ga0068853_100067432 | 3300005539 | Bacteria | 3109 |
| 144 | Ga0070672_100200754 | 3300005543 | Bacteria | 1668 |
| 145 | Ga0070665_100003302 | 3300005548 | Bacteria | 17281 |
| 146 | Ga0070665_100012924 | 3300005548 | Bacteria | 8411 |
| 147 | Ga0070665_100027961 | 3300005548 | Bacteria | 5679 |
| 148 | Ga0070665_100090630 | 3300005548 | Bacteria | 3063 |
| 149 | Ga0070665_100117303 | 3300005548 | Bacteria | 2664 |
| 150 | Ga0070665_100233214 | 3300005548 | Bacteria | 1841 |
| 151 | Ga0068855_100016972 | 3300005563 | Bacteria | 8756 |
| 152 | Ga0068855_100018409 | 3300005563 | Bacteria | 8392 |
| 153 | Ga0068855_100021270 | 3300005563 | Bacteria | 7778 |
| 154 | Ga0068855_100032736 | 3300005563 | Bacteria | 6207 |
| 155 | Ga0068855_100082048 | 3300005563 | Bacteria | 3737 |
| 156 | Ga0068855_100235003 | 3300005563 | Bacteria | 2050 |
| 157 | Ga0068855_100552887 | 3300005563 | Bacteria | 1246 |
| 158 | Ga0070664_100001101 | 3300005564 | Bacteria | 21375 |
| 159 | Ga0070664_100004083 | 3300005564 | Bacteria | 11732 |
| 160 | Ga0068857_100003218 | 3300005577 | Bacteria | 13546 |
| 161 | Ga0068857_100039120 | 3300005577 | Bacteria | 4201 |
| 162 | Ga0068857_100127973 | 3300005577 | Bacteria | 2289 |
| 163 | Ga0068857_100146071 | 3300005577 | Bacteria | 2140 |
| 164 | Ga0068857_100209333 | 3300005577 | Bacteria | 1779 |
| 165 | Ga0068857_100314938 | 3300005577 | Bacteria | 1444 |
| 166 | Ga0068857_100737896 | 3300005577 | Bacteria | 937 |
| 167 | Ga0068854_100078594 | 3300005578 | Bacteria | 2431 |
| 168 | Ga0068856_100018638 | 3300005614 | Bacteria | 6727 |
| 169 | Ga0068856_100153505 | 3300005614 | Bacteria | 2312 |
| 170 | Ga0068856_100185005 | 3300005614 | Bacteria | 2097 |
| 171 | Ga0068852_100000021 | 3300005616 | Bacteria | 126061 |
| 172 | Ga0068852_100073313 | 3300005616 | Bacteria | 3011 |
| 173 | Ga0068852_100606257 | 3300005616 | Bacteria | 1099 |
| 174 | Ga0068859_100049835 | 3300005617 | Bacteria | 4206 |
| 175 | Ga0068859_100101523 | 3300005617 | Bacteria | 2934 |
| 176 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 177 | Ga0068864_100022756 | 3300005618 | Bacteria | 5256 |
| 178 | Ga0068864_100210709 | 3300005618 | Bacteria | 1789 |
| 179 | Ga0068861_100292923 | 3300005719 | Bacteria | 1406 |
| 180 | Ga0068851_10011603 | 3300005834 | Bacteria | 4135 |
| 181 | Ga0068863_100009104 | 3300005841 | Bacteria | 9695 |
| 182 | Ga0068863_100012187 | 3300005841 | Bacteria | 8303 |
| 183 | Ga0068863_100014553 | 3300005841 | Bacteria | 7574 |
| 184 | Ga0068860_100175045 | 3300005843 | Bacteria | 2074 |
| 185 | Ga0068860_100348249 | 3300005843 | Bacteria | 1457 |
| 186 | Ga0068860_100397565 | 3300005843 | Bacteria | 1363 |
| 187 | Ga0068862_100156884 | 3300005844 | Bacteria | 2029 |
| 188 | Ga0068862_100235134 | 3300005844 | Bacteria | 1664 |
| 189 | Ga0068862_100277796 | 3300005844 | Bacteria | 1534 |
| 190 | Ga0068862_100595531 | 3300005844 | Bacteria | 1061 |
| 191 | Ga0081455_10001369 | 3300005937 | Bacteria | 30084 |
| 192 | Ga0081538_10140994 | 3300005981 | Bacteria | 1111 |
| 193 | Ga0081540_1109528 | 3300005983 | Bacteria | 1171 |
| 194 | Ga0081540_1179312 | 3300005983 | Bacteria | 795 |
| 195 | Ga0070717_10028565 | 3300006028 | Bacteria | 4466 |
| 196 | Ga0075363_100468782 | 3300006048 | Bacteria | 745 |
| 197 | Ga0075364_10072909 | 3300006051 | Bacteria | 2263 |
| 198 | Ga0075364_10085946 | 3300006051 | Bacteria | 2083 |
| 199 | Ga0075364_10093100 | 3300006051 | Bacteria | 2001 |
| 200 | Ga0075364_10216662 | 3300006051 | Bacteria | 1298 |
| 201 | Ga0070716_100089161 | 3300006173 | Bacteria | 1862 |
| 202 | Ga0075366_10005676 | 3300006195 | Bacteria | 6768 |
| 203 | Ga0075366_10091668 | 3300006195 | Bacteria | 1820 |
| 204 | Ga0097621_100093428 | 3300006237 | Bacteria | 2521 |
| 205 | Ga0097621_100112184 | 3300006237 | Bacteria | 2305 |
| 206 | Ga0097621_100247031 | 3300006237 | Bacteria | 1561 |
| 207 | Ga0075370_10230606 | 3300006353 | Bacteria | 1096 |
| 208 | Ga0068871_100002826 | 3300006358 | Bacteria | 11878 |
| 209 | Ga0068871_100024543 | 3300006358 | Bacteria | 4677 |
| 210 | Ga0068871_100235910 | 3300006358 | Bacteria | 1589 |
| 211 | Ga0075428_100020857 | 3300006844 | Bacteria | 7255 |
| 212 | Ga0075428_100029944 | 3300006844 | Bacteria | 6021 |
| 213 | Ga0075428_100086112 | 3300006844 | Bacteria | 3427 |
| 214 | Ga0075428_100746064 | 3300006844 | Bacteria | 1042 |
| 215 | Ga0075430_100132088 | 3300006846 | Bacteria | 2081 |
| 216 | Ga0075431_100005178 | 3300006847 | Bacteria | 12842 |
| 217 | Ga0075431_100196400 | 3300006847 | Bacteria | 2065 |
| 218 | Ga0075433_10206688 | 3300006852 | Bacteria | 1745 |
| 219 | Ga0075434_100166915 | 3300006871 | Bacteria | 2221 |
| 220 | Ga0075434_100195313 | 3300006871 | Bacteria | 2043 |
| 221 | Ga0075429_100015070 | 3300006880 | Bacteria | 6700 |
| 222 | Ga0068865_100021630 | 3300006881 | Bacteria | 4186 |
| 223 | Ga0075436_100001541 | 3300006914 | Bacteria | 15748 |
| 224 | Ga0075436_100495628 | 3300006914 | Bacteria | 893 |
| 225 | Ga0097620_100049833 | 3300006931 | Bacteria | 4206 |
| 226 | Ga0097620_100101520 | 3300006931 | Bacteria | 2934 |
| 227 | Ga0099823_1000397 | 3300006944 | Bacteria | 27902 |
| 228 | Ga0079104_1000120 | 3300006946 | Bacteria | 111969 |
| 229 | Ga0079104_1000135 | 3300006946 | Bacteria | 103632 |
| 230 | Ga0079104_1000487 | 3300006946 | Bacteria | 43465 |
| 231 | Ga0079104_1001580 | 3300006946 | Bacteria | 14875 |
| 232 | Ga0079104_1002605 | 3300006946 | Bacteria | 9453 |
| 233 | Ga0079104_1002650 | 3300006946 | Bacteria | 9307 |
| 234 | Ga0079104_1006134 | 3300006946 | Bacteria | 4630 |
| 235 | Ga0079104_1028407 | 3300006946 | Bacteria | 1421 |
| 236 | Ga0079104_1073335 | 3300006946 | Bacteria | 715 |
| 237 | Ga0099826_10012472 | 3300006948 | Bacteria | 6404 |
| 238 | Ga0075435_100017057 | 3300007076 | Bacteria | 5487 |
| 239 | Ga0075435_100037815 | 3300007076 | Bacteria | 3846 |
| 240 | Ga0075435_100504872 | 3300007076 | Bacteria | 1046 |
| 241 | Ga0099794_10149796 | 3300007265 | Bacteria | 1184 |
| 242 | Ga0099795_10084934 | 3300007788 | Bacteria | 1217 |
| 243 | Ga0105251_10000500 | 3300009011 | Bacteria | 37162 |
| 244 | Ga0105251_10000649 | 3300009011 | Bacteria | 32045 |
| 245 | Ga0105251_10002203 | 3300009011 | Bacteria | 15575 |
| 246 | Ga0105251_10002226 | 3300009011 | Bacteria | 15475 |
| 247 | Ga0105251_10019937 | 3300009011 | Bacteria | 3530 |
| 248 | Ga0105251_10021742 | 3300009011 | Bacteria | 3343 |
| 249 | Ga0105251_10025169 | 3300009011 | Bacteria | 3048 |
| 250 | Ga0105251_10051689 | 3300009011 | Bacteria | 1959 |
| 251 | Ga0105251_10059723 | 3300009011 | Bacteria | 1797 |
| 252 | Ga0105251_10088202 | 3300009011 | Bacteria | 1427 |
| 253 | Ga0105251_10089046 | 3300009011 | Bacteria | 1420 |
| 254 | Ga0105251_10092604 | 3300009011 | Bacteria | 1387 |
| 255 | Ga0105251_10195998 | 3300009011 | Bacteria | 910 |
| 256 | Ga0105244_10000246 | 3300009036 | Bacteria | 55589 |
| 257 | Ga0105244_10000337 | 3300009036 | Bacteria | 44183 |
| 258 | Ga0105244_10000342 | 3300009036 | Bacteria | 43837 |
| 259 | Ga0105244_10001474 | 3300009036 | Bacteria | 19004 |
| 260 | Ga0105244_10002267 | 3300009036 | Bacteria | 14624 |
| 261 | Ga0105244_10007923 | 3300009036 | Bacteria | 6694 |
| 262 | Ga0105244_10022204 | 3300009036 | Bacteria | 3495 |
| 263 | Ga0105244_10025529 | 3300009036 | Bacteria | 3211 |
| 264 | Ga0105244_10028040 | 3300009036 | Bacteria | 3026 |
| 265 | Ga0105244_10033494 | 3300009036 | Bacteria | 2707 |
| 266 | Ga0105244_10057283 | 3300009036 | Bacteria | 1970 |
| 267 | Ga0105244_10060740 | 3300009036 | Bacteria | 1904 |
| 268 | Ga0105244_10066137 | 3300009036 | Bacteria | 1810 |
| 269 | Ga0105244_10067245 | 3300009036 | Bacteria | 1793 |
| 270 | Ga0105244_10073265 | 3300009036 | Bacteria | 1705 |
| 271 | Ga0105244_10110909 | 3300009036 | Bacteria | 1335 |
| 272 | Ga0105244_10119654 | 3300009036 | Bacteria | 1276 |
| 273 | Ga0105244_10120223 | 3300009036 | Bacteria | 1272 |
| 274 | Ga0105244_10125113 | 3300009036 | Bacteria | 1243 |
| 275 | Ga0105244_10125660 | 3300009036 | Bacteria | 1240 |
| 276 | Ga0105250_10000007 | 3300009092 | Bacteria | 355249 |
| 277 | Ga0105250_10000018 | 3300009092 | Bacteria | 246692 |
| 278 | Ga0105250_10000080 | 3300009092 | Bacteria | 83436 |
| 279 | Ga0105250_10002387 | 3300009092 | Bacteria | 9478 |
| 280 | Ga0105250_10003285 | 3300009092 | Bacteria | 7696 |
| 281 | Ga0105250_10006776 | 3300009092 | Bacteria | 4974 |
| 282 | Ga0105250_10013064 | 3300009092 | Bacteria | 3418 |
| 283 | Ga0105250_10023962 | 3300009092 | Bacteria | 2460 |
| 284 | Ga0105250_10073013 | 3300009092 | Bacteria | 1387 |
| 285 | Ga0105240_10003055 | 3300009093 | Bacteria | 26321 |
| 286 | Ga0105240_10003087 | 3300009093 | Bacteria | 26186 |
| 287 | Ga0105240_10016586 | 3300009093 | Bacteria | 9966 |
| 288 | Ga0105240_10030004 | 3300009093 | Bacteria | 7074 |
| 289 | Ga0105240_10051034 | 3300009093 | Bacteria | 5208 |
| 290 | Ga0105240_10092102 | 3300009093 | Bacteria | 3702 |
| 291 | Ga0105240_10096438 | 3300009093 | Bacteria | 3604 |
| 292 | Ga0105240_10261833 | 3300009093 | Bacteria | 1995 |
| 293 | Ga0105240_10275533 | 3300009093 | Bacteria | 1935 |
| 294 | Ga0105240_10275860 | 3300009093 | Bacteria | 1934 |
| 295 | Ga0105240_10318043 | 3300009093 | Bacteria | 1775 |
| 296 | Ga0105240_10434415 | 3300009093 | Bacteria | 1472 |
| 297 | Ga0105240_10522986 | 3300009093 | Bacteria | 1316 |
| 298 | Ga0111539_10002472 | 3300009094 | Bacteria | 24526 |
| 299 | Ga0111539_10058214 | 3300009094 | Bacteria | 4585 |
| 300 | Ga0105245_10350049 | 3300009098 | Bacteria | 1463 |
| 301 | Ga0105247_10000416 | 3300009101 | Bacteria | 36118 |
| 302 | Ga0105247_10003341 | 3300009101 | Bacteria | 10502 |
| 303 | Ga0105247_10126947 | 3300009101 | Bacteria | 1659 |
| 304 | Ga0114129_10085130 | 3300009147 | Bacteria | 4386 |
| 305 | Ga0114129_10105084 | 3300009147 | Bacteria | 3903 |
| 306 | Ga0105243_10000123 | 3300009148 | Bacteria | 88281 |
| 307 | Ga0105243_10000587 | 3300009148 | Bacteria | 36543 |
| 308 | Ga0105243_10040506 | 3300009148 | Bacteria | 3638 |
| 309 | Ga0105243_10068541 | 3300009148 | Bacteria | 2859 |
| 310 | Ga0105241_10000001 | 3300009174 | Bacteria | 879793 |
| 311 | Ga0105241_10005427 | 3300009174 | Bacteria | 9428 |
| 312 | Ga0105241_10009030 | 3300009174 | Bacteria | 7331 |
| 313 | Ga0105241_10631353 | 3300009174 | Bacteria | 971 |
| 314 | Ga0105242_10006800 | 3300009176 | Bacteria | 8819 |
| 315 | Ga0105242_10515440 | 3300009176 | Bacteria | 1140 |
| 316 | Ga0105248_10035407 | 3300009177 | Bacteria | 5585 |
| 317 | Ga0105248_10174768 | 3300009177 | Bacteria | 2421 |
| 318 | Ga0105237_10000582 | 3300009545 | Bacteria | 51165 |
| 319 | Ga0105237_10014816 | 3300009545 | Bacteria | 8138 |
| 320 | Ga0105237_10038802 | 3300009545 | Bacteria | 4809 |
| 321 | Ga0105237_10040136 | 3300009545 | Bacteria | 4721 |
| 322 | Ga0105237_10120744 | 3300009545 | Bacteria | 2615 |
| 323 | Ga0105237_10274158 | 3300009545 | Bacteria | 1690 |
| 324 | Ga0105237_10742196 | 3300009545 | Bacteria | 988 |
| 325 | Ga0105238_10008807 | 3300009551 | Bacteria | 10096 |
| 326 | Ga0105238_10015411 | 3300009551 | Bacteria | 7734 |
| 327 | Ga0105238_10044289 | 3300009551 | Bacteria | 4499 |
| 328 | Ga0105238_10062077 | 3300009551 | Bacteria | 3738 |
| 329 | Ga0105238_10217504 | 3300009551 | Bacteria | 1887 |
| 330 | Ga0105249_10017291 | 3300009553 | Bacteria | 6402 |
| 331 | Ga0105249_10084861 | 3300009553 | Bacteria | 2950 |
| 332 | Ga0105249_10475794 | 3300009553 | Bacteria | 1291 |
| 333 | Ga0105239_10010544 | 3300010375 | Bacteria | 10332 |
| 334 | Ga0105239_10372303 | 3300010375 | Bacteria | 1614 |
| 335 | Ga0105246_10086246 | 3300011119 | Bacteria | 2250 |
| 336 | Ga0105246_10139431 | 3300011119 | Bacteria | 1822 |
| 337 | Ga0105246_10146747 | 3300011119 | Bacteria | 1781 |
| 338 | Ga0105246_10949496 | 3300011119 | Bacteria | 775 |
| 339 | Ga0105246_10949497 | 3300011119 | Bacteria | 775 |
| 340 | Ga0157373_10000400 | 3300013100 | Bacteria | 34834 |
| 341 | Ga0157373_10003007 | 3300013100 | Bacteria | 12751 |
| 342 | Ga0157373_10005419 | 3300013100 | Bacteria | 9583 |
| 343 | Ga0157373_10057651 | 3300013100 | Bacteria | 2755 |
| 344 | Ga0157373_10063017 | 3300013100 | Bacteria | 2626 |
| 345 | Ga0157373_10102302 | 3300013100 | Bacteria | 2016 |
| 346 | Ga0157373_10222974 | 3300013100 | Bacteria | 1330 |
| 347 | Ga0157373_10394651 | 3300013100 | Bacteria | 991 |
| 348 | Ga0157371_10000006 | 3300013102 | Bacteria | 404774 |
| 349 | Ga0157371_10000560 | 3300013102 | Bacteria | 44059 |
| 350 | Ga0157371_10001683 | 3300013102 | Bacteria | 22533 |
| 351 | Ga0157371_10002562 | 3300013102 | Bacteria | 17247 |
| 352 | Ga0157371_10002986 | 3300013102 | Bacteria | 15709 |
| 353 | Ga0157371_10016802 | 3300013102 | Bacteria | 5450 |
| 354 | Ga0157371_10043415 | 3300013102 | Bacteria | 3203 |
| 355 | Ga0157371_10098076 | 3300013102 | Bacteria | 2078 |
| 356 | Ga0157371_10105526 | 3300013102 | Bacteria | 1999 |
| 357 | Ga0157371_10121242 | 3300013102 | Bacteria | 1859 |
| 358 | Ga0157370_10000067 | 3300013104 | Bacteria | 113351 |
| 359 | Ga0157370_10000618 | 3300013104 | Bacteria | 44184 |
| 360 | Ga0157370_10000644 | 3300013104 | Bacteria | 43467 |
| 361 | Ga0157370_10006254 | 3300013104 | Bacteria | 13182 |
| 362 | Ga0157370_10026206 | 3300013104 | Bacteria | 5759 |
| 363 | Ga0157370_10063557 | 3300013104 | Bacteria | 3496 |
| 364 | Ga0157370_10121597 | 3300013104 | Bacteria | 2437 |
| 365 | Ga0157370_10183224 | 3300013104 | Bacteria | 1945 |
| 366 | Ga0157370_10207789 | 3300013104 | Bacteria | 1815 |
| 367 | Ga0157370_10254613 | 3300013104 | Bacteria | 1623 |
| 368 | Ga0157370_10260773 | 3300013104 | Bacteria | 1602 |
| 369 | Ga0157370_10733782 | 3300013104 | Bacteria | 901 |
| 370 | Ga0157369_10000375 | 3300013105 | Bacteria | 59272 |
| 371 | Ga0157369_10001060 | 3300013105 | Bacteria | 34676 |
| 372 | Ga0157369_10001168 | 3300013105 | Bacteria | 32769 |
| 373 | Ga0157369_10001656 | 3300013105 | Bacteria | 27174 |
| 374 | Ga0157369_10005638 | 3300013105 | Bacteria | 14545 |
| 375 | Ga0157369_10040266 | 3300013105 | Bacteria | 5102 |
| 376 | Ga0157369_10052776 | 3300013105 | Bacteria | 4396 |
| 377 | Ga0157369_10103532 | 3300013105 | Bacteria | 3032 |
| 378 | Ga0157369_10358959 | 3300013105 | Bacteria | 1513 |
| 379 | Ga0157369_10384259 | 3300013105 | Bacteria | 1457 |
| 380 | Ga0157369_10874537 | 3300013105 | Bacteria | 922 |
| 381 | Ga0157374_10703756 | 3300013296 | Bacteria | 1023 |
| 382 | Ga0157378_10111171 | 3300013297 | Bacteria | 2512 |
| 383 | Ga0163162_10010274 | 3300013306 | Bacteria | 9097 |
| 384 | Ga0163162_10022107 | 3300013306 | Bacteria | 6268 |
| 385 | Ga0163162_10040482 | 3300013306 | Bacteria | 4660 |
| 386 | Ga0163162_10150800 | 3300013306 | Bacteria | 2442 |
| 387 | Ga0163162_10151120 | 3300013306 | Bacteria | 2440 |
| 388 | Ga0157372_10001955 | 3300013307 | Bacteria | 22388 |
| 389 | Ga0157372_10002168 | 3300013307 | Bacteria | 21369 |
| 390 | Ga0157372_10016311 | 3300013307 | Bacteria | 7972 |
| 391 | Ga0157372_10021477 | 3300013307 | Bacteria | 6975 |
| 392 | Ga0157372_10023748 | 3300013307 | Bacteria | 6651 |
| 393 | Ga0157372_10058132 | 3300013307 | Bacteria | 4322 |
| 394 | Ga0157372_10062065 | 3300013307 | Bacteria | 4186 |
| 395 | Ga0157372_10092018 | 3300013307 | Bacteria | 3449 |
| 396 | Ga0157372_10115970 | 3300013307 | Bacteria | 3071 |
| 397 | Ga0157372_10144931 | 3300013307 | Bacteria | 2739 |
| 398 | Ga0157372_10144933 | 3300013307 | Bacteria | 2739 |
| 399 | Ga0157372_10281836 | 3300013307 | Bacteria | 1932 |
| 400 | Ga0157375_10200618 | 3300013308 | Bacteria | 2151 |
| 401 | Ga0157375_10662900 | 3300013308 | Bacteria | 1199 |
| 402 | Ga0163163_10000687 | 3300014325 | Bacteria | 28756 |
| 403 | Ga0182008_10001623 | 3300014497 | Bacteria | 14895 |
| 404 | Ga0182008_10029374 | 3300014497 | Bacteria | 2778 |
| 405 | Ga0157379_10027141 | 3300014968 | Bacteria | 5098 |
| 406 | Ga0157379_10088473 | 3300014968 | Bacteria | 2778 |
| 407 | Ga0182006_1000024 | 3300015261 | Bacteria | 257431 |
| 408 | Ga0182006_1014014 | 3300015261 | Bacteria | 3462 |
| 409 | Ga0182006_1023446 | 3300015261 | Bacteria | 2556 |
| 410 | Ga0182006_1035307 | 3300015261 | Bacteria | 1994 |
| 411 | Ga0182007_10048505 | 3300015262 | Bacteria | 1404 |
| 412 | Ga0182007_10062034 | 3300015262 | Bacteria | 1225 |
| 413 | Ga0182005_1093785 | 3300015265 | Bacteria | 836 |
| 414 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 415 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 416 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 417 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 418 | Ga0163161_10000003 | 3300017792 | Bacteria | 339847 |
| 419 | Ga0163161_10034504 | 3300017792 | Bacteria | 3620 |
| 420 | Ga0163161_10095441 | 3300017792 | Bacteria | 2206 |
| 421 | Ga0163161_10231290 | 3300017792 | Bacteria | 1435 |
| 422 | Ga0163161_10563445 | 3300017792 | Bacteria | 935 |
| 423 | Ga0197907_10316666 | 3300020069 | Bacteria | 1784 |
| 424 | Ga0197907_10479836 | 3300020069 | Bacteria | 2097 |
| 425 | Ga0197907_10974095 | 3300020069 | Bacteria | 2071 |
| 426 | Ga0197907_11438784 | 3300020069 | Bacteria | 1727 |
| 427 | Ga0206356_10888656 | 3300020070 | Bacteria | 1232 |
| 428 | Ga0206356_11820743 | 3300020070 | Bacteria | 1345 |
| 429 | Ga0206349_1221543 | 3300020075 | Bacteria | 1500 |
| 430 | Ga0206355_1041887 | 3300020076 | Bacteria | 2123 |
| 431 | Ga0206355_1413860 | 3300020076 | Bacteria | 3664 |
| 432 | Ga0206351_10535310 | 3300020077 | Bacteria | 1239 |
| 433 | Ga0206351_10679320 | 3300020077 | Bacteria | 2070 |
| 434 | Ga0206352_10109537 | 3300020078 | Bacteria | 2111 |
| 435 | Ga0206352_10476527 | 3300020078 | Bacteria | 5168 |
| 436 | Ga0206352_10517688 | 3300020078 | Bacteria | 1768 |
| 437 | Ga0206352_11361616 | 3300020078 | Bacteria | 1129 |
| 438 | Ga0206350_10008355 | 3300020080 | Bacteria | 1228 |
| 439 | Ga0206350_10187858 | 3300020080 | Bacteria | 3412 |
| 440 | Ga0206350_10364460 | 3300020080 | Bacteria | 1266 |
| 441 | Ga0206350_11177477 | 3300020080 | Bacteria | 703 |
| 442 | Ga0206350_11276978 | 3300020080 | Bacteria | 3494 |
| 443 | Ga0206354_10132274 | 3300020081 | Bacteria | 892 |
| 444 | Ga0213872_10001684 | 3300021361 | Bacteria | 13911 |
| 445 | Ga0213872_10010678 | 3300021361 | Bacteria | 4363 |
| 446 | Ga0213876_10000023 | 3300021384 | Bacteria | 255370 |
| 447 | Ga0213875_10012137 | 3300021388 | Bacteria | 4261 |
| 448 | Ga0224712_10021233 | 3300022467 | Bacteria | 2218 |
| 449 | Ga0224712_10035225 | 3300022467 | Bacteria | 1847 |
| 450 | Ga0224712_10050639 | 3300022467 | Bacteria | 1614 |
| 451 | Ga0224712_10146735 | 3300022467 | Bacteria | 1042 |
| 452 | Ga0209435_103421 | 3300025206 | Bacteria | 1816 |
| 453 | Ga0209760_100018 | 3300025207 | Bacteria | 172833 |
| 454 | Ga0209760_100089 | 3300025207 | Bacteria | 72658 |
| 455 | Ga0209760_100093 | 3300025207 | Bacteria | 71626 |
| 456 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 457 | Ga0209784_100126 | 3300025224 | Bacteria | 78815 |
| 458 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 459 | Ga0209566_100152 | 3300025225 | Bacteria | 78864 |
| 460 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 461 | Ga0209674_100177 | 3300025226 | Bacteria | 78864 |
| 462 | Ga0209147_100179 | 3300025229 | Bacteria | 78864 |
| 463 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 464 | Ga0209563_100142 | 3300025230 | Bacteria | 78864 |
| 465 | Ga0209563_101212 | 3300025230 | Bacteria | 7187 |
| 466 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 467 | Ga0207427_100011 | 3300025231 | Bacteria | 640076 |
| 468 | Ga0207427_100015 | 3300025231 | Bacteria | 542133 |
| 469 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 470 | Ga0209437_100027 | 3300025233 | Bacteria | 542133 |
| 471 | Ga0209437_100044 | 3300025233 | Bacteria | 430619 |
| 472 | Ga0209437_100103 | 3300025233 | Bacteria | 221904 |
| 473 | Ga0209258_100366 | 3300025242 | Bacteria | 59744 |
| 474 | Ga0209646_1000380 | 3300025246 | Bacteria | 28576 |
| 475 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 476 | Ga0209677_100125 | 3300025253 | Bacteria | 78864 |
| 477 | Ga0209759_1001848 | 3300025256 | Bacteria | 10573 |
| 478 | Ga0209759_1021634 | 3300025256 | Bacteria | 1458 |
| 479 | Ga0209129_1000037 | 3300025258 | Bacteria | 326534 |
| 480 | Ga0209233_1000039 | 3300025261 | Bacteria | 542133 |
| 481 | Ga0209233_1000057 | 3300025261 | Bacteria | 430619 |
| 482 | Ga0209233_1001125 | 3300025261 | Bacteria | 10912 |
| 483 | Ga0209675_1004567 | 3300025291 | Bacteria | 6107 |
| 484 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 485 | Ga0209676_1000017 | 3300025292 | Bacteria | 643409 |
| 486 | Ga0209676_1000696 | 3300025292 | Bacteria | 47256 |
| 487 | Ga0209676_1004220 | 3300025292 | Bacteria | 8131 |
| 488 | Ga0209676_1055738 | 3300025292 | Bacteria | 1011 |
| 489 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 490 | Ga0209050_1025723 | 3300025298 | Bacteria | 1991 |
| 491 | Ga0209050_1026442 | 3300025298 | Bacteria | 1941 |
| 492 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 493 | Ga0209051_1000666 | 3300025303 | Bacteria | 38569 |
| 494 | Ga0209051_1033587 | 3300025303 | Bacteria | 1938 |
| 495 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 496 | Ga0209257_1019138 | 3300025304 | Bacteria | 2594 |
| 497 | Ga0207656_10004868 | 3300025321 | Bacteria | 4713 |
| 498 | Ga0207656_10043071 | 3300025321 | Bacteria | 1924 |
| 499 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 500 | Ga0207696_1000013 | 3300025711 | Bacteria | 524881 |
| 501 | Ga0207696_1000029 | 3300025711 | Bacteria | 398074 |
| 502 | Ga0207696_1000067 | 3300025711 | Bacteria | 228478 |
| 503 | Ga0207696_1000081 | 3300025711 | Bacteria | 198887 |
| 504 | Ga0207696_1000100 | 3300025711 | Bacteria | 171029 |
| 505 | Ga0207696_1000117 | 3300025711 | Bacteria | 148004 |
| 506 | Ga0207696_1000124 | 3300025711 | Bacteria | 139229 |
| 507 | Ga0207696_1000147 | 3300025711 | Bacteria | 120603 |
| 508 | Ga0207696_1000185 | 3300025711 | Bacteria | 97304 |
| 509 | Ga0207696_1000275 | 3300025711 | Bacteria | 61367 |
| 510 | Ga0207696_1000766 | 3300025711 | Bacteria | 21229 |
| 511 | Ga0207696_1001267 | 3300025711 | Bacteria | 14132 |
| 512 | Ga0207696_1003770 | 3300025711 | Bacteria | 6758 |
| 513 | Ga0207696_1011700 | 3300025711 | Bacteria | 3144 |
| 514 | Ga0207696_1032044 | 3300025711 | Bacteria | 1586 |
| 515 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 516 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 517 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 518 | Ga0207655_1000041 | 3300025728 | Bacteria | 333962 |
| 519 | Ga0207655_1000062 | 3300025728 | Bacteria | 258054 |
| 520 | Ga0207655_1000094 | 3300025728 | Bacteria | 196748 |
| 521 | Ga0207655_1000115 | 3300025728 | Bacteria | 162114 |
| 522 | Ga0207655_1000205 | 3300025728 | Bacteria | 102993 |
| 523 | Ga0207655_1000540 | 3300025728 | Bacteria | 47892 |
| 524 | Ga0207655_1000769 | 3300025728 | Bacteria | 35833 |
| 525 | Ga0207655_1003638 | 3300025728 | Bacteria | 11388 |
| 526 | Ga0207655_1006042 | 3300025728 | Bacteria | 8094 |
| 527 | Ga0207655_1007903 | 3300025728 | Bacteria | 6830 |
| 528 | Ga0207655_1011548 | 3300025728 | Bacteria | 5248 |
| 529 | Ga0207655_1011844 | 3300025728 | Bacteria | 5152 |
| 530 | Ga0207655_1013784 | 3300025728 | Bacteria | 4613 |
| 531 | Ga0207655_1014509 | 3300025728 | Bacteria | 4448 |
| 532 | Ga0207655_1019433 | 3300025728 | Bacteria | 3550 |
| 533 | Ga0207655_1019756 | 3300025728 | Bacteria | 3502 |
| 534 | Ga0207655_1020977 | 3300025728 | Bacteria | 3335 |
| 535 | Ga0207655_1026768 | 3300025728 | Bacteria | 2761 |
| 536 | Ga0207655_1033923 | 3300025728 | Bacteria | 2304 |
| 537 | Ga0207655_1041602 | 3300025728 | Bacteria | 1968 |
| 538 | Ga0207655_1096446 | 3300025728 | Bacteria | 1028 |
| 539 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 540 | Ga0207713_1000023 | 3300025735 | Bacteria | 346097 |
| 541 | Ga0207713_1000083 | 3300025735 | Bacteria | 160973 |
| 542 | Ga0207713_1000208 | 3300025735 | Bacteria | 79660 |
| 543 | Ga0207713_1000241 | 3300025735 | Bacteria | 72891 |
| 544 | Ga0207713_1000397 | 3300025735 | Bacteria | 46586 |
| 545 | Ga0207713_1001290 | 3300025735 | Bacteria | 20648 |
| 546 | Ga0207713_1001368 | 3300025735 | Bacteria | 19839 |
| 547 | Ga0207713_1001926 | 3300025735 | Bacteria | 15706 |
| 548 | Ga0207713_1002140 | 3300025735 | Bacteria | 14704 |
| 549 | Ga0207713_1006051 | 3300025735 | Bacteria | 7462 |
| 550 | Ga0207713_1006520 | 3300025735 | Bacteria | 7095 |
| 551 | Ga0207713_1006730 | 3300025735 | Bacteria | 6944 |
| 552 | Ga0207713_1011365 | 3300025735 | Bacteria | 4850 |
| 553 | Ga0207713_1015136 | 3300025735 | Bacteria | 3972 |
| 554 | Ga0207713_1022789 | 3300025735 | Bacteria | 2963 |
| 555 | Ga0207713_1046537 | 3300025735 | Bacteria | 1763 |
| 556 | Ga0207713_1048315 | 3300025735 | Bacteria | 1714 |
| 557 | Ga0207713_1050065 | 3300025735 | Bacteria | 1670 |
| 558 | Ga0207710_10000057 | 3300025900 | Bacteria | 177544 |
| 559 | Ga0207710_10000116 | 3300025900 | Bacteria | 99007 |
| 560 | Ga0207680_10010111 | 3300025903 | Bacteria | 4709 |
| 561 | Ga0207699_10081485 | 3300025906 | Bacteria | 2008 |
| 562 | Ga0207699_10617707 | 3300025906 | Bacteria | 790 |
| 563 | Ga0207705_10010468 | 3300025909 | Bacteria | 6744 |
| 564 | Ga0207705_10176978 | 3300025909 | Bacteria | 1608 |
| 565 | Ga0207684_10000375 | 3300025910 | Bacteria | 60578 |
| 566 | Ga0207684_10022809 | 3300025910 | Bacteria | 5345 |
| 567 | Ga0207654_10000004 | 3300025911 | Bacteria | 902334 |
| 568 | Ga0207654_10004979 | 3300025911 | Bacteria | 6716 |
| 569 | Ga0207654_10075807 | 3300025911 | Bacteria | 2011 |
| 570 | Ga0207654_10222427 | 3300025911 | Bacteria | 1253 |
| 571 | Ga0207654_10355931 | 3300025911 | Bacteria | 1009 |
| 572 | Ga0207707_10002960 | 3300025912 | Bacteria | 15130 |
| 573 | Ga0207707_10018917 | 3300025912 | Bacteria | 6005 |
| 574 | Ga0207707_10060015 | 3300025912 | Bacteria | 3309 |
| 575 | Ga0207707_10068088 | 3300025912 | Bacteria | 3101 |
| 576 | Ga0207707_10159012 | 3300025912 | Bacteria | 1976 |
| 577 | Ga0207707_10173916 | 3300025912 | Bacteria | 1881 |
| 578 | Ga0207707_10210230 | 3300025912 | Bacteria | 1695 |
| 579 | Ga0207707_10277738 | 3300025912 | Bacteria | 1451 |
| 580 | Ga0207707_10371650 | 3300025912 | Bacteria | 1230 |
| 581 | Ga0207707_10611870 | 3300025912 | Bacteria | 921 |
| 582 | Ga0207695_10000026 | 3300025913 | Bacteria | 624558 |
| 583 | Ga0207695_10005663 | 3300025913 | Bacteria | 16491 |
| 584 | Ga0207695_10019479 | 3300025913 | Bacteria | 7815 |
| 585 | Ga0207695_10025210 | 3300025913 | Bacteria | 6664 |
| 586 | Ga0207695_10050803 | 3300025913 | Bacteria | 4359 |
| 587 | Ga0207695_10051504 | 3300025913 | Bacteria | 4323 |
| 588 | Ga0207695_10052355 | 3300025913 | Bacteria | 4278 |
| 589 | Ga0207695_10092453 | 3300025913 | Bacteria | 3036 |
| 590 | Ga0207695_10131539 | 3300025913 | Bacteria | 2460 |
| 591 | Ga0207695_10168277 | 3300025913 | Bacteria | 2119 |
| 592 | Ga0207695_10480417 | 3300025913 | Bacteria | 1125 |
| 593 | Ga0207671_10002402 | 3300025914 | Bacteria | 20078 |
| 594 | Ga0207671_10034020 | 3300025914 | Bacteria | 3789 |
| 595 | Ga0207671_10051567 | 3300025914 | Bacteria | 3049 |
| 596 | Ga0207671_10208201 | 3300025914 | Bacteria | 1529 |
| 597 | Ga0207671_10259363 | 3300025914 | Bacteria | 1368 |
| 598 | Ga0207671_10520887 | 3300025914 | Bacteria | 948 |
| 599 | Ga0207693_10252945 | 3300025915 | Bacteria | 1382 |
| 600 | Ga0207663_10465201 | 3300025916 | Bacteria | 977 |
| 601 | Ga0207663_10647141 | 3300025916 | Bacteria | 834 |
| 602 | Ga0207660_10025625 | 3300025917 | Bacteria | 4006 |
| 603 | Ga0207660_10169795 | 3300025917 | Bacteria | 1688 |
| 604 | Ga0207660_10173051 | 3300025917 | Bacteria | 1672 |
| 605 | Ga0207660_10315648 | 3300025917 | Bacteria | 1247 |
| 606 | Ga0207657_10002216 | 3300025919 | Bacteria | 21083 |
| 607 | Ga0207657_10004132 | 3300025919 | Bacteria | 15407 |
| 608 | Ga0207657_10067879 | 3300025919 | Bacteria | 3031 |
| 609 | Ga0207649_10000091 | 3300025920 | Bacteria | 75046 |
| 610 | Ga0207652_10013412 | 3300025921 | Bacteria | 6633 |
| 611 | Ga0207652_10050651 | 3300025921 | Bacteria | 3558 |
| 612 | Ga0207652_10122102 | 3300025921 | Bacteria | 2318 |
| 613 | Ga0207652_10123933 | 3300025921 | Bacteria | 2301 |
| 614 | Ga0207652_10205194 | 3300025921 | Bacteria | 1774 |
| 615 | Ga0207652_10265675 | 3300025921 | Bacteria | 1548 |
| 616 | Ga0207652_10331840 | 3300025921 | Bacteria | 1373 |
| 617 | Ga0207652_10332695 | 3300025921 | Bacteria | 1371 |
| 618 | Ga0207646_10000646 | 3300025922 | Bacteria | 45189 |
| 619 | Ga0207646_10001061 | 3300025922 | Bacteria | 34965 |
| 620 | Ga0207681_10003927 | 3300025923 | Bacteria | 9220 |
| 621 | Ga0207681_10009509 | 3300025923 | Bacteria | 5941 |
| 622 | Ga0207681_10012158 | 3300025923 | Bacteria | 5306 |
| 623 | Ga0207694_10001887 | 3300025924 | Bacteria | 17377 |
| 624 | Ga0207694_10006117 | 3300025924 | Bacteria | 9201 |
| 625 | Ga0207694_10016836 | 3300025924 | Bacteria | 5522 |
| 626 | Ga0207694_10111105 | 3300025924 | Bacteria | 2180 |
| 627 | Ga0207694_10207946 | 3300025924 | Bacteria | 1594 |
| 628 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 629 | Ga0207650_10196516 | 3300025925 | Bacteria | 1614 |
| 630 | Ga0207687_10016550 | 3300025927 | Bacteria | 4844 |
| 631 | Ga0207687_10590549 | 3300025927 | Bacteria | 935 |
| 632 | Ga0207700_10143008 | 3300025928 | Bacteria | 1968 |
| 633 | Ga0207664_10021199 | 3300025929 | Bacteria | 4827 |
| 634 | Ga0207664_10162988 | 3300025929 | Bacteria | 1903 |
| 635 | Ga0207644_10000114 | 3300025931 | Bacteria | 59996 |
| 636 | Ga0207690_10185857 | 3300025932 | Bacteria | 1568 |
| 637 | Ga0207706_10005988 | 3300025933 | Bacteria | 11308 |
| 638 | Ga0207706_10449114 | 3300025933 | Bacteria | 1115 |
| 639 | Ga0207686_10018755 | 3300025934 | Bacteria | 3921 |
| 640 | Ga0207686_10404358 | 3300025934 | Bacteria | 1041 |
| 641 | Ga0207709_10000014 | 3300025935 | Bacteria | 526302 |
| 642 | Ga0207709_10000057 | 3300025935 | Bacteria | 216617 |
| 643 | Ga0207709_10044337 | 3300025935 | Bacteria | 2687 |
| 644 | Ga0207709_10045254 | 3300025935 | Bacteria | 2664 |
| 645 | Ga0207704_10267511 | 3300025938 | Bacteria | 1292 |
| 646 | Ga0207665_10229470 | 3300025939 | Bacteria | 1364 |
| 647 | Ga0207691_10011158 | 3300025940 | Bacteria | 8623 |
| 648 | Ga0207711_10000540 | 3300025941 | Bacteria | 38701 |
| 649 | Ga0207711_10094296 | 3300025941 | Bacteria | 2637 |
| 650 | Ga0207661_10104321 | 3300025944 | Bacteria | 2387 |
| 651 | Ga0207661_10162496 | 3300025944 | Bacteria | 1938 |
| 652 | Ga0207661_10293109 | 3300025944 | Bacteria | 1457 |
| 653 | Ga0207661_10336558 | 3300025944 | Bacteria | 1359 |
| 654 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 655 | Ga0207679_10003924 | 3300025945 | Bacteria | 9236 |
| 656 | Ga0207679_10355068 | 3300025945 | Bacteria | 1279 |
| 657 | Ga0207679_10565822 | 3300025945 | Bacteria | 1021 |
| 658 | Ga0207667_10000056 | 3300025949 | Bacteria | 206107 |
| 659 | Ga0207667_10007192 | 3300025949 | Bacteria | 13428 |
| 660 | Ga0207667_10008358 | 3300025949 | Bacteria | 12301 |
| 661 | Ga0207667_10011443 | 3300025949 | Bacteria | 10312 |
| 662 | Ga0207667_10015452 | 3300025949 | Bacteria | 8671 |
| 663 | Ga0207667_10047933 | 3300025949 | Bacteria | 4519 |
| 664 | Ga0207667_10050239 | 3300025949 | Bacteria | 4400 |
| 665 | Ga0207667_10332042 | 3300025949 | Bacteria | 1552 |
| 666 | Ga0207651_10900677 | 3300025960 | Bacteria | 788 |
| 667 | Ga0207712_10035652 | 3300025961 | Bacteria | 3382 |
| 668 | Ga0207712_10098219 | 3300025961 | Bacteria | 2171 |
| 669 | Ga0207712_10263888 | 3300025961 | Bacteria | 1398 |
| 670 | Ga0207668_10056646 | 3300025972 | Bacteria | 2730 |
| 671 | Ga0207640_10066017 | 3300025981 | Bacteria | 2416 |
| 672 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 673 | Ga0207658_10278685 | 3300025986 | Bacteria | 1432 |
| 674 | Ga0207658_10711757 | 3300025986 | Bacteria | 908 |
| 675 | Ga0207703_10139240 | 3300026035 | Bacteria | 2104 |
| 676 | Ga0207639_10002091 | 3300026041 | Bacteria | 13437 |
| 677 | Ga0207639_10042648 | 3300026041 | Bacteria | 3401 |
| 678 | Ga0207639_10134728 | 3300026041 | Bacteria | 2050 |
| 679 | Ga0207708_10339945 | 3300026075 | Bacteria | 1229 |
| 680 | Ga0207702_10222315 | 3300026078 | Bacteria | 1760 |
| 681 | Ga0207702_10364738 | 3300026078 | Bacteria | 1385 |
| 682 | Ga0207641_10010424 | 3300026088 | Bacteria | 7637 |
| 683 | Ga0207641_10034576 | 3300026088 | Bacteria | 4205 |
| 684 | Ga0207641_10043029 | 3300026088 | Bacteria | 3791 |
| 685 | Ga0207641_10058260 | 3300026088 | Bacteria | 3287 |
| 686 | Ga0207648_10122125 | 3300026089 | Bacteria | 2290 |
| 687 | Ga0207648_10376716 | 3300026089 | Bacteria | 1283 |
| 688 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 689 | Ga0207676_10033379 | 3300026095 | Bacteria | 3888 |
| 690 | Ga0207676_10268177 | 3300026095 | Bacteria | 1545 |
| 691 | Ga0207674_10006670 | 3300026116 | Bacteria | 13558 |
| 692 | Ga0207674_10011684 | 3300026116 | Bacteria | 9857 |
| 693 | Ga0207674_10023573 | 3300026116 | Bacteria | 6590 |
| 694 | Ga0207674_10090377 | 3300026116 | Bacteria | 3053 |
| 695 | Ga0207674_10127165 | 3300026116 | Bacteria | 2514 |
| 696 | Ga0207674_10362769 | 3300026116 | Bacteria | 1400 |
| 697 | Ga0207674_10393041 | 3300026116 | Bacteria | 1340 |
| 698 | Ga0207683_10229593 | 3300026121 | Bacteria | 1692 |
| 699 | Ga0207683_10500576 | 3300026121 | Bacteria | 1122 |
| 700 | Ga0207698_10000016 | 3300026142 | Bacteria | 183355 |
| 701 | Ga0207698_10008579 | 3300026142 | Bacteria | 6475 |
| 702 | Ga0207698_10012294 | 3300026142 | Bacteria | 5595 |
| 703 | Ga0207698_10028126 | 3300026142 | Bacteria | 4004 |
| 704 | Ga0207698_11008029 | 3300026142 | Bacteria | 844 |
| 705 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 706 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 707 | Ga0209281_1000038 | 3300027111 | Bacteria | 361154 |
| 708 | Ga0209281_1000073 | 3300027111 | Bacteria | 269036 |
| 709 | Ga0209281_1000095 | 3300027111 | Bacteria | 238108 |
| 710 | Ga0209281_1000219 | 3300027111 | Bacteria | 123456 |
| 711 | Ga0209281_1000245 | 3300027111 | Bacteria | 109870 |
| 712 | Ga0209281_1000286 | 3300027111 | Bacteria | 94163 |
| 713 | Ga0209281_1000523 | 3300027111 | Bacteria | 49786 |
| 714 | Ga0209281_1001391 | 3300027111 | Bacteria | 14786 |
| 715 | Ga0209281_1001556 | 3300027111 | Bacteria | 12619 |
| 716 | Ga0209281_1014319 | 3300027111 | Bacteria | 1683 |
| 717 | Ga0209281_1034725 | 3300027111 | Bacteria | 880 |
| 718 | Ga0209389_1000059 | 3300027296 | Bacteria | 106207 |
| 719 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 720 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 721 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 722 | Ga0209371_1000074 | 3300027312 | Bacteria | 198823 |
| 723 | Ga0209371_1000108 | 3300027312 | Bacteria | 141822 |
| 724 | Ga0209371_1000118 | 3300027312 | Bacteria | 134470 |
| 725 | Ga0209371_1000559 | 3300027312 | Bacteria | 34100 |
| 726 | Ga0209371_1000623 | 3300027312 | Bacteria | 31527 |
| 727 | Ga0209371_1001065 | 3300027312 | Bacteria | 20506 |
| 728 | Ga0209371_1001486 | 3300027312 | Bacteria | 15660 |
| 729 | Ga0209371_1001911 | 3300027312 | Bacteria | 12728 |
| 730 | Ga0209371_1001929 | 3300027312 | Bacteria | 12659 |
| 731 | Ga0209371_1003423 | 3300027312 | Bacteria | 7729 |
| 732 | Ga0209371_1005379 | 3300027312 | Bacteria | 5108 |
| 733 | Ga0209371_1005669 | 3300027312 | Bacteria | 4884 |
| 734 | Ga0209371_1005973 | 3300027312 | Bacteria | 4662 |
| 735 | Ga0209371_1008915 | 3300027312 | Bacteria | 3257 |
| 736 | Ga0209371_1039405 | 3300027312 | Bacteria | 968 |
| 737 | Ga0209371_1047394 | 3300027312 | Bacteria | 840 |
| 738 | Ga0209969_1038876 | 3300027360 | Bacteria | 736 |
| 739 | Ga0209996_1001408 | 3300027395 | Bacteria | 2891 |
| 740 | Ga0209995_1002861 | 3300027471 | Bacteria | 2737 |
| 741 | Ga0209968_1017603 | 3300027526 | Bacteria | 1141 |
| 742 | Ga0209999_1000815 | 3300027543 | Bacteria | 5139 |
| 743 | Ga0209999_1003362 | 3300027543 | Bacteria | 2855 |
| 744 | Ga0209982_1000570 | 3300027552 | Bacteria | 4616 |
| 745 | Ga0209970_1051345 | 3300027614 | Bacteria | 746 |
| 746 | Ga0210002_1014314 | 3300027617 | Bacteria | 1243 |
| 747 | Ga0209983_1008056 | 3300027665 | Bacteria | 2154 |
| 748 | Ga0209971_1002760 | 3300027682 | Bacteria | 4197 |
| 749 | Ga0209974_10011293 | 3300027876 | Bacteria | 3004 |
| 750 | Ga0209974_10020683 | 3300027876 | Bacteria | 2181 |
| 751 | Ga0207428_10009183 | 3300027907 | Bacteria | 8883 |
| 752 | Ga0207428_10307440 | 3300027907 | Bacteria | 1173 |
| 753 | Ga0268266_10000260 | 3300028379 | Bacteria | 88643 |
| 754 | Ga0268266_10000922 | 3300028379 | Bacteria | 37700 |
| 755 | Ga0268266_10008882 | 3300028379 | Bacteria | 8898 |
| 756 | Ga0268266_10014247 | 3300028379 | Bacteria | 6838 |
| 757 | Ga0268266_10394983 | 3300028379 | Bacteria | 1307 |
| 758 | Ga0268265_10001710 | 3300028380 | Bacteria | 17840 |
| 759 | Ga0268265_10180571 | 3300028380 | Bacteria | 1813 |
| 760 | Ga0268265_10364450 | 3300028380 | Bacteria | 1324 |
| 761 | Ga0268265_10761446 | 3300028380 | Bacteria | 941 |
| 762 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 763 | Ga0268264_10187921 | 3300028381 | Bacteria | 1881 |
| 764 | Ga0268264_10432056 | 3300028381 | Bacteria | 1272 |
| 765 | Ga0265334_10000027 | 3300028573 | Bacteria | 116133 |
| 766 | Ga0265338_10005574 | 3300028800 | Bacteria | 16374 |
| 767 | Ga0265338_10009230 | 3300028800 | Bacteria | 11804 |
| 768 | Ga0265338_10703116 | 3300028800 | Bacteria | 697 |
| 769 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 770 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 771 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 772 | Ga0268256_1000035 | 3300030500 | Bacteria | 384794 |
| 773 | Ga0268256_1000067 | 3300030500 | Bacteria | 198823 |
| 774 | Ga0268256_1000076 | 3300030500 | Bacteria | 178295 |
| 775 | Ga0268256_1000100 | 3300030500 | Bacteria | 134526 |
| 776 | Ga0268256_1001225 | 3300030500 | Bacteria | 16220 |
| 777 | Ga0268256_1001273 | 3300030500 | Bacteria | 15660 |
| 778 | Ga0268256_1002311 | 3300030500 | Bacteria | 9873 |
| 779 | Ga0268256_1003145 | 3300030500 | Bacteria | 7695 |
| 780 | Ga0268256_1005534 | 3300030500 | Bacteria | 4927 |
| 781 | Ga0268256_1005606 | 3300030500 | Bacteria | 4884 |
| 782 | Ga0268256_1009434 | 3300030500 | Bacteria | 3238 |
| 783 | Ga0268256_1009898 | 3300030500 | Bacteria | 3125 |
| 784 | Ga0268256_1012362 | 3300030500 | Bacteria | 2643 |
| 785 | Ga0268256_1019408 | 3300030500 | Bacteria | 1863 |
| 786 | Ga0314311_1177641 | 3300030733 | Bacteria | 10294 |
| 787 | Ga0316183_1021560 | 3300030742 | Bacteria | 1239 |
| 788 | Ga0316181_1094953 | 3300030744 | Bacteria | 3560 |
| 789 | Ga0265339_10010931 | 3300031249 | Bacteria | 5611 |
| 790 | Ga0265331_10009805 | 3300031250 | Bacteria | 5342 |
| 791 | Ga0265331_10085094 | 3300031250 | Bacteria | 1465 |
| 792 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 793 | Ga0265327_10000068 | 3300031251 | Bacteria | 219962 |
| 794 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 795 | Ga0316575_10034839 | 3300031665 | Bacteria | 1978 |
| 796 | Ga0316575_10111770 | 3300031665 | Bacteria | 1115 |
| 797 | Ga0316579_10077408 | 3300031691 | Bacteria | 1581 |
| 798 | Ga0316579_10258132 | 3300031691 | Bacteria | 843 |
| 799 | Ga0265314_10000200 | 3300031711 | Bacteria | 88202 |
| 800 | Ga0265314_10170386 | 3300031711 | Bacteria | 1315 |
| 801 | Ga0265314_10192298 | 3300031711 | Bacteria | 1213 |
| 802 | Ga0316576_10007643 | 3300031727 | Bacteria | 6818 |
| 803 | Ga0316576_10029210 | 3300031727 | Bacteria | 3894 |
| 804 | Ga0316576_10073876 | 3300031727 | Bacteria | 2520 |
| 805 | Ga0316576_10398958 | 3300031727 | Bacteria | 1019 |
| 806 | Ga0316576_10450987 | 3300031727 | Bacteria | 950 |
| 807 | Ga0316578_10039501 | 3300031728 | Bacteria | 2726 |
| 808 | Ga0316578_10040877 | 3300031728 | Bacteria | 2683 |
| 809 | Ga0316578_10051828 | 3300031728 | Bacteria | 2404 |
| 810 | Ga0316578_10096159 | 3300031728 | Bacteria | 1773 |
| 811 | Ga0316578_10130874 | 3300031728 | Bacteria | 1510 |
| 812 | Ga0316578_10162476 | 3300031728 | Bacteria | 1346 |
| 813 | Ga0316578_10164734 | 3300031728 | Bacteria | 1336 |
| 814 | Ga0316578_10325902 | 3300031728 | Bacteria | 916 |
| 815 | Ga0316577_10014110 | 3300031733 | Bacteria | 4385 |
| 816 | Ga0316577_10025136 | 3300031733 | Bacteria | 3313 |
| 817 | Ga0316577_10054961 | 3300031733 | Bacteria | 2222 |
| 818 | Ga0307407_10926423 | 3300031903 | Bacteria | 670 |
| 819 | Ga0307412_10204864 | 3300031911 | Bacteria | 1501 |
| 820 | Ga0307414_10309274 | 3300032004 | Bacteria | 1340 |
| 821 | Ga0307414_10354090 | 3300032004 | Bacteria | 1261 |
| 822 | Ga0316583_10021544 | 3300032133 | Bacteria | 2310 |
| 823 | Ga0316583_10063189 | 3300032133 | Bacteria | 1297 |
| 824 | Ga0316583_10075812 | 3300032133 | Bacteria | 1176 |
| 825 | Ga0316583_10149250 | 3300032133 | Bacteria | 814 |
| 826 | Ga0316580_10094174 | 3300032139 | Bacteria | 917 |
| 827 | Ga0307510_10149283 | 3300033180 | Bacteria | 1961 |
| 828 | Ga0316588_1068150 | 3300033528 | Bacteria | 872 |
| 829 | Ga0316574_0009492 | 3300035398 | Bacteria | 5451 |
| 830 | Ga0316574_0057866 | 3300035398 | Bacteria | 2428 |
| 831 | Ga0316574_0079136 | 3300035398 | Bacteria | 2085 |
| 832 | Ga0373931_0113716 | 3300035691 | Bacteria | 1539 |
| 833 | Ga0373931_0212543 | 3300035691 | Bacteria | 1161 |
| 834 | Ga0373937_0138772 | 3300036401 | Bacteria | 2274 |
| 835 | Ga0373937_0468333 | 3300036401 | Bacteria | 1197 |
| 836 | Ga0373937_0994095 | 3300036401 | Bacteria | 788 |
| 837 | Ga0316582_0002360 | 3300036647 | Bacteria | 8847 |
| 838 | Ga0316582_0008667 | 3300036647 | Bacteria | 5475 |
| 839 | Ga0316582_0043570 | 3300036647 | Bacteria | 2816 |
| 840 | Ga0316582_0054014 | 3300036647 | Bacteria | 2556 |
| 841 | Ga0316582_0067917 | 3300036647 | Bacteria | 2301 |
| 842 | Ga0316582_0138315 | 3300036647 | Unclassified | 1641 |
| 843 | Ga0316582_0301093 | 3300036647 | Bacteria | 1102 |
| 844 | Ga0316582_0328019 | 3300036647 | Bacteria | 1052 |
| 845 | Ga0316582_0478801 | 3300036647 | Bacteria | 858 |
| 846 | Ga0316584_0003440 | 3300036712 | Bacteria | 10276 |
| 847 | Ga0316584_0007542 | 3300036712 | Bacteria | 7453 |
| 848 | Ga0316584_0026181 | 3300036712 | Bacteria | 4285 |
| 849 | Ga0316584_0032332 | 3300036712 | Bacteria | 3873 |
| 850 | Ga0316584_0118564 | 3300036712 | Bacteria | 1979 |
| 851 | Ga0316584_0123617 | 3300036712 | Bacteria | 1933 |
| 852 | Ga0316584_0189578 | 3300036712 | Bacteria | 1520 |
| 853 | Ga0316584_0261120 | 3300036712 | Bacteria | 1263 |
| 854 | Ga0316584_0315928 | 3300036712 | Unclassified | 1128 |
| 855 | Ga0373925_0234933 | 3300037068 | Bacteria | 1467 |
| 856 | Ga0373925_0253900 | 3300037068 | Bacteria | 1411 |
| 857 | Ga0395899_0137518 | 3300037312 | Bacteria | 1741 |
| 858 | Ga0395900_0050862 | 3300037418 | Bacteria | 4268 |
| 859 | Ga0316581_0022472 | 3300037588 | Bacteria | 1860 |
| 860 | Ga0316581_0143268 | 3300037588 | Bacteria | 737 |
| 861 | Ga0436364_0207702 | 3300037853 | Bacteria | 15053 |
| 862 | Ga0395901_0594051 | 3300038443 | Bacteria | 1117 |
| 863 | Ga0237819_01448 | 3300038705 | Bacteria | 6101 |
| 864 | Ga0436365_0965775 | 3300039437 | Bacteria | 470291 |
| 865 | Ga0436361_0242772 | 3300039447 | Bacteria | 10101 |
| 866 | Ga0436361_0245497 | 3300039447 | Bacteria | 13991 |
| 867 | Ga0436362_0424287 | 3300039453 | Bacteria | 1473 |
| 868 | Ga0439436_0009562 | 3300041404 | Bacteria | 2973 |
| 869 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 870 | Ga0439438_005231 | 3300041405 | Bacteria | 4814 |
| 871 | Ga0439438_010532 | 3300041405 | Bacteria | 2918 |
| 872 | Ga0439438_013436 | 3300041405 | Bacteria | 2470 |
| 873 | Ga0439438_039147 | 3300041405 | Bacteria | 1235 |
| 874 | Ga0439447_000766 | 3300041407 | Bacteria | 11849 |
| 875 | Ga0439447_001765 | 3300041407 | Bacteria | 7934 |
| 876 | Ga0439447_004016 | 3300041407 | Bacteria | 5147 |
| 877 | Ga0439466_0000001 | 3300041411 | Bacteria | 647258 |
| 878 | Ga0439466_0043834 | 3300041411 | Bacteria | 1484 |
| 879 | Ga0451807_2221466 | 3300041486 | Bacteria | 1549 |
| 880 | Ga0451853_3687995 | 3300041512 | Bacteria | 1643 |
| 881 | Ga0439431_0000701 | 3300041997 | Bacteria | 7210 |
| 882 | Ga0439437_001932 | 3300042000 | Bacteria | 2202 |
| 883 | Ga0439432_006455 | 3300042006 | Bacteria | 4187 |
| 884 | Ga0439432_008550 | 3300042006 | Bacteria | 3592 |
| 885 | Ga0439432_019197 | 3300042006 | Bacteria | 2278 |
| 886 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 887 | Ga0439452_000015 | 3300042010 | Bacteria | 342948 |
| 888 | Ga0439452_000020 | 3300042010 | Bacteria | 309345 |
| 889 | Ga0439452_002528 | 3300042010 | Bacteria | 6726 |
| 890 | Ga0439452_003897 | 3300042010 | Bacteria | 5114 |
| 891 | Ga0439452_010867 | 3300042010 | Bacteria | 2633 |
| 892 | Ga0439452_013703 | 3300042010 | Bacteria | 2269 |
| 893 | Ga0439456_002909 | 3300042013 | Bacteria | 3460 |
| 894 | Ga0439463_008014 | 3300042016 | Bacteria | 2606 |
| 895 | Ga0450911_000013 | 3300042115 | Bacteria | 129019 |
| 896 | Ga0450891_003387 | 3300042129 | Bacteria | 1537 |
| 897 | Ga0450900_006691 | 3300042136 | Bacteria | 1401 |
| 898 | Ga0450904_000563 | 3300042139 | Bacteria | 6971 |
| 899 | Ga0450905_003201 | 3300042142 | Bacteria | 2147 |
| 900 | Ga0450907_001332 | 3300042146 | Bacteria | 5489 |
| 901 | Ga0439464_0001265 | 3300042439 | Bacteria | 5876 |
| 902 | Ga0439464_0008628 | 3300042439 | Bacteria | 2670 |
| 903 | Ga0439464_0009525 | 3300042439 | Bacteria | 2558 |
| 904 | Ga0450916_008641 | 3300042530 | Bacteria | 1243 |
| 905 | Ga0450901_001122 | 3300042533 | Bacteria | 3104 |
| 906 | Ga0451577_0189897 | 3300042876 | Bacteria | 1853 |
| 907 | Ga0451577_0238178 | 3300042876 | Bacteria | 1646 |
| 908 | Ga0451577_1074925 | 3300042876 | Bacteria | 721 |
| 909 | Ga0466981_0000013 | 3300044669 | Bacteria | 129274 |
| 910 | Ga0453683_0085063 | 3300044673 | Unclassified | 1981 |
| 911 | Ga0466961_0262982 | 3300044693 | Bacteria | 1058 |
| 912 | Ga0453684_0163432 | 3300044712 | Bacteria | 2631 |
| 913 | Ga0453684_0205476 | 3300044712 | Bacteria | 2293 |
| 914 | Ga0451576_0074345 | 3300045051 | Bacteria | 3536 |
| 915 | Ga0495627_001293 | 3300046453 | Bacteria | 15345 |
| 916 | Ga0495627_002814 | 3300046453 | Bacteria | 8071 |
| 917 | Ga0495627_004099 | 3300046453 | Bacteria | 6194 |
| 918 | Ga0495627_011664 | 3300046453 | Bacteria | 3146 |
| 919 | Ga0495603_0001787 | 3300046455 | Bacteria | 12689 |
| 920 | Ga0495603_0007169 | 3300046455 | Bacteria | 6696 |
| 921 | Ga0495590_0065519 | 3300046457 | Bacteria | 1272 |
| 922 | Ga0495591_000001 | 3300046458 | Bacteria | 503087 |
| 923 | Ga0495591_000294 | 3300046458 | Bacteria | 45588 |
| 924 | Ga0495591_002693 | 3300046458 | Bacteria | 9637 |
| 925 | Ga0495591_003463 | 3300046458 | Bacteria | 8135 |
| 926 | Ga0495591_018161 | 3300046458 | Bacteria | 2391 |
| 927 | Ga0495591_019023 | 3300046458 | Bacteria | 2312 |
| 928 | Ga0495591_022970 | 3300046458 | Bacteria | 2007 |
| 929 | Ga0495629_0004989 | 3300046459 | Bacteria | 9953 |
| 930 | Ga0495629_0041111 | 3300046459 | Bacteria | 3253 |
| 931 | Ga0495651_0007356 | 3300046462 | Bacteria | 8420 |
| 932 | Ga0495651_0075679 | 3300046462 | Bacteria | 2551 |
| 933 | Ga0495651_0352907 | 3300046462 | Bacteria | 971 |
| 934 | Ga0495653_0009486 | 3300046463 | Bacteria | 7967 |
| 935 | Ga0495653_0096886 | 3300046463 | Bacteria | 2144 |
| 936 | Ga0495650_0000018 | 3300046471 | Bacteria | 538888 |
| 937 | Ga0495650_0000047 | 3300046471 | Bacteria | 335136 |
| 938 | Ga0495650_0000065 | 3300046471 | Bacteria | 275124 |
| 939 | Ga0495650_0034724 | 3300046471 | Bacteria | 2228 |
| 940 | Ga0495650_0041541 | 3300046471 | Bacteria | 1966 |
| 941 | Ga0495580_0097021 | 3300046472 | Bacteria | 2050 |
| 942 | Ga0495580_0123367 | 3300046472 | Bacteria | 1798 |
| 943 | Ga0495580_0278565 | 3300046472 | Bacteria | 1141 |
| 944 | Ga0495580_0289104 | 3300046472 | Bacteria | 1117 |
| 945 | Ga0495582_0001734 | 3300046473 | Bacteria | 12309 |
| 946 | Ga0495605_0001329 | 3300046474 | Bacteria | 16353 |
| 947 | Ga0495605_0003755 | 3300046474 | Bacteria | 9013 |
| 948 | Ga0495605_0016097 | 3300046474 | Bacteria | 4053 |
| 949 | Ga0495605_0062880 | 3300046474 | Bacteria | 1772 |
| 950 | Ga0495639_0000745 | 3300046475 | Bacteria | 14896 |
| 951 | Ga0495662_0001664 | 3300046476 | Bacteria | 11072 |
| 952 | Ga0495664_0010856 | 3300046477 | Bacteria | 5120 |
| 953 | Ga0495584_0009860 | 3300046491 | Bacteria | 4911 |
| 954 | Ga0495584_0054593 | 3300046491 | Bacteria | 2010 |
| 955 | Ga0495585_0004297 | 3300046492 | Bacteria | 9275 |
| 956 | Ga0495585_0054882 | 3300046492 | Bacteria | 2202 |
| 957 | Ga0495585_0073715 | 3300046492 | Bacteria | 1858 |
| 958 | Ga0495594_0000216 | 3300046499 | Bacteria | 28040 |
| 959 | Ga0495594_0000830 | 3300046499 | Bacteria | 15930 |
| 960 | Ga0495594_0052832 | 3300046499 | Bacteria | 2237 |
| 961 | Ga0495596_0031937 | 3300046500 | Bacteria | 2101 |
| 962 | Ga0495596_0110699 | 3300046500 | Bacteria | 1066 |
| 963 | Ga0495607_0007302 | 3300046501 | Bacteria | 7663 |
| 964 | Ga0495607_0007331 | 3300046501 | Bacteria | 7645 |
| 965 | Ga0495607_0013183 | 3300046501 | Bacteria | 5428 |
| 966 | Ga0495607_0046555 | 3300046501 | Bacteria | 2546 |
| 967 | Ga0495607_0144411 | 3300046501 | Bacteria | 1224 |
| 968 | Ga0495583_0002373 | 3300046506 | Bacteria | 16250 |
| 969 | Ga0495606_0002485 | 3300046507 | Bacteria | 21334 |
| 970 | Ga0495606_0008696 | 3300046507 | Bacteria | 8745 |
| 971 | Ga0495606_0018216 | 3300046507 | Bacteria | 5275 |
| 972 | Ga0495606_0067958 | 3300046507 | Bacteria | 2256 |
| 973 | Ga0495606_0111942 | 3300046507 | Bacteria | 1645 |
| 974 | Ga0495608_0092071 | 3300046511 | Bacteria | 1960 |
| 975 | Ga0495610_0005513 | 3300046512 | Bacteria | 8965 |
| 976 | Ga0495610_0027951 | 3300046512 | Bacteria | 2989 |
| 977 | Ga0495616_0130415 | 3300046513 | Bacteria | 1152 |
| 978 | Ga0495620_0000442 | 3300046515 | Bacteria | 27759 |
| 979 | Ga0495620_0020756 | 3300046515 | Bacteria | 3201 |
| 980 | Ga0495620_0079176 | 3300046515 | Bacteria | 1332 |
| 981 | Ga0495620_0086445 | 3300046515 | Bacteria | 1262 |
| 982 | Ga0495628_0020708 | 3300046516 | Bacteria | 5420 |
| 983 | Ga0495628_0247745 | 3300046516 | Bacteria | 1331 |
| 984 | Ga0495631_0005429 | 3300046518 | Bacteria | 6672 |
| 985 | Ga0495631_0024246 | 3300046518 | Bacteria | 2802 |
| 986 | Ga0495632_0017242 | 3300046519 | Bacteria | 3992 |
| 987 | Ga0495632_0022277 | 3300046519 | Bacteria | 3397 |
| 988 | Ga0495632_0050001 | 3300046519 | Bacteria | 2064 |
| 989 | Ga0495632_0060310 | 3300046519 | Bacteria | 1843 |
| 990 | Ga0495637_0010588 | 3300046520 | Bacteria | 4453 |
| 991 | Ga0495643_0012496 | 3300046522 | Bacteria | 5121 |
| 992 | Ga0495643_0020777 | 3300046522 | Bacteria | 3778 |
| 993 | Ga0495643_0033482 | 3300046522 | Bacteria | 2842 |
| 994 | Ga0495643_0084001 | 3300046522 | Bacteria | 1652 |
| 995 | Ga0495644_0000233 | 3300046523 | Bacteria | 26270 |
| 996 | Ga0495644_0005253 | 3300046523 | Bacteria | 5060 |
| 997 | Ga0495648_0012791 | 3300046524 | Bacteria | 6232 |
| 998 | Ga0495648_0021611 | 3300046524 | Bacteria | 4452 |
| 999 | Ga0495648_0034739 | 3300046524 | Bacteria | 3277 |
| 1000 | Ga0495648_0049812 | 3300046524 | Bacteria | 2564 |
| 1001 | Ga0495666_0003666 | 3300046526 | Bacteria | 7757 |
| 1002 | Ga0495642_0079041 | 3300046528 | Bacteria | 1383 |
| 1003 | Ga0495654_0000009 | 3300046530 | Bacteria | 381872 |
| 1004 | Ga0495654_0001323 | 3300046530 | Bacteria | 17296 |
| 1005 | Ga0495654_0002421 | 3300046530 | Bacteria | 12017 |
| 1006 | Ga0495654_0015044 | 3300046530 | Bacteria | 4111 |
| 1007 | Ga0495654_0030540 | 3300046530 | Bacteria | 2740 |
| 1008 | Ga0495654_0133639 | 3300046530 | Bacteria | 1111 |
| 1009 | Ga0495654_0179076 | 3300046530 | Bacteria | 919 |
| 1010 | Ga0495665_0014859 | 3300046531 | Bacteria | 4193 |
| 1011 | Ga0495640_0007292 | 3300046533 | Bacteria | 8712 |
| 1012 | Ga0495586_0194202 | 3300046535 | Bacteria | 1150 |
| 1013 | Ga0495587_0055535 | 3300046536 | Bacteria | 2332 |
| 1014 | Ga0495609_0000051 | 3300046538 | Bacteria | 153822 |
| 1015 | Ga0495609_0003299 | 3300046538 | Bacteria | 9307 |
| 1016 | Ga0495609_0024685 | 3300046538 | Bacteria | 2756 |
| 1017 | Ga0495597_0004166 | 3300046542 | Bacteria | 8020 |
| 1018 | Ga0495645_0234118 | 3300046543 | Bacteria | 1229 |
| 1019 | Ga0495622_0033549 | 3300046557 | Bacteria | 2395 |
| 1020 | Ga0495633_0000915 | 3300046558 | Bacteria | 25017 |
| 1021 | Ga0495633_0027564 | 3300046558 | Bacteria | 2776 |
| 1022 | Ga0495667_0012738 | 3300046559 | Bacteria | 5699 |
| 1023 | Ga0495634_0003158 | 3300046642 | Bacteria | 13334 |
| 1024 | Ga0495611_0020449 | 3300046648 | Bacteria | 2849 |
| 1025 | Ga0495611_0025207 | 3300046648 | Bacteria | 2590 |
| 1026 | Ga0495611_0028487 | 3300046648 | Bacteria | 2446 |
| 1027 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 1028 | Ga0495625_0011960 | 3300046660 | Bacteria | 7044 |
| 1029 | Ga0495625_0016366 | 3300046660 | Bacteria | 5839 |
| 1030 | Ga0495635_0029627 | 3300046663 | Bacteria | 3806 |
| 1031 | Ga0495661_0000013 | 3300046665 | Bacteria | 259387 |
| 1032 | Ga0495661_0000548 | 3300046665 | Bacteria | 38896 |
| 1033 | Ga0495661_0000809 | 3300046665 | Bacteria | 29384 |
| 1034 | Ga0495588_0036433 | 3300046674 | Bacteria | 2496 |
| 1035 | Ga0495588_0051895 | 3300046674 | Bacteria | 2113 |
| 1036 | Ga0495657_0126901 | 3300046675 | Bacteria | 1602 |
| 1037 | Ga0495599_0001842 | 3300046678 | Bacteria | 12288 |
| 1038 | Ga0495599_0172334 | 3300046678 | Bacteria | 1335 |
| 1039 | Ga0495623_0026675 | 3300046679 | Bacteria | 3717 |
| 1040 | Ga0495623_0059092 | 3300046679 | Bacteria | 2409 |
| 1041 | Ga0495646_0006639 | 3300046680 | Bacteria | 7336 |
| 1042 | Ga0495658_0224910 | 3300046683 | Bacteria | 1176 |
| 1043 | Ga0495669_0001216 | 3300046684 | Bacteria | 10714 |
| 1044 | Ga0495613_0032456 | 3300046689 | Bacteria | 3879 |
| 1045 | Ga0495613_0082068 | 3300046689 | Bacteria | 2341 |
| 1046 | Ga0495613_0122210 | 3300046689 | Bacteria | 1869 |
| 1047 | Ga0495613_0196759 | 3300046689 | Bacteria | 1423 |
| 1048 | Ga0495624_0003705 | 3300046690 | Bacteria | 11297 |
| 1049 | Ga0495670_0004477 | 3300046691 | Bacteria | 6853 |
| 1050 | Ga0495671_0002913 | 3300046692 | Bacteria | 10671 |
| 1051 | Ga0495671_0049519 | 3300046692 | Bacteria | 2094 |
| 1052 | Ga0495671_0076738 | 3300046692 | Bacteria | 1638 |
| 1053 | Ga0495649_0015931 | 3300046694 | Bacteria | 4268 |
| 1054 | Ga0495649_0020506 | 3300046694 | Bacteria | 3708 |
| 1055 | Ga0495649_0100822 | 3300046694 | Bacteria | 1534 |
| 1056 | Ga0495649_0352189 | 3300046694 | Bacteria | 744 |
| 1057 | Ga0495589_0000003 | 3300046794 | Bacteria | 453448 |
| 1058 | Ga0495589_0015919 | 3300046794 | Bacteria | 3866 |
| 1059 | Ga0495589_0048748 | 3300046794 | Bacteria | 2096 |
| 1060 | Ga0495589_0089504 | 3300046794 | Bacteria | 1495 |
| 1061 | Ga0495589_0091341 | 3300046794 | Bacteria | 1478 |
| 1062 | Ga0495600_0000817 | 3300046809 | Bacteria | 16536 |
| 1063 | Ga0495600_0107321 | 3300046809 | Bacteria | 1819 |
| 1064 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 1065 | Ga0495660_0000017 | 3300046810 | Bacteria | 320655 |
| 1066 | Ga0495660_0072561 | 3300046810 | Bacteria | 1822 |
| 1067 | Ga0495660_0136060 | 3300046810 | Bacteria | 1227 |
| 1068 | Ga0495581_0059696 | 3300047315 | Bacteria | 2204 |
| 1069 | Ga0495604_0005986 | 3300047317 | Bacteria | 9655 |
| 1070 | Ga0495604_0016655 | 3300047317 | Bacteria | 5878 |
| 1071 | Ga0495674_0014787 | 3300047319 | Bacteria | 7300 |
| 1072 | Ga0495674_0049201 | 3300047319 | Bacteria | 3726 |
| 1073 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 1074 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 1075 | Ga0495672_0000038 | 3300047320 | Bacteria | 273489 |
| 1076 | Ga0495672_0053550 | 3300047320 | Bacteria | 2364 |
| 1077 | Ga0495672_0126990 | 3300047320 | Bacteria | 1347 |
| 1078 | Ga0495676_0000023 | 3300047321 | Bacteria | 156478 |
| 1079 | Ga0495676_0006988 | 3300047321 | Bacteria | 10358 |
| 1080 | Ga0495676_0054753 | 3300047321 | Bacteria | 3168 |
| 1081 | Ga0495680_0085480 | 3300047322 | Bacteria | 2375 |
| 1082 | Ga0495680_0107043 | 3300047322 | Bacteria | 2077 |
| 1083 | Ga0495683_0000090 | 3300047323 | Bacteria | 91954 |
| 1084 | Ga0495683_0000514 | 3300047323 | Bacteria | 29686 |
| 1085 | Ga0495675_0000711 | 3300047444 | Bacteria | 20794 |
| 1086 | Ga0495675_0021010 | 3300047444 | Bacteria | 4156 |
| 1087 | Ga0495679_000032 | 3300047446 | Bacteria | 171636 |
| 1088 | Ga0495679_000505 | 3300047446 | Bacteria | 27693 |
| 1089 | Ga0495679_001387 | 3300047446 | Bacteria | 13885 |
| 1090 | Ga0495679_004343 | 3300047446 | Bacteria | 6569 |
| 1091 | Ga0495679_015469 | 3300047446 | Bacteria | 2789 |
| 1092 | Ga0495673_0000019 | 3300047469 | Bacteria | 554389 |
| 1093 | Ga0495673_0000071 | 3300047469 | Bacteria | 217117 |
| 1094 | Ga0495673_0023667 | 3300047469 | Bacteria | 2982 |
| 1095 | Ga0495673_0044074 | 3300047469 | Bacteria | 1992 |
| 1096 | Ga0495673_0067656 | 3300047469 | Bacteria | 1511 |
| 1097 | Ga0495684_0009188 | 3300047471 | Bacteria | 7633 |
| 1098 | Ga0495686_0089975 | 3300047472 | Bacteria | 1864 |
| 1099 | Ga0495614_0001515 | 3300048089 | Bacteria | 10066 |
| 1100 | Ga0495614_0014267 | 3300048089 | Bacteria | 3481 |
| 1101 | Ga0495626_0000095 | 3300048091 | Bacteria | 114682 |
| 1102 | Ga0496100_0080311 | 3300048903 | Bacteria | 2200 |
| 1103 | Ga0496100_0232381 | 3300048903 | Bacteria | 1357 |
| 1104 | Ga0496100_0378827 | 3300048903 | Bacteria | 1074 |
| 1105 | Ga0496101_0000060 | 3300048904 | Bacteria | 128504 |
| 1106 | Ga0496101_0603971 | 3300048904 | Bacteria | 867 |
| 1107 | Ga0496102_0029999 | 3300048905 | Bacteria | 4867 |
| 1108 | Ga0496102_0150812 | 3300048905 | Bacteria | 2184 |
| 1109 | Ga0496102_0171025 | 3300048905 | Bacteria | 2045 |
| 1110 | Ga0496103_0110321 | 3300048906 | Bacteria | 1747 |
| 1111 | Ga0496103_0382227 | 3300048906 | Bacteria | 905 |
| 1112 | Ga0496104_0000212 | 3300048907 | Bacteria | 51443 |
| 1113 | Ga0496104_0043660 | 3300048907 | Bacteria | 4210 |
| 1114 | Ga0496105_0062827 | 3300048908 | Bacteria | 3064 |
| 1115 | Ga0496105_0209586 | 3300048908 | Bacteria | 1589 |
| 1116 | Ga0496106_0367030 | 3300048909 | Bacteria | 1157 |
| 1117 | Ga0496108_0054724 | 3300048911 | Bacteria | 3349 |
| 1118 | Ga0496109_0101743 | 3300048912 | Bacteria | 2667 |
| 1119 | Ga0496110_0438032 | 3300048913 | Bacteria | 1191 |
| 1120 | Ga0496112_0013081 | 3300048915 | Bacteria | 7655 |
| 1121 | Ga0496112_0026555 | 3300048915 | Bacteria | 5574 |
| 1122 | Ga0496112_0350858 | 3300048915 | Bacteria | 1418 |
| 1123 | Ga0496113_0123491 | 3300048916 | Bacteria | 2026 |
| 1124 | Ga0496113_0392597 | 3300048916 | Bacteria | 1114 |
| 1125 | Ga0496114_0069631 | 3300048917 | Bacteria | 2954 |
| 1126 | Ga0496116_0000007 | 3300048919 | Bacteria | 795464 |
| 1127 | Ga0496116_0000118 | 3300048919 | Bacteria | 168946 |
| 1128 | Ga0496116_0000132 | 3300048919 | Bacteria | 156427 |
| 1129 | Ga0496116_0000420 | 3300048919 | Bacteria | 59988 |
| 1130 | Ga0496116_0000446 | 3300048919 | Bacteria | 57660 |
| 1131 | Ga0496116_0006113 | 3300048919 | Bacteria | 11011 |
| 1132 | Ga0496116_0014310 | 3300048919 | Bacteria | 6342 |
| 1133 | Ga0496116_0043259 | 3300048919 | Bacteria | 3070 |
| 1134 | Ga0496116_0092235 | 3300048919 | Bacteria | 1838 |
| 1135 | Ga0496116_0109529 | 3300048919 | Bacteria | 1627 |
| 1136 | Ga0496116_0167310 | 3300048919 | Bacteria | 1196 |
| 1137 | Ga0496117_0000009 | 3300048920 | Bacteria | 613759 |
| 1138 | Ga0496117_0000113 | 3300048920 | Bacteria | 181737 |
| 1139 | Ga0496117_0000504 | 3300048920 | Bacteria | 64550 |
| 1140 | Ga0496117_0002374 | 3300048920 | Bacteria | 24004 |
| 1141 | Ga0496117_0008055 | 3300048920 | Bacteria | 10097 |
| 1142 | Ga0496117_0008355 | 3300048920 | Bacteria | 9843 |
| 1143 | Ga0496117_0021821 | 3300048920 | Bacteria | 5163 |
| 1144 | Ga0496117_0026137 | 3300048920 | Bacteria | 4572 |
| 1145 | Ga0496117_0089242 | 3300048920 | Bacteria | 1992 |
| 1146 | Ga0496117_0118344 | 3300048920 | Bacteria | 1633 |
| 1147 | Ga0496117_0125419 | 3300048920 | Bacteria | 1568 |
| 1148 | Ga0496118_0000017 | 3300048921 | Bacteria | 549445 |
| 1149 | Ga0496118_0001101 | 3300048921 | Bacteria | 41978 |
| 1150 | Ga0496118_0001258 | 3300048921 | Bacteria | 38870 |
| 1151 | Ga0496118_0003548 | 3300048921 | Bacteria | 19494 |
| 1152 | Ga0496118_0003973 | 3300048921 | Bacteria | 18041 |
| 1153 | Ga0496118_0007913 | 3300048921 | Bacteria | 11131 |
| 1154 | Ga0496118_0040635 | 3300048921 | Bacteria | 3695 |
| 1155 | Ga0496118_0200729 | 3300048921 | Bacteria | 1181 |
| 1156 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 1157 | Ga0496119_0000012 | 3300048922 | Bacteria | 411917 |
| 1158 | Ga0496119_0000129 | 3300048922 | Bacteria | 106571 |
| 1159 | Ga0496119_0000194 | 3300048922 | Bacteria | 85475 |
| 1160 | Ga0496119_0000860 | 3300048922 | Bacteria | 40109 |
| 1161 | Ga0496119_0008725 | 3300048922 | Bacteria | 8846 |
| 1162 | Ga0496119_0008995 | 3300048922 | Bacteria | 8669 |
| 1163 | Ga0496119_0043407 | 3300048922 | Bacteria | 2840 |
| 1164 | Ga0496119_0050436 | 3300048922 | Bacteria | 2565 |
| 1165 | Ga0496119_0053625 | 3300048922 | Bacteria | 2461 |
| 1166 | Ga0496119_0073749 | 3300048922 | Bacteria | 1989 |
| 1167 | Ga0496119_0095156 | 3300048922 | Bacteria | 1683 |
| 1168 | Ga0496120_0000004 | 3300048923 | Bacteria | 534793 |
| 1169 | Ga0496120_0000081 | 3300048923 | Bacteria | 158294 |
| 1170 | Ga0496120_0000179 | 3300048923 | Bacteria | 107658 |
| 1171 | Ga0496120_0000186 | 3300048923 | Bacteria | 106450 |
| 1172 | Ga0496120_0000206 | 3300048923 | Bacteria | 101409 |
| 1173 | Ga0496120_0000632 | 3300048923 | Bacteria | 52410 |
| 1174 | Ga0496120_0001420 | 3300048923 | Bacteria | 28924 |
| 1175 | Ga0496120_0002896 | 3300048923 | Bacteria | 16415 |
| 1176 | Ga0496120_0007219 | 3300048923 | Bacteria | 8318 |
| 1177 | Ga0496120_0066813 | 3300048923 | Bacteria | 1987 |
| 1178 | Ga0496120_0082862 | 3300048923 | Bacteria | 1732 |
| 1179 | Ga0496121_0000224 | 3300048924 | Bacteria | 122378 |
| 1180 | Ga0496121_0148900 | 3300048924 | Bacteria | 1725 |
| 1181 | Ga0496121_0156685 | 3300048924 | Bacteria | 1670 |
| 1182 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 1183 | Ga0496122_0000303 | 3300048925 | Bacteria | 108668 |
| 1184 | Ga0496122_0001758 | 3300048925 | Bacteria | 33261 |
| 1185 | Ga0496122_0001770 | 3300048925 | Bacteria | 33106 |
| 1186 | Ga0496122_0003568 | 3300048925 | Bacteria | 20322 |
| 1187 | Ga0496122_0008975 | 3300048925 | Bacteria | 10628 |
| 1188 | Ga0496122_0066730 | 3300048925 | Bacteria | 2597 |
| 1189 | Ga0496122_0070219 | 3300048925 | Bacteria | 2504 |
| 1190 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 1191 | Ga0496123_0000250 | 3300048926 | Bacteria | 108668 |
| 1192 | Ga0496123_0001176 | 3300048926 | Bacteria | 38560 |
| 1193 | Ga0496123_0007059 | 3300048926 | Bacteria | 10686 |
| 1194 | Ga0496123_0008944 | 3300048926 | Bacteria | 9107 |
| 1195 | Ga0496123_0010352 | 3300048926 | Bacteria | 8256 |
| 1196 | Ga0496123_0013533 | 3300048926 | Bacteria | 6833 |
| 1197 | Ga0496123_0016478 | 3300048926 | Bacteria | 5998 |
| 1198 | Ga0496123_0036419 | 3300048926 | Bacteria | 3490 |
| 1199 | Ga0496123_0051401 | 3300048926 | Bacteria | 2744 |
| 1200 | Ga0496123_0167035 | 3300048926 | Bacteria | 1165 |
| 1201 | Ga0496124_0000027 | 3300048927 | Bacteria | 376097 |
| 1202 | Ga0496124_0000028 | 3300048927 | Bacteria | 357219 |
| 1203 | Ga0496124_0000738 | 3300048927 | Bacteria | 53538 |
| 1204 | Ga0496124_0001085 | 3300048927 | Bacteria | 42903 |
| 1205 | Ga0496124_0001441 | 3300048927 | Bacteria | 35169 |
| 1206 | Ga0496124_0002677 | 3300048927 | Bacteria | 22827 |
| 1207 | Ga0496124_0003289 | 3300048927 | Bacteria | 19924 |
| 1208 | Ga0496124_0009187 | 3300048927 | Bacteria | 10204 |
| 1209 | Ga0496124_0019429 | 3300048927 | Bacteria | 6322 |
| 1210 | Ga0496124_0042797 | 3300048927 | Bacteria | 3896 |
| 1211 | Ga0496124_0066234 | 3300048927 | Bacteria | 3009 |
| 1212 | Ga0496124_0068604 | 3300048927 | Bacteria | 2946 |
| 1213 | Ga0496124_0106428 | 3300048927 | Bacteria | 2264 |
| 1214 | Ga0496124_0209412 | 3300048927 | Bacteria | 1476 |
| 1215 | Ga0496125_0000052 | 3300048928 | Bacteria | 281862 |
| 1216 | Ga0496125_0008709 | 3300048928 | Bacteria | 10558 |
| 1217 | Ga0496125_0025608 | 3300048928 | Bacteria | 5398 |
| 1218 | Ga0496125_0074463 | 3300048928 | Bacteria | 2632 |
| 1219 | Ga0496125_0098242 | 3300048928 | Bacteria | 2166 |
| 1220 | Ga0496126_0000410 | 3300048929 | Bacteria | 87052 |
| 1221 | Ga0496126_0021260 | 3300048929 | Bacteria | 6341 |
| 1222 | Ga0496126_0032462 | 3300048929 | Bacteria | 4918 |
| 1223 | Ga0496126_0072885 | 3300048929 | Bacteria | 3054 |
| 1224 | Ga0496126_0077966 | 3300048929 | Bacteria | 2936 |
| 1225 | Ga0496126_0130998 | 3300048929 | Bacteria | 2167 |
| 1226 | Ga0496126_0287348 | 3300048929 | Bacteria | 1361 |
| 1227 | Ga0495678_001728 | 3300049459 | Bacteria | 16296 |
| 1228 | Ga0495678_002124 | 3300049459 | Bacteria | 14078 |
| 1229 | Ga0495678_030301 | 3300049459 | Bacteria | 2265 |
| 1230 | Ga0495682_0001613 | 3300049460 | Bacteria | 11619 |
| 1231 | Ga0495682_0011912 | 3300049460 | Bacteria | 3342 |
| 1232 | Ga0495682_0044862 | 3300049460 | Bacteria | 1616 |
| 1233 | Ga0501314_007074 | 3300049530 | Bacteria | 990 |
| 1234 | Ga0501033_0185145 | 3300049570 | Bacteria | 1492 |
| 1235 | Ga0501034_0000145 | 3300049571 | Bacteria | 133121 |
| 1236 | Ga0501034_0012355 | 3300049571 | Bacteria | 8822 |
| 1237 | Ga0501034_0083430 | 3300049571 | Bacteria | 3197 |
| 1238 | Ga0501034_0177261 | 3300049571 | Bacteria | 2097 |
| 1239 | Ga0501034_0456501 | 3300049571 | Bacteria | 1195 |
| 1240 | Ga0501037_0002871 | 3300049573 | Bacteria | 12492 |
| 1241 | Ga0501037_0105348 | 3300049573 | Bacteria | 2033 |
| 1242 | Ga0501038_0255896 | 3300049574 | Bacteria | 1385 |
| 1243 | Ga0501039_0294740 | 3300049575 | Bacteria | 1275 |
| 1244 | Ga0501043_0559202 | 3300049579 | Bacteria | 849 |
| 1245 | Ga0501047_0010623 | 3300049581 | Bacteria | 8706 |
| 1246 | Ga0501047_0147036 | 3300049581 | Bacteria | 2233 |
| 1247 | Ga0501048_0299509 | 3300049582 | Bacteria | 1144 |
| 1248 | Ga0501069_0293676 | 3300049585 | Bacteria | 952 |
| 1249 | Ga0501070_0007727 | 3300049586 | Bacteria | 9117 |
| 1250 | Ga0501070_0034696 | 3300049586 | Bacteria | 4217 |
| 1251 | Ga0501070_0386169 | 3300049586 | Bacteria | 1134 |
| 1252 | Ga0501071_0307709 | 3300049587 | Bacteria | 1202 |
| 1253 | Ga0501074_0091382 | 3300049590 | Bacteria | 2180 |
| 1254 | Ga0501257_024449 | 3300049686 | Bacteria | 1435 |
| 1255 | Ga0501080_0032637 | 3300049742 | Bacteria | 4857 |
| 1256 | Ga0501080_0493553 | 3300049742 | Bacteria | 1095 |
| 1257 | Ga0501035_0014148 | 3300049822 | Bacteria | 7361 |
| 1258 | Ga0501035_0058356 | 3300049822 | Bacteria | 3439 |
| 1259 | Ga0501035_0290828 | 3300049822 | Bacteria | 1379 |
| 1260 | Ga0501044_0001205 | 3300049823 | Bacteria | 30688 |
| 1261 | Ga0501044_0036795 | 3300049823 | Bacteria | 5119 |
| 1262 | Ga0501044_0067954 | 3300049823 | Bacteria | 3631 |
| 1263 | Ga0501044_0205911 | 3300049823 | Bacteria | 1924 |
| 1264 | Ga0501044_0415624 | 3300049823 | Bacteria | 1256 |
| 1265 | Ga0501226_000015 | 3300049853 | Bacteria | 164151 |
| 1266 | nmdc:mga00v17_122775_c1 | 3300050491 | Bacteria | 1655 |
| 1267 | nmdc:mga00v17_154009_c1 | 3300050491 | Bacteria | 1477 |
| 1268 | nmdc:mga00v17_163505_c1 | 3300050491 | Bacteria | 1434 |
| 1269 | nmdc:mga00v17_50237_c1 | 3300050491 | Bacteria | 2533 |
| 1270 | nmdc:mga00v17_9293_c1 | 3300050491 | Bacteria | 5316 |
| 1271 | nmdc:mga0k408_41598_c2 | 3300050493 | Bacteria | 2112 |
| 1272 | nmdc:mga05p37_189680_c1 | 3300050507 | Bacteria | 2497 |
| 1273 | nmdc:mga05p37_307347_c1 | 3300050507 | Bacteria | 1881 |
| 1274 | nmdc:mga05p37_82202_c1 | 3300050507 | Bacteria | 3969 |
| 1275 | nmdc:mga05p37_845023_c1 | 3300050507 | Bacteria | 995 |
| 1276 | nmdc:mga09592_12903_c1 | 3300050508 | Bacteria | 6814 |
| 1277 | nmdc:mga09592_387204_c1 | 3300050508 | Bacteria | 1209 |
| 1278 | nmdc:mga06r32_34801_c1 | 3300050510 | Bacteria | 4751 |
| 1279 | nmdc:mga06r32_67343_c1 | 3300050510 | Bacteria | 3457 |
| 1280 | nmdc:mga08y16_10120_c1 | 3300050511 | Bacteria | 9900 |
| 1281 | nmdc:mga08y16_3586_c1 | 3300050511 | Bacteria | 16123 |
| 1282 | nmdc:mga0n895_1048318_c1 | 3300050512 | Bacteria | 795 |
| 1283 | nmdc:mga0n895_330408_c1 | 3300050512 | Bacteria | 1545 |
| 1284 | nmdc:mga0n895_33421_c1 | 3300050512 | Bacteria | 4944 |
| 1285 | nmdc:mga0n895_506666_c1 | 3300050512 | Bacteria | 1216 |
| 1286 | nmdc:mga0rr50_55568_c1 | 3300050513 | Bacteria | 2954 |
| 1287 | nmdc:mga0rr50_71339_c1 | 3300050513 | Bacteria | 2650 |
| 1288 | nmdc:mga0rr50_754191_c1 | 3300050513 | Bacteria | 831 |
| 1289 | nmdc:mga08x19_1868_c1 | 3300050514 | Bacteria | 12906 |
| 1290 | nmdc:mga08x19_2799_c1 | 3300050514 | Bacteria | 10518 |
| 1291 | nmdc:mga08x19_579971_c1 | 3300050514 | Bacteria | 794 |
| 1292 | nmdc:mga0a205_232877_c1 | 3300050515 | Bacteria | 1725 |
| 1293 | nmdc:mga0a205_315202_c1 | 3300050515 | Bacteria | 1436 |
| 1294 | Ga0500650_0000029 | 3300053098 | Bacteria | 54937 |
| 1295 | Ga0500618_014747 | 3300053125 | Bacteria | 1989 |
| 1296 | Ga0500621_000070 | 3300053126 | Bacteria | 11635 |
| 1297 | Ga0500659_0071065 | 3300053135 | Bacteria | 1844 |
| 1298 | Ga0500568_0112300 | 3300053139 | Bacteria | 1018 |
| 1299 | Ga0501084_0530363 | 3300054114 | Bacteria | 995 |
| 1300 | Ga0587091_047756 | 3300059511 | Bacteria | 868 |
| 1301 | Ga0587094_006971 | 3300059513 | Bacteria | 1373 |
| 1302 | Ga0587117_005138 | 3300059627 | Bacteria | 1401 |
| 1303 | Ga0587062_003284 | 3300059639 | Bacteria | 1622 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10085268 | Ga0065704_100852682 | 204 |
| 2 | 3300027614 | Ga0209970_1051345 | Ga0209970_10513451 | 204 |
| 3 | 3300042876 | Ga0451577_0189897 | Ga0451577_0189897_674_1351 | 204 |
| 4 | 3300028800 | Ga0265338_10005574 | Ga0265338_1000557415 | 205 |
| 5 | 3300042876 | Ga0451577_0238178 | Ga0451577_0238178_725_1354 | 205 |
| 6 | 3300044673 | Ga0453683_0085063 | Ga0453683_0085063_785_1420 | 205 |
| 7 | 3300044712 | Ga0453684_0163432 | Ga0453684_0163432_1980_2615 | 205 |
| 8 | 3300031665 | Ga0316575_10034839 | Ga0316575_100348392 | 206 |
| 9 | 3300031665 | Ga0316575_10111770 | Ga0316575_101117701 | 206 |
| 10 | 3300031727 | Ga0316576_10073876 | Ga0316576_100738763 | 206 |
| 11 | 3300031727 | Ga0316576_10450987 | Ga0316576_104509871 | 206 |
| 12 | 3300031728 | Ga0316578_10040877 | Ga0316578_100408772 | 206 |
| 13 | 3300031728 | Ga0316578_10096159 | Ga0316578_100961592 | 206 |
| 14 | 3300031728 | Ga0316578_10162476 | Ga0316578_101624762 | 206 |
| 15 | 3300031728 | Ga0316578_10325902 | Ga0316578_103259022 | 206 |
| 16 | 3300031733 | Ga0316577_10054961 | Ga0316577_100549613 | 206 |
| 17 | 3300032133 | Ga0316583_10021544 | Ga0316583_100215442 | 206 |
| 18 | 3300032133 | Ga0316583_10063189 | Ga0316583_100631892 | 206 |
| 19 | 3300032133 | Ga0316583_10075812 | Ga0316583_100758122 | 206 |
| 20 | 3300032133 | Ga0316583_10149250 | Ga0316583_101492501 | 206 |
| 21 | 3300033528 | Ga0316588_1068150 | Ga0316588_10681502 | 206 |
| 22 | 3300035398 | Ga0316574_0009492 | Ga0316574_0009492_1154_1783 | 206 |
| 23 | 3300035398 | Ga0316574_0057866 | Ga0316574_0057866_1245_1874 | 206 |
| 24 | 3300036647 | Ga0316582_0054014 | Ga0316582_0054014_450_1079 | 206 |
| 25 | 3300036647 | Ga0316582_0328019 | Ga0316582_0328019_166_795 | 206 |
| 26 | 3300036712 | Ga0316584_0007542 | Ga0316584_0007542_1003_1632 | 206 |
| 27 | 3300036712 | Ga0316584_0026181 | Ga0316584_0026181_103_732 | 206 |
| 28 | 3300044712 | Ga0453684_0205476 | Ga0453684_0205476_1094_1732 | 206 |
| 29 | 3300009094 | Ga0111539_10002472 | Ga0111539_1000247213 | 208 |
| 30 | iso_pu_bacteria | 2883068021 | 2883069488 | 208 |
| 31 | iso_pu_bacteria | 2884791551 | 2884792082 | 208 |
| 32 | iso_pu_bacteria | 2896109856 | 2896110367 | 208 |
| 33 | iso_pu_bacteria | 2929177148 | 2929181927 | 208 |
| 34 | iso_pu_bacteria | 2945977869 | 2945984323 | 208 |
| 35 | iso_pu_bacteria | 2946013367 | 2946016284 | 208 |
| 36 | iso_pu_bacteria | 8001522603 | 8001525446 | 208 |
| 37 | 3300049686 | Ga0501257_024449 | Ga0501257_024449_172_801 | 209 |
| 38 | 3300050511 | nmdc:mga08y16_10120_c1 | nmdc:mga08y16_10120_c1_687_1319 | 209 |
| 39 | 3300049571 | Ga0501034_0177261 | Ga0501034_0177261_554_1186 | 210 |
| 40 | 3300003322 | rootL2_10021840 | rootL2_100218408 | 211 |
| 41 | 3300004803 | Ga0058862_12840720 | Ga0058862_128407203 | 211 |
| 42 | 3300005295 | Ga0065707_10054040 | Ga0065707_100540401 | 211 |
| 43 | 3300005518 | Ga0070699_100203295 | Ga0070699_1002032952 | 211 |
| 44 | 3300005530 | Ga0070679_100094428 | Ga0070679_1000944284 | 211 |
| 45 | 3300005536 | Ga0070697_100414222 | Ga0070697_1004142222 | 211 |
| 46 | 3300005548 | Ga0070665_100003302 | Ga0070665_10000330217 | 211 |
| 47 | 3300005563 | Ga0068855_100552887 | Ga0068855_1005528872 | 211 |
| 48 | 3300005983 | Ga0081540_1109528 | Ga0081540_11095282 | 211 |
| 49 | 3300006358 | Ga0068871_100235910 | Ga0068871_1002359102 | 211 |
| 50 | 3300006844 | Ga0075428_100020857 | Ga0075428_1000208575 | 211 |
| 51 | 3300006846 | Ga0075430_100132088 | Ga0075430_1001320883 | 211 |
| 52 | 3300006871 | Ga0075434_100166915 | Ga0075434_1001669152 | 211 |
| 53 | 3300007076 | Ga0075435_100504872 | Ga0075435_1005048722 | 211 |
| 54 | 3300009093 | Ga0105240_10003087 | Ga0105240_1000308711 | 211 |
| 55 | 3300009093 | Ga0105240_10096438 | Ga0105240_100964383 | 211 |
| 56 | 3300009093 | Ga0105240_10522986 | Ga0105240_105229862 | 211 |
| 57 | 3300009545 | Ga0105237_10742196 | Ga0105237_107421962 | 211 |
| 58 | 3300013104 | Ga0157370_10260773 | Ga0157370_102607732 | 211 |
| 59 | 3300013105 | Ga0157369_10384259 | Ga0157369_103842592 | 211 |
| 60 | 3300013306 | Ga0163162_10010274 | Ga0163162_100102742 | 211 |
| 61 | 3300014968 | Ga0157379_10027141 | Ga0157379_100271413 | 211 |
| 62 | 3300020069 | Ga0197907_10316666 | Ga0197907_103166663 | 211 |
| 63 | 3300020069 | Ga0197907_10479836 | Ga0197907_104798363 | 211 |
| 64 | 3300020069 | Ga0197907_10974095 | Ga0197907_109740954 | 211 |
| 65 | 3300020075 | Ga0206349_1221543 | Ga0206349_12215432 | 211 |
| 66 | 3300020076 | Ga0206355_1041887 | Ga0206355_10418874 | 211 |
| 67 | 3300020076 | Ga0206355_1413860 | Ga0206355_14138602 | 211 |
| 68 | 3300020077 | Ga0206351_10679320 | Ga0206351_106793204 | 211 |
| 69 | 3300020078 | Ga0206352_10109537 | Ga0206352_101095372 | 211 |
| 70 | 3300020078 | Ga0206352_10517688 | Ga0206352_105176883 | 211 |
| 71 | 3300020080 | Ga0206350_10187858 | Ga0206350_101878583 | 211 |
| 72 | 3300020080 | Ga0206350_11177477 | Ga0206350_111774771 | 211 |
| 73 | 3300020080 | Ga0206350_11276978 | Ga0206350_112769784 | 211 |
| 74 | 3300020081 | Ga0206354_10132274 | Ga0206354_101322741 | 211 |
| 75 | 3300022467 | Ga0224712_10021233 | Ga0224712_100212334 | 211 |
| 76 | 3300025912 | Ga0207707_10159012 | Ga0207707_101590122 | 211 |
| 77 | 3300025913 | Ga0207695_10050803 | Ga0207695_100508033 | 211 |
| 78 | 3300025916 | Ga0207663_10465201 | Ga0207663_104652011 | 211 |
| 79 | 3300025944 | Ga0207661_10104321 | Ga0207661_101043213 | 211 |
| 80 | 3300026089 | Ga0207648_10376716 | Ga0207648_103767162 | 211 |
| 81 | 3300028379 | Ga0268266_10000260 | Ga0268266_1000026052 | 211 |
| 82 | 3300028379 | Ga0268266_10394983 | Ga0268266_103949832 | 211 |
| 83 | 3300031691 | Ga0316579_10077408 | Ga0316579_100774082 | 211 |
| 84 | 3300031728 | Ga0316578_10164734 | Ga0316578_101647342 | 211 |
| 85 | 3300031733 | Ga0316577_10025136 | Ga0316577_100251362 | 211 |
| 86 | 3300032139 | Ga0316580_10094174 | Ga0316580_100941742 | 211 |
| 87 | 3300036401 | Ga0373937_0468333 | Ga0373937_0468333_445_1080 | 211 |
| 88 | 3300036647 | Ga0316582_0067917 | Ga0316582_0067917_1410_2063 | 211 |
| 89 | 3300036712 | Ga0316584_0003440 | Ga0316584_0003440_5965_6618 | 211 |
| 90 | 3300036712 | Ga0316584_0189578 | Ga0316584_0189578_198_863 | 211 |
| 91 | 3300037068 | Ga0373925_0253900 | Ga0373925_0253900_600_1235 | 211 |
| 92 | 3300037588 | Ga0316581_0022472 | Ga0316581_0022472_255_908 | 211 |
| 93 | 3300042876 | Ga0451577_1074925 | Ga0451577_1074925_48_683 | 211 |
| 94 | 3300046455 | Ga0495603_0001787 | Ga0495603_0001787_7672_8307 | 211 |
| 95 | 3300046455 | Ga0495603_0007169 | Ga0495603_0007169_1673_2308 | 211 |
| 96 | 3300046459 | Ga0495629_0004989 | Ga0495629_0004989_1566_2201 | 211 |
| 97 | 3300046459 | Ga0495629_0041111 | Ga0495629_0041111_291_926 | 211 |
| 98 | 3300046462 | Ga0495651_0007356 | Ga0495651_0007356_7765_8400 | 211 |
| 99 | 3300046462 | Ga0495651_0075679 | Ga0495651_0075679_1280_1915 | 211 |
| 100 | 3300046463 | Ga0495653_0009486 | Ga0495653_0009486_288_923 | 211 |
| 101 | 3300046472 | Ga0495580_0097021 | Ga0495580_0097021_926_1561 | 211 |
| 102 | 3300046472 | Ga0495580_0123367 | Ga0495580_0123367_450_1085 | 211 |
| 103 | 3300046472 | Ga0495580_0289104 | Ga0495580_0289104_238_873 | 211 |
| 104 | 3300046473 | Ga0495582_0001734 | Ga0495582_0001734_3093_3728 | 211 |
| 105 | 3300046475 | Ga0495639_0000745 | Ga0495639_0000745_7053_7688 | 211 |
| 106 | 3300046476 | Ga0495662_0001664 | Ga0495662_0001664_9632_10267 | 211 |
| 107 | 3300046477 | Ga0495664_0010856 | Ga0495664_0010856_1995_2630 | 211 |
| 108 | 3300046492 | Ga0495585_0004297 | Ga0495585_0004297_3965_4600 | 211 |
| 109 | 3300046499 | Ga0495594_0000216 | Ga0495594_0000216_24926_25561 | 211 |
| 110 | 3300046499 | Ga0495594_0000830 | Ga0495594_0000830_658_1293 | 211 |
| 111 | 3300046507 | Ga0495606_0018216 | Ga0495606_0018216_3675_4313 | 211 |
| 112 | 3300046511 | Ga0495608_0092071 | Ga0495608_0092071_314_949 | 211 |
| 113 | 3300046516 | Ga0495628_0020708 | Ga0495628_0020708_3058_3693 | 211 |
| 114 | 3300046516 | Ga0495628_0247745 | Ga0495628_0247745_553_1188 | 211 |
| 115 | 3300046523 | Ga0495644_0000233 | Ga0495644_0000233_20771_21406 | 211 |
| 116 | 3300046526 | Ga0495666_0003666 | Ga0495666_0003666_4654_5289 | 211 |
| 117 | 3300046528 | Ga0495642_0079041 | Ga0495642_0079041_278_913 | 211 |
| 118 | 3300046531 | Ga0495665_0014859 | Ga0495665_0014859_2752_3387 | 211 |
| 119 | 3300046533 | Ga0495640_0007292 | Ga0495640_0007292_7924_8559 | 211 |
| 120 | 3300046536 | Ga0495587_0055535 | Ga0495587_0055535_744_1379 | 211 |
| 121 | 3300046557 | Ga0495622_0033549 | Ga0495622_0033549_954_1589 | 211 |
| 122 | 3300046558 | Ga0495633_0027564 | Ga0495633_0027564_1273_1908 | 211 |
| 123 | 3300046559 | Ga0495667_0012738 | Ga0495667_0012738_2822_3457 | 211 |
| 124 | 3300046642 | Ga0495634_0003158 | Ga0495634_0003158_4634_5269 | 211 |
| 125 | 3300046648 | Ga0495611_0028487 | Ga0495611_0028487_1239_1874 | 211 |
| 126 | 3300046660 | Ga0495625_0016366 | Ga0495625_0016366_2752_3387 | 211 |
| 127 | 3300046663 | Ga0495635_0029627 | Ga0495635_0029627_1532_2167 | 211 |
| 128 | 3300046674 | Ga0495588_0051895 | Ga0495588_0051895_22_657 | 211 |
| 129 | 3300046675 | Ga0495657_0126901 | Ga0495657_0126901_492_1127 | 211 |
| 130 | 3300046678 | Ga0495599_0001842 | Ga0495599_0001842_635_1270 | 211 |
| 131 | 3300046678 | Ga0495599_0172334 | Ga0495599_0172334_226_861 | 211 |
| 132 | 3300046679 | Ga0495623_0059092 | Ga0495623_0059092_337_972 | 211 |
| 133 | 3300046680 | Ga0495646_0006639 | Ga0495646_0006639_5652_6287 | 211 |
| 134 | 3300046683 | Ga0495658_0224910 | Ga0495658_0224910_420_1055 | 211 |
| 135 | 3300046684 | Ga0495669_0001216 | Ga0495669_0001216_7577_8212 | 211 |
| 136 | 3300046689 | Ga0495613_0032456 | Ga0495613_0032456_725_1360 | 211 |
| 137 | 3300046689 | Ga0495613_0082068 | Ga0495613_0082068_1056_1691 | 211 |
| 138 | 3300046690 | Ga0495624_0003705 | Ga0495624_0003705_2373_3008 | 211 |
| 139 | 3300046694 | Ga0495649_0100822 | Ga0495649_0100822_723_1361 | 211 |
| 140 | 3300046694 | Ga0495649_0352189 | Ga0495649_0352189_17_652 | 211 |
| 141 | 3300046794 | Ga0495589_0089504 | Ga0495589_0089504_119_754 | 211 |
| 142 | 3300046809 | Ga0495600_0000817 | Ga0495600_0000817_3356_3991 | 211 |
| 143 | 3300046809 | Ga0495600_0107321 | Ga0495600_0107321_130_765 | 211 |
| 144 | 3300047315 | Ga0495581_0059696 | Ga0495581_0059696_1425_2060 | 211 |
| 145 | 3300047317 | Ga0495604_0005986 | Ga0495604_0005986_7124_7759 | 211 |
| 146 | 3300047317 | Ga0495604_0016655 | Ga0495604_0016655_290_925 | 211 |
| 147 | 3300047319 | Ga0495674_0014787 | Ga0495674_0014787_6054_6689 | 211 |
| 148 | 3300047320 | Ga0495672_0126990 | Ga0495672_0126990_528_1163 | 211 |
| 149 | 3300047321 | Ga0495676_0006988 | Ga0495676_0006988_4387_5022 | 211 |
| 150 | 3300047444 | Ga0495675_0021010 | Ga0495675_0021010_2929_3564 | 211 |
| 151 | 3300047469 | Ga0495673_0044074 | Ga0495673_0044074_865_1500 | 211 |
| 152 | 3300047471 | Ga0495684_0009188 | Ga0495684_0009188_2904_3539 | 211 |
| 153 | 3300048089 | Ga0495614_0001515 | Ga0495614_0001515_6310_6945 | 211 |
| 154 | 3300048089 | Ga0495614_0014267 | Ga0495614_0014267_1904_2539 | 211 |
| 155 | 3300048903 | Ga0496100_0378827 | Ga0496100_0378827_160_795 | 211 |
| 156 | 3300048908 | Ga0496105_0209586 | Ga0496105_0209586_778_1413 | 211 |
| 157 | 3300048929 | Ga0496126_0287348 | Ga0496126_0287348_131_766 | 211 |
| 158 | 3300050507 | nmdc:mga05p37_82202_c1 | nmdc:mga05p37_82202_c1_451_1086 | 211 |
| 159 | 3300050508 | nmdc:mga09592_387204_c1 | nmdc:mga09592_387204_c1_561_1196 | 211 |
| 160 | 3300050512 | nmdc:mga0n895_1048318_c1 | nmdc:mga0n895_1048318_c1_117_752 | 211 |
| 161 | 3300050512 | nmdc:mga0n895_330408_c1 | nmdc:mga0n895_330408_c1_514_1149 | 211 |
| 162 | 3300050515 | nmdc:mga0a205_232877_c1 | nmdc:mga0a205_232877_c1_492_1127 | 211 |
| 163 | 3300003320 | rootH2_10085512 | rootH2_100855125 | 212 |
| 164 | 3300005434 | Ga0070709_10069602 | Ga0070709_100696023 | 212 |
| 165 | 3300005435 | Ga0070714_100002772 | Ga0070714_1000027725 | 212 |
| 166 | 3300005436 | Ga0070713_100258329 | Ga0070713_1002583292 | 212 |
| 167 | 3300005458 | Ga0070681_10068202 | Ga0070681_100682023 | 212 |
| 168 | 3300005563 | Ga0068855_100021270 | Ga0068855_1000212702 | 212 |
| 169 | 3300005577 | Ga0068857_100314938 | Ga0068857_1003149382 | 212 |
| 170 | 3300005616 | Ga0068852_100073313 | Ga0068852_1000733134 | 212 |
| 171 | 3300005844 | Ga0068862_100156884 | Ga0068862_1001568842 | 212 |
| 172 | 3300005981 | Ga0081538_10140994 | Ga0081538_101409941 | 212 |
| 173 | 3300006237 | Ga0097621_100093428 | Ga0097621_1000934282 | 212 |
| 174 | 3300006358 | Ga0068871_100024543 | Ga0068871_1000245435 | 212 |
| 175 | 3300006844 | Ga0075428_100029944 | Ga0075428_1000299442 | 212 |
| 176 | 3300007265 | Ga0099794_10149796 | Ga0099794_101497962 | 212 |
| 177 | 3300007788 | Ga0099795_10084934 | Ga0099795_100849342 | 212 |
| 178 | 3300009093 | Ga0105240_10051034 | Ga0105240_100510345 | 212 |
| 179 | 3300009093 | Ga0105240_10261833 | Ga0105240_102618332 | 212 |
| 180 | 3300009094 | Ga0111539_10058214 | Ga0111539_100582143 | 212 |
| 181 | 3300013102 | Ga0157371_10121242 | Ga0157371_101212422 | 212 |
| 182 | 3300013104 | Ga0157370_10207789 | Ga0157370_102077891 | 212 |
| 183 | 3300013297 | Ga0157378_10111171 | Ga0157378_101111714 | 212 |
| 184 | 3300013306 | Ga0163162_10040482 | Ga0163162_100404825 | 212 |
| 185 | 3300020078 | Ga0206352_10476527 | Ga0206352_104765278 | 212 |
| 186 | 3300021361 | Ga0213872_10010678 | Ga0213872_100106784 | 212 |
| 187 | 3300021388 | Ga0213875_10012137 | Ga0213875_100121372 | 212 |
| 188 | 3300025906 | Ga0207699_10081485 | Ga0207699_100814854 | 212 |
| 189 | 3300025912 | Ga0207707_10002960 | Ga0207707_100029604 | 212 |
| 190 | 3300025913 | Ga0207695_10025210 | Ga0207695_100252107 | 212 |
| 191 | 3300025949 | Ga0207667_10011443 | Ga0207667_100114438 | 212 |
| 192 | 3300026078 | Ga0207702_10222315 | Ga0207702_102223152 | 212 |
| 193 | 3300026116 | Ga0207674_10393041 | Ga0207674_103930411 | 212 |
| 194 | 3300026121 | Ga0207683_10500576 | Ga0207683_105005761 | 212 |
| 195 | 3300026142 | Ga0207698_10012294 | Ga0207698_100122947 | 212 |
| 196 | 3300028800 | Ga0265338_10703116 | Ga0265338_107031161 | 212 |
| 197 | 3300031733 | Ga0316577_10014110 | Ga0316577_100141102 | 212 |
| 198 | 3300031903 | Ga0307407_10926423 | Ga0307407_109264231 | 212 |
| 199 | 3300031911 | Ga0307412_10204864 | Ga0307412_102048642 | 212 |
| 200 | 3300032004 | Ga0307414_10309274 | Ga0307414_103092742 | 212 |
| 201 | 3300036647 | Ga0316582_0008667 | Ga0316582_0008667_685_1323 | 212 |
| 202 | 3300036712 | Ga0316584_0032332 | Ga0316584_0032332_161_802 | 212 |
| 203 | 3300036712 | Ga0316584_0261120 | Ga0316584_0261120_450_1088 | 212 |
| 204 | 3300037853 | Ga0436364_0207702 | Ga0436364_0207702_464_1102 | 212 |
| 205 | 3300039447 | Ga0436361_0242772 | Ga0436361_0242772_5897_6535 | 212 |
| 206 | 3300041997 | Ga0439431_0000701 | Ga0439431_0000701_5575_6213 | 212 |
| 207 | 3300044693 | Ga0466961_0262982 | Ga0466961_0262982_165_803 | 212 |
| 208 | 3300049570 | Ga0501033_0185145 | Ga0501033_0185145_303_941 | 212 |
| 209 | 3300049573 | Ga0501037_0002871 | Ga0501037_0002871_849_1487 | 212 |
| 210 | 3300049575 | Ga0501039_0294740 | Ga0501039_0294740_500_1138 | 212 |
| 211 | 3300049582 | Ga0501048_0299509 | Ga0501048_0299509_165_803 | 212 |
| 212 | 3300049585 | Ga0501069_0293676 | Ga0501069_0293676_180_818 | 212 |
| 213 | 3300049586 | Ga0501070_0034696 | Ga0501070_0034696_2162_2800 | 212 |
| 214 | 3300049587 | Ga0501071_0307709 | Ga0501071_0307709_238_876 | 212 |
| 215 | 3300049590 | Ga0501074_0091382 | Ga0501074_0091382_462_1100 | 212 |
| 216 | 3300049823 | Ga0501044_0205911 | Ga0501044_0205911_179_817 | 212 |
| 217 | 3300003911 | JGI25405J52794_10011315 | JGI25405J52794_100113152 | 213 |
| 218 | 3300004799 | Ga0058863_11745031 | Ga0058863_117450312 | 213 |
| 219 | 3300004800 | Ga0058861_11992559 | Ga0058861_119925594 | 213 |
| 220 | 3300004803 | Ga0058862_10209510 | Ga0058862_102095102 | 213 |
| 221 | 3300005293 | Ga0065715_10358674 | Ga0065715_103586742 | 213 |
| 222 | 3300005327 | Ga0070658_10078582 | Ga0070658_100785822 | 213 |
| 223 | 3300005327 | Ga0070658_10174300 | Ga0070658_101743002 | 213 |
| 224 | 3300005336 | Ga0070680_100182953 | Ga0070680_1001829532 | 213 |
| 225 | 3300005339 | Ga0070660_100001518 | Ga0070660_1000015184 | 213 |
| 226 | 3300005366 | Ga0070659_100401584 | Ga0070659_1004015841 | 213 |
| 227 | 3300005434 | Ga0070709_10482606 | Ga0070709_104826062 | 213 |
| 228 | 3300005435 | Ga0070714_100067450 | Ga0070714_1000674502 | 213 |
| 229 | 3300005435 | Ga0070714_100109240 | Ga0070714_1001092403 | 213 |
| 230 | 3300005435 | Ga0070714_100139294 | Ga0070714_1001392943 | 213 |
| 231 | 3300005435 | Ga0070714_100793847 | Ga0070714_1007938471 | 213 |
| 232 | 3300005436 | Ga0070713_100006711 | Ga0070713_1000067116 | 213 |
| 233 | 3300005439 | Ga0070711_100191254 | Ga0070711_1001912541 | 213 |
| 234 | 3300005439 | Ga0070711_100425488 | Ga0070711_1004254881 | 213 |
| 235 | 3300005439 | Ga0070711_100601621 | Ga0070711_1006016211 | 213 |
| 236 | 3300005445 | Ga0070708_100000392 | Ga0070708_10000039228 | 213 |
| 237 | 3300005458 | Ga0070681_10031259 | Ga0070681_100312595 | 213 |
| 238 | 3300005458 | Ga0070681_10093609 | Ga0070681_100936092 | 213 |
| 239 | 3300005458 | Ga0070681_10106869 | Ga0070681_101068692 | 213 |
| 240 | 3300005458 | Ga0070681_10170524 | Ga0070681_101705242 | 213 |
| 241 | 3300005458 | Ga0070681_10821945 | Ga0070681_108219452 | 213 |
| 242 | 3300005467 | Ga0070706_100001692 | Ga0070706_1000016926 | 213 |
| 243 | 3300005468 | Ga0070707_100000351 | Ga0070707_10000035121 | 213 |
| 244 | 3300005468 | Ga0070707_100004546 | Ga0070707_1000045465 | 213 |
| 245 | 3300005471 | Ga0070698_100000922 | Ga0070698_10000092227 | 213 |
| 246 | 3300005471 | Ga0070698_100019643 | Ga0070698_1000196437 | 213 |
| 247 | 3300005518 | Ga0070699_100000502 | Ga0070699_10000050229 | 213 |
| 248 | 3300005518 | Ga0070699_100037730 | Ga0070699_1000377303 | 213 |
| 249 | 3300005530 | Ga0070679_100000945 | Ga0070679_10000094522 | 213 |
| 250 | 3300005530 | Ga0070679_100168821 | Ga0070679_1001688212 | 213 |
| 251 | 3300005530 | Ga0070679_100330768 | Ga0070679_1003307682 | 213 |
| 252 | 3300005530 | Ga0070679_100360345 | Ga0070679_1003603452 | 213 |
| 253 | 3300005530 | Ga0070679_100957878 | Ga0070679_1009578781 | 213 |
| 254 | 3300005535 | Ga0070684_100033892 | Ga0070684_1000338923 | 213 |
| 255 | 3300005535 | Ga0070684_100066556 | Ga0070684_1000665562 | 213 |
| 256 | 3300005536 | Ga0070697_100002721 | Ga0070697_1000027219 | 213 |
| 257 | 3300005536 | Ga0070697_100189545 | Ga0070697_1001895452 | 213 |
| 258 | 3300005539 | Ga0068853_100016299 | Ga0068853_1000162992 | 213 |
| 259 | 3300005543 | Ga0070672_100200754 | Ga0070672_1002007542 | 213 |
| 260 | 3300005563 | Ga0068855_100016972 | Ga0068855_1000169725 | 213 |
| 261 | 3300005563 | Ga0068855_100018409 | Ga0068855_1000184099 | 213 |
| 262 | 3300005563 | Ga0068855_100032736 | Ga0068855_1000327364 | 213 |
| 263 | 3300005564 | Ga0070664_100004083 | Ga0070664_1000040838 | 213 |
| 264 | 3300005577 | Ga0068857_100039120 | Ga0068857_1000391202 | 213 |
| 265 | 3300005577 | Ga0068857_100146071 | Ga0068857_1001460712 | 213 |
| 266 | 3300005577 | Ga0068857_100209333 | Ga0068857_1002093332 | 213 |
| 267 | 3300005614 | Ga0068856_100153505 | Ga0068856_1001535053 | 213 |
| 268 | 3300005614 | Ga0068856_100185005 | Ga0068856_1001850055 | 213 |
| 269 | 3300005616 | Ga0068852_100000021 | Ga0068852_10000002198 | 213 |
| 270 | 3300005618 | Ga0068864_100210709 | Ga0068864_1002107092 | 213 |
| 271 | 3300005841 | Ga0068863_100012187 | Ga0068863_1000121877 | 213 |
| 272 | 3300005937 | Ga0081455_10001369 | Ga0081455_1000136916 | 213 |
| 273 | 3300005983 | Ga0081540_1179312 | Ga0081540_11793121 | 213 |
| 274 | 3300006028 | Ga0070717_10028565 | Ga0070717_100285655 | 213 |
| 275 | 3300006173 | Ga0070716_100089161 | Ga0070716_1000891612 | 213 |
| 276 | 3300006237 | Ga0097621_100112184 | Ga0097621_1001121842 | 213 |
| 277 | 3300006844 | Ga0075428_100086112 | Ga0075428_1000861122 | 213 |
| 278 | 3300006844 | Ga0075428_100746064 | Ga0075428_1007460642 | 213 |
| 279 | 3300006847 | Ga0075431_100005178 | Ga0075431_1000051788 | 213 |
| 280 | 3300006847 | Ga0075431_100196400 | Ga0075431_1001964003 | 213 |
| 281 | 3300006852 | Ga0075433_10206688 | Ga0075433_102066882 | 213 |
| 282 | 3300006871 | Ga0075434_100195313 | Ga0075434_1001953132 | 213 |
| 283 | 3300006880 | Ga0075429_100015070 | Ga0075429_1000150704 | 213 |
| 284 | 3300006914 | Ga0075436_100001541 | Ga0075436_10000154112 | 213 |
| 285 | 3300006914 | Ga0075436_100495628 | Ga0075436_1004956282 | 213 |
| 286 | 3300007076 | Ga0075435_100017057 | Ga0075435_1000170572 | 213 |
| 287 | 3300007076 | Ga0075435_100037815 | Ga0075435_1000378152 | 213 |
| 288 | 3300009093 | Ga0105240_10003055 | Ga0105240_100030558 | 213 |
| 289 | 3300009093 | Ga0105240_10275533 | Ga0105240_102755332 | 213 |
| 290 | 3300009093 | Ga0105240_10275860 | Ga0105240_102758603 | 213 |
| 291 | 3300009093 | Ga0105240_10318043 | Ga0105240_103180432 | 213 |
| 292 | 3300009093 | Ga0105240_10434415 | Ga0105240_104344152 | 213 |
| 293 | 3300009098 | Ga0105245_10350049 | Ga0105245_103500492 | 213 |
| 294 | 3300009101 | Ga0105247_10126947 | Ga0105247_101269472 | 213 |
| 295 | 3300009147 | Ga0114129_10085130 | Ga0114129_100851302 | 213 |
| 296 | 3300009147 | Ga0114129_10105084 | Ga0114129_101050845 | 213 |
| 297 | 3300009174 | Ga0105241_10005427 | Ga0105241_100054272 | 213 |
| 298 | 3300009174 | Ga0105241_10009030 | Ga0105241_100090305 | 213 |
| 299 | 3300009174 | Ga0105241_10631353 | Ga0105241_106313532 | 213 |
| 300 | 3300009545 | Ga0105237_10014816 | Ga0105237_100148165 | 213 |
| 301 | 3300009545 | Ga0105237_10038802 | Ga0105237_100388024 | 213 |
| 302 | 3300009545 | Ga0105237_10040136 | Ga0105237_100401366 | 213 |
| 303 | 3300009545 | Ga0105237_10120744 | Ga0105237_101207442 | 213 |
| 304 | 3300009551 | Ga0105238_10008807 | Ga0105238_100088079 | 213 |
| 305 | 3300009551 | Ga0105238_10015411 | Ga0105238_100154114 | 213 |
| 306 | 3300009551 | Ga0105238_10044289 | Ga0105238_100442892 | 213 |
| 307 | 3300009551 | Ga0105238_10217504 | Ga0105238_102175042 | 213 |
| 308 | 3300010375 | Ga0105239_10010544 | Ga0105239_100105445 | 213 |
| 309 | 3300010375 | Ga0105239_10372303 | Ga0105239_103723032 | 213 |
| 310 | 3300013100 | Ga0157373_10057651 | Ga0157373_100576512 | 213 |
| 311 | 3300013102 | Ga0157371_10105526 | Ga0157371_101055263 | 213 |
| 312 | 3300013104 | Ga0157370_10000067 | Ga0157370_1000006779 | 213 |
| 313 | 3300013104 | Ga0157370_10006254 | Ga0157370_100062542 | 213 |
| 314 | 3300013104 | Ga0157370_10183224 | Ga0157370_101832242 | 213 |
| 315 | 3300013105 | Ga0157369_10001168 | Ga0157369_1000116823 | 213 |
| 316 | 3300013105 | Ga0157369_10001656 | Ga0157369_1000165616 | 213 |
| 317 | 3300013105 | Ga0157369_10005638 | Ga0157369_100056387 | 213 |
| 318 | 3300013105 | Ga0157369_10040266 | Ga0157369_100402666 | 213 |
| 319 | 3300013105 | Ga0157369_10052776 | Ga0157369_100527764 | 213 |
| 320 | 3300013105 | Ga0157369_10103532 | Ga0157369_101035323 | 213 |
| 321 | 3300013105 | Ga0157369_10358959 | Ga0157369_103589592 | 213 |
| 322 | 3300013105 | Ga0157369_10874537 | Ga0157369_108745371 | 213 |
| 323 | 3300013296 | Ga0157374_10703756 | Ga0157374_107037562 | 213 |
| 324 | 3300013307 | Ga0157372_10023748 | Ga0157372_100237485 | 213 |
| 325 | 3300013307 | Ga0157372_10058132 | Ga0157372_100581323 | 213 |
| 326 | 3300013307 | Ga0157372_10092018 | Ga0157372_100920181 | 213 |
| 327 | 3300013307 | Ga0157372_10115970 | Ga0157372_101159703 | 213 |
| 328 | 3300013307 | Ga0157372_10281836 | Ga0157372_102818362 | 213 |
| 329 | 3300014968 | Ga0157379_10088473 | Ga0157379_100884734 | 213 |
| 330 | 3300020069 | Ga0197907_11438784 | Ga0197907_114387842 | 213 |
| 331 | 3300020070 | Ga0206356_11820743 | Ga0206356_118207431 | 213 |
| 332 | 3300020077 | Ga0206351_10535310 | Ga0206351_105353102 | 213 |
| 333 | 3300020078 | Ga0206352_11361616 | Ga0206352_113616162 | 213 |
| 334 | 3300020080 | Ga0206350_10008355 | Ga0206350_100083551 | 213 |
| 335 | 3300020080 | Ga0206350_10364460 | Ga0206350_103644602 | 213 |
| 336 | 3300021361 | Ga0213872_10001684 | Ga0213872_1000168412 | 213 |
| 337 | 3300022467 | Ga0224712_10035225 | Ga0224712_100352252 | 213 |
| 338 | 3300022467 | Ga0224712_10050639 | Ga0224712_100506392 | 213 |
| 339 | 3300022467 | Ga0224712_10146735 | Ga0224712_101467351 | 213 |
| 340 | 3300025906 | Ga0207699_10617707 | Ga0207699_106177071 | 213 |
| 341 | 3300025909 | Ga0207705_10010468 | Ga0207705_100104686 | 213 |
| 342 | 3300025909 | Ga0207705_10176978 | Ga0207705_101769782 | 213 |
| 343 | 3300025910 | Ga0207684_10000375 | Ga0207684_1000037566 | 213 |
| 344 | 3300025910 | Ga0207684_10022809 | Ga0207684_100228094 | 213 |
| 345 | 3300025911 | Ga0207654_10004979 | Ga0207654_100049794 | 213 |
| 346 | 3300025911 | Ga0207654_10075807 | Ga0207654_100758072 | 213 |
| 347 | 3300025911 | Ga0207654_10355931 | Ga0207654_103559312 | 213 |
| 348 | 3300025912 | Ga0207707_10018917 | Ga0207707_100189173 | 213 |
| 349 | 3300025912 | Ga0207707_10068088 | Ga0207707_100680884 | 213 |
| 350 | 3300025912 | Ga0207707_10173916 | Ga0207707_101739162 | 213 |
| 351 | 3300025912 | Ga0207707_10210230 | Ga0207707_102102302 | 213 |
| 352 | 3300025912 | Ga0207707_10371650 | Ga0207707_103716502 | 213 |
| 353 | 3300025912 | Ga0207707_10611870 | Ga0207707_106118702 | 213 |
| 354 | 3300025913 | Ga0207695_10000026 | Ga0207695_1000002624 | 213 |
| 355 | 3300025913 | Ga0207695_10005663 | Ga0207695_100056639 | 213 |
| 356 | 3300025913 | Ga0207695_10480417 | Ga0207695_104804172 | 213 |
| 357 | 3300025914 | Ga0207671_10034020 | Ga0207671_100340204 | 213 |
| 358 | 3300025914 | Ga0207671_10051567 | Ga0207671_100515672 | 213 |
| 359 | 3300025914 | Ga0207671_10208201 | Ga0207671_102082011 | 213 |
| 360 | 3300025914 | Ga0207671_10520887 | Ga0207671_105208872 | 213 |
| 361 | 3300025915 | Ga0207693_10252945 | Ga0207693_102529453 | 213 |
| 362 | 3300025916 | Ga0207663_10647141 | Ga0207663_106471411 | 213 |
| 363 | 3300025917 | Ga0207660_10025625 | Ga0207660_100256254 | 213 |
| 364 | 3300025917 | Ga0207660_10169795 | Ga0207660_101697952 | 213 |
| 365 | 3300025917 | Ga0207660_10315648 | Ga0207660_103156482 | 213 |
| 366 | 3300025919 | Ga0207657_10002216 | Ga0207657_100022169 | 213 |
| 367 | 3300025919 | Ga0207657_10004132 | Ga0207657_1000413210 | 213 |
| 368 | 3300025919 | Ga0207657_10067879 | Ga0207657_100678791 | 213 |
| 369 | 3300025921 | Ga0207652_10013412 | Ga0207652_100134127 | 213 |
| 370 | 3300025921 | Ga0207652_10050651 | Ga0207652_100506516 | 213 |
| 371 | 3300025921 | Ga0207652_10122102 | Ga0207652_101221022 | 213 |
| 372 | 3300025921 | Ga0207652_10123933 | Ga0207652_101239332 | 213 |
| 373 | 3300025921 | Ga0207652_10265675 | Ga0207652_102656752 | 213 |
| 374 | 3300025921 | Ga0207652_10331840 | Ga0207652_103318402 | 213 |
| 375 | 3300025921 | Ga0207652_10332695 | Ga0207652_103326952 | 213 |
| 376 | 3300025922 | Ga0207646_10000646 | Ga0207646_1000064623 | 213 |
| 377 | 3300025922 | Ga0207646_10001061 | Ga0207646_1000106112 | 213 |
| 378 | 3300025924 | Ga0207694_10006117 | Ga0207694_100061179 | 213 |
| 379 | 3300025924 | Ga0207694_10111105 | Ga0207694_101111053 | 213 |
| 380 | 3300025924 | Ga0207694_10207946 | Ga0207694_102079462 | 213 |
| 381 | 3300025927 | Ga0207687_10590549 | Ga0207687_105905492 | 213 |
| 382 | 3300025928 | Ga0207700_10143008 | Ga0207700_101430082 | 213 |
| 383 | 3300025929 | Ga0207664_10021199 | Ga0207664_100211995 | 213 |
| 384 | 3300025929 | Ga0207664_10162988 | Ga0207664_101629882 | 213 |
| 385 | 3300025932 | Ga0207690_10185857 | Ga0207690_101858573 | 213 |
| 386 | 3300025933 | Ga0207706_10449114 | Ga0207706_104491141 | 213 |
| 387 | 3300025939 | Ga0207665_10229470 | Ga0207665_102294703 | 213 |
| 388 | 3300025940 | Ga0207691_10011158 | Ga0207691_100111582 | 213 |
| 389 | 3300025944 | Ga0207661_10293109 | Ga0207661_102931092 | 213 |
| 390 | 3300025945 | Ga0207679_10003924 | Ga0207679_100039243 | 213 |
| 391 | 3300025945 | Ga0207679_10355068 | Ga0207679_103550681 | 213 |
| 392 | 3300025949 | Ga0207667_10000056 | Ga0207667_10000056142 | 213 |
| 393 | 3300025949 | Ga0207667_10007192 | Ga0207667_1000719210 | 213 |
| 394 | 3300025949 | Ga0207667_10015452 | Ga0207667_100154525 | 213 |
| 395 | 3300025949 | Ga0207667_10050239 | Ga0207667_100502392 | 213 |
| 396 | 3300025960 | Ga0207651_10900677 | Ga0207651_109006771 | 213 |
| 397 | 3300025986 | Ga0207658_10711757 | Ga0207658_107117572 | 213 |
| 398 | 3300026041 | Ga0207639_10002091 | Ga0207639_100020912 | 213 |
| 399 | 3300026041 | Ga0207639_10134728 | Ga0207639_101347282 | 213 |
| 400 | 3300026095 | Ga0207676_10268177 | Ga0207676_102681772 | 213 |
| 401 | 3300026116 | Ga0207674_10023573 | Ga0207674_100235736 | 213 |
| 402 | 3300026116 | Ga0207674_10127165 | Ga0207674_101271652 | 213 |
| 403 | 3300026121 | Ga0207683_10229593 | Ga0207683_102295932 | 213 |
| 404 | 3300026142 | Ga0207698_10000016 | Ga0207698_1000001624 | 213 |
| 405 | 3300026142 | Ga0207698_10028126 | Ga0207698_100281264 | 213 |
| 406 | 3300026142 | Ga0207698_11008029 | Ga0207698_110080292 | 213 |
| 407 | 3300027907 | Ga0207428_10009183 | Ga0207428_100091832 | 213 |
| 408 | 3300028800 | Ga0265338_10009230 | Ga0265338_100092302 | 213 |
| 409 | 3300031249 | Ga0265339_10010931 | Ga0265339_100109312 | 213 |
| 410 | 3300031250 | Ga0265331_10009805 | Ga0265331_100098055 | 213 |
| 411 | 3300031711 | Ga0265314_10000200 | Ga0265314_1000020041 | 213 |
| 412 | 3300031711 | Ga0265314_10170386 | Ga0265314_101703862 | 213 |
| 413 | 3300031711 | Ga0265314_10192298 | Ga0265314_101922981 | 213 |
| 414 | 3300035691 | Ga0373931_0113716 | Ga0373931_0113716_563_1204 | 213 |
| 415 | 3300035691 | Ga0373931_0212543 | Ga0373931_0212543_468_1145 | 213 |
| 416 | 3300036401 | Ga0373937_0138772 | Ga0373937_0138772_699_1340 | 213 |
| 417 | 3300037068 | Ga0373925_0234933 | Ga0373925_0234933_546_1187 | 213 |
| 418 | 3300037418 | Ga0395900_0050862 | Ga0395900_0050862_3268_3909 | 213 |
| 419 | 3300037588 | Ga0316581_0143268 | Ga0316581_0143268_47_712 | 213 |
| 420 | 3300038443 | Ga0395901_0594051 | Ga0395901_0594051_15_656 | 213 |
| 421 | 3300039447 | Ga0436361_0245497 | Ga0436361_0245497_10892_11533 | 213 |
| 422 | 3300039453 | Ga0436362_0424287 | Ga0436362_0424287_658_1299 | 213 |
| 423 | 3300045051 | Ga0451576_0074345 | Ga0451576_0074345_794_1435 | 213 |
| 424 | 3300046462 | Ga0495651_0352907 | Ga0495651_0352907_45_686 | 213 |
| 425 | 3300046472 | Ga0495580_0278565 | Ga0495580_0278565_191_832 | 213 |
| 426 | 3300046543 | Ga0495645_0234118 | Ga0495645_0234118_164_805 | 213 |
| 427 | 3300046679 | Ga0495623_0026675 | Ga0495623_0026675_636_1277 | 213 |
| 428 | 3300046689 | Ga0495613_0196759 | Ga0495613_0196759_80_721 | 213 |
| 429 | 3300047319 | Ga0495674_0049201 | Ga0495674_0049201_654_1295 | 213 |
| 430 | 3300047322 | Ga0495680_0085480 | Ga0495680_0085480_312_953 | 213 |
| 431 | 3300047444 | Ga0495675_0000711 | Ga0495675_0000711_1137_1778 | 213 |
| 432 | 3300048905 | Ga0496102_0029999 | Ga0496102_0029999_1602_2279 | 213 |
| 433 | 3300048906 | Ga0496103_0382227 | Ga0496103_0382227_229_870 | 213 |
| 434 | 3300048909 | Ga0496106_0367030 | Ga0496106_0367030_100_741 | 213 |
| 435 | 3300048911 | Ga0496108_0054724 | Ga0496108_0054724_1566_2243 | 213 |
| 436 | 3300048912 | Ga0496109_0101743 | Ga0496109_0101743_1463_2140 | 213 |
| 437 | 3300048915 | Ga0496112_0013081 | Ga0496112_0013081_6789_7430 | 213 |
| 438 | 3300048915 | Ga0496112_0026555 | Ga0496112_0026555_920_1597 | 213 |
| 439 | 3300048915 | Ga0496112_0350858 | Ga0496112_0350858_706_1347 | 213 |
| 440 | 3300048916 | Ga0496113_0123491 | Ga0496113_0123491_1359_2000 | 213 |
| 441 | 3300048916 | Ga0496113_0392597 | Ga0496113_0392597_388_1065 | 213 |
| 442 | 3300048929 | Ga0496126_0130998 | Ga0496126_0130998_810_1451 | 213 |
| 443 | 3300049571 | Ga0501034_0012355 | Ga0501034_0012355_5872_6513 | 213 |
| 444 | 3300049579 | Ga0501043_0559202 | Ga0501043_0559202_22_663 | 213 |
| 445 | 3300049581 | Ga0501047_0010623 | Ga0501047_0010623_4710_5351 | 213 |
| 446 | 3300049586 | Ga0501070_0007727 | Ga0501070_0007727_5861_6502 | 213 |
| 447 | 3300049586 | Ga0501070_0386169 | Ga0501070_0386169_404_1045 | 213 |
| 448 | 3300049822 | Ga0501035_0014148 | Ga0501035_0014148_1706_2347 | 213 |
| 449 | 3300049823 | Ga0501044_0067954 | Ga0501044_0067954_261_902 | 213 |
| 450 | 3300050507 | nmdc:mga05p37_189680_c1 | nmdc:mga05p37_189680_c1_170_811 | 213 |
| 451 | 3300050507 | nmdc:mga05p37_307347_c1 | nmdc:mga05p37_307347_c1_438_1079 | 213 |
| 452 | 3300050507 | nmdc:mga05p37_845023_c1 | nmdc:mga05p37_845023_c1_237_878 | 213 |
| 453 | 3300050508 | nmdc:mga09592_12903_c1 | nmdc:mga09592_12903_c1_4081_4722 | 213 |
| 454 | 3300050510 | nmdc:mga06r32_34801_c1 | nmdc:mga06r32_34801_c1_2924_3565 | 213 |
| 455 | 3300050510 | nmdc:mga06r32_67343_c1 | nmdc:mga06r32_67343_c1_1053_1694 | 213 |
| 456 | 3300050511 | nmdc:mga08y16_3586_c1 | nmdc:mga08y16_3586_c1_8652_9293 | 213 |
| 457 | 3300050512 | nmdc:mga0n895_33421_c1 | nmdc:mga0n895_33421_c1_3963_4604 | 213 |
| 458 | 3300050512 | nmdc:mga0n895_506666_c1 | nmdc:mga0n895_506666_c1_362_1003 | 213 |
| 459 | 3300050513 | nmdc:mga0rr50_55568_c1 | nmdc:mga0rr50_55568_c1_108_749 | 213 |
| 460 | 3300050513 | nmdc:mga0rr50_71339_c1 | nmdc:mga0rr50_71339_c1_1747_2388 | 213 |
| 461 | 3300050513 | nmdc:mga0rr50_754191_c1 | nmdc:mga0rr50_754191_c1_164_805 | 213 |
| 462 | 3300050514 | nmdc:mga08x19_1868_c1 | nmdc:mga08x19_1868_c1_562_1203 | 213 |
| 463 | 3300050514 | nmdc:mga08x19_2799_c1 | nmdc:mga08x19_2799_c1_2106_2747 | 213 |
| 464 | 3300050514 | nmdc:mga08x19_579971_c1 | nmdc:mga08x19_579971_c1_14_655 | 213 |
| 465 | 3300050515 | nmdc:mga0a205_315202_c1 | nmdc:mga0a205_315202_c1_171_812 | 213 |
| 466 | 3300054114 | Ga0501084_0530363 | Ga0501084_0530363_37_678 | 213 |
| 467 | 3300003856 | Ga0058692_1007969 | Ga0058692_10079692 | 214 |
| 468 | 3300031691 | Ga0316579_10258132 | Ga0316579_102581322 | 214 |
| 469 | 3300031727 | Ga0316576_10007643 | Ga0316576_100076434 | 214 |
| 470 | 3300031727 | Ga0316576_10029210 | Ga0316576_100292102 | 214 |
| 471 | 3300031727 | Ga0316576_10398958 | Ga0316576_103989582 | 214 |
| 472 | 3300031728 | Ga0316578_10039501 | Ga0316578_100395013 | 214 |
| 473 | 3300031728 | Ga0316578_10130874 | Ga0316578_101308742 | 214 |
| 474 | 3300035398 | Ga0316574_0079136 | Ga0316574_0079136_755_1399 | 214 |
| 475 | 3300031728 | Ga0316578_10051828 | Ga0316578_100518282 | 215 |
| 476 | 3300036647 | Ga0316582_0002360 | Ga0316582_0002360_3322_3978 | 215 |
| 477 | 3300036647 | Ga0316582_0478801 | Ga0316582_0478801_167_820 | 215 |
| 478 | 3300036712 | Ga0316584_0123617 | Ga0316584_0123617_815_1462 | 215 |
| 479 | 3300036647 | Ga0316582_0043570 | Ga0316582_0043570_383_1036 | 216 |
| 480 | 3300036647 | Ga0316582_0138315 | Ga0316582_0138315_172_825 | 216 |
| 481 | 3300036647 | Ga0316582_0301093 | Ga0316582_0301093_241_894 | 216 |
| 482 | 3300036712 | Ga0316584_0315928 | Ga0316584_0315928_218_871 | 216 |
| 483 | 3300049742 | Ga0501080_0493553 | Ga0501080_0493553_239_892 | 216 |
| 484 | iso_pu_bacteria | 2609459761 | 2609909656 | 216 |
| 485 | iso_pu_bacteria | 2939573065 | 2939575361 | 216 |
| 486 | iso_pu_bacteria | 2945874760 | 2945876844 | 216 |
| 487 | 3300005329 | Ga0070683_100294876 | Ga0070683_1002948762 | 217 |
| 488 | 3300005344 | Ga0070661_100335890 | Ga0070661_1003358902 | 217 |
| 489 | 3300005345 | Ga0070692_10331813 | Ga0070692_103318132 | 217 |
| 490 | 3300005366 | Ga0070659_100191861 | Ga0070659_1001918612 | 217 |
| 491 | 3300005458 | Ga0070681_10132687 | Ga0070681_101326874 | 217 |
| 492 | 3300005459 | Ga0068867_100092572 | Ga0068867_1000925723 | 217 |
| 493 | 3300005530 | Ga0070679_100031038 | Ga0070679_1000310387 | 217 |
| 494 | 3300005535 | Ga0070684_100535110 | Ga0070684_1005351102 | 217 |
| 495 | 3300005563 | Ga0068855_100082048 | Ga0068855_1000820482 | 217 |
| 496 | 3300005563 | Ga0068855_100235003 | Ga0068855_1002350032 | 217 |
| 497 | 3300005577 | Ga0068857_100737896 | Ga0068857_1007378961 | 217 |
| 498 | 3300005614 | Ga0068856_100018638 | Ga0068856_1000186388 | 217 |
| 499 | 3300005616 | Ga0068852_100606257 | Ga0068852_1006062572 | 217 |
| 500 | 3300006237 | Ga0097621_100247031 | Ga0097621_1002470311 | 217 |
| 501 | 3300006358 | Ga0068871_100002826 | Ga0068871_10000282610 | 217 |
| 502 | 3300006881 | Ga0068865_100021630 | Ga0068865_1000216304 | 217 |
| 503 | 3300009093 | Ga0105240_10030004 | Ga0105240_100300049 | 217 |
| 504 | 3300009093 | Ga0105240_10092102 | Ga0105240_100921024 | 217 |
| 505 | 3300009551 | Ga0105238_10062077 | Ga0105238_100620772 | 217 |
| 506 | 3300013100 | Ga0157373_10394651 | Ga0157373_103946511 | 217 |
| 507 | 3300013102 | Ga0157371_10098076 | Ga0157371_100980762 | 217 |
| 508 | 3300020070 | Ga0206356_10888656 | Ga0206356_108886562 | 217 |
| 509 | 3300025911 | Ga0207654_10222427 | Ga0207654_102224272 | 217 |
| 510 | 3300025912 | Ga0207707_10060015 | Ga0207707_100600155 | 217 |
| 511 | 3300025912 | Ga0207707_10277738 | Ga0207707_102777382 | 217 |
| 512 | 3300025913 | Ga0207695_10019479 | Ga0207695_100194792 | 217 |
| 513 | 3300025913 | Ga0207695_10051504 | Ga0207695_100515044 | 217 |
| 514 | 3300025913 | Ga0207695_10131539 | Ga0207695_101315393 | 217 |
| 515 | 3300025913 | Ga0207695_10168277 | Ga0207695_101682772 | 217 |
| 516 | 3300025917 | Ga0207660_10173051 | Ga0207660_101730512 | 217 |
| 517 | 3300025921 | Ga0207652_10205194 | Ga0207652_102051942 | 217 |
| 518 | 3300025924 | Ga0207694_10001887 | Ga0207694_100018872 | 217 |
| 519 | 3300025924 | Ga0207694_10016836 | Ga0207694_100168364 | 217 |
| 520 | 3300025927 | Ga0207687_10016550 | Ga0207687_100165505 | 217 |
| 521 | 3300025934 | Ga0207686_10018755 | Ga0207686_100187555 | 217 |
| 522 | 3300025938 | Ga0207704_10267511 | Ga0207704_102675112 | 217 |
| 523 | 3300025944 | Ga0207661_10162496 | Ga0207661_101624961 | 217 |
| 524 | 3300025944 | Ga0207661_10336558 | Ga0207661_103365583 | 217 |
| 525 | 3300025945 | Ga0207679_10565822 | Ga0207679_105658221 | 217 |
| 526 | 3300025949 | Ga0207667_10008358 | Ga0207667_100083589 | 217 |
| 527 | 3300025949 | Ga0207667_10047933 | Ga0207667_100479334 | 217 |
| 528 | 3300025949 | Ga0207667_10332042 | Ga0207667_103320421 | 217 |
| 529 | 3300026078 | Ga0207702_10364738 | Ga0207702_103647383 | 217 |
| 530 | 3300026089 | Ga0207648_10122125 | Ga0207648_101221253 | 217 |
| 531 | 3300026116 | Ga0207674_10011684 | Ga0207674_100116842 | 217 |
| 532 | 3300026116 | Ga0207674_10090377 | Ga0207674_100903775 | 217 |
| 533 | 3300026142 | Ga0207698_10008579 | Ga0207698_100085792 | 217 |
| 534 | 3300036401 | Ga0373937_0994095 | Ga0373937_0994095_42_695 | 217 |
| 535 | 3300037312 | Ga0395899_0137518 | Ga0395899_0137518_229_903 | 217 |
| 536 | 3300026088 | Ga0207641_10010424 | Ga0207641_100104246 | 218 |
| 537 | 3300048922 | Ga0496119_0000860 | Ga0496119_0000860_14429_15091 | 218 |
| 538 | 3300048923 | Ga0496120_0001420 | Ga0496120_0001420_17665_18327 | 218 |
| 539 | iso_pu_bacteria | 2551306352 | 2552746586 | 219 |
| 540 | iso_pu_bacteria | 2639762793 | 2640733120 | 219 |
| 541 | iso_pu_bacteria | 2675903507 | 2678229828 | 219 |
| 542 | iso_pu_bacteria | 2773857761 | 2774391335 | 219 |
| 543 | iso_pu_bacteria | 2773857770 | 2774439472 | 219 |
| 544 | iso_pu_bacteria | 2919182534 | 2919185542 | 219 |
| 545 | iso_pu_bacteria | 2928515477 | 2928516300 | 219 |
| 546 | iso_pu_bacteria | 2984568884 | 2984572177 | 219 |
| 547 | 3300005293 | Ga0065715_10100728 | Ga0065715_101007282 | 220 |
| 548 | 3300005293 | Ga0065715_10582615 | Ga0065715_105826151 | 220 |
| 549 | 3300005617 | Ga0068859_100101523 | Ga0068859_1001015232 | 220 |
| 550 | 3300005618 | Ga0068864_100022756 | Ga0068864_1000227562 | 220 |
| 551 | 3300005841 | Ga0068863_100009104 | Ga0068863_1000091045 | 220 |
| 552 | 3300005843 | Ga0068860_100175045 | Ga0068860_1001750453 | 220 |
| 553 | 3300005844 | Ga0068862_100595531 | Ga0068862_1005955312 | 220 |
| 554 | 3300006931 | Ga0097620_100101520 | Ga0097620_1001015202 | 220 |
| 555 | 3300006946 | Ga0079104_1000120 | Ga0079104_1000120109 | 220 |
| 556 | 3300009092 | Ga0105250_10000080 | Ga0105250_1000008061 | 220 |
| 557 | 3300009177 | Ga0105248_10035407 | Ga0105248_100354075 | 220 |
| 558 | 3300009553 | Ga0105249_10475794 | Ga0105249_104757942 | 220 |
| 559 | 3300025711 | Ga0207696_1000067 | Ga0207696_100006780 | 220 |
| 560 | 3300025711 | Ga0207696_1000100 | Ga0207696_100010060 | 220 |
| 561 | 3300025941 | Ga0207711_10094296 | Ga0207711_100942962 | 220 |
| 562 | 3300025961 | Ga0207712_10098219 | Ga0207712_100982192 | 220 |
| 563 | 3300026088 | Ga0207641_10043029 | Ga0207641_100430295 | 220 |
| 564 | 3300026095 | Ga0207676_10033379 | Ga0207676_100333795 | 220 |
| 565 | 3300027111 | Ga0209281_1000014 | Ga0209281_1000014374 | 220 |
| 566 | 3300028380 | Ga0268265_10180571 | Ga0268265_101805713 | 220 |
| 567 | 3300028381 | Ga0268264_10187921 | Ga0268264_101879213 | 220 |
| 568 | 3300028381 | Ga0268264_10432056 | Ga0268264_104320562 | 220 |
| 569 | 3300036712 | Ga0316584_0118564 | Ga0316584_0118564_646_1341 | 220 |
| 570 | 3300046535 | Ga0495586_0194202 | Ga0495586_0194202_223_897 | 220 |
| 571 | 3300046689 | Ga0495613_0122210 | Ga0495613_0122210_966_1640 | 220 |
| 572 | 3300047322 | Ga0495680_0107043 | Ga0495680_0107043_1361_2035 | 220 |
| 573 | 3300048925 | Ga0496122_0008975 | Ga0496122_0008975_834_1496 | 220 |
| 574 | 3300048926 | Ga0496123_0007059 | Ga0496123_0007059_965_1627 | 220 |
| 575 | iso_pu_bacteria | 2506520007 | 2506579584 | 220 |
| 576 | iso_pu_bacteria | 2506520008 | 2506584723 | 220 |
| 577 | iso_pu_bacteria | 2508501071 | 2508853373 | 220 |
| 578 | iso_pu_bacteria | 2510065053 | 2510281668 | 220 |
| 579 | iso_pu_bacteria | 2510065055 | 2510292161 | 220 |
| 580 | iso_pu_bacteria | 2510065058 | 2510309816 | 220 |
| 581 | iso_pu_bacteria | 2511231004 | 2511257178 | 220 |
| 582 | iso_pu_bacteria | 2511231006 | 2511267301 | 220 |
| 583 | iso_pu_bacteria | 2511231007 | 2511273809 | 220 |
| 584 | iso_pu_bacteria | 2511231008 | 2511278357 | 220 |
| 585 | iso_pu_bacteria | 2511231010 | 2511288186 | 220 |
| 586 | iso_pu_bacteria | 2511231011 | 2511295980 | 220 |
| 587 | iso_pu_bacteria | 2511231012 | 2511299340 | 220 |
| 588 | iso_pu_bacteria | 2511231014 | 2511311217 | 220 |
| 589 | iso_pu_bacteria | 2511231015 | 2511317673 | 220 |
| 590 | iso_pu_bacteria | 2511231016 | 2511329341 | 220 |
| 591 | iso_pu_bacteria | 2511231017 | 2511334121 | 220 |
| 592 | iso_pu_bacteria | 2511231018 | 2511340236 | 220 |
| 593 | iso_pu_bacteria | 2511231019 | 2511345321 | 220 |
| 594 | iso_pu_bacteria | 2511231020 | 2511352734 | 220 |
| 595 | iso_pu_bacteria | 2511231021 | 2511357878 | 220 |
| 596 | iso_pu_bacteria | 2511231022 | 2511361100 | 220 |
| 597 | iso_pu_bacteria | 2511231023 | 2511369792 | 220 |
| 598 | iso_pu_bacteria | 2511231024 | 2511376132 | 220 |
| 599 | iso_pu_bacteria | 2511231025 | 2511380070 | 220 |
| 600 | iso_pu_bacteria | 2511231031 | 2511416408 | 220 |
| 601 | iso_pu_bacteria | 2511231035 | 2511434942 | 220 |
| 602 | iso_pu_bacteria | 2511231156 | 2511824148 | 220 |
| 603 | iso_pu_bacteria | 2512047018 | 2512325513 | 220 |
| 604 | iso_pu_bacteria | 2537561728 | 2538425393 | 220 |
| 605 | iso_pu_bacteria | 2547132181 | 2547697316 | 220 |
| 606 | iso_pu_bacteria | 2554235132 | 2554814806 | 220 |
| 607 | iso_pu_bacteria | 2554235231 | 2555246031 | 220 |
| 608 | iso_pu_bacteria | 2554235234 | 2555259855 | 220 |
| 609 | iso_pu_bacteria | 2554235341 | 2555670900 | 220 |
| 610 | iso_pu_bacteria | 2561511199 | 2562463596 | 220 |
| 611 | iso_pu_bacteria | 2582580891 | 2583793139 | 220 |
| 612 | iso_pu_bacteria | 2585427591 | 2585827733 | 220 |
| 613 | iso_pu_bacteria | 2585427592 | 2585835066 | 220 |
| 614 | iso_pu_bacteria | 2597489887 | 2597858915 | 220 |
| 615 | iso_pu_bacteria | 2597489888 | 2597864544 | 220 |
| 616 | iso_pu_bacteria | 2597489889 | 2597870352 | 220 |
| 617 | iso_pu_bacteria | 2599185155 | 2599329187 | 220 |
| 618 | iso_pu_bacteria | 2599185160 | 2599357539 | 220 |
| 619 | iso_pu_bacteria | 2599185161 | 2599364329 | 220 |
| 620 | iso_pu_bacteria | 2599185162 | 2599370650 | 220 |
| 621 | iso_pu_bacteria | 2599185163 | 2599377157 | 220 |
| 622 | iso_pu_bacteria | 2599185164 | 2599382744 | 220 |
| 623 | iso_pu_bacteria | 2599185165 | 2599389192 | 220 |
| 624 | iso_pu_bacteria | 2599185166 | 2599395875 | 220 |
| 625 | iso_pu_bacteria | 2599185167 | 2599397669 | 220 |
| 626 | iso_pu_bacteria | 2599185168 | 2599408265 | 220 |
| 627 | iso_pu_bacteria | 2599185169 | 2599411258 | 220 |
| 628 | iso_pu_bacteria | 2599185179 | 2599452115 | 220 |
| 629 | iso_pu_bacteria | 2599185181 | 2599463972 | 220 |
| 630 | iso_pu_bacteria | 2599185182 | 2599470999 | 220 |
| 631 | iso_pu_bacteria | 2599185185 | 2599487647 | 220 |
| 632 | iso_pu_bacteria | 2599185186 | 2599492991 | 220 |
| 633 | iso_pu_bacteria | 2599185188 | 2599502000 | 220 |
| 634 | iso_pu_bacteria | 2599185189 | 2599506756 | 220 |
| 635 | iso_pu_bacteria | 2599185190 | 2599513497 | 220 |
| 636 | iso_pu_bacteria | 2599185191 | 2599517995 | 220 |
| 637 | iso_pu_bacteria | 2599185212 | 2599611260 | 220 |
| 638 | iso_pu_bacteria | 2599185248 | 2599769885 | 220 |
| 639 | iso_pu_bacteria | 2599185257 | 2599806027 | 220 |
| 640 | iso_pu_bacteria | 2599185288 | 2599880862 | 220 |
| 641 | iso_pu_bacteria | 2599185289 | 2599887209 | 220 |
| 642 | iso_pu_bacteria | 2599185290 | 2599892174 | 220 |
| 643 | iso_pu_bacteria | 2599185291 | 2599898626 | 220 |
| 644 | iso_pu_bacteria | 2599185299 | 2599926515 | 220 |
| 645 | iso_pu_bacteria | 2599185300 | 2599932940 | 220 |
| 646 | iso_pu_bacteria | 2599185302 | 2599942698 | 220 |
| 647 | iso_pu_bacteria | 2599185303 | 2599949845 | 220 |
| 648 | iso_pu_bacteria | 2599185304 | 2599953447 | 220 |
| 649 | iso_pu_bacteria | 2599185305 | 2599959086 | 220 |
| 650 | iso_pu_bacteria | 2599185306 | 2599964351 | 220 |
| 651 | iso_pu_bacteria | 2599185307 | 2599970714 | 220 |
| 652 | iso_pu_bacteria | 2599185308 | 2599975777 | 220 |
| 653 | iso_pu_bacteria | 2599185309 | 2599982370 | 220 |
| 654 | iso_pu_bacteria | 2599185310 | 2599989152 | 220 |
| 655 | iso_pu_bacteria | 2599185311 | 2599994582 | 220 |
| 656 | iso_pu_bacteria | 2599185312 | 2599999439 | 220 |
| 657 | iso_pu_bacteria | 2599185313 | 2600005935 | 220 |
| 658 | iso_pu_bacteria | 2599185314 | 2600009586 | 220 |
| 659 | iso_pu_bacteria | 2599185315 | 2600017071 | 220 |
| 660 | iso_pu_bacteria | 2599185316 | 2600022247 | 220 |
| 661 | iso_pu_bacteria | 2599185317 | 2600029125 | 220 |
| 662 | iso_pu_bacteria | 2599185318 | 2600035573 | 220 |
| 663 | iso_pu_bacteria | 2599185319 | 2600042144 | 220 |
| 664 | iso_pu_bacteria | 2599185320 | 2600047051 | 220 |
| 665 | iso_pu_bacteria | 2599185321 | 2600051894 | 220 |
| 666 | iso_pu_bacteria | 2599185322 | 2600057206 | 220 |
| 667 | iso_pu_bacteria | 2599185323 | 2600064898 | 220 |
| 668 | iso_pu_bacteria | 2599185324 | 2600069874 | 220 |
| 669 | iso_pu_bacteria | 2599185325 | 2600075522 | 220 |
| 670 | iso_pu_bacteria | 2599185356 | 2600217113 | 220 |
| 671 | iso_pu_bacteria | 2600254930 | 2600358499 | 220 |
| 672 | iso_pu_bacteria | 2600254931 | 2600366733 | 220 |
| 673 | iso_pu_bacteria | 2600254954 | 2600444815 | 220 |
| 674 | iso_pu_bacteria | 2600255254 | 2601524253 | 220 |
| 675 | iso_pu_bacteria | 2600255255 | 2601529407 | 220 |
| 676 | iso_pu_bacteria | 2600255256 | 2601535009 | 220 |
| 677 | iso_pu_bacteria | 2600255257 | 2601539362 | 220 |
| 678 | iso_pu_bacteria | 2600255280 | 2601616241 | 220 |
| 679 | iso_pu_bacteria | 2600255281 | 2601620963 | 220 |
| 680 | iso_pu_bacteria | 2600255283 | 2601627817 | 220 |
| 681 | iso_pu_bacteria | 2600255287 | 2601644310 | 220 |
| 682 | iso_pu_bacteria | 2600255288 | 2601649360 | 220 |
| 683 | iso_pu_bacteria | 2600255289 | 2601654287 | 220 |
| 684 | iso_pu_bacteria | 2600255290 | 2601659709 | 220 |
| 685 | iso_pu_bacteria | 2600255291 | 2601664132 | 220 |
| 686 | iso_pu_bacteria | 2600255296 | 2601690153 | 220 |
| 687 | iso_pu_bacteria | 2600255298 | 2601697092 | 220 |
| 688 | iso_pu_bacteria | 2600255299 | 2601702138 | 220 |
| 689 | iso_pu_bacteria | 2600255300 | 2601707031 | 220 |
| 690 | iso_pu_bacteria | 2600255301 | 2601712017 | 220 |
| 691 | iso_pu_bacteria | 2600255302 | 2601717548 | 220 |
| 692 | iso_pu_bacteria | 2600255303 | 2601722182 | 220 |
| 693 | iso_pu_bacteria | 2600255304 | 2601727476 | 220 |
| 694 | iso_pu_bacteria | 2600255305 | 2601732459 | 220 |
| 695 | iso_pu_bacteria | 2600255306 | 2601737026 | 220 |
| 696 | iso_pu_bacteria | 2600255307 | 2601741308 | 220 |
| 697 | iso_pu_bacteria | 2600255309 | 2601752438 | 220 |
| 698 | iso_pu_bacteria | 2600255310 | 2601757712 | 220 |
| 699 | iso_pu_bacteria | 2600255311 | 2601764070 | 220 |
| 700 | iso_pu_bacteria | 2600255313 | 2601777284 | 220 |
| 701 | iso_pu_bacteria | 2600255318 | 2601797219 | 220 |
| 702 | iso_pu_bacteria | 2600255389 | 2602011881 | 220 |
| 703 | iso_pu_bacteria | 2600255392 | 2602019279 | 220 |
| 704 | iso_pu_bacteria | 2602042046 | 2603636880 | 220 |
| 705 | iso_pu_bacteria | 2602042047 | 2603645366 | 220 |
| 706 | iso_pu_bacteria | 2602042052 | 2603662295 | 220 |
| 707 | iso_pu_bacteria | 2602042053 | 2603667191 | 220 |
| 708 | iso_pu_bacteria | 2602042066 | 2603699340 | 220 |
| 709 | iso_pu_bacteria | 2602042067 | 2603705369 | 220 |
| 710 | iso_pu_bacteria | 2602042103 | 2603839900 | 220 |
| 711 | iso_pu_bacteria | 2602042104 | 2603844977 | 220 |
| 712 | iso_pu_bacteria | 2602042105 | 2603850019 | 220 |
| 713 | iso_pu_bacteria | 2602042106 | 2603855118 | 220 |
| 714 | iso_pu_bacteria | 2602042109 | 2603867935 | 220 |
| 715 | iso_pu_bacteria | 2602042110 | 2603872698 | 220 |
| 716 | iso_pu_bacteria | 2602042111 | 2603878002 | 220 |
| 717 | iso_pu_bacteria | 2603880178 | 2606049845 | 220 |
| 718 | iso_pu_bacteria | 2603880184 | 2606071505 | 220 |
| 719 | iso_pu_bacteria | 2603880185 | 2606076050 | 220 |
| 720 | iso_pu_bacteria | 2603880199 | 2606130661 | 220 |
| 721 | iso_pu_bacteria | 2603880202 | 2606147562 | 220 |
| 722 | iso_pu_bacteria | 2603880211 | 2606177734 | 220 |
| 723 | iso_pu_bacteria | 2606217733 | 2608383706 | 220 |
| 724 | iso_pu_bacteria | 2608642108 | 2608670030 | 220 |
| 725 | iso_pu_bacteria | 2619619299 | 2621298944 | 220 |
| 726 | iso_pu_bacteria | 2623620443 | 2624481495 | 220 |
| 727 | iso_pu_bacteria | 2623620446 | 2624493047 | 220 |
| 728 | iso_pu_bacteria | 2636415599 | 2637224075 | 220 |
| 729 | iso_pu_bacteria | 2643221565 | 2643843597 | 220 |
| 730 | iso_pu_bacteria | 2643221571 | 2643871250 | 220 |
| 731 | iso_pu_bacteria | 2643221589 | 2643953852 | 220 |
| 732 | iso_pu_bacteria | 2643221602 | 2644021786 | 220 |
| 733 | iso_pu_bacteria | 2643221633 | 2644185579 | 220 |
| 734 | iso_pu_bacteria | 2643221650 | 2644283755 | 220 |
| 735 | iso_pu_bacteria | 2643221713 | 2644620455 | 220 |
| 736 | iso_pu_bacteria | 2648501693 | 2650895756 | 220 |
| 737 | iso_pu_bacteria | 2651869719 | 2652545455 | 220 |
| 738 | iso_pu_bacteria | 2654587920 | 2656276983 | 220 |
| 739 | iso_pu_bacteria | 2667528170 | 2671091118 | 220 |
| 740 | iso_pu_bacteria | 2667528171 | 2671100493 | 220 |
| 741 | iso_pu_bacteria | 2667528172 | 2671101120 | 220 |
| 742 | iso_pu_bacteria | 2667528173 | 2671107104 | 220 |
| 743 | iso_pu_bacteria | 2667528176 | 2671124591 | 220 |
| 744 | iso_pu_bacteria | 2671180115 | 2671584545 | 220 |
| 745 | iso_pu_bacteria | 2671180172 | 2671772907 | 220 |
| 746 | iso_pu_bacteria | 2675903046 | 2676405483 | 220 |
| 747 | iso_pu_bacteria | 2675903420 | 2677899505 | 220 |
| 748 | iso_pu_bacteria | 2675903515 | 2678264105 | 220 |
| 749 | iso_pu_bacteria | 2681812866 | 2681996222 | 220 |
| 750 | iso_pu_bacteria | 2681812869 | 2682006442 | 220 |
| 751 | iso_pu_bacteria | 2684622997 | 2686354167 | 220 |
| 752 | iso_pu_bacteria | 2687453129 | 2687577466 | 220 |
| 753 | iso_pu_bacteria | 2687453601 | 2689446107 | 220 |
| 754 | iso_pu_bacteria | 2711768156 | 2712468879 | 220 |
| 755 | iso_pu_bacteria | 2713897148 | 2715753604 | 220 |
| 756 | iso_pu_bacteria | 2713897149 | 2715756012 | 220 |
| 757 | iso_pu_bacteria | 2718217725 | 2718634748 | 220 |
| 758 | iso_pu_bacteria | 2721755607 | 2723249330 | 220 |
| 759 | iso_pu_bacteria | 2728369097 | 2729148140 | 220 |
| 760 | iso_pu_bacteria | 2738541265 | 2738672190 | 220 |
| 761 | iso_pu_bacteria | 2738541271 | 2738691984 | 220 |
| 762 | iso_pu_bacteria | 2738541276 | 2738714952 | 220 |
| 763 | iso_pu_bacteria | 2738541282 | 2738750583 | 220 |
| 764 | iso_pu_bacteria | 2738541294 | 2738806084 | 220 |
| 765 | iso_pu_bacteria | 2738541303 | 2738859624 | 220 |
| 766 | iso_pu_bacteria | 2738541309 | 2738893444 | 220 |
| 767 | iso_pu_bacteria | 2738543004 | 2739199877 | 220 |
| 768 | iso_pu_bacteria | 2738543015 | 2739260250 | 220 |
| 769 | iso_pu_bacteria | 2738543016 | 2739267643 | 220 |
| 770 | iso_pu_bacteria | 2738543020 | 2739285246 | 220 |
| 771 | iso_pu_bacteria | 2738543021 | 2739290560 | 220 |
| 772 | iso_pu_bacteria | 2738543025 | 2739313715 | 220 |
| 773 | iso_pu_bacteria | 2740892503 | 2743738435 | 220 |
| 774 | iso_pu_bacteria | 2744054620 | 2745004561 | 220 |
| 775 | iso_pu_bacteria | 2751185917 | 2753856916 | 220 |
| 776 | iso_pu_bacteria | 2765235841 | 2765583076 | 220 |
| 777 | iso_pu_bacteria | 2765235842 | 2765590021 | 220 |
| 778 | iso_pu_bacteria | 2772190666 | 2772440015 | 220 |
| 779 | iso_pu_bacteria | 2773857670 | 2774119097 | 220 |
| 780 | iso_pu_bacteria | 2773857672 | 2774130185 | 220 |
| 781 | iso_pu_bacteria | 2773857673 | 2774135077 | 220 |
| 782 | iso_pu_bacteria | 2775506706 | 2775541307 | 220 |
| 783 | iso_pu_bacteria | 2775507074 | 2777020952 | 220 |
| 784 | iso_pu_bacteria | 2784132063 | 2784265148 | 220 |
| 785 | iso_pu_bacteria | 2784132072 | 2784317743 | 220 |
| 786 | iso_pu_bacteria | 2791354903 | 2791922290 | 220 |
| 787 | iso_pu_bacteria | 2791355010 | 2792312021 | 220 |
| 788 | iso_pu_bacteria | 2791355275 | 2793404741 | 220 |
| 789 | iso_pu_bacteria | 2791355520 | 2794596824 | 220 |
| 790 | iso_pu_bacteria | 2806310673 | 2807179701 | 220 |
| 791 | iso_pu_bacteria | 2806310737 | 2807407690 | 220 |
| 792 | iso_pu_bacteria | 2806310745 | 2807456005 | 220 |
| 793 | iso_pu_bacteria | 2808606361 | 2808858261 | 220 |
| 794 | iso_pu_bacteria | 2808606373 | 2808907816 | 220 |
| 795 | iso_pu_bacteria | 2808606376 | 2808925606 | 220 |
| 796 | iso_pu_bacteria | 2808606377 | 2808931745 | 220 |
| 797 | iso_pu_bacteria | 2808606378 | 2808938026 | 220 |
| 798 | iso_pu_bacteria | 2808606379 | 2808943554 | 220 |
| 799 | iso_pu_bacteria | 2808606380 | 2808947710 | 220 |
| 800 | iso_pu_bacteria | 2808606381 | 2808953865 | 220 |
| 801 | iso_pu_bacteria | 2808606382 | 2808959083 | 220 |
| 802 | iso_pu_bacteria | 2808606383 | 2808966746 | 220 |
| 803 | iso_pu_bacteria | 2808606385 | 2808978975 | 220 |
| 804 | iso_pu_bacteria | 2808606388 | 2808994710 | 220 |
| 805 | iso_pu_bacteria | 2808606389 | 2809001571 | 220 |
| 806 | iso_pu_bacteria | 2808606414 | 2809125198 | 220 |
| 807 | iso_pu_bacteria | 2808606445 | 2809214321 | 220 |
| 808 | iso_pu_bacteria | 2811994881 | 2812367464 | 220 |
| 809 | iso_pu_bacteria | 2811995292 | 2813727890 | 220 |
| 810 | iso_pu_bacteria | 2814123068 | 2814695433 | 220 |
| 811 | iso_pu_bacteria | 2816332298 | 2817491894 | 220 |
| 812 | iso_pu_bacteria | 2818991456 | 2819657733 | 220 |
| 813 | iso_pu_bacteria | 2818991464 | 2819706155 | 220 |
| 814 | iso_pu_bacteria | 2821118458 | 2821121040 | 220 |
| 815 | iso_pu_bacteria | 2823373977 | 2823375674 | 220 |
| 816 | iso_pu_bacteria | 2823421272 | 2823423817 | 220 |
| 817 | iso_pu_bacteria | 2825651385 | 2825657069 | 220 |
| 818 | iso_pu_bacteria | 2826581358 | 2826582305 | 220 |
| 819 | iso_pu_bacteria | 2834028612 | 2834032685 | 220 |
| 820 | iso_pu_bacteria | 2842805378 | 2842807039 | 220 |
| 821 | iso_pu_bacteria | 2842815866 | 2842816649 | 220 |
| 822 | iso_pu_bacteria | 2842826826 | 2842828315 | 220 |
| 823 | iso_pu_bacteria | 2842832357 | 2842836334 | 220 |
| 824 | iso_pu_bacteria | 2842837860 | 2842841078 | 220 |
| 825 | iso_pu_bacteria | 2842843487 | 2842844229 | 220 |
| 826 | iso_pu_bacteria | 2842849001 | 2842854055 | 220 |
| 827 | iso_pu_bacteria | 2842854478 | 2842855043 | 220 |
| 828 | iso_pu_bacteria | 2844425489 | 2844428365 | 220 |
| 829 | iso_pu_bacteria | 2844528606 | 2844529133 | 220 |
| 830 | iso_pu_bacteria | 2844665904 | 2844671455 | 220 |
| 831 | iso_pu_bacteria | 2846540461 | 2846540472 | 220 |
| 832 | iso_pu_bacteria | 2847085930 | 2847086613 | 220 |
| 833 | iso_pu_bacteria | 2847797336 | 2847798973 | 220 |
| 834 | iso_pu_bacteria | 2852103415 | 2852107027 | 220 |
| 835 | iso_pu_bacteria | 2852612431 | 2852613803 | 220 |
| 836 | iso_pu_bacteria | 2852657418 | 2852659412 | 220 |
| 837 | iso_pu_bacteria | 2852667396 | 2852668461 | 220 |
| 838 | iso_pu_bacteria | 2855195626 | 2855199623 | 220 |
| 839 | iso_pu_bacteria | 2858466076 | 2858466760 | 220 |
| 840 | iso_pu_bacteria | 2860339153 | 2860344281 | 220 |
| 841 | iso_pu_bacteria | 2860867994 | 2860871044 | 220 |
| 842 | iso_pu_bacteria | 2865014394 | 2865016565 | 220 |
| 843 | iso_pu_bacteria | 2869551831 | 2869555454 | 220 |
| 844 | iso_pu_bacteria | 2871272651 | 2871275949 | 220 |
| 845 | iso_pu_bacteria | 2871282230 | 2871285806 | 220 |
| 846 | iso_pu_bacteria | 2876601092 | 2876603272 | 220 |
| 847 | iso_pu_bacteria | 2878029506 | 2878033469 | 220 |
| 848 | iso_pu_bacteria | 2880230671 | 2880232815 | 220 |
| 849 | iso_pu_bacteria | 2881609920 | 2881612013 | 220 |
| 850 | iso_pu_bacteria | 2884086401 | 2884087876 | 220 |
| 851 | iso_pu_bacteria | 2888366609 | 2888370108 | 220 |
| 852 | iso_pu_bacteria | 2888373701 | 2888377368 | 220 |
| 853 | iso_pu_bacteria | 2891670763 | 2891672346 | 220 |
| 854 | iso_pu_bacteria | 2900051742 | 2900052974 | 220 |
| 855 | iso_pu_bacteria | 2904474040 | 2904476028 | 220 |
| 856 | iso_pu_bacteria | 2904504865 | 2904506451 | 220 |
| 857 | iso_pu_bacteria | 2904513164 | 2904515389 | 220 |
| 858 | iso_pu_bacteria | 2904518522 | 2904520447 | 220 |
| 859 | iso_pu_bacteria | 2904550169 | 2904553609 | 220 |
| 860 | iso_pu_bacteria | 2908446538 | 2908450343 | 220 |
| 861 | iso_pu_bacteria | 2908669403 | 2908672428 | 220 |
| 862 | iso_pu_bacteria | 2912963787 | 2912965689 | 220 |
| 863 | iso_pu_bacteria | 2913036834 | 2913040491 | 220 |
| 864 | iso_pu_bacteria | 2917070673 | 2917074759 | 220 |
| 865 | iso_pu_bacteria | 2917832318 | 2917832513 | 220 |
| 866 | iso_pu_bacteria | 2919063839 | 2919069169 | 220 |
| 867 | iso_pu_bacteria | 2919108558 | 2919110971 | 220 |
| 868 | iso_pu_bacteria | 2919125081 | 2919125312 | 220 |
| 869 | iso_pu_bacteria | 2919150387 | 2919152197 | 220 |
| 870 | iso_pu_bacteria | 2919155634 | 2919159541 | 220 |
| 871 | iso_pu_bacteria | 2919385768 | 2919387628 | 220 |
| 872 | iso_pu_bacteria | 2919456309 | 2919461312 | 220 |
| 873 | iso_pu_bacteria | 2919481497 | 2919482339 | 220 |
| 874 | iso_pu_bacteria | 2919487758 | 2919490372 | 220 |
| 875 | iso_pu_bacteria | 2919493220 | 2919493544 | 220 |
| 876 | iso_pu_bacteria | 2919501602 | 2919503559 | 220 |
| 877 | iso_pu_bacteria | 2919543075 | 2919545054 | 220 |
| 878 | iso_pu_bacteria | 2919697872 | 2919699677 | 220 |
| 879 | iso_pu_bacteria | 2923153595 | 2923157492 | 220 |
| 880 | iso_pu_bacteria | 2923519811 | 2923521513 | 220 |
| 881 | iso_pu_bacteria | 2923525760 | 2923528824 | 220 |
| 882 | iso_pu_bacteria | 2923586266 | 2923587905 | 220 |
| 883 | iso_pu_bacteria | 2923634449 | 2923635889 | 220 |
| 884 | iso_pu_bacteria | 2926063275 | 2926065869 | 220 |
| 885 | iso_pu_bacteria | 2927143783 | 2927144866 | 220 |
| 886 | iso_pu_bacteria | 2927833300 | 2927837613 | 220 |
| 887 | iso_pu_bacteria | 2929144301 | 2929146336 | 220 |
| 888 | iso_pu_bacteria | 2929189879 | 2929193113 | 220 |
| 889 | iso_pu_bacteria | 2931369376 | 2931374592 | 220 |
| 890 | iso_pu_bacteria | 2931390751 | 2931393379 | 220 |
| 891 | iso_pu_bacteria | 2931396565 | 2931403012 | 220 |
| 892 | iso_pu_bacteria | 2932406140 | 2932410812 | 220 |
| 893 | iso_pu_bacteria | 2935353572 | 2935355254 | 220 |
| 894 | iso_pu_bacteria | 2935625433 | 2935625765 | 220 |
| 895 | iso_pu_bacteria | 2937539931 | 2937542446 | 220 |
| 896 | iso_pu_bacteria | 2937967321 | 2937968639 | 220 |
| 897 | iso_pu_bacteria | 2939568625 | 2939570036 | 220 |
| 898 | iso_pu_bacteria | 2939577877 | 2939582315 | 220 |
| 899 | iso_pu_bacteria | 2939602548 | 2939604802 | 220 |
| 900 | iso_pu_bacteria | 2939607340 | 2939608680 | 220 |
| 901 | iso_pu_bacteria | 2939617950 | 2939618486 | 220 |
| 902 | iso_pu_bacteria | 2939636861 | 2939640306 | 220 |
| 903 | iso_pu_bacteria | 2939642701 | 2939642945 | 220 |
| 904 | iso_pu_bacteria | 2939651529 | 2939653849 | 220 |
| 905 | iso_pu_bacteria | 2945928738 | 2945932883 | 220 |
| 906 | iso_pu_bacteria | 2945951305 | 2945952219 | 220 |
| 907 | iso_pu_bacteria | 2945961074 | 2945964555 | 220 |
| 908 | iso_pu_bacteria | 2946006987 | 2946009156 | 220 |
| 909 | iso_pu_bacteria | 2946027586 | 2946031389 | 220 |
| 910 | iso_pu_bacteria | 2947233263 | 2947238359 | 220 |
| 911 | iso_pu_bacteria | 2952252522 | 2952254987 | 220 |
| 912 | iso_pu_bacteria | 2969079654 | 2969081109 | 220 |
| 913 | iso_pu_bacteria | 2969304461 | 2969308228 | 220 |
| 914 | iso_pu_bacteria | 2971820967 | 2971822491 | 220 |
| 915 | iso_pu_bacteria | 2974289157 | 2974290297 | 220 |
| 916 | iso_pu_bacteria | 2974298342 | 2974300555 | 220 |
| 917 | iso_pu_bacteria | 2974310843 | 2974311091 | 220 |
| 918 | iso_pu_bacteria | 2974435778 | 2974439281 | 220 |
| 919 | iso_pu_bacteria | 2978975091 | 2978978693 | 220 |
| 920 | iso_pu_bacteria | 2984286254 | 2984288647 | 220 |
| 921 | iso_pu_bacteria | 2984494565 | 2984497533 | 220 |
| 922 | iso_pu_bacteria | 2984499530 | 2984502937 | 220 |
| 923 | iso_pu_bacteria | 2984504281 | 2984508519 | 220 |
| 924 | iso_pu_bacteria | 2984559226 | 2984563567 | 220 |
| 925 | iso_pu_bacteria | 2984595703 | 2984596301 | 220 |
| 926 | iso_pu_bacteria | 2988728565 | 2988729694 | 220 |
| 927 | iso_pu_bacteria | 2990196909 | 2990199484 | 220 |
| 928 | iso_pu_bacteria | 2990261002 | 2990261482 | 220 |
| 929 | iso_pu_bacteria | 2998139840 | 2998143556 | 220 |
| 930 | iso_pu_bacteria | 3000376612 | 3000378358 | 220 |
| 931 | iso_pu_bacteria | 3007252601 | 3007252740 | 220 |
| 932 | iso_pu_bacteria | 3007315729 | 3007318616 | 220 |
| 933 | iso_pu_bacteria | 3007395558 | 3007396814 | 220 |
| 934 | iso_pu_bacteria | 3007419365 | 3007424028 | 220 |
| 935 | iso_pu_bacteria | 3007511990 | 3007515193 | 220 |
| 936 | iso_pu_bacteria | 3007614139 | 3007616659 | 220 |
| 937 | iso_pu_bacteria | 3007619802 | 3007620947 | 220 |
| 938 | iso_pu_bacteria | 3007718800 | 3007719671 | 220 |
| 939 | iso_pu_bacteria | 3007803356 | 3007808794 | 220 |
| 940 | iso_pu_bacteria | 3007855910 | 3007859014 | 220 |
| 941 | iso_pu_bacteria | 3007861166 | 3007861463 | 220 |
| 942 | iso_pu_bacteria | 3007866637 | 3007868506 | 220 |
| 943 | iso_pu_bacteria | 3007872151 | 3007874252 | 220 |
| 944 | iso_pu_bacteria | 637000220 | 637321235 | 220 |
| 945 | iso_pu_bacteria | 640753048 | 640938853 | 220 |
| 946 | iso_pu_bacteria | 8002745576 | 8002748585 | 220 |
| 947 | iso_pu_bacteria | 8004592986 | 8004596169 | 220 |
| 948 | iso_pu_bacteria | 8011350971 | 8011354076 | 220 |
| 949 | iso_pu_bacteria | 8015394850 | 8015397811 | 220 |
| 950 | iso_pu_bacteria | 8015687852 | 8015691654 | 220 |
| 951 | iso_pu_bacteria | 8016728285 | 8016729228 | 220 |
| 952 | iso_pu_bacteria | 8016733728 | 8016735064 | 220 |
| 953 | iso_pu_bacteria | 8018221730 | 8018224689 | 220 |
| 954 | iso_pu_bacteria | 8018405270 | 8018409241 | 220 |
| 955 | iso_pu_bacteria | 8019499862 | 8019501454 | 220 |
| 956 | iso_pu_bacteria | 8019504834 | 8019505176 | 220 |
| 957 | iso_pu_bacteria | 8019769354 | 8019772153 | 220 |
| 958 | iso_pu_bacteria | 8019775933 | 8019776052 | 220 |
| 959 | iso_pu_bacteria | 8029995093 | 8029997268 | 220 |
| 960 | iso_pu_bacteria | 8034962539 | 8034964679 | 220 |
| 961 | iso_pu_bacteria | 8052494512 | 8052498196 | 220 |
| 962 | iso_pu_bacteria | 8054285046 | 8054285048 | 220 |
| 963 | iso_pu_bacteria | 8054347763 | 8054347788 | 220 |
| 964 | iso_pu_bacteria | 8054503363 | 8054506885 | 220 |
| 965 | iso_pu_bacteria | 8054844752 | 8054846625 | 220 |
| 966 | iso_pu_bacteria | 8054849141 | 8054851967 | 220 |
| 967 | iso_pu_bacteria | 8054929484 | 8054932211 | 220 |
| 968 | iso_pu_bacteria | 8055087960 | 8055092167 | 220 |
| 969 | iso_pu_bacteria | 8055092621 | 8055095493 | 220 |
| 970 | iso_pu_bacteria | 8055097453 | 8055100203 | 220 |
| 971 | iso_pu_bacteria | 8055693939 | 8055696847 | 220 |
| 972 | iso_pu_bacteria | 8055770955 | 8055774843 | 220 |
| 973 | iso_pu_bacteria | 8055817908 | 8055821678 | 220 |
| 974 | iso_pu_bacteria | 8055878733 | 8055880867 | 220 |
| 975 | iso_pu_bacteria | 8056115690 | 8056118076 | 220 |
| 976 | iso_pu_bacteria | 8056120720 | 8056122714 | 220 |
| 977 | iso_pu_bacteria | 8056125926 | 8056129741 | 220 |
| 978 | iso_pu_bacteria | 8056131705 | 8056135346 | 220 |
| 979 | iso_pu_bacteria | 8056137416 | 8056141074 | 220 |
| 980 | iso_pu_bacteria | 8056143049 | 8056146942 | 220 |
| 981 | iso_pu_bacteria | 8056148874 | 8056154323 | 220 |
| 982 | iso_pu_bacteria | 8056155041 | 8056160281 | 220 |
| 983 | iso_pu_bacteria | 8056161164 | 8056165442 | 220 |
| 984 | iso_pu_bacteria | 8056166840 | 8056167655 | 220 |
| 985 | iso_pu_bacteria | 8056172158 | 8056173669 | 220 |
| 986 | iso_pu_bacteria | 8056177738 | 8056183872 | 220 |
| 987 | iso_pu_bacteria | 8056569372 | 8056573606 | 220 |
| 988 | iso_pu_bacteria | 8057160832 | 8057163440 | 220 |
| 989 | iso_pu_bacteria | 8057304971 | 8057306773 | 220 |
| 990 | iso_pu_bacteria | 8057798959 | 8057801377 | 220 |
| 991 | 3300005353 | Ga0070669_100442327 | Ga0070669_1004423272 | 221 |
| 992 | 3300005719 | Ga0068861_100292923 | Ga0068861_1002929232 | 221 |
| 993 | 3300005841 | Ga0068863_100014553 | Ga0068863_1000145532 | 221 |
| 994 | 3300005843 | Ga0068860_100397565 | Ga0068860_1003975652 | 221 |
| 995 | 3300005844 | Ga0068862_100235134 | Ga0068862_1002351341 | 221 |
| 996 | 3300005844 | Ga0068862_100277796 | Ga0068862_1002777962 | 221 |
| 997 | 3300009553 | Ga0105249_10084861 | Ga0105249_100848612 | 221 |
| 998 | 3300013306 | Ga0163162_10151120 | Ga0163162_101511201 | 221 |
| 999 | 3300013308 | Ga0157375_10200618 | Ga0157375_102006182 | 221 |
| 1000 | 3300025961 | Ga0207712_10263888 | Ga0207712_102638882 | 221 |
| 1001 | 3300025986 | Ga0207658_10278685 | Ga0207658_102786852 | 221 |
| 1002 | 3300026088 | Ga0207641_10058260 | Ga0207641_100582602 | 221 |
| 1003 | 3300028380 | Ga0268265_10364450 | Ga0268265_103644502 | 221 |
| 1004 | 3300005331 | Ga0070670_100000054 | Ga0070670_100000054102 | 222 |
| 1005 | 3300005335 | Ga0070666_10009694 | Ga0070666_100096945 | 222 |
| 1006 | 3300005353 | Ga0070669_100005396 | Ga0070669_1000053965 | 222 |
| 1007 | 3300005355 | Ga0070671_100000037 | Ga0070671_10000003776 | 222 |
| 1008 | 3300005365 | Ga0070688_100004371 | Ga0070688_1000043715 | 222 |
| 1009 | 3300005367 | Ga0070667_100000002 | Ga0070667_100000002456 | 222 |
| 1010 | 3300005466 | Ga0070685_10000014 | Ga0070685_1000001494 | 222 |
| 1011 | 3300005548 | Ga0070665_100027961 | Ga0070665_1000279616 | 222 |
| 1012 | 3300005577 | Ga0068857_100127973 | Ga0068857_1001279732 | 222 |
| 1013 | 3300005617 | Ga0068859_100049835 | Ga0068859_1000498353 | 222 |
| 1014 | 3300005618 | Ga0068864_100000002 | Ga0068864_10000000217 | 222 |
| 1015 | 3300005843 | Ga0068860_100348249 | Ga0068860_1003482491 | 222 |
| 1016 | 3300006931 | Ga0097620_100049833 | Ga0097620_1000498333 | 222 |
| 1017 | 3300009553 | Ga0105249_10017291 | Ga0105249_100172916 | 222 |
| 1018 | 3300013306 | Ga0163162_10150800 | Ga0163162_101508002 | 222 |
| 1019 | 3300014325 | Ga0163163_10000687 | Ga0163163_1000068724 | 222 |
| 1020 | 3300025903 | Ga0207680_10010111 | Ga0207680_100101116 | 222 |
| 1021 | 3300025923 | Ga0207681_10003927 | Ga0207681_100039275 | 222 |
| 1022 | 3300025925 | Ga0207650_10000002 | Ga0207650_1000000217 | 222 |
| 1023 | 3300025931 | Ga0207644_10000114 | Ga0207644_1000011420 | 222 |
| 1024 | 3300025941 | Ga0207711_10000540 | Ga0207711_1000054026 | 222 |
| 1025 | 3300025986 | Ga0207658_10000001 | Ga0207658_100000011337 | 222 |
| 1026 | 3300026035 | Ga0207703_10139240 | Ga0207703_101392404 | 222 |
| 1027 | 3300026088 | Ga0207641_10034576 | Ga0207641_100345762 | 222 |
| 1028 | 3300026095 | Ga0207676_10000001 | Ga0207676_1000000117 | 222 |
| 1029 | 3300026116 | Ga0207674_10362769 | Ga0207674_103627692 | 222 |
| 1030 | 3300028380 | Ga0268265_10001710 | Ga0268265_1000171015 | 222 |
| 1031 | 3300028381 | Ga0268264_10000004 | Ga0268264_1000000416 | 222 |
| 1032 | 3300031250 | Ga0265331_10085094 | Ga0265331_100850941 | 222 |
| 1033 | 3300031251 | Ga0265327_10000068 | Ga0265327_1000006852 | 222 |
| 1034 | 3300049571 | Ga0501034_0456501 | Ga0501034_0456501_444_1112 | 222 |
| 1035 | 3300049573 | Ga0501037_0105348 | Ga0501037_0105348_1248_1916 | 222 |
| 1036 | 3300049581 | Ga0501047_0147036 | Ga0501047_0147036_814_1587 | 222 |
| 1037 | 3300049822 | Ga0501035_0058356 | Ga0501035_0058356_1831_2499 | 222 |
| 1038 | 3300049823 | Ga0501044_0415624 | Ga0501044_0415624_62_730 | 222 |
| 1039 | 3300053098 | Ga0500650_0000029 | Ga0500650_0000029_52761_53429 | 222 |
| 1040 | 2162886007 | SwRhRL2b_contig_297133 | SwRhRL2b_0614.00001780 | 223 |
| 1041 | 3300005272 | Ga0065703_1000185 | Ga0065703_10001857 | 223 |
| 1042 | 3300005289 | Ga0065704_10014544 | Ga0065704_100145443 | 223 |
| 1043 | 3300005353 | Ga0070669_100004838 | Ga0070669_1000048385 | 223 |
| 1044 | 3300005548 | Ga0070665_100012924 | Ga0070665_1000129243 | 223 |
| 1045 | 3300006051 | Ga0075364_10093100 | Ga0075364_100931002 | 223 |
| 1046 | 3300009011 | Ga0105251_10051689 | Ga0105251_100516892 | 223 |
| 1047 | 3300009036 | Ga0105244_10073265 | Ga0105244_100732652 | 223 |
| 1048 | 3300009093 | Ga0105240_10016586 | Ga0105240_100165865 | 223 |
| 1049 | 3300009101 | Ga0105247_10003341 | Ga0105247_100033416 | 223 |
| 1050 | 3300009148 | Ga0105243_10000123 | Ga0105243_100001238 | 223 |
| 1051 | 3300025711 | Ga0207696_1003770 | Ga0207696_10037705 | 223 |
| 1052 | 3300025728 | Ga0207655_1041602 | Ga0207655_10416022 | 223 |
| 1053 | 3300025735 | Ga0207713_1001290 | Ga0207713_100129015 | 223 |
| 1054 | 3300025900 | Ga0207710_10000057 | Ga0207710_1000005789 | 223 |
| 1055 | 3300025913 | Ga0207695_10052355 | Ga0207695_100523554 | 223 |
| 1056 | 3300025923 | Ga0207681_10009509 | Ga0207681_100095094 | 223 |
| 1057 | 3300025935 | Ga0207709_10000057 | Ga0207709_10000057110 | 223 |
| 1058 | 3300027312 | Ga0209371_1000074 | Ga0209371_100007486 | 223 |
| 1059 | 3300028379 | Ga0268266_10008882 | Ga0268266_100088825 | 223 |
| 1060 | 3300030500 | Ga0268256_1000067 | Ga0268256_100006786 | 223 |
| 1061 | 3300031251 | Ga0265327_10000014 | Ga0265327_10000014260 | 223 |
| 1062 | 3300048920 | Ga0496117_0118344 | Ga0496117_0118344_183_854 | 223 |
| 1063 | 3300049822 | Ga0501035_0290828 | Ga0501035_0290828_153_824 | 223 |
| 1064 | 3300049823 | Ga0501044_0001205 | Ga0501044_0001205_24403_25074 | 223 |
| 1065 | 3300002737 | JGI25162J39368_1000002 | JGI25162J39368_1000002392 | 224 |
| 1066 | 3300002737 | JGI25162J39368_1005314 | JGI25162J39368_10053142 | 224 |
| 1067 | 3300002738 | JGI25154J39366_1012551 | JGI25154J39366_10125511 | 224 |
| 1068 | 3300002771 | JGI25163J39215_1000024 | JGI25163J39215_100002431 | 224 |
| 1069 | 3300002771 | JGI25163J39215_1003812 | JGI25163J39215_10038122 | 224 |
| 1070 | 3300002772 | JGI25164J39214_1000006 | JGI25164J39214_1000006277 | 224 |
| 1071 | 3300002772 | JGI25164J39214_1000069 | JGI25164J39214_10000692 | 224 |
| 1072 | 3300002772 | JGI25164J39214_1000228 | JGI25164J39214_10002282 | 224 |
| 1073 | 3300002773 | JGI25152J39213_1000602 | JGI25152J39213_100060211 | 224 |
| 1074 | 3300003214 | JGI25165J46597_1000168 | JGI25165J46597_100016891 | 224 |
| 1075 | 3300003214 | JGI25165J46597_1000424 | JGI25165J46597_100042436 | 224 |
| 1076 | 3300003320 | rootH2_10052056 | rootH2_100520565 | 224 |
| 1077 | 3300003323 | rootH1_10005050 | rootH1_100050502 | 224 |
| 1078 | 3300003578 | Ga0006562J51391_1025316 | Ga0006562J51391_10253163 | 224 |
| 1079 | 3300003751 | Ga0055538_1000003 | Ga0055538_1000003392 | 224 |
| 1080 | 3300003751 | Ga0055538_1000088 | Ga0055538_100008861 | 224 |
| 1081 | 3300003752 | Ga0055539_1000003 | Ga0055539_1000003227 | 224 |
| 1082 | 3300003752 | Ga0055539_1000132 | Ga0055539_100013261 | 224 |
| 1083 | 3300003756 | Ga0055533_1000005 | Ga0055533_1000005227 | 224 |
| 1084 | 3300003756 | Ga0055533_1000135 | Ga0055533_100013561 | 224 |
| 1085 | 3300003758 | Ga0055532_1000178 | Ga0055532_100017824 | 224 |
| 1086 | 3300003759 | Ga0055525_1000005 | Ga0055525_1000005392 | 224 |
| 1087 | 3300003759 | Ga0055525_1000449 | Ga0055525_100044924 | 224 |
| 1088 | 3300003761 | Ga0055535_1016059 | Ga0055535_10160592 | 224 |
| 1089 | 3300003781 | Ga0055536_1015762 | Ga0055536_10157622 | 224 |
| 1090 | 3300003781 | Ga0055536_1022882 | Ga0055536_10228822 | 224 |
| 1091 | 3300003781 | Ga0055536_1024507 | Ga0055536_10245072 | 224 |
| 1092 | 3300003781 | Ga0055536_1031303 | Ga0055536_10313032 | 224 |
| 1093 | 3300003781 | Ga0055536_1049300 | Ga0055536_10493002 | 224 |
| 1094 | 3300003791 | Ga0055530_10021619 | Ga0055530_100216192 | 224 |
| 1095 | 3300003791 | Ga0055530_10023625 | Ga0055530_100236252 | 224 |
| 1096 | 3300003791 | Ga0055530_10049125 | Ga0055530_100491252 | 224 |
| 1097 | 3300003791 | Ga0055530_10060716 | Ga0055530_100607161 | 224 |
| 1098 | 3300003792 | Ga0055540_1005526 | Ga0055540_10055265 | 224 |
| 1099 | 3300003792 | Ga0055540_1013134 | Ga0055540_10131342 | 224 |
| 1100 | 3300003792 | Ga0055540_1020296 | Ga0055540_10202962 | 224 |
| 1101 | 3300003794 | Ga0055531_10004591 | Ga0055531_100045912 | 224 |
| 1102 | 3300003841 | Ga0055541_1000003 | Ga0055541_1000003392 | 224 |
| 1103 | 3300003841 | Ga0055541_1000087 | Ga0055541_100008724 | 224 |
| 1104 | 3300003856 | Ga0058692_1000092 | Ga0058692_100009233 | 224 |
| 1105 | 3300003856 | Ga0058692_1000734 | Ga0058692_10007344 | 224 |
| 1106 | 3300003856 | Ga0058692_1020156 | Ga0058692_10201562 | 224 |
| 1107 | 3300003856 | Ga0058692_1020519 | Ga0058692_10205191 | 224 |
| 1108 | 3300005272 | Ga0065703_1020317 | Ga0065703_10203172 | 224 |
| 1109 | 3300005288 | Ga0065714_10000291 | Ga0065714_100002912 | 224 |
| 1110 | 3300005288 | Ga0065714_10022500 | Ga0065714_100225001 | 224 |
| 1111 | 3300005288 | Ga0065714_10024032 | Ga0065714_100240322 | 224 |
| 1112 | 3300005288 | Ga0065714_10042677 | Ga0065714_100426772 | 224 |
| 1113 | 3300005289 | Ga0065704_10000641 | Ga0065704_100006416 | 224 |
| 1114 | 3300005289 | Ga0065704_10001523 | Ga0065704_100015231 | 224 |
| 1115 | 3300005289 | Ga0065704_10007486 | Ga0065704_100074861 | 224 |
| 1116 | 3300005289 | Ga0065704_10071962 | Ga0065704_1007196210 | 224 |
| 1117 | 3300005289 | Ga0065704_10110828 | Ga0065704_101108282 | 224 |
| 1118 | 3300005289 | Ga0065704_10314531 | Ga0065704_103145311 | 224 |
| 1119 | 3300005290 | Ga0065712_10085148 | Ga0065712_100851482 | 224 |
| 1120 | 3300005290 | Ga0065712_10090299 | Ga0065712_100902992 | 224 |
| 1121 | 3300005290 | Ga0065712_10166150 | Ga0065712_101661502 | 224 |
| 1122 | 3300005290 | Ga0065712_10177747 | Ga0065712_101777472 | 224 |
| 1123 | 3300005293 | Ga0065715_10009777 | Ga0065715_100097771 | 224 |
| 1124 | 3300005344 | Ga0070661_100000221 | Ga0070661_10000022112 | 224 |
| 1125 | 3300005353 | Ga0070669_100017073 | Ga0070669_1000170736 | 224 |
| 1126 | 3300005441 | Ga0070700_100440784 | Ga0070700_1004407841 | 224 |
| 1127 | 3300005456 | Ga0070678_100412312 | Ga0070678_1004123122 | 224 |
| 1128 | 3300005539 | Ga0068853_100067432 | Ga0068853_1000674323 | 224 |
| 1129 | 3300005548 | Ga0070665_100090630 | Ga0070665_1000906302 | 224 |
| 1130 | 3300005548 | Ga0070665_100117303 | Ga0070665_1001173032 | 224 |
| 1131 | 3300005548 | Ga0070665_100233214 | Ga0070665_1002332142 | 224 |
| 1132 | 3300005564 | Ga0070664_100001101 | Ga0070664_1000011018 | 224 |
| 1133 | 3300005577 | Ga0068857_100003218 | Ga0068857_1000032184 | 224 |
| 1134 | 3300005578 | Ga0068854_100078594 | Ga0068854_1000785942 | 224 |
| 1135 | 3300005834 | Ga0068851_10011603 | Ga0068851_100116034 | 224 |
| 1136 | 3300006048 | Ga0075363_100468782 | Ga0075363_1004687821 | 224 |
| 1137 | 3300006051 | Ga0075364_10072909 | Ga0075364_100729091 | 224 |
| 1138 | 3300006051 | Ga0075364_10085946 | Ga0075364_100859462 | 224 |
| 1139 | 3300006051 | Ga0075364_10216662 | Ga0075364_102166622 | 224 |
| 1140 | 3300006195 | Ga0075366_10005676 | Ga0075366_100056765 | 224 |
| 1141 | 3300006195 | Ga0075366_10091668 | Ga0075366_100916682 | 224 |
| 1142 | 3300006353 | Ga0075370_10230606 | Ga0075370_102306062 | 224 |
| 1143 | 3300006944 | Ga0099823_1000397 | Ga0099823_100039724 | 224 |
| 1144 | 3300006946 | Ga0079104_1000135 | Ga0079104_100013550 | 224 |
| 1145 | 3300006946 | Ga0079104_1000487 | Ga0079104_100048710 | 224 |
| 1146 | 3300006946 | Ga0079104_1001580 | Ga0079104_10015807 | 224 |
| 1147 | 3300006946 | Ga0079104_1002605 | Ga0079104_10026058 | 224 |
| 1148 | 3300006946 | Ga0079104_1002650 | Ga0079104_10026501 | 224 |
| 1149 | 3300006946 | Ga0079104_1006134 | Ga0079104_10061341 | 224 |
| 1150 | 3300006946 | Ga0079104_1028407 | Ga0079104_10284071 | 224 |
| 1151 | 3300006946 | Ga0079104_1073335 | Ga0079104_10733351 | 224 |
| 1152 | 3300006948 | Ga0099826_10012472 | Ga0099826_100124725 | 224 |
| 1153 | 3300009011 | Ga0105251_10000500 | Ga0105251_100005002 | 224 |
| 1154 | 3300009011 | Ga0105251_10000649 | Ga0105251_100006499 | 224 |
| 1155 | 3300009011 | Ga0105251_10002203 | Ga0105251_100022037 | 224 |
| 1156 | 3300009011 | Ga0105251_10002226 | Ga0105251_1000222612 | 224 |
| 1157 | 3300009011 | Ga0105251_10019937 | Ga0105251_100199371 | 224 |
| 1158 | 3300009011 | Ga0105251_10021742 | Ga0105251_100217423 | 224 |
| 1159 | 3300009011 | Ga0105251_10025169 | Ga0105251_100251691 | 224 |
| 1160 | 3300009011 | Ga0105251_10059723 | Ga0105251_100597232 | 224 |
| 1161 | 3300009011 | Ga0105251_10088202 | Ga0105251_100882022 | 224 |
| 1162 | 3300009011 | Ga0105251_10089046 | Ga0105251_100890462 | 224 |
| 1163 | 3300009011 | Ga0105251_10092604 | Ga0105251_100926042 | 224 |
| 1164 | 3300009011 | Ga0105251_10195998 | Ga0105251_101959982 | 224 |
| 1165 | 3300009036 | Ga0105244_10000246 | Ga0105244_1000024635 | 224 |
| 1166 | 3300009036 | Ga0105244_10000337 | Ga0105244_1000033728 | 224 |
| 1167 | 3300009036 | Ga0105244_10000342 | Ga0105244_100003424 | 224 |
| 1168 | 3300009036 | Ga0105244_10001474 | Ga0105244_1000147410 | 224 |
| 1169 | 3300009036 | Ga0105244_10002267 | Ga0105244_1000226711 | 224 |
| 1170 | 3300009036 | Ga0105244_10007923 | Ga0105244_100079234 | 224 |
| 1171 | 3300009036 | Ga0105244_10022204 | Ga0105244_100222043 | 224 |
| 1172 | 3300009036 | Ga0105244_10025529 | Ga0105244_100255292 | 224 |
| 1173 | 3300009036 | Ga0105244_10028040 | Ga0105244_100280402 | 224 |
| 1174 | 3300009036 | Ga0105244_10033494 | Ga0105244_100334942 | 224 |
| 1175 | 3300009036 | Ga0105244_10057283 | Ga0105244_100572832 | 224 |
| 1176 | 3300009036 | Ga0105244_10060740 | Ga0105244_100607402 | 224 |
| 1177 | 3300009036 | Ga0105244_10066137 | Ga0105244_100661372 | 224 |
| 1178 | 3300009036 | Ga0105244_10067245 | Ga0105244_100672452 | 224 |
| 1179 | 3300009036 | Ga0105244_10110909 | Ga0105244_101109093 | 224 |
| 1180 | 3300009036 | Ga0105244_10119654 | Ga0105244_101196541 | 224 |
| 1181 | 3300009036 | Ga0105244_10120223 | Ga0105244_101202232 | 224 |
| 1182 | 3300009036 | Ga0105244_10125113 | Ga0105244_101251131 | 224 |
| 1183 | 3300009036 | Ga0105244_10125660 | Ga0105244_101256601 | 224 |
| 1184 | 3300009092 | Ga0105250_10000007 | Ga0105250_10000007182 | 224 |
| 1185 | 3300009092 | Ga0105250_10000018 | Ga0105250_1000001875 | 224 |
| 1186 | 3300009092 | Ga0105250_10002387 | Ga0105250_100023874 | 224 |
| 1187 | 3300009092 | Ga0105250_10003285 | Ga0105250_100032852 | 224 |
| 1188 | 3300009092 | Ga0105250_10006776 | Ga0105250_100067762 | 224 |
| 1189 | 3300009092 | Ga0105250_10013064 | Ga0105250_100130644 | 224 |
| 1190 | 3300009092 | Ga0105250_10023962 | Ga0105250_100239622 | 224 |
| 1191 | 3300009092 | Ga0105250_10073013 | Ga0105250_100730132 | 224 |
| 1192 | 3300009101 | Ga0105247_10000416 | Ga0105247_1000041625 | 224 |
| 1193 | 3300009148 | Ga0105243_10000587 | Ga0105243_100005873 | 224 |
| 1194 | 3300009148 | Ga0105243_10040506 | Ga0105243_100405064 | 224 |
| 1195 | 3300009148 | Ga0105243_10068541 | Ga0105243_100685412 | 224 |
| 1196 | 3300009174 | Ga0105241_10000001 | Ga0105241_10000001693 | 224 |
| 1197 | 3300009176 | Ga0105242_10006800 | Ga0105242_100068006 | 224 |
| 1198 | 3300009176 | Ga0105242_10515440 | Ga0105242_105154402 | 224 |
| 1199 | 3300009177 | Ga0105248_10174768 | Ga0105248_101747683 | 224 |
| 1200 | 3300009545 | Ga0105237_10000582 | Ga0105237_1000058231 | 224 |
| 1201 | 3300009545 | Ga0105237_10274158 | Ga0105237_102741582 | 224 |
| 1202 | 3300011119 | Ga0105246_10086246 | Ga0105246_100862462 | 224 |
| 1203 | 3300011119 | Ga0105246_10139431 | Ga0105246_101394312 | 224 |
| 1204 | 3300011119 | Ga0105246_10146747 | Ga0105246_101467472 | 224 |
| 1205 | 3300011119 | Ga0105246_10949496 | Ga0105246_109494961 | 224 |
| 1206 | 3300011119 | Ga0105246_10949497 | Ga0105246_109494971 | 224 |
| 1207 | 3300013100 | Ga0157373_10000400 | Ga0157373_100004002 | 224 |
| 1208 | 3300013100 | Ga0157373_10003007 | Ga0157373_1000300710 | 224 |
| 1209 | 3300013100 | Ga0157373_10005419 | Ga0157373_100054196 | 224 |
| 1210 | 3300013100 | Ga0157373_10063017 | Ga0157373_100630172 | 224 |
| 1211 | 3300013100 | Ga0157373_10102302 | Ga0157373_101023022 | 224 |
| 1212 | 3300013100 | Ga0157373_10222974 | Ga0157373_102229742 | 224 |
| 1213 | 3300013102 | Ga0157371_10000006 | Ga0157371_10000006140 | 224 |
| 1214 | 3300013102 | Ga0157371_10000560 | Ga0157371_1000056021 | 224 |
| 1215 | 3300013102 | Ga0157371_10001683 | Ga0157371_1000168312 | 224 |
| 1216 | 3300013102 | Ga0157371_10002562 | Ga0157371_1000256215 | 224 |
| 1217 | 3300013102 | Ga0157371_10002986 | Ga0157371_1000298611 | 224 |
| 1218 | 3300013102 | Ga0157371_10016802 | Ga0157371_100168024 | 224 |
| 1219 | 3300013102 | Ga0157371_10043415 | Ga0157371_100434152 | 224 |
| 1220 | 3300013104 | Ga0157370_10000618 | Ga0157370_100006184 | 224 |
| 1221 | 3300013104 | Ga0157370_10000644 | Ga0157370_1000064426 | 224 |
| 1222 | 3300013104 | Ga0157370_10026206 | Ga0157370_100262062 | 224 |
| 1223 | 3300013104 | Ga0157370_10063557 | Ga0157370_100635571 | 224 |
| 1224 | 3300013104 | Ga0157370_10121597 | Ga0157370_101215972 | 224 |
| 1225 | 3300013104 | Ga0157370_10254613 | Ga0157370_102546132 | 224 |
| 1226 | 3300013104 | Ga0157370_10733782 | Ga0157370_107337821 | 224 |
| 1227 | 3300013105 | Ga0157369_10000375 | Ga0157369_100003754 | 224 |
| 1228 | 3300013105 | Ga0157369_10001060 | Ga0157369_1000106031 | 224 |
| 1229 | 3300013306 | Ga0163162_10022107 | Ga0163162_100221072 | 224 |
| 1230 | 3300013307 | Ga0157372_10001955 | Ga0157372_1000195510 | 224 |
| 1231 | 3300013307 | Ga0157372_10002168 | Ga0157372_1000216810 | 224 |
| 1232 | 3300013307 | Ga0157372_10016311 | Ga0157372_100163115 | 224 |
| 1233 | 3300013307 | Ga0157372_10021477 | Ga0157372_100214774 | 224 |
| 1234 | 3300013307 | Ga0157372_10062065 | Ga0157372_100620653 | 224 |
| 1235 | 3300013307 | Ga0157372_10144931 | Ga0157372_101449311 | 224 |
| 1236 | 3300013307 | Ga0157372_10144933 | Ga0157372_101449331 | 224 |
| 1237 | 3300013308 | Ga0157375_10662900 | Ga0157375_106629002 | 224 |
| 1238 | 3300014497 | Ga0182008_10001623 | Ga0182008_100016232 | 224 |
| 1239 | 3300014497 | Ga0182008_10029374 | Ga0182008_100293743 | 224 |
| 1240 | 3300015261 | Ga0182006_1000024 | Ga0182006_100002411 | 224 |
| 1241 | 3300015261 | Ga0182006_1014014 | Ga0182006_10140143 | 224 |
| 1242 | 3300015261 | Ga0182006_1023446 | Ga0182006_10234464 | 224 |
| 1243 | 3300015261 | Ga0182006_1035307 | Ga0182006_10353072 | 224 |
| 1244 | 3300015262 | Ga0182007_10048505 | Ga0182007_100485052 | 224 |
| 1245 | 3300015262 | Ga0182007_10062034 | Ga0182007_100620341 | 224 |
| 1246 | 3300015265 | Ga0182005_1093785 | Ga0182005_10937851 | 224 |
| 1247 | 3300015679 | Ga0183366_1001 | Ga0183366_10012382 | 224 |
| 1248 | 3300015680 | Ga0183370_1001 | Ga0183370_10012382 | 224 |
| 1249 | 3300015685 | Ga0183369_1001 | Ga0183369_10012383 | 224 |
| 1250 | 3300015687 | Ga0183368_1001 | Ga0183368_10012382 | 224 |
| 1251 | 3300017792 | Ga0163161_10000003 | Ga0163161_10000003186 | 224 |
| 1252 | 3300017792 | Ga0163161_10034504 | Ga0163161_100345043 | 224 |
| 1253 | 3300017792 | Ga0163161_10095441 | Ga0163161_100954412 | 224 |
| 1254 | 3300017792 | Ga0163161_10231290 | Ga0163161_102312902 | 224 |
| 1255 | 3300017792 | Ga0163161_10563445 | Ga0163161_105634451 | 224 |
| 1256 | 3300021384 | Ga0213876_10000023 | Ga0213876_1000002367 | 224 |
| 1257 | 3300025206 | Ga0209435_103421 | Ga0209435_1034212 | 224 |
| 1258 | 3300025207 | Ga0209760_100018 | Ga0209760_100018161 | 224 |
| 1259 | 3300025207 | Ga0209760_100089 | Ga0209760_10008926 | 224 |
| 1260 | 3300025207 | Ga0209760_100093 | Ga0209760_10009316 | 224 |
| 1261 | 3300025224 | Ga0209784_100001 | Ga0209784_1000012986 | 224 |
| 1262 | 3300025224 | Ga0209784_100126 | Ga0209784_10012624 | 224 |
| 1263 | 3300025225 | Ga0209566_100001 | Ga0209566_1000012986 | 224 |
| 1264 | 3300025225 | Ga0209566_100152 | Ga0209566_10015224 | 224 |
| 1265 | 3300025226 | Ga0209674_100002 | Ga0209674_1000022986 | 224 |
| 1266 | 3300025226 | Ga0209674_100177 | Ga0209674_10017724 | 224 |
| 1267 | 3300025229 | Ga0209147_100179 | Ga0209147_10017924 | 224 |
| 1268 | 3300025230 | Ga0209563_100002 | Ga0209563_1000021521 | 224 |
| 1269 | 3300025230 | Ga0209563_100142 | Ga0209563_10014224 | 224 |
| 1270 | 3300025230 | Ga0209563_101212 | Ga0209563_1012126 | 224 |
| 1271 | 3300025231 | Ga0207427_100009 | Ga0207427_100009387 | 224 |
| 1272 | 3300025231 | Ga0207427_100011 | Ga0207427_100011206 | 224 |
| 1273 | 3300025231 | Ga0207427_100015 | Ga0207427_100015347 | 224 |
| 1274 | 3300025233 | Ga0209437_100001 | Ga0209437_1000011521 | 224 |
| 1275 | 3300025233 | Ga0209437_100027 | Ga0209437_100027168 | 224 |
| 1276 | 3300025233 | Ga0209437_100044 | Ga0209437_100044206 | 224 |
| 1277 | 3300025233 | Ga0209437_100103 | Ga0209437_10010397 | 224 |
| 1278 | 3300025242 | Ga0209258_100366 | Ga0209258_10036652 | 224 |
| 1279 | 3300025246 | Ga0209646_1000380 | Ga0209646_100038024 | 224 |
| 1280 | 3300025253 | Ga0209677_100002 | Ga0209677_1000021521 | 224 |
| 1281 | 3300025253 | Ga0209677_100125 | Ga0209677_10012524 | 224 |
| 1282 | 3300025256 | Ga0209759_1001848 | Ga0209759_10018484 | 224 |
| 1283 | 3300025256 | Ga0209759_1021634 | Ga0209759_10216342 | 224 |
| 1284 | 3300025258 | Ga0209129_1000037 | Ga0209129_1000037187 | 224 |
| 1285 | 3300025261 | Ga0209233_1000039 | Ga0209233_1000039347 | 224 |
| 1286 | 3300025261 | Ga0209233_1000057 | Ga0209233_1000057206 | 224 |
| 1287 | 3300025261 | Ga0209233_1001125 | Ga0209233_10011252 | 224 |
| 1288 | 3300025291 | Ga0209675_1004567 | Ga0209675_10045672 | 224 |
| 1289 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002333 | 224 |
| 1290 | 3300025292 | Ga0209676_1000017 | Ga0209676_1000017312 | 224 |
| 1291 | 3300025292 | Ga0209676_1000696 | Ga0209676_100069632 | 224 |
| 1292 | 3300025292 | Ga0209676_1004220 | Ga0209676_10042206 | 224 |
| 1293 | 3300025292 | Ga0209676_1055738 | Ga0209676_10557381 | 224 |
| 1294 | 3300025298 | Ga0209050_1000037 | Ga0209050_1000037346 | 224 |
| 1295 | 3300025298 | Ga0209050_1025723 | Ga0209050_10257233 | 224 |
| 1296 | 3300025298 | Ga0209050_1026442 | Ga0209050_10264422 | 224 |
| 1297 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001333 | 224 |
| 1298 | 3300025303 | Ga0209051_1000666 | Ga0209051_100066625 | 224 |
| 1299 | 3300025303 | Ga0209051_1033587 | Ga0209051_10335872 | 224 |
| 1300 | 3300025304 | Ga0209257_1000056 | Ga0209257_10000562 | 224 |
| 1301 | 3300025304 | Ga0209257_1019138 | Ga0209257_10191382 | 224 |
| 1302 | 3300025321 | Ga0207656_10004868 | Ga0207656_100048684 | 224 |
| 1303 | 3300025321 | Ga0207656_10043071 | Ga0207656_100430712 | 224 |
| 1304 | 3300025711 | Ga0207696_1000001 | Ga0207696_10000012331 | 224 |
| 1305 | 3300025711 | Ga0207696_1000013 | Ga0207696_1000013333 | 224 |
| 1306 | 3300025711 | Ga0207696_1000029 | Ga0207696_1000029217 | 224 |
| 1307 | 3300025711 | Ga0207696_1000081 | Ga0207696_100008184 | 224 |
| 1308 | 3300025711 | Ga0207696_1000117 | Ga0207696_100011734 | 224 |
| 1309 | 3300025711 | Ga0207696_1000124 | Ga0207696_100012452 | 224 |
| 1310 | 3300025711 | Ga0207696_1000147 | Ga0207696_1000147107 | 224 |
| 1311 | 3300025711 | Ga0207696_1000185 | Ga0207696_100018537 | 224 |
| 1312 | 3300025711 | Ga0207696_1000275 | Ga0207696_10002757 | 224 |
| 1313 | 3300025711 | Ga0207696_1000766 | Ga0207696_100076618 | 224 |
| 1314 | 3300025711 | Ga0207696_1001267 | Ga0207696_100126713 | 224 |
| 1315 | 3300025711 | Ga0207696_1011700 | Ga0207696_10117003 | 224 |
| 1316 | 3300025711 | Ga0207696_1032044 | Ga0207696_10320441 | 224 |
| 1317 | 3300025728 | Ga0207655_1000002 | Ga0207655_1000002259 | 224 |
| 1318 | 3300025728 | Ga0207655_1000004 | Ga0207655_1000004247 | 224 |
| 1319 | 3300025728 | Ga0207655_1000007 | Ga0207655_1000007585 | 224 |
| 1320 | 3300025728 | Ga0207655_1000041 | Ga0207655_100004174 | 224 |
| 1321 | 3300025728 | Ga0207655_1000062 | Ga0207655_10000626 | 224 |
| 1322 | 3300025728 | Ga0207655_1000094 | Ga0207655_100009424 | 224 |
| 1323 | 3300025728 | Ga0207655_1000115 | Ga0207655_100011558 | 224 |
| 1324 | 3300025728 | Ga0207655_1000205 | Ga0207655_100020545 | 224 |
| 1325 | 3300025728 | Ga0207655_1000540 | Ga0207655_100054020 | 224 |
| 1326 | 3300025728 | Ga0207655_1000769 | Ga0207655_10007693 | 224 |
| 1327 | 3300025728 | Ga0207655_1003638 | Ga0207655_10036384 | 224 |
| 1328 | 3300025728 | Ga0207655_1006042 | Ga0207655_10060428 | 224 |
| 1329 | 3300025728 | Ga0207655_1007903 | Ga0207655_10079035 | 224 |
| 1330 | 3300025728 | Ga0207655_1011548 | Ga0207655_10115482 | 224 |
| 1331 | 3300025728 | Ga0207655_1011844 | Ga0207655_10118444 | 224 |
| 1332 | 3300025728 | Ga0207655_1013784 | Ga0207655_10137844 | 224 |
| 1333 | 3300025728 | Ga0207655_1014509 | Ga0207655_10145093 | 224 |
| 1334 | 3300025728 | Ga0207655_1019433 | Ga0207655_10194332 | 224 |
| 1335 | 3300025728 | Ga0207655_1019756 | Ga0207655_10197562 | 224 |
| 1336 | 3300025728 | Ga0207655_1020977 | Ga0207655_10209774 | 224 |
| 1337 | 3300025728 | Ga0207655_1026768 | Ga0207655_10267683 | 224 |
| 1338 | 3300025728 | Ga0207655_1033923 | Ga0207655_10339233 | 224 |
| 1339 | 3300025728 | Ga0207655_1096446 | Ga0207655_10964462 | 224 |
| 1340 | 3300025735 | Ga0207713_1000001 | Ga0207713_10000011832 | 224 |
| 1341 | 3300025735 | Ga0207713_1000023 | Ga0207713_100002395 | 224 |
| 1342 | 3300025735 | Ga0207713_1000083 | Ga0207713_1000083118 | 224 |
| 1343 | 3300025735 | Ga0207713_1000208 | Ga0207713_10002087 | 224 |
| 1344 | 3300025735 | Ga0207713_1000241 | Ga0207713_100024168 | 224 |
| 1345 | 3300025735 | Ga0207713_1000397 | Ga0207713_100039711 | 224 |
| 1346 | 3300025735 | Ga0207713_1001368 | Ga0207713_100136820 | 224 |
| 1347 | 3300025735 | Ga0207713_1001926 | Ga0207713_10019267 | 224 |
| 1348 | 3300025735 | Ga0207713_1002140 | Ga0207713_100214010 | 224 |
| 1349 | 3300025735 | Ga0207713_1006051 | Ga0207713_10060518 | 224 |
| 1350 | 3300025735 | Ga0207713_1006520 | Ga0207713_10065204 | 224 |
| 1351 | 3300025735 | Ga0207713_1006730 | Ga0207713_10067306 | 224 |
| 1352 | 3300025735 | Ga0207713_1011365 | Ga0207713_10113655 | 224 |
| 1353 | 3300025735 | Ga0207713_1015136 | Ga0207713_10151362 | 224 |
| 1354 | 3300025735 | Ga0207713_1022789 | Ga0207713_10227893 | 224 |
| 1355 | 3300025735 | Ga0207713_1046537 | Ga0207713_10465372 | 224 |
| 1356 | 3300025735 | Ga0207713_1048315 | Ga0207713_10483153 | 224 |
| 1357 | 3300025735 | Ga0207713_1050065 | Ga0207713_10500652 | 224 |
| 1358 | 3300025900 | Ga0207710_10000116 | Ga0207710_100001162 | 224 |
| 1359 | 3300025911 | Ga0207654_10000004 | Ga0207654_10000004721 | 224 |
| 1360 | 3300025913 | Ga0207695_10092453 | Ga0207695_100924532 | 224 |
| 1361 | 3300025914 | Ga0207671_10002402 | Ga0207671_1000240215 | 224 |
| 1362 | 3300025914 | Ga0207671_10259363 | Ga0207671_102593632 | 224 |
| 1363 | 3300025920 | Ga0207649_10000091 | Ga0207649_1000009143 | 224 |
| 1364 | 3300025923 | Ga0207681_10012158 | Ga0207681_100121584 | 224 |
| 1365 | 3300025925 | Ga0207650_10196516 | Ga0207650_101965162 | 224 |
| 1366 | 3300025933 | Ga0207706_10005988 | Ga0207706_100059889 | 224 |
| 1367 | 3300025934 | Ga0207686_10404358 | Ga0207686_104043582 | 224 |
| 1368 | 3300025935 | Ga0207709_10000014 | Ga0207709_10000014371 | 224 |
| 1369 | 3300025935 | Ga0207709_10044337 | Ga0207709_100443373 | 224 |
| 1370 | 3300025935 | Ga0207709_10045254 | Ga0207709_100452542 | 224 |
| 1371 | 3300025945 | Ga0207679_10000016 | Ga0207679_10000016191 | 224 |
| 1372 | 3300025961 | Ga0207712_10035652 | Ga0207712_100356522 | 224 |
| 1373 | 3300025972 | Ga0207668_10056646 | Ga0207668_100566462 | 224 |
| 1374 | 3300025981 | Ga0207640_10066017 | Ga0207640_100660173 | 224 |
| 1375 | 3300026041 | Ga0207639_10042648 | Ga0207639_100426483 | 224 |
| 1376 | 3300026075 | Ga0207708_10339945 | Ga0207708_103399452 | 224 |
| 1377 | 3300026116 | Ga0207674_10006670 | Ga0207674_100066708 | 224 |
| 1378 | 3300027111 | Ga0209281_1000004 | Ga0209281_1000004217 | 224 |
| 1379 | 3300027111 | Ga0209281_1000038 | Ga0209281_1000038191 | 224 |
| 1380 | 3300027111 | Ga0209281_1000073 | Ga0209281_1000073222 | 224 |
| 1381 | 3300027111 | Ga0209281_1000095 | Ga0209281_1000095189 | 224 |
| 1382 | 3300027111 | Ga0209281_1000219 | Ga0209281_100021984 | 224 |
| 1383 | 3300027111 | Ga0209281_1000245 | Ga0209281_100024517 | 224 |
| 1384 | 3300027111 | Ga0209281_1000286 | Ga0209281_100028688 | 224 |
| 1385 | 3300027111 | Ga0209281_1000523 | Ga0209281_100052332 | 224 |
| 1386 | 3300027111 | Ga0209281_1001391 | Ga0209281_10013919 | 224 |
| 1387 | 3300027111 | Ga0209281_1001556 | Ga0209281_10015567 | 224 |
| 1388 | 3300027111 | Ga0209281_1014319 | Ga0209281_10143191 | 224 |
| 1389 | 3300027111 | Ga0209281_1034725 | Ga0209281_10347251 | 224 |
| 1390 | 3300027296 | Ga0209389_1000059 | Ga0209389_100005938 | 224 |
| 1391 | 3300027312 | Ga0209371_1000001 | Ga0209371_10000012374 | 224 |
| 1392 | 3300027312 | Ga0209371_1000005 | Ga0209371_1000005904 | 224 |
| 1393 | 3300027312 | Ga0209371_1000015 | Ga0209371_1000015295 | 224 |
| 1394 | 3300027312 | Ga0209371_1000108 | Ga0209371_100010830 | 224 |
| 1395 | 3300027312 | Ga0209371_1000118 | Ga0209371_100011892 | 224 |
| 1396 | 3300027312 | Ga0209371_1000559 | Ga0209371_10005596 | 224 |
| 1397 | 3300027312 | Ga0209371_1000623 | Ga0209371_10006238 | 224 |
| 1398 | 3300027312 | Ga0209371_1001065 | Ga0209371_100106518 | 224 |
| 1399 | 3300027312 | Ga0209371_1001486 | Ga0209371_100148610 | 224 |
| 1400 | 3300027312 | Ga0209371_1001911 | Ga0209371_10019115 | 224 |
| 1401 | 3300027312 | Ga0209371_1001929 | Ga0209371_100192912 | 224 |
| 1402 | 3300027312 | Ga0209371_1003423 | Ga0209371_10034238 | 224 |
| 1403 | 3300027312 | Ga0209371_1005379 | Ga0209371_10053792 | 224 |
| 1404 | 3300027312 | Ga0209371_1005669 | Ga0209371_10056692 | 224 |
| 1405 | 3300027312 | Ga0209371_1005973 | Ga0209371_10059734 | 224 |
| 1406 | 3300027312 | Ga0209371_1008915 | Ga0209371_10089153 | 224 |
| 1407 | 3300027312 | Ga0209371_1039405 | Ga0209371_10394052 | 224 |
| 1408 | 3300027312 | Ga0209371_1047394 | Ga0209371_10473941 | 224 |
| 1409 | 3300027360 | Ga0209969_1038876 | Ga0209969_10388761 | 224 |
| 1410 | 3300027395 | Ga0209996_1001408 | Ga0209996_10014082 | 224 |
| 1411 | 3300027471 | Ga0209995_1002861 | Ga0209995_10028612 | 224 |
| 1412 | 3300027526 | Ga0209968_1017603 | Ga0209968_10176032 | 224 |
| 1413 | 3300027543 | Ga0209999_1000815 | Ga0209999_10008155 | 224 |
| 1414 | 3300027543 | Ga0209999_1003362 | Ga0209999_10033622 | 224 |
| 1415 | 3300027552 | Ga0209982_1000570 | Ga0209982_10005702 | 224 |
| 1416 | 3300027617 | Ga0210002_1014314 | Ga0210002_10143142 | 224 |
| 1417 | 3300027665 | Ga0209983_1008056 | Ga0209983_10080562 | 224 |
| 1418 | 3300027682 | Ga0209971_1002760 | Ga0209971_10027604 | 224 |
| 1419 | 3300027876 | Ga0209974_10011293 | Ga0209974_100112932 | 224 |
| 1420 | 3300027876 | Ga0209974_10020683 | Ga0209974_100206833 | 224 |
| 1421 | 3300027907 | Ga0207428_10307440 | Ga0207428_103074402 | 224 |
| 1422 | 3300028379 | Ga0268266_10000922 | Ga0268266_100009228 | 224 |
| 1423 | 3300028379 | Ga0268266_10014247 | Ga0268266_100142473 | 224 |
| 1424 | 3300028573 | Ga0265334_10000027 | Ga0265334_1000002722 | 224 |
| 1425 | 3300030500 | Ga0268256_1000001 | Ga0268256_1000001266 | 224 |
| 1426 | 3300030500 | Ga0268256_1000006 | Ga0268256_1000006153 | 224 |
| 1427 | 3300030500 | Ga0268256_1000018 | Ga0268256_1000018329 | 224 |
| 1428 | 3300030500 | Ga0268256_1000035 | Ga0268256_10000351 | 224 |
| 1429 | 3300030500 | Ga0268256_1000076 | Ga0268256_1000076171 | 224 |
| 1430 | 3300030500 | Ga0268256_1000100 | Ga0268256_100010092 | 224 |
| 1431 | 3300030500 | Ga0268256_1001225 | Ga0268256_100122512 | 224 |
| 1432 | 3300030500 | Ga0268256_1001273 | Ga0268256_10012735 | 224 |
| 1433 | 3300030500 | Ga0268256_1002311 | Ga0268256_10023118 | 224 |
| 1434 | 3300030500 | Ga0268256_1003145 | Ga0268256_10031455 | 224 |
| 1435 | 3300030500 | Ga0268256_1005534 | Ga0268256_10055344 | 224 |
| 1436 | 3300030500 | Ga0268256_1005606 | Ga0268256_10056063 | 224 |
| 1437 | 3300030500 | Ga0268256_1009434 | Ga0268256_10094343 | 224 |
| 1438 | 3300030500 | Ga0268256_1009898 | Ga0268256_10098983 | 224 |
| 1439 | 3300030500 | Ga0268256_1012362 | Ga0268256_10123622 | 224 |
| 1440 | 3300030500 | Ga0268256_1019408 | Ga0268256_10194082 | 224 |
| 1441 | 3300030733 | Ga0314311_1177641 | Ga0314311_11776415 | 224 |
| 1442 | 3300030742 | Ga0316183_1021560 | Ga0316183_10215602 | 224 |
| 1443 | 3300030744 | Ga0316181_1094953 | Ga0316181_10949531 | 224 |
| 1444 | 3300031548 | Ga0307408_100000004 | Ga0307408_100000004562 | 224 |
| 1445 | 3300032004 | Ga0307414_10354090 | Ga0307414_103540902 | 224 |
| 1446 | 3300033180 | Ga0307510_10149283 | Ga0307510_101492832 | 224 |
| 1447 | 3300038705 | Ga0237819_01448 | Ga0237819_01448_2290_2964 | 224 |
| 1448 | 3300039437 | Ga0436365_0965775 | Ga0436365_0965775_79983_80657 | 224 |
| 1449 | 3300041404 | Ga0439436_0009562 | Ga0439436_0009562_1005_1682 | 224 |
| 1450 | 3300041405 | Ga0439438_000002 | Ga0439438_000002_347874_348551 | 224 |
| 1451 | 3300041405 | Ga0439438_005231 | Ga0439438_005231_806_1480 | 224 |
| 1452 | 3300041405 | Ga0439438_010532 | Ga0439438_010532_1867_2544 | 224 |
| 1453 | 3300041405 | Ga0439438_013436 | Ga0439438_013436_696_1370 | 224 |
| 1454 | 3300041405 | Ga0439438_039147 | Ga0439438_039147_469_1143 | 224 |
| 1455 | 3300041407 | Ga0439447_000766 | Ga0439447_000766_9870_10547 | 224 |
| 1456 | 3300041407 | Ga0439447_001765 | Ga0439447_001765_5912_6589 | 224 |
| 1457 | 3300041407 | Ga0439447_004016 | Ga0439447_004016_3862_4536 | 224 |
| 1458 | 3300041411 | Ga0439466_0000001 | Ga0439466_0000001_402950_403627 | 224 |
| 1459 | 3300041411 | Ga0439466_0043834 | Ga0439466_0043834_168_845 | 224 |
| 1460 | 3300041486 | Ga0451807_2221466 | Ga0451807_2221466_266_940 | 224 |
| 1461 | 3300041512 | Ga0451853_3687995 | Ga0451853_3687995_920_1597 | 224 |
| 1462 | 3300042000 | Ga0439437_001932 | Ga0439437_001932_598_1275 | 224 |
| 1463 | 3300042006 | Ga0439432_006455 | Ga0439432_006455_1114_1788 | 224 |
| 1464 | 3300042006 | Ga0439432_008550 | Ga0439432_008550_1408_2085 | 224 |
| 1465 | 3300042006 | Ga0439432_019197 | Ga0439432_019197_831_1508 | 224 |
| 1466 | 3300042010 | Ga0439452_000002 | Ga0439452_000002_243396_244070 | 224 |
| 1467 | 3300042010 | Ga0439452_000015 | Ga0439452_000015_38423_39100 | 224 |
| 1468 | 3300042010 | Ga0439452_000020 | Ga0439452_000020_23668_24342 | 224 |
| 1469 | 3300042010 | Ga0439452_002528 | Ga0439452_002528_3973_4647 | 224 |
| 1470 | 3300042010 | Ga0439452_003897 | Ga0439452_003897_400_1074 | 224 |
| 1471 | 3300042010 | Ga0439452_010867 | Ga0439452_010867_748_1425 | 224 |
| 1472 | 3300042010 | Ga0439452_013703 | Ga0439452_013703_583_1260 | 224 |
| 1473 | 3300042013 | Ga0439456_002909 | Ga0439456_002909_1970_2647 | 224 |
| 1474 | 3300042016 | Ga0439463_008014 | Ga0439463_008014_996_1673 | 224 |
| 1475 | 3300042115 | Ga0450911_000013 | Ga0450911_000013_1694_2371 | 224 |
| 1476 | 3300042129 | Ga0450891_003387 | Ga0450891_003387_164_841 | 224 |
| 1477 | 3300042136 | Ga0450900_006691 | Ga0450900_006691_70_747 | 224 |
| 1478 | 3300042139 | Ga0450904_000563 | Ga0450904_000563_3202_3879 | 224 |
| 1479 | 3300042142 | Ga0450905_003201 | Ga0450905_003201_1008_1685 | 224 |
| 1480 | 3300042146 | Ga0450907_001332 | Ga0450907_001332_1824_2501 | 224 |
| 1481 | 3300042439 | Ga0439464_0001265 | Ga0439464_0001265_1401_2078 | 224 |
| 1482 | 3300042439 | Ga0439464_0008628 | Ga0439464_0008628_981_1658 | 224 |
| 1483 | 3300042439 | Ga0439464_0009525 | Ga0439464_0009525_667_1344 | 224 |
| 1484 | 3300042530 | Ga0450916_008641 | Ga0450916_008641_541_1218 | 224 |
| 1485 | 3300042533 | Ga0450901_001122 | Ga0450901_001122_602_1279 | 224 |
| 1486 | 3300044669 | Ga0466981_0000013 | Ga0466981_0000013_90286_90960 | 224 |
| 1487 | 3300046453 | Ga0495627_001293 | Ga0495627_001293_777_1451 | 224 |
| 1488 | 3300046453 | Ga0495627_002814 | Ga0495627_002814_1605_2279 | 224 |
| 1489 | 3300046453 | Ga0495627_004099 | Ga0495627_004099_994_1668 | 224 |
| 1490 | 3300046453 | Ga0495627_011664 | Ga0495627_011664_683_1357 | 224 |
| 1491 | 3300046457 | Ga0495590_0065519 | Ga0495590_0065519_578_1252 | 224 |
| 1492 | 3300046458 | Ga0495591_000001 | Ga0495591_000001_314214_314894 | 224 |
| 1493 | 3300046458 | Ga0495591_000294 | Ga0495591_000294_34470_35144 | 224 |
| 1494 | 3300046458 | Ga0495591_002693 | Ga0495591_002693_5612_6286 | 224 |
| 1495 | 3300046458 | Ga0495591_003463 | Ga0495591_003463_1533_2207 | 224 |
| 1496 | 3300046458 | Ga0495591_018161 | Ga0495591_018161_650_1324 | 224 |
| 1497 | 3300046458 | Ga0495591_019023 | Ga0495591_019023_1003_1680 | 224 |
| 1498 | 3300046458 | Ga0495591_022970 | Ga0495591_022970_1120_1794 | 224 |
| 1499 | 3300046463 | Ga0495653_0096886 | Ga0495653_0096886_760_1434 | 224 |
| 1500 | 3300046471 | Ga0495650_0000018 | Ga0495650_0000018_63504_64178 | 224 |
| 1501 | 3300046471 | Ga0495650_0000047 | Ga0495650_0000047_59579_60253 | 224 |
| 1502 | 3300046471 | Ga0495650_0000065 | Ga0495650_0000065_101560_102234 | 224 |
| 1503 | 3300046471 | Ga0495650_0034724 | Ga0495650_0034724_837_1511 | 224 |
| 1504 | 3300046471 | Ga0495650_0041541 | Ga0495650_0041541_404_1078 | 224 |
| 1505 | 3300046474 | Ga0495605_0001329 | Ga0495605_0001329_9977_10651 | 224 |
| 1506 | 3300046474 | Ga0495605_0003755 | Ga0495605_0003755_905_1579 | 224 |
| 1507 | 3300046474 | Ga0495605_0016097 | Ga0495605_0016097_2035_2709 | 224 |
| 1508 | 3300046474 | Ga0495605_0062880 | Ga0495605_0062880_219_893 | 224 |
| 1509 | 3300046491 | Ga0495584_0009860 | Ga0495584_0009860_4102_4776 | 224 |
| 1510 | 3300046491 | Ga0495584_0054593 | Ga0495584_0054593_1082_1756 | 224 |
| 1511 | 3300046492 | Ga0495585_0054882 | Ga0495585_0054882_904_1578 | 224 |
| 1512 | 3300046492 | Ga0495585_0073715 | Ga0495585_0073715_666_1343 | 224 |
| 1513 | 3300046499 | Ga0495594_0052832 | Ga0495594_0052832_1055_1729 | 224 |
| 1514 | 3300046500 | Ga0495596_0031937 | Ga0495596_0031937_635_1312 | 224 |
| 1515 | 3300046500 | Ga0495596_0110699 | Ga0495596_0110699_157_831 | 224 |
| 1516 | 3300046501 | Ga0495607_0007302 | Ga0495607_0007302_1216_1890 | 224 |
| 1517 | 3300046501 | Ga0495607_0007331 | Ga0495607_0007331_5971_6645 | 224 |
| 1518 | 3300046501 | Ga0495607_0013183 | Ga0495607_0013183_471_1145 | 224 |
| 1519 | 3300046501 | Ga0495607_0046555 | Ga0495607_0046555_144_818 | 224 |
| 1520 | 3300046501 | Ga0495607_0144411 | Ga0495607_0144411_71_745 | 224 |
| 1521 | 3300046506 | Ga0495583_0002373 | Ga0495583_0002373_5605_6279 | 224 |
| 1522 | 3300046507 | Ga0495606_0002485 | Ga0495606_0002485_9177_9851 | 224 |
| 1523 | 3300046507 | Ga0495606_0008696 | Ga0495606_0008696_825_1499 | 224 |
| 1524 | 3300046507 | Ga0495606_0067958 | Ga0495606_0067958_735_1409 | 224 |
| 1525 | 3300046507 | Ga0495606_0111942 | Ga0495606_0111942_236_910 | 224 |
| 1526 | 3300046512 | Ga0495610_0005513 | Ga0495610_0005513_5663_6337 | 224 |
| 1527 | 3300046512 | Ga0495610_0027951 | Ga0495610_0027951_127_801 | 224 |
| 1528 | 3300046513 | Ga0495616_0130415 | Ga0495616_0130415_16_690 | 224 |
| 1529 | 3300046515 | Ga0495620_0000442 | Ga0495620_0000442_25757_26434 | 224 |
| 1530 | 3300046515 | Ga0495620_0020756 | Ga0495620_0020756_745_1419 | 224 |
| 1531 | 3300046515 | Ga0495620_0079176 | Ga0495620_0079176_104_778 | 224 |
| 1532 | 3300046515 | Ga0495620_0086445 | Ga0495620_0086445_462_1136 | 224 |
| 1533 | 3300046518 | Ga0495631_0005429 | Ga0495631_0005429_272_946 | 224 |
| 1534 | 3300046518 | Ga0495631_0024246 | Ga0495631_0024246_1742_2416 | 224 |
| 1535 | 3300046519 | Ga0495632_0017242 | Ga0495632_0017242_2759_3436 | 224 |
| 1536 | 3300046519 | Ga0495632_0022277 | Ga0495632_0022277_1898_2572 | 224 |
| 1537 | 3300046519 | Ga0495632_0050001 | Ga0495632_0050001_417_1091 | 224 |
| 1538 | 3300046519 | Ga0495632_0060310 | Ga0495632_0060310_606_1280 | 224 |
| 1539 | 3300046520 | Ga0495637_0010588 | Ga0495637_0010588_1475_2149 | 224 |
| 1540 | 3300046522 | Ga0495643_0012496 | Ga0495643_0012496_3946_4623 | 224 |
| 1541 | 3300046522 | Ga0495643_0020777 | Ga0495643_0020777_2910_3587 | 224 |
| 1542 | 3300046522 | Ga0495643_0033482 | Ga0495643_0033482_101_775 | 224 |
| 1543 | 3300046522 | Ga0495643_0084001 | Ga0495643_0084001_743_1417 | 224 |
| 1544 | 3300046523 | Ga0495644_0005253 | Ga0495644_0005253_2648_3322 | 224 |
| 1545 | 3300046524 | Ga0495648_0012791 | Ga0495648_0012791_2609_3286 | 224 |
| 1546 | 3300046524 | Ga0495648_0021611 | Ga0495648_0021611_1561_2235 | 224 |
| 1547 | 3300046524 | Ga0495648_0034739 | Ga0495648_0034739_918_1592 | 224 |
| 1548 | 3300046524 | Ga0495648_0049812 | Ga0495648_0049812_1019_1696 | 224 |
| 1549 | 3300046530 | Ga0495654_0000009 | Ga0495654_0000009_286837_287517 | 224 |
| 1550 | 3300046530 | Ga0495654_0001323 | Ga0495654_0001323_6531_7205 | 224 |
| 1551 | 3300046530 | Ga0495654_0002421 | Ga0495654_0002421_1068_1742 | 224 |
| 1552 | 3300046530 | Ga0495654_0015044 | Ga0495654_0015044_516_1190 | 224 |
| 1553 | 3300046530 | Ga0495654_0030540 | Ga0495654_0030540_739_1413 | 224 |
| 1554 | 3300046530 | Ga0495654_0133639 | Ga0495654_0133639_54_728 | 224 |
| 1555 | 3300046530 | Ga0495654_0179076 | Ga0495654_0179076_32_706 | 224 |
| 1556 | 3300046538 | Ga0495609_0000051 | Ga0495609_0000051_4106_4780 | 224 |
| 1557 | 3300046538 | Ga0495609_0003299 | Ga0495609_0003299_2981_3655 | 224 |
| 1558 | 3300046538 | Ga0495609_0024685 | Ga0495609_0024685_895_1569 | 224 |
| 1559 | 3300046542 | Ga0495597_0004166 | Ga0495597_0004166_1424_2098 | 224 |
| 1560 | 3300046558 | Ga0495633_0000915 | Ga0495633_0000915_23273_23947 | 224 |
| 1561 | 3300046648 | Ga0495611_0020449 | Ga0495611_0020449_1184_1858 | 224 |
| 1562 | 3300046648 | Ga0495611_0025207 | Ga0495611_0025207_846_1520 | 224 |
| 1563 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_1539_2213 | 224 |
| 1564 | 3300046660 | Ga0495625_0011960 | Ga0495625_0011960_402_1076 | 224 |
| 1565 | 3300046665 | Ga0495661_0000013 | Ga0495661_0000013_1105_1779 | 224 |
| 1566 | 3300046665 | Ga0495661_0000548 | Ga0495661_0000548_37302_37976 | 224 |
| 1567 | 3300046665 | Ga0495661_0000809 | Ga0495661_0000809_23017_23691 | 224 |
| 1568 | 3300046674 | Ga0495588_0036433 | Ga0495588_0036433_1647_2321 | 224 |
| 1569 | 3300046691 | Ga0495670_0004477 | Ga0495670_0004477_5615_6289 | 224 |
| 1570 | 3300046692 | Ga0495671_0002913 | Ga0495671_0002913_2980_3654 | 224 |
| 1571 | 3300046692 | Ga0495671_0049519 | Ga0495671_0049519_747_1421 | 224 |
| 1572 | 3300046692 | Ga0495671_0076738 | Ga0495671_0076738_811_1485 | 224 |
| 1573 | 3300046694 | Ga0495649_0015931 | Ga0495649_0015931_2684_3358 | 224 |
| 1574 | 3300046694 | Ga0495649_0020506 | Ga0495649_0020506_1579_2253 | 224 |
| 1575 | 3300046794 | Ga0495589_0000003 | Ga0495589_0000003_260038_260712 | 224 |
| 1576 | 3300046794 | Ga0495589_0015919 | Ga0495589_0015919_954_1628 | 224 |
| 1577 | 3300046794 | Ga0495589_0048748 | Ga0495589_0048748_1007_1681 | 224 |
| 1578 | 3300046794 | Ga0495589_0091341 | Ga0495589_0091341_400_1074 | 224 |
| 1579 | 3300046810 | Ga0495660_0000004 | Ga0495660_0000004_298611_299285 | 224 |
| 1580 | 3300046810 | Ga0495660_0000017 | Ga0495660_0000017_3209_3883 | 224 |
| 1581 | 3300046810 | Ga0495660_0072561 | Ga0495660_0072561_523_1197 | 224 |
| 1582 | 3300046810 | Ga0495660_0136060 | Ga0495660_0136060_219_896 | 224 |
| 1583 | 3300047320 | Ga0495672_0000001 | Ga0495672_0000001_1125359_1126033 | 224 |
| 1584 | 3300047320 | Ga0495672_0000009 | Ga0495672_0000009_158103_158777 | 224 |
| 1585 | 3300047320 | Ga0495672_0000038 | Ga0495672_0000038_123438_124115 | 224 |
| 1586 | 3300047320 | Ga0495672_0053550 | Ga0495672_0053550_608_1282 | 224 |
| 1587 | 3300047321 | Ga0495676_0000023 | Ga0495676_0000023_154906_155580 | 224 |
| 1588 | 3300047321 | Ga0495676_0054753 | Ga0495676_0054753_824_1498 | 224 |
| 1589 | 3300047323 | Ga0495683_0000090 | Ga0495683_0000090_89621_90295 | 224 |
| 1590 | 3300047323 | Ga0495683_0000514 | Ga0495683_0000514_5642_6316 | 224 |
| 1591 | 3300047446 | Ga0495679_000032 | Ga0495679_000032_71207_71881 | 224 |
| 1592 | 3300047446 | Ga0495679_000505 | Ga0495679_000505_1040_1714 | 224 |
| 1593 | 3300047446 | Ga0495679_001387 | Ga0495679_001387_4059_4733 | 224 |
| 1594 | 3300047446 | Ga0495679_004343 | Ga0495679_004343_5507_6184 | 224 |
| 1595 | 3300047446 | Ga0495679_015469 | Ga0495679_015469_558_1232 | 224 |
| 1596 | 3300047469 | Ga0495673_0000019 | Ga0495673_0000019_235075_235749 | 224 |
| 1597 | 3300047469 | Ga0495673_0000071 | Ga0495673_0000071_190231_190905 | 224 |
| 1598 | 3300047469 | Ga0495673_0023667 | Ga0495673_0023667_542_1216 | 224 |
| 1599 | 3300047469 | Ga0495673_0067656 | Ga0495673_0067656_747_1421 | 224 |
| 1600 | 3300047472 | Ga0495686_0089975 | Ga0495686_0089975_421_1095 | 224 |
| 1601 | 3300048091 | Ga0495626_0000095 | Ga0495626_0000095_113116_113790 | 224 |
| 1602 | 3300048903 | Ga0496100_0080311 | Ga0496100_0080311_872_1549 | 224 |
| 1603 | 3300048903 | Ga0496100_0232381 | Ga0496100_0232381_83_763 | 224 |
| 1604 | 3300048904 | Ga0496101_0000060 | Ga0496101_0000060_697_1377 | 224 |
| 1605 | 3300048904 | Ga0496101_0603971 | Ga0496101_0603971_105_779 | 224 |
| 1606 | 3300048905 | Ga0496102_0150812 | Ga0496102_0150812_989_1663 | 224 |
| 1607 | 3300048905 | Ga0496102_0171025 | Ga0496102_0171025_380_1057 | 224 |
| 1608 | 3300048906 | Ga0496103_0110321 | Ga0496103_0110321_279_956 | 224 |
| 1609 | 3300048907 | Ga0496104_0000212 | Ga0496104_0000212_8044_8718 | 224 |
| 1610 | 3300048907 | Ga0496104_0043660 | Ga0496104_0043660_618_1292 | 224 |
| 1611 | 3300048908 | Ga0496105_0062827 | Ga0496105_0062827_244_921 | 224 |
| 1612 | 3300048913 | Ga0496110_0438032 | Ga0496110_0438032_184_861 | 224 |
| 1613 | 3300048917 | Ga0496114_0069631 | Ga0496114_0069631_596_1273 | 224 |
| 1614 | 3300048919 | Ga0496116_0000007 | Ga0496116_0000007_298808_299482 | 224 |
| 1615 | 3300048919 | Ga0496116_0000118 | Ga0496116_0000118_104036_104710 | 224 |
| 1616 | 3300048919 | Ga0496116_0000132 | Ga0496116_0000132_154099_154773 | 224 |
| 1617 | 3300048919 | Ga0496116_0000420 | Ga0496116_0000420_37531_38208 | 224 |
| 1618 | 3300048919 | Ga0496116_0000446 | Ga0496116_0000446_831_1508 | 224 |
| 1619 | 3300048919 | Ga0496116_0006113 | Ga0496116_0006113_825_1499 | 224 |
| 1620 | 3300048919 | Ga0496116_0014310 | Ga0496116_0014310_5479_6156 | 224 |
| 1621 | 3300048919 | Ga0496116_0043259 | Ga0496116_0043259_476_1150 | 224 |
| 1622 | 3300048919 | Ga0496116_0092235 | Ga0496116_0092235_1121_1801 | 224 |
| 1623 | 3300048919 | Ga0496116_0109529 | Ga0496116_0109529_805_1479 | 224 |
| 1624 | 3300048919 | Ga0496116_0167310 | Ga0496116_0167310_373_1050 | 224 |
| 1625 | 3300048920 | Ga0496117_0000009 | Ga0496117_0000009_521539_522216 | 224 |
| 1626 | 3300048920 | Ga0496117_0000113 | Ga0496117_0000113_88322_88999 | 224 |
| 1627 | 3300048920 | Ga0496117_0000504 | Ga0496117_0000504_26981_27658 | 224 |
| 1628 | 3300048920 | Ga0496117_0002374 | Ga0496117_0002374_17413_18087 | 224 |
| 1629 | 3300048920 | Ga0496117_0008055 | Ga0496117_0008055_3473_4147 | 224 |
| 1630 | 3300048920 | Ga0496117_0008355 | Ga0496117_0008355_8889_9563 | 224 |
| 1631 | 3300048920 | Ga0496117_0021821 | Ga0496117_0021821_4009_4683 | 224 |
| 1632 | 3300048920 | Ga0496117_0026137 | Ga0496117_0026137_924_1598 | 224 |
| 1633 | 3300048920 | Ga0496117_0089242 | Ga0496117_0089242_689_1369 | 224 |
| 1634 | 3300048920 | Ga0496117_0125419 | Ga0496117_0125419_48_725 | 224 |
| 1635 | 3300048921 | Ga0496118_0000017 | Ga0496118_0000017_457225_457902 | 224 |
| 1636 | 3300048921 | Ga0496118_0001101 | Ga0496118_0001101_31894_32568 | 224 |
| 1637 | 3300048921 | Ga0496118_0001258 | Ga0496118_0001258_20944_21621 | 224 |
| 1638 | 3300048921 | Ga0496118_0003548 | Ga0496118_0003548_18529_19203 | 224 |
| 1639 | 3300048921 | Ga0496118_0003973 | Ga0496118_0003973_7649_8326 | 224 |
| 1640 | 3300048921 | Ga0496118_0007913 | Ga0496118_0007913_6910_7584 | 224 |
| 1641 | 3300048921 | Ga0496118_0040635 | Ga0496118_0040635_2259_2936 | 224 |
| 1642 | 3300048921 | Ga0496118_0200729 | Ga0496118_0200729_35_709 | 224 |
| 1643 | 3300048922 | Ga0496119_0000011 | Ga0496119_0000011_402784_403461 | 224 |
| 1644 | 3300048922 | Ga0496119_0000012 | Ga0496119_0000012_318582_319256 | 224 |
| 1645 | 3300048922 | Ga0496119_0000129 | Ga0496119_0000129_86980_87657 | 224 |
| 1646 | 3300048922 | Ga0496119_0000194 | Ga0496119_0000194_61372_62046 | 224 |
| 1647 | 3300048922 | Ga0496119_0008725 | Ga0496119_0008725_7561_8235 | 224 |
| 1648 | 3300048922 | Ga0496119_0008995 | Ga0496119_0008995_616_1293 | 224 |
| 1649 | 3300048922 | Ga0496119_0043407 | Ga0496119_0043407_1252_1926 | 224 |
| 1650 | 3300048922 | Ga0496119_0050436 | Ga0496119_0050436_717_1397 | 224 |
| 1651 | 3300048922 | Ga0496119_0053625 | Ga0496119_0053625_1249_1923 | 224 |
| 1652 | 3300048922 | Ga0496119_0073749 | Ga0496119_0073749_825_1499 | 224 |
| 1653 | 3300048922 | Ga0496119_0095156 | Ga0496119_0095156_412_1086 | 224 |
| 1654 | 3300048923 | Ga0496120_0000004 | Ga0496120_0000004_92662_93336 | 224 |
| 1655 | 3300048923 | Ga0496120_0000081 | Ga0496120_0000081_31686_32360 | 224 |
| 1656 | 3300048923 | Ga0496120_0000179 | Ga0496120_0000179_9832_10509 | 224 |
| 1657 | 3300048923 | Ga0496120_0000186 | Ga0496120_0000186_18915_19592 | 224 |
| 1658 | 3300048923 | Ga0496120_0000206 | Ga0496120_0000206_1260_1937 | 224 |
| 1659 | 3300048923 | Ga0496120_0000632 | Ga0496120_0000632_28873_29553 | 224 |
| 1660 | 3300048923 | Ga0496120_0002896 | Ga0496120_0002896_5899_6573 | 224 |
| 1661 | 3300048923 | Ga0496120_0007219 | Ga0496120_0007219_6144_6818 | 224 |
| 1662 | 3300048923 | Ga0496120_0066813 | Ga0496120_0066813_915_1589 | 224 |
| 1663 | 3300048923 | Ga0496120_0082862 | Ga0496120_0082862_348_1022 | 224 |
| 1664 | 3300048924 | Ga0496121_0000224 | Ga0496121_0000224_101996_102673 | 224 |
| 1665 | 3300048924 | Ga0496121_0148900 | Ga0496121_0148900_180_854 | 224 |
| 1666 | 3300048924 | Ga0496121_0156685 | Ga0496121_0156685_175_849 | 224 |
| 1667 | 3300048925 | Ga0496122_0000003 | Ga0496122_0000003_490822_491496 | 224 |
| 1668 | 3300048925 | Ga0496122_0000303 | Ga0496122_0000303_64425_65099 | 224 |
| 1669 | 3300048925 | Ga0496122_0001758 | Ga0496122_0001758_21807_22481 | 224 |
| 1670 | 3300048925 | Ga0496122_0001770 | Ga0496122_0001770_29442_30122 | 224 |
| 1671 | 3300048925 | Ga0496122_0003568 | Ga0496122_0003568_18583_19260 | 224 |
| 1672 | 3300048925 | Ga0496122_0066730 | Ga0496122_0066730_823_1497 | 224 |
| 1673 | 3300048925 | Ga0496122_0070219 | Ga0496122_0070219_1071_1745 | 224 |
| 1674 | 3300048926 | Ga0496123_0000012 | Ga0496123_0000012_246005_246679 | 224 |
| 1675 | 3300048926 | Ga0496123_0000250 | Ga0496123_0000250_43570_44244 | 224 |
| 1676 | 3300048926 | Ga0496123_0001176 | Ga0496123_0001176_7404_8078 | 224 |
| 1677 | 3300048926 | Ga0496123_0008944 | Ga0496123_0008944_254_928 | 224 |
| 1678 | 3300048926 | Ga0496123_0010352 | Ga0496123_0010352_5842_6522 | 224 |
| 1679 | 3300048926 | Ga0496123_0013533 | Ga0496123_0013533_442_1119 | 224 |
| 1680 | 3300048926 | Ga0496123_0016478 | Ga0496123_0016478_3874_4551 | 224 |
| 1681 | 3300048926 | Ga0496123_0036419 | Ga0496123_0036419_810_1484 | 224 |
| 1682 | 3300048926 | Ga0496123_0051401 | Ga0496123_0051401_962_1636 | 224 |
| 1683 | 3300048926 | Ga0496123_0167035 | Ga0496123_0167035_52_726 | 224 |
| 1684 | 3300048927 | Ga0496124_0000027 | Ga0496124_0000027_290115_290789 | 224 |
| 1685 | 3300048927 | Ga0496124_0000028 | Ga0496124_0000028_179039_179713 | 224 |
| 1686 | 3300048927 | Ga0496124_0000738 | Ga0496124_0000738_49709_50386 | 224 |
| 1687 | 3300048927 | Ga0496124_0001085 | Ga0496124_0001085_887_1561 | 224 |
| 1688 | 3300048927 | Ga0496124_0001441 | Ga0496124_0001441_1152_1826 | 224 |
| 1689 | 3300048927 | Ga0496124_0002677 | Ga0496124_0002677_1590_2264 | 224 |
| 1690 | 3300048927 | Ga0496124_0003289 | Ga0496124_0003289_4465_5139 | 224 |
| 1691 | 3300048927 | Ga0496124_0009187 | Ga0496124_0009187_9056_9730 | 224 |
| 1692 | 3300048927 | Ga0496124_0019429 | Ga0496124_0019429_818_1498 | 224 |
| 1693 | 3300048927 | Ga0496124_0042797 | Ga0496124_0042797_1291_1968 | 224 |
| 1694 | 3300048927 | Ga0496124_0066234 | Ga0496124_0066234_662_1339 | 224 |
| 1695 | 3300048927 | Ga0496124_0068604 | Ga0496124_0068604_1106_1783 | 224 |
| 1696 | 3300048927 | Ga0496124_0106428 | Ga0496124_0106428_475_1149 | 224 |
| 1697 | 3300048927 | Ga0496124_0209412 | Ga0496124_0209412_620_1297 | 224 |
| 1698 | 3300048928 | Ga0496125_0000052 | Ga0496125_0000052_202275_202949 | 224 |
| 1699 | 3300048928 | Ga0496125_0008709 | Ga0496125_0008709_1366_2040 | 224 |
| 1700 | 3300048928 | Ga0496125_0025608 | Ga0496125_0025608_1631_2308 | 224 |
| 1701 | 3300048928 | Ga0496125_0074463 | Ga0496125_0074463_902_1579 | 224 |
| 1702 | 3300048928 | Ga0496125_0098242 | Ga0496125_0098242_668_1342 | 224 |
| 1703 | 3300048929 | Ga0496126_0000410 | Ga0496126_0000410_64760_65434 | 224 |
| 1704 | 3300048929 | Ga0496126_0021260 | Ga0496126_0021260_4753_5427 | 224 |
| 1705 | 3300048929 | Ga0496126_0032462 | Ga0496126_0032462_993_1667 | 224 |
| 1706 | 3300048929 | Ga0496126_0072885 | Ga0496126_0072885_1660_2340 | 224 |
| 1707 | 3300048929 | Ga0496126_0077966 | Ga0496126_0077966_914_1591 | 224 |
| 1708 | 3300049459 | Ga0495678_001728 | Ga0495678_001728_9980_10654 | 224 |
| 1709 | 3300049459 | Ga0495678_002124 | Ga0495678_002124_2622_3296 | 224 |
| 1710 | 3300049459 | Ga0495678_030301 | Ga0495678_030301_1362_2039 | 224 |
| 1711 | 3300049460 | Ga0495682_0001613 | Ga0495682_0001613_1677_2351 | 224 |
| 1712 | 3300049460 | Ga0495682_0011912 | Ga0495682_0011912_1766_2440 | 224 |
| 1713 | 3300049460 | Ga0495682_0044862 | Ga0495682_0044862_158_832 | 224 |
| 1714 | 3300049530 | Ga0501314_007074 | Ga0501314_007074_94_771 | 224 |
| 1715 | 3300049571 | Ga0501034_0000145 | Ga0501034_0000145_125272_125949 | 224 |
| 1716 | 3300049571 | Ga0501034_0083430 | Ga0501034_0083430_1641_2318 | 224 |
| 1717 | 3300049574 | Ga0501038_0255896 | Ga0501038_0255896_34_711 | 224 |
| 1718 | 3300049742 | Ga0501080_0032637 | Ga0501080_0032637_1760_2434 | 224 |
| 1719 | 3300049823 | Ga0501044_0036795 | Ga0501044_0036795_4178_4852 | 224 |
| 1720 | 3300049853 | Ga0501226_000015 | Ga0501226_000015_26126_26803 | 224 |
| 1721 | 3300050491 | nmdc:mga00v17_122775_c1 | nmdc:mga00v17_122775_c1_450_1130 | 224 |
| 1722 | 3300050491 | nmdc:mga00v17_154009_c1 | nmdc:mga00v17_154009_c1_255_929 | 224 |
| 1723 | 3300050491 | nmdc:mga00v17_163505_c1 | nmdc:mga00v17_163505_c1_376_1053 | 224 |
| 1724 | 3300050491 | nmdc:mga00v17_50237_c1 | nmdc:mga00v17_50237_c1_955_1629 | 224 |
| 1725 | 3300050491 | nmdc:mga00v17_9293_c1 | nmdc:mga00v17_9293_c1_3430_4104 | 224 |
| 1726 | 3300050493 | nmdc:mga0k408_41598_c2 | nmdc:mga0k408_41598_c2_468_1142 | 224 |
| 1727 | 3300053125 | Ga0500618_014747 | Ga0500618_014747_452_1126 | 224 |
| 1728 | 3300053126 | Ga0500621_000070 | Ga0500621_000070_9268_9942 | 224 |
| 1729 | 3300053135 | Ga0500659_0071065 | Ga0500659_0071065_306_983 | 224 |
| 1730 | 3300053139 | Ga0500568_0112300 | Ga0500568_0112300_231_905 | 224 |
| 1731 | 3300059511 | Ga0587091_047756 | Ga0587091_047756_28_702 | 224 |
| 1732 | 3300059513 | Ga0587094_006971 | Ga0587094_006971_449_1123 | 224 |
| 1733 | 3300059627 | Ga0587117_005138 | Ga0587117_005138_315_989 | 224 |
| 1734 | 3300059639 | Ga0587062_003284 | Ga0587062_003284_544_1218 | 224 |
| 1735 | 3300028380 | Ga0268265_10761446 | Ga0268265_107614461 | 231 |
| 1736 | 2124908027 | MRS2a_Contig_29 | MRS2a_00189250 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p7e-assembly1.cif.gz_B | complex i from e. coli, ddm/lmng-purified, apo, resting state | 0.815 | 44 | 217 |
| 4wz7-assembly1.cif.gz_K | crystal structure of mitochondrial nadh:ubiquinone oxidoreductase from yarrowia lipolytica. | 0.8093 | 44 | 180 |
| 6h8k-assembly1.cif.gz_K | crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i | 0.7977 | 46 | 180 |
| 4hea-assembly2.cif.gz_G | crystal structure of the entire respiratory complex i from thermus thermophilus | 0.7948 | 48 | 178 |
| 7ard-assembly1.cif.gz_B | cryo-em structure of polytomella complex-i (complete composition) | 0.7919 | 46 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5ADP7_59_222_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7824 | 45 | 180 | 3.40.50.12280 |
| af_P06670_7_180_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7667 | 42 | 181 | 3.40.50.12280 |
| af_P9WJH1_2_170_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7561 | 42 | 186 | 3.40.50.12280 |
| af_I6XUD2_20_159_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7522 | 56 | 173 | 3.40.50.12280 |
| af_Q57936_1_148_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7443 | 55 | 175 | 3.40.50.12280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F5AW62-F1-model_v4 | NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) | 0.8019 | 26 | 216 |
GO:0005506
GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539 |
| AF-A0A7L9C5A6-F1-model_v4 | NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) | 0.8017 | 31 | 181 |
GO:0005506
GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539 |
| AF-A0A7R8WTC0-F1-model_v4 | NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein | 0.7968 | 45 | 181 |
GO:0008137
GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0051539 |
| AF-A0A812NP09-F1-model_v4 | NADH-ubiquinone oxidoreductase chain 3 (NADH dehydrogenase subunit 3) | 0.7968 | 42 | 181 |
GO:0008137
GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0051539 |
| AF-A0A2M7YUV5-F1-model_v4 | NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) | 0.7964 | 42 | 181 |
GO:0005506
GO:0005886 GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0048038 GO:0050136 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar