F495524

General Info

Members Datasets Scaffolds Average Seq Length
1736 888 1303 220

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10085268|Ga0065704_100852682
Length 205
Sequence MRYELTRIDPDAVNDQYPIGQRETVSDSQLEDQVHKNSLWPYNFGLSCCYVEMTTAFTAPHDIARFGAEVIRASPRQADFMVVAGTCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDVYVPGCPPRPEAFLQALMLLQDSIGEERRPLSWVVGDQGIYRAEMPAQRDVRREQRIQVTNLRSPDEV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231014 Pseudomonas sp. GM48 Isolate Nodule
17 2511231015 Pseudomonas sp. GM49 Isolate Nodule
18 2511231016 Pseudomonas sp. GM50 Isolate Nodule
19 2511231017 Pseudomonas sp. GM55 Isolate Nodule
20 2511231018 Pseudomonas sp. GM60 Isolate Nodule
21 2511231019 Pseudomonas sp. GM67 Isolate Nodule
22 2511231020 Pseudomonas sp. GM74 Isolate Nodule
23 2511231021 Pseudomonas sp. GM78 Isolate Nodule
24 2511231022 Pseudomonas sp. GM79 Isolate Nodule
25 2511231023 Pseudomonas sp. GM80 Isolate Nodule
26 2511231024 Pseudomonas sp. GM84 Isolate Nodule
27 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
28 2511231031 Pseudomonas sp. GM16 Isolate Nodule
29 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
33 2547132181 Kosakonia sacchari SP1 Isolate Stem
34 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
35 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
36 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
37 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
38 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
39 2561511199 Enterobacter sp. R4-368 Isolate Nodule
40 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
41 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
42 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
43 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
44 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
45 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
46 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
47 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
48 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
49 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
50 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
51 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
52 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
53 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
54 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
55 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
56 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
57 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
58 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
59 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
60 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
61 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
62 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
63 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
64 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
65 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
66 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
67 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
68 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
69 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
70 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
71 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
72 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
73 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
74 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
75 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
76 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
77 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
78 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
79 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
80 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
81 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
82 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
83 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
84 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
85 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
86 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
87 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
88 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
89 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
90 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
91 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
92 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
93 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
94 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
95 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
96 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
97 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
98 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
99 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
100 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
101 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
102 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
103 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
104 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
105 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
106 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
107 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
108 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
109 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
110 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
111 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
112 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
113 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
114 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
115 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
116 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
117 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
118 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
119 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
120 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
121 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
122 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
123 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
124 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
125 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
126 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
127 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
128 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
129 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
130 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
131 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
132 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
133 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
134 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
135 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
136 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
137 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
138 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
139 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
140 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
141 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
142 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
143 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
144 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
145 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
146 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
147 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
148 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
149 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
150 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
151 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
152 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
153 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
154 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
155 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
156 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
157 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
158 2636415599 Klebsiella variicola DX120E Isolate Unclassified
159 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
160 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
161 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
162 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
163 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
164 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
165 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
166 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
167 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
168 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
169 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
170 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
171 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
172 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
173 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
174 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
175 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
176 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
177 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
178 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
179 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
180 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
181 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
182 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
183 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
184 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
185 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
186 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
187 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
188 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
189 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
190 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
191 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
192 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
193 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
194 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
195 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
196 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
197 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
198 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
199 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
200 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
201 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
202 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
203 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
204 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
205 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
206 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
207 2751185917 Enterobacter sp. HK169 Isolate Unclassified
208 2765235841 Pseudomonas putida AA7 Isolate Unclassified
209 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
210 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
211 2773857670 Pseudomonas sp. 478 Isolate Unclassified
212 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
213 2773857673 Pseudomonas sp. 443 Isolate Unclassified
214 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
215 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
216 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
217 2775507074 Klebsiella sp. D5A Isolate Unclassified
218 2784132063 Pseudomonas sp. 424 Isolate Unclassified
219 2784132072 Pseudomonas sp. 460 Isolate Unclassified
220 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
221 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
222 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
223 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
224 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
225 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
226 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
227 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
228 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
229 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
230 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
231 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
232 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
233 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
234 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
235 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
236 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
237 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
238 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
239 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
240 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
241 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
242 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
243 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
244 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
245 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
246 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
247 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
248 2821118458 Enterobacter asburiae 609 Isolate Unclassified
249 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
250 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
251 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
252 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
253 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
254 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
255 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
256 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
257 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
258 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
259 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
260 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
261 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
262 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
263 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
264 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
265 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
266 2847085930 Erwinia persicina B64 Isolate Bulb
267 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
268 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
269 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
270 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
271 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
272 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
273 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
274 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
275 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
276 2865014394 Pantoea sp. R-71966 Isolate Unclassified
277 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
278 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
279 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
280 2876601092 Pantoea endophytica 596 Isolate Unclassified
281 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
282 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
283 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
284 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
285 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
286 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
287 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
288 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
289 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
290 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
291 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
292 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
293 2904504865 Serratia marcescens 1822 Isolate Unclassified
294 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
295 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
296 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
297 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
298 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
299 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
300 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
301 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
302 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
303 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
304 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
305 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
306 2919150387 Rahnella aceris 1817 Isolate Unclassified
307 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
308 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
309 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
310 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
311 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
312 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
313 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
314 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
315 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
316 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
317 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
318 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
319 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
320 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
321 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
322 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
323 2927143783 Rahnella sp. 2050 Isolate Unclassified
324 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
325 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
326 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
327 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
328 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
329 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
330 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
331 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
332 2932406140 Serratia sp. 2723 Isolate Rhizosphere
333 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
334 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
335 2937539931 Pantoea sp. LS15 Isolate Unclassified
336 2937967321 Serratia sp. YC16 Isolate Unclassified
337 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
338 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
339 2939577877 Serratia sp. 509 Isolate Rhizosphere
340 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
341 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
342 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
343 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
344 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
345 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
346 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
347 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
348 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
349 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
350 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
351 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
352 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
353 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
354 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
355 2952252522 Salinicola sp. DM10 Isolate Unclassified
356 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
357 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
358 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
359 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
360 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
361 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
362 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
363 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
364 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
365 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
366 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
367 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
368 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
369 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
370 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
371 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
372 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
373 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
374 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
375 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
376 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
377 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
378 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
379 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
380 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
381 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
382 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
383 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
384 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
385 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
386 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
387 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
388 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
389 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
390 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
391 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
392 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
393 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
394 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
395 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
396 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
397 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
398 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
399 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
400 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
401 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
402 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
403 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
404 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
405 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
406 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
407 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
408 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
409 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
410 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
411 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
412 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
416 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
417 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
418 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
419 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
420 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
421 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
422 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
423 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
424 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
425 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
426 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
427 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
428 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
429 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
430 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
431 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
432 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
433 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
434 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
435 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
436 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
437 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
438 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
439 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
440 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
441 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
442 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
443 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
444 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
445 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
446 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
447 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
448 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
449 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
450 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
451 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
452 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
453 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
454 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
455 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
456 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
457 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
458 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
459 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
460 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
461 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
462 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
463 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
464 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
465 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
466 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
467 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
468 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
469 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
470 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
471 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
472 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
473 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
474 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
475 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
476 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
477 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
478 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
479 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
480 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
481 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
482 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
483 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
484 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
485 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
486 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
487 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
488 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
489 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
490 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
491 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
492 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
493 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
494 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
495 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
496 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
497 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
498 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
499 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
500 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
501 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
502 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
503 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
504 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
505 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
506 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
507 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
508 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
509 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
510 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
511 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
512 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
513 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
514 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
515 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
516 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
517 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
518 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
519 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
520 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
521 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
522 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
523 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
524 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
525 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
526 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
527 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
528 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
529 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
530 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
531 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
532 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
533 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
534 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
535 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
536 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
537 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
538 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
539 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
540 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
541 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
542 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
543 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
544 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
545 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
546 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
547 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
548 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
549 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
550 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
551 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
552 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
553 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
554 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
555 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
556 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
557 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
558 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
562 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
607 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
610 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
611 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
613 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
615 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
616 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
617 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
618 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
619 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
620 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
621 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
622 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
623 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
624 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
625 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
626 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
627 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
628 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
629 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
630 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
634 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
635 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
636 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
637 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
638 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
639 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
640 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
641 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
642 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
643 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
644 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
645 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
646 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
647 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
648 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
649 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
650 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
651 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
652 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
653 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
654 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
655 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
657 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
658 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
659 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
660 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
661 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
662 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
663 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
664 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
665 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
666 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
667 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
668 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
669 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
670 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
671 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
672 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
673 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
674 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
675 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
676 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
677 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
678 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
679 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
680 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
681 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
682 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
683 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
684 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
685 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
686 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
687 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
688 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
689 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
690 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
691 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
692 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
693 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
694 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
695 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
696 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
697 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
698 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
699 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
700 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
701 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
702 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
703 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
704 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
705 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
706 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
707 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
708 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
709 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
710 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
711 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
712 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
713 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
714 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
715 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
716 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
717 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
718 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
719 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
720 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
721 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
722 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
723 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
724 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
725 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
726 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
727 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
728 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
729 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
730 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
731 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
732 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
733 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
734 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
735 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
736 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
737 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
738 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
739 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
740 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
741 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
742 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
743 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
744 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
745 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
746 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
747 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
748 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
749 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
750 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
751 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
752 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
753 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
754 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
755 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
756 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
757 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
758 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
759 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
760 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
761 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
762 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
763 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
764 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
765 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
766 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
767 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
768 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
769 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
770 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
771 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
772 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
773 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
774 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
775 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
776 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
777 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
778 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
779 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
780 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
781 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
782 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
783 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
784 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
785 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
786 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
787 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
788 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
789 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
790 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
791 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
792 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
793 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
794 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
795 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
796 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
797 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
798 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
799 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
800 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
801 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
802 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
803 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
805 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
806 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
807 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
808 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
809 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
810 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
811 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
812 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
813 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
814 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
815 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
816 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
817 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
818 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
819 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
820 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
821 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
822 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
823 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
824 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
825 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
826 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
827 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
828 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
829 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
830 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
831 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
832 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
833 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
834 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
835 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
836 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
837 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
838 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
839 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
840 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
841 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
842 640753048 Serratia proteamaculans 568 Isolate Endosphere
843 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
844 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
845 8004592986 Serratia sp. S119 Isolate Unclassified
846 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
847 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
848 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
849 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
850 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
851 8018221730 Enterobacter sp. CM29 Isolate Unclassified
852 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
853 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
854 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
855 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
856 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
857 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
858 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
859 8052494512 Pseudomonas putida LD6 Isolate Unclassified
860 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
861 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
862 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
863 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
864 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
865 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
866 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
867 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
868 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
869 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
870 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
871 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
872 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
873 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
874 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
875 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
876 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
877 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
878 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
879 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
880 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
881 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
882 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
883 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
884 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
885 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
886 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
887 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
888 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.93
Metatranscriptomes 2.07
Isolates 25

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0.06
Endosphere 5.53
Nodule 2.65
Rhizoplane 8.53
Rhizosphere 68.61
Stem 0.06
Stem Tuber 0.29
Unclassified 13.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_29 2124908027 Bacteria 60739
2 SwRhRL2b_contig_297133 2162886007 Bacteria 2675
3 JGI25162J39368_1000002 3300002737 Bacteria 663004
4 JGI25162J39368_1005314 3300002737 Bacteria 2587
5 JGI25154J39366_1012551 3300002738 Bacteria 932
6 JGI25163J39215_1000024 3300002771 Bacteria 70395
7 JGI25163J39215_1003812 3300002771 Bacteria 1144
8 JGI25164J39214_1000006 3300002772 Bacteria 342675
9 JGI25164J39214_1000069 3300002772 Bacteria 103125
10 JGI25164J39214_1000228 3300002772 Bacteria 43827
11 JGI25152J39213_1000602 3300002773 Bacteria 19375
12 JGI25165J46597_1000168 3300003214 Bacteria 103125
13 JGI25165J46597_1000424 3300003214 Bacteria 43827
14 rootH2_10052056 3300003320 Bacteria 13419
15 rootH2_10085512 3300003320 Bacteria 13406
16 rootL2_10021840 3300003322 Bacteria 9126
17 rootH1_10005050 3300003316 Bacteria 9926
18 rootH1_10005050 3300003323 Bacteria 27642
19 Ga0006562J51391_1025316 3300003578 Bacteria 1702
20 Ga0055538_1000003 3300003751 Bacteria 663004
21 Ga0055538_1000088 3300003751 Bacteria 78763
22 Ga0055539_1000003 3300003752 Bacteria 663004
23 Ga0055539_1000132 3300003752 Bacteria 78763
24 Ga0055533_1000005 3300003756 Bacteria 663004
25 Ga0055533_1000135 3300003756 Bacteria 78763
26 Ga0055532_1000178 3300003758 Bacteria 54660
27 Ga0055525_1000005 3300003759 Bacteria 663004
28 Ga0055525_1000449 3300003759 Bacteria 23656
29 Ga0055535_1016059 3300003761 Bacteria 1033
30 Ga0055536_1015762 3300003781 Bacteria 2568
31 Ga0055536_1022882 3300003781 Bacteria 1851
32 Ga0055536_1024507 3300003781 Bacteria 1746
33 Ga0055536_1031303 3300003781 Bacteria 1395
34 Ga0055536_1049300 3300003781 Bacteria 936
35 Ga0055530_10021619 3300003791 Bacteria 1890
36 Ga0055530_10023625 3300003791 Bacteria 1761
37 Ga0055530_10049125 3300003791 Bacteria 988
38 Ga0055530_10060716 3300003791 Bacteria 844
39 Ga0055540_1005526 3300003792 Bacteria 5284
40 Ga0055540_1013134 3300003792 Bacteria 2550
41 Ga0055540_1020296 3300003792 Bacteria 1761
42 Ga0055531_10004591 3300003794 Bacteria 8330
43 Ga0055541_1000003 3300003841 Bacteria 663004
44 Ga0055541_1000087 3300003841 Bacteria 78763
45 Ga0058692_1000092 3300003856 Bacteria 60796
46 Ga0058692_1000734 3300003856 Bacteria 13270
47 Ga0058692_1007969 3300003856 Bacteria 2758
48 Ga0058692_1020156 3300003856 Bacteria 1407
49 Ga0058692_1020519 3300003856 Bacteria 1387
50 JGI25405J52794_10011315 3300003911 Bacteria 1707
51 Ga0058863_11745031 3300004799 Bacteria 1651
52 Ga0058861_11992559 3300004800 Bacteria 1795
53 Ga0058862_10209510 3300004803 Bacteria 1442
54 Ga0058862_12840720 3300004803 Bacteria 1834
55 Ga0065703_1000185 3300005272 Bacteria 19705
56 Ga0065703_1020317 3300005272 Bacteria 1880
57 Ga0065714_10000291 3300005288 Bacteria 6107
58 Ga0065714_10022500 3300005288 Bacteria 1049
59 Ga0065714_10024032 3300005288 Bacteria 1619
60 Ga0065714_10042677 3300005288 Bacteria 1125
61 Ga0065704_10000641 3300005289 Bacteria 21869
62 Ga0065704_10001523 3300005289 Bacteria 7440
63 Ga0065704_10007486 3300005289 Bacteria 3780
64 Ga0065704_10014544 3300005289 Bacteria 2654
65 Ga0065704_10071962 3300005289 Bacteria 9503
66 Ga0065704_10085268 3300005289 Bacteria 3239
67 Ga0065704_10110828 3300005289 Bacteria 1971
68 Ga0065704_10314531 3300005289 Bacteria 863
69 Ga0065712_10085148 3300005290 Bacteria 2716
70 Ga0065712_10090299 3300005290 Bacteria 2427
71 Ga0065712_10166150 3300005290 Bacteria 1272
72 Ga0065712_10177747 3300005290 Bacteria 1209
73 Ga0065715_10009777 3300005293 Bacteria 2631
74 Ga0065715_10100728 3300005293 Bacteria 3272
75 Ga0065715_10358674 3300005293 Bacteria 939
76 Ga0065715_10582615 3300005293 Bacteria 719
77 Ga0065707_10054040 3300005295 Bacteria 889
78 Ga0070658_10078582 3300005327 Bacteria 2708
79 Ga0070658_10174300 3300005327 Bacteria 1808
80 Ga0070683_100294876 3300005329 Bacteria 1542
81 Ga0070670_100000054 3300005331 Bacteria 127396
82 Ga0070666_10009694 3300005335 Bacteria 6016
83 Ga0070680_100182953 3300005336 Bacteria 1765
84 Ga0070660_100001518 3300005339 Bacteria 15915
85 Ga0070661_100000221 3300005344 Bacteria 47122
86 Ga0070661_100335890 3300005344 Bacteria 1183
87 Ga0070692_10331813 3300005345 Bacteria 939
88 Ga0070669_100004838 3300005353 Bacteria 9719
89 Ga0070669_100005396 3300005353 Bacteria 9223
90 Ga0070669_100017073 3300005353 Bacteria 5177
91 Ga0070669_100442327 3300005353 Bacteria 1070
92 Ga0070671_100000037 3300005355 Bacteria 95248
93 Ga0070688_100004371 3300005365 Bacteria 7353
94 Ga0070659_100191861 3300005366 Bacteria 1679
95 Ga0070659_100401584 3300005366 Bacteria 1157
96 Ga0070667_100000002 3300005367 Bacteria 504831
97 Ga0070709_10069602 3300005434 Bacteria 2267
98 Ga0070709_10482606 3300005434 Bacteria 939
99 Ga0070714_100002772 3300005435 Bacteria 12911
100 Ga0070714_100067450 3300005435 Bacteria 3085
101 Ga0070714_100109240 3300005435 Bacteria 2446
102 Ga0070714_100139294 3300005435 Bacteria 2176
103 Ga0070714_100793847 3300005435 Bacteria 917
104 Ga0070713_100006711 3300005436 Bacteria 8010
105 Ga0070713_100258329 3300005436 Bacteria 1591
106 Ga0070711_100191254 3300005439 Bacteria 1573
107 Ga0070711_100425488 3300005439 Bacteria 1083
108 Ga0070711_100601621 3300005439 Bacteria 917
109 Ga0070700_100440784 3300005441 Bacteria 989
110 Ga0070708_100000392 3300005445 Bacteria 33124
111 Ga0070678_100412312 3300005456 Bacteria 1176
112 Ga0070681_10031259 3300005458 Bacteria 5344
113 Ga0070681_10068202 3300005458 Bacteria 3524
114 Ga0070681_10093609 3300005458 Bacteria 2954
115 Ga0070681_10106869 3300005458 Bacteria 2740
116 Ga0070681_10132687 3300005458 Bacteria 2422
117 Ga0070681_10170524 3300005458 Bacteria 2098
118 Ga0070681_10821945 3300005458 Bacteria 846
119 Ga0068867_100092572 3300005459 Bacteria 2296
120 Ga0070685_10000014 3300005466 Bacteria 120530
121 Ga0070706_100001692 3300005467 Bacteria 22966
122 Ga0070707_100000351 3300005468 Bacteria 45175
123 Ga0070707_100004546 3300005468 Bacteria 12991
124 Ga0070698_100000922 3300005471 Bacteria 32132
125 Ga0070698_100019643 3300005471 Bacteria 7087
126 Ga0070699_100000502 3300005518 Bacteria 37239
127 Ga0070699_100037730 3300005518 Bacteria 4183
128 Ga0070699_100203295 3300005518 Bacteria 1762
129 Ga0070679_100000945 3300005530 Bacteria 25224
130 Ga0070679_100031038 3300005530 Bacteria 5279
131 Ga0070679_100094428 3300005530 Bacteria 2978
132 Ga0070679_100168821 3300005530 Bacteria 2161
133 Ga0070679_100330768 3300005530 Bacteria 1472
134 Ga0070679_100360345 3300005530 Bacteria 1401
135 Ga0070679_100957878 3300005530 Bacteria 799
136 Ga0070684_100033892 3300005535 Bacteria 4363
137 Ga0070684_100066556 3300005535 Bacteria 3163
138 Ga0070684_100535110 3300005535 Bacteria 1086
139 Ga0070697_100002721 3300005536 Bacteria 13623
140 Ga0070697_100189545 3300005536 Bacteria 1745
141 Ga0070697_100414222 3300005536 Bacteria 1170
142 Ga0068853_100016299 3300005539 Bacteria 6114
143 Ga0068853_100067432 3300005539 Bacteria 3109
144 Ga0070672_100200754 3300005543 Bacteria 1668
145 Ga0070665_100003302 3300005548 Bacteria 17281
146 Ga0070665_100012924 3300005548 Bacteria 8411
147 Ga0070665_100027961 3300005548 Bacteria 5679
148 Ga0070665_100090630 3300005548 Bacteria 3063
149 Ga0070665_100117303 3300005548 Bacteria 2664
150 Ga0070665_100233214 3300005548 Bacteria 1841
151 Ga0068855_100016972 3300005563 Bacteria 8756
152 Ga0068855_100018409 3300005563 Bacteria 8392
153 Ga0068855_100021270 3300005563 Bacteria 7778
154 Ga0068855_100032736 3300005563 Bacteria 6207
155 Ga0068855_100082048 3300005563 Bacteria 3737
156 Ga0068855_100235003 3300005563 Bacteria 2050
157 Ga0068855_100552887 3300005563 Bacteria 1246
158 Ga0070664_100001101 3300005564 Bacteria 21375
159 Ga0070664_100004083 3300005564 Bacteria 11732
160 Ga0068857_100003218 3300005577 Bacteria 13546
161 Ga0068857_100039120 3300005577 Bacteria 4201
162 Ga0068857_100127973 3300005577 Bacteria 2289
163 Ga0068857_100146071 3300005577 Bacteria 2140
164 Ga0068857_100209333 3300005577 Bacteria 1779
165 Ga0068857_100314938 3300005577 Bacteria 1444
166 Ga0068857_100737896 3300005577 Bacteria 937
167 Ga0068854_100078594 3300005578 Bacteria 2431
168 Ga0068856_100018638 3300005614 Bacteria 6727
169 Ga0068856_100153505 3300005614 Bacteria 2312
170 Ga0068856_100185005 3300005614 Bacteria 2097
171 Ga0068852_100000021 3300005616 Bacteria 126061
172 Ga0068852_100073313 3300005616 Bacteria 3011
173 Ga0068852_100606257 3300005616 Bacteria 1099
174 Ga0068859_100049835 3300005617 Bacteria 4206
175 Ga0068859_100101523 3300005617 Bacteria 2934
176 Ga0068864_100000002 3300005618 Bacteria 658857
177 Ga0068864_100022756 3300005618 Bacteria 5256
178 Ga0068864_100210709 3300005618 Bacteria 1789
179 Ga0068861_100292923 3300005719 Bacteria 1406
180 Ga0068851_10011603 3300005834 Bacteria 4135
181 Ga0068863_100009104 3300005841 Bacteria 9695
182 Ga0068863_100012187 3300005841 Bacteria 8303
183 Ga0068863_100014553 3300005841 Bacteria 7574
184 Ga0068860_100175045 3300005843 Bacteria 2074
185 Ga0068860_100348249 3300005843 Bacteria 1457
186 Ga0068860_100397565 3300005843 Bacteria 1363
187 Ga0068862_100156884 3300005844 Bacteria 2029
188 Ga0068862_100235134 3300005844 Bacteria 1664
189 Ga0068862_100277796 3300005844 Bacteria 1534
190 Ga0068862_100595531 3300005844 Bacteria 1061
191 Ga0081455_10001369 3300005937 Bacteria 30084
192 Ga0081538_10140994 3300005981 Bacteria 1111
193 Ga0081540_1109528 3300005983 Bacteria 1171
194 Ga0081540_1179312 3300005983 Bacteria 795
195 Ga0070717_10028565 3300006028 Bacteria 4466
196 Ga0075363_100468782 3300006048 Bacteria 745
197 Ga0075364_10072909 3300006051 Bacteria 2263
198 Ga0075364_10085946 3300006051 Bacteria 2083
199 Ga0075364_10093100 3300006051 Bacteria 2001
200 Ga0075364_10216662 3300006051 Bacteria 1298
201 Ga0070716_100089161 3300006173 Bacteria 1862
202 Ga0075366_10005676 3300006195 Bacteria 6768
203 Ga0075366_10091668 3300006195 Bacteria 1820
204 Ga0097621_100093428 3300006237 Bacteria 2521
205 Ga0097621_100112184 3300006237 Bacteria 2305
206 Ga0097621_100247031 3300006237 Bacteria 1561
207 Ga0075370_10230606 3300006353 Bacteria 1096
208 Ga0068871_100002826 3300006358 Bacteria 11878
209 Ga0068871_100024543 3300006358 Bacteria 4677
210 Ga0068871_100235910 3300006358 Bacteria 1589
211 Ga0075428_100020857 3300006844 Bacteria 7255
212 Ga0075428_100029944 3300006844 Bacteria 6021
213 Ga0075428_100086112 3300006844 Bacteria 3427
214 Ga0075428_100746064 3300006844 Bacteria 1042
215 Ga0075430_100132088 3300006846 Bacteria 2081
216 Ga0075431_100005178 3300006847 Bacteria 12842
217 Ga0075431_100196400 3300006847 Bacteria 2065
218 Ga0075433_10206688 3300006852 Bacteria 1745
219 Ga0075434_100166915 3300006871 Bacteria 2221
220 Ga0075434_100195313 3300006871 Bacteria 2043
221 Ga0075429_100015070 3300006880 Bacteria 6700
222 Ga0068865_100021630 3300006881 Bacteria 4186
223 Ga0075436_100001541 3300006914 Bacteria 15748
224 Ga0075436_100495628 3300006914 Bacteria 893
225 Ga0097620_100049833 3300006931 Bacteria 4206
226 Ga0097620_100101520 3300006931 Bacteria 2934
227 Ga0099823_1000397 3300006944 Bacteria 27902
228 Ga0079104_1000120 3300006946 Bacteria 111969
229 Ga0079104_1000135 3300006946 Bacteria 103632
230 Ga0079104_1000487 3300006946 Bacteria 43465
231 Ga0079104_1001580 3300006946 Bacteria 14875
232 Ga0079104_1002605 3300006946 Bacteria 9453
233 Ga0079104_1002650 3300006946 Bacteria 9307
234 Ga0079104_1006134 3300006946 Bacteria 4630
235 Ga0079104_1028407 3300006946 Bacteria 1421
236 Ga0079104_1073335 3300006946 Bacteria 715
237 Ga0099826_10012472 3300006948 Bacteria 6404
238 Ga0075435_100017057 3300007076 Bacteria 5487
239 Ga0075435_100037815 3300007076 Bacteria 3846
240 Ga0075435_100504872 3300007076 Bacteria 1046
241 Ga0099794_10149796 3300007265 Bacteria 1184
242 Ga0099795_10084934 3300007788 Bacteria 1217
243 Ga0105251_10000500 3300009011 Bacteria 37162
244 Ga0105251_10000649 3300009011 Bacteria 32045
245 Ga0105251_10002203 3300009011 Bacteria 15575
246 Ga0105251_10002226 3300009011 Bacteria 15475
247 Ga0105251_10019937 3300009011 Bacteria 3530
248 Ga0105251_10021742 3300009011 Bacteria 3343
249 Ga0105251_10025169 3300009011 Bacteria 3048
250 Ga0105251_10051689 3300009011 Bacteria 1959
251 Ga0105251_10059723 3300009011 Bacteria 1797
252 Ga0105251_10088202 3300009011 Bacteria 1427
253 Ga0105251_10089046 3300009011 Bacteria 1420
254 Ga0105251_10092604 3300009011 Bacteria 1387
255 Ga0105251_10195998 3300009011 Bacteria 910
256 Ga0105244_10000246 3300009036 Bacteria 55589
257 Ga0105244_10000337 3300009036 Bacteria 44183
258 Ga0105244_10000342 3300009036 Bacteria 43837
259 Ga0105244_10001474 3300009036 Bacteria 19004
260 Ga0105244_10002267 3300009036 Bacteria 14624
261 Ga0105244_10007923 3300009036 Bacteria 6694
262 Ga0105244_10022204 3300009036 Bacteria 3495
263 Ga0105244_10025529 3300009036 Bacteria 3211
264 Ga0105244_10028040 3300009036 Bacteria 3026
265 Ga0105244_10033494 3300009036 Bacteria 2707
266 Ga0105244_10057283 3300009036 Bacteria 1970
267 Ga0105244_10060740 3300009036 Bacteria 1904
268 Ga0105244_10066137 3300009036 Bacteria 1810
269 Ga0105244_10067245 3300009036 Bacteria 1793
270 Ga0105244_10073265 3300009036 Bacteria 1705
271 Ga0105244_10110909 3300009036 Bacteria 1335
272 Ga0105244_10119654 3300009036 Bacteria 1276
273 Ga0105244_10120223 3300009036 Bacteria 1272
274 Ga0105244_10125113 3300009036 Bacteria 1243
275 Ga0105244_10125660 3300009036 Bacteria 1240
276 Ga0105250_10000007 3300009092 Bacteria 355249
277 Ga0105250_10000018 3300009092 Bacteria 246692
278 Ga0105250_10000080 3300009092 Bacteria 83436
279 Ga0105250_10002387 3300009092 Bacteria 9478
280 Ga0105250_10003285 3300009092 Bacteria 7696
281 Ga0105250_10006776 3300009092 Bacteria 4974
282 Ga0105250_10013064 3300009092 Bacteria 3418
283 Ga0105250_10023962 3300009092 Bacteria 2460
284 Ga0105250_10073013 3300009092 Bacteria 1387
285 Ga0105240_10003055 3300009093 Bacteria 26321
286 Ga0105240_10003087 3300009093 Bacteria 26186
287 Ga0105240_10016586 3300009093 Bacteria 9966
288 Ga0105240_10030004 3300009093 Bacteria 7074
289 Ga0105240_10051034 3300009093 Bacteria 5208
290 Ga0105240_10092102 3300009093 Bacteria 3702
291 Ga0105240_10096438 3300009093 Bacteria 3604
292 Ga0105240_10261833 3300009093 Bacteria 1995
293 Ga0105240_10275533 3300009093 Bacteria 1935
294 Ga0105240_10275860 3300009093 Bacteria 1934
295 Ga0105240_10318043 3300009093 Bacteria 1775
296 Ga0105240_10434415 3300009093 Bacteria 1472
297 Ga0105240_10522986 3300009093 Bacteria 1316
298 Ga0111539_10002472 3300009094 Bacteria 24526
299 Ga0111539_10058214 3300009094 Bacteria 4585
300 Ga0105245_10350049 3300009098 Bacteria 1463
301 Ga0105247_10000416 3300009101 Bacteria 36118
302 Ga0105247_10003341 3300009101 Bacteria 10502
303 Ga0105247_10126947 3300009101 Bacteria 1659
304 Ga0114129_10085130 3300009147 Bacteria 4386
305 Ga0114129_10105084 3300009147 Bacteria 3903
306 Ga0105243_10000123 3300009148 Bacteria 88281
307 Ga0105243_10000587 3300009148 Bacteria 36543
308 Ga0105243_10040506 3300009148 Bacteria 3638
309 Ga0105243_10068541 3300009148 Bacteria 2859
310 Ga0105241_10000001 3300009174 Bacteria 879793
311 Ga0105241_10005427 3300009174 Bacteria 9428
312 Ga0105241_10009030 3300009174 Bacteria 7331
313 Ga0105241_10631353 3300009174 Bacteria 971
314 Ga0105242_10006800 3300009176 Bacteria 8819
315 Ga0105242_10515440 3300009176 Bacteria 1140
316 Ga0105248_10035407 3300009177 Bacteria 5585
317 Ga0105248_10174768 3300009177 Bacteria 2421
318 Ga0105237_10000582 3300009545 Bacteria 51165
319 Ga0105237_10014816 3300009545 Bacteria 8138
320 Ga0105237_10038802 3300009545 Bacteria 4809
321 Ga0105237_10040136 3300009545 Bacteria 4721
322 Ga0105237_10120744 3300009545 Bacteria 2615
323 Ga0105237_10274158 3300009545 Bacteria 1690
324 Ga0105237_10742196 3300009545 Bacteria 988
325 Ga0105238_10008807 3300009551 Bacteria 10096
326 Ga0105238_10015411 3300009551 Bacteria 7734
327 Ga0105238_10044289 3300009551 Bacteria 4499
328 Ga0105238_10062077 3300009551 Bacteria 3738
329 Ga0105238_10217504 3300009551 Bacteria 1887
330 Ga0105249_10017291 3300009553 Bacteria 6402
331 Ga0105249_10084861 3300009553 Bacteria 2950
332 Ga0105249_10475794 3300009553 Bacteria 1291
333 Ga0105239_10010544 3300010375 Bacteria 10332
334 Ga0105239_10372303 3300010375 Bacteria 1614
335 Ga0105246_10086246 3300011119 Bacteria 2250
336 Ga0105246_10139431 3300011119 Bacteria 1822
337 Ga0105246_10146747 3300011119 Bacteria 1781
338 Ga0105246_10949496 3300011119 Bacteria 775
339 Ga0105246_10949497 3300011119 Bacteria 775
340 Ga0157373_10000400 3300013100 Bacteria 34834
341 Ga0157373_10003007 3300013100 Bacteria 12751
342 Ga0157373_10005419 3300013100 Bacteria 9583
343 Ga0157373_10057651 3300013100 Bacteria 2755
344 Ga0157373_10063017 3300013100 Bacteria 2626
345 Ga0157373_10102302 3300013100 Bacteria 2016
346 Ga0157373_10222974 3300013100 Bacteria 1330
347 Ga0157373_10394651 3300013100 Bacteria 991
348 Ga0157371_10000006 3300013102 Bacteria 404774
349 Ga0157371_10000560 3300013102 Bacteria 44059
350 Ga0157371_10001683 3300013102 Bacteria 22533
351 Ga0157371_10002562 3300013102 Bacteria 17247
352 Ga0157371_10002986 3300013102 Bacteria 15709
353 Ga0157371_10016802 3300013102 Bacteria 5450
354 Ga0157371_10043415 3300013102 Bacteria 3203
355 Ga0157371_10098076 3300013102 Bacteria 2078
356 Ga0157371_10105526 3300013102 Bacteria 1999
357 Ga0157371_10121242 3300013102 Bacteria 1859
358 Ga0157370_10000067 3300013104 Bacteria 113351
359 Ga0157370_10000618 3300013104 Bacteria 44184
360 Ga0157370_10000644 3300013104 Bacteria 43467
361 Ga0157370_10006254 3300013104 Bacteria 13182
362 Ga0157370_10026206 3300013104 Bacteria 5759
363 Ga0157370_10063557 3300013104 Bacteria 3496
364 Ga0157370_10121597 3300013104 Bacteria 2437
365 Ga0157370_10183224 3300013104 Bacteria 1945
366 Ga0157370_10207789 3300013104 Bacteria 1815
367 Ga0157370_10254613 3300013104 Bacteria 1623
368 Ga0157370_10260773 3300013104 Bacteria 1602
369 Ga0157370_10733782 3300013104 Bacteria 901
370 Ga0157369_10000375 3300013105 Bacteria 59272
371 Ga0157369_10001060 3300013105 Bacteria 34676
372 Ga0157369_10001168 3300013105 Bacteria 32769
373 Ga0157369_10001656 3300013105 Bacteria 27174
374 Ga0157369_10005638 3300013105 Bacteria 14545
375 Ga0157369_10040266 3300013105 Bacteria 5102
376 Ga0157369_10052776 3300013105 Bacteria 4396
377 Ga0157369_10103532 3300013105 Bacteria 3032
378 Ga0157369_10358959 3300013105 Bacteria 1513
379 Ga0157369_10384259 3300013105 Bacteria 1457
380 Ga0157369_10874537 3300013105 Bacteria 922
381 Ga0157374_10703756 3300013296 Bacteria 1023
382 Ga0157378_10111171 3300013297 Bacteria 2512
383 Ga0163162_10010274 3300013306 Bacteria 9097
384 Ga0163162_10022107 3300013306 Bacteria 6268
385 Ga0163162_10040482 3300013306 Bacteria 4660
386 Ga0163162_10150800 3300013306 Bacteria 2442
387 Ga0163162_10151120 3300013306 Bacteria 2440
388 Ga0157372_10001955 3300013307 Bacteria 22388
389 Ga0157372_10002168 3300013307 Bacteria 21369
390 Ga0157372_10016311 3300013307 Bacteria 7972
391 Ga0157372_10021477 3300013307 Bacteria 6975
392 Ga0157372_10023748 3300013307 Bacteria 6651
393 Ga0157372_10058132 3300013307 Bacteria 4322
394 Ga0157372_10062065 3300013307 Bacteria 4186
395 Ga0157372_10092018 3300013307 Bacteria 3449
396 Ga0157372_10115970 3300013307 Bacteria 3071
397 Ga0157372_10144931 3300013307 Bacteria 2739
398 Ga0157372_10144933 3300013307 Bacteria 2739
399 Ga0157372_10281836 3300013307 Bacteria 1932
400 Ga0157375_10200618 3300013308 Bacteria 2151
401 Ga0157375_10662900 3300013308 Bacteria 1199
402 Ga0163163_10000687 3300014325 Bacteria 28756
403 Ga0182008_10001623 3300014497 Bacteria 14895
404 Ga0182008_10029374 3300014497 Bacteria 2778
405 Ga0157379_10027141 3300014968 Bacteria 5098
406 Ga0157379_10088473 3300014968 Bacteria 2778
407 Ga0182006_1000024 3300015261 Bacteria 257431
408 Ga0182006_1014014 3300015261 Bacteria 3462
409 Ga0182006_1023446 3300015261 Bacteria 2556
410 Ga0182006_1035307 3300015261 Bacteria 1994
411 Ga0182007_10048505 3300015262 Bacteria 1404
412 Ga0182007_10062034 3300015262 Bacteria 1225
413 Ga0182005_1093785 3300015265 Bacteria 836
414 Ga0183366_1001 3300015679 Bacteria 2743932
415 Ga0183370_1001 3300015680 Bacteria 2743932
416 Ga0183369_1001 3300015685 Bacteria 2743932
417 Ga0183368_1001 3300015687 Bacteria 2743932
418 Ga0163161_10000003 3300017792 Bacteria 339847
419 Ga0163161_10034504 3300017792 Bacteria 3620
420 Ga0163161_10095441 3300017792 Bacteria 2206
421 Ga0163161_10231290 3300017792 Bacteria 1435
422 Ga0163161_10563445 3300017792 Bacteria 935
423 Ga0197907_10316666 3300020069 Bacteria 1784
424 Ga0197907_10479836 3300020069 Bacteria 2097
425 Ga0197907_10974095 3300020069 Bacteria 2071
426 Ga0197907_11438784 3300020069 Bacteria 1727
427 Ga0206356_10888656 3300020070 Bacteria 1232
428 Ga0206356_11820743 3300020070 Bacteria 1345
429 Ga0206349_1221543 3300020075 Bacteria 1500
430 Ga0206355_1041887 3300020076 Bacteria 2123
431 Ga0206355_1413860 3300020076 Bacteria 3664
432 Ga0206351_10535310 3300020077 Bacteria 1239
433 Ga0206351_10679320 3300020077 Bacteria 2070
434 Ga0206352_10109537 3300020078 Bacteria 2111
435 Ga0206352_10476527 3300020078 Bacteria 5168
436 Ga0206352_10517688 3300020078 Bacteria 1768
437 Ga0206352_11361616 3300020078 Bacteria 1129
438 Ga0206350_10008355 3300020080 Bacteria 1228
439 Ga0206350_10187858 3300020080 Bacteria 3412
440 Ga0206350_10364460 3300020080 Bacteria 1266
441 Ga0206350_11177477 3300020080 Bacteria 703
442 Ga0206350_11276978 3300020080 Bacteria 3494
443 Ga0206354_10132274 3300020081 Bacteria 892
444 Ga0213872_10001684 3300021361 Bacteria 13911
445 Ga0213872_10010678 3300021361 Bacteria 4363
446 Ga0213876_10000023 3300021384 Bacteria 255370
447 Ga0213875_10012137 3300021388 Bacteria 4261
448 Ga0224712_10021233 3300022467 Bacteria 2218
449 Ga0224712_10035225 3300022467 Bacteria 1847
450 Ga0224712_10050639 3300022467 Bacteria 1614
451 Ga0224712_10146735 3300022467 Bacteria 1042
452 Ga0209435_103421 3300025206 Bacteria 1816
453 Ga0209760_100018 3300025207 Bacteria 172833
454 Ga0209760_100089 3300025207 Bacteria 72658
455 Ga0209760_100093 3300025207 Bacteria 71626
456 Ga0209784_100001 3300025224 Bacteria 3600592
457 Ga0209784_100126 3300025224 Bacteria 78815
458 Ga0209566_100001 3300025225 Bacteria 3600765
459 Ga0209566_100152 3300025225 Bacteria 78864
460 Ga0209674_100002 3300025226 Bacteria 3600592
461 Ga0209674_100177 3300025226 Bacteria 78864
462 Ga0209147_100179 3300025229 Bacteria 78864
463 Ga0209563_100002 3300025230 Bacteria 2045675
464 Ga0209563_100142 3300025230 Bacteria 78864
465 Ga0209563_101212 3300025230 Bacteria 7187
466 Ga0207427_100009 3300025231 Bacteria 663036
467 Ga0207427_100011 3300025231 Bacteria 640076
468 Ga0207427_100015 3300025231 Bacteria 542133
469 Ga0209437_100001 3300025233 Bacteria 2045675
470 Ga0209437_100027 3300025233 Bacteria 542133
471 Ga0209437_100044 3300025233 Bacteria 430619
472 Ga0209437_100103 3300025233 Bacteria 221904
473 Ga0209258_100366 3300025242 Bacteria 59744
474 Ga0209646_1000380 3300025246 Bacteria 28576
475 Ga0209677_100002 3300025253 Bacteria 2045675
476 Ga0209677_100125 3300025253 Bacteria 78864
477 Ga0209759_1001848 3300025256 Bacteria 10573
478 Ga0209759_1021634 3300025256 Bacteria 1458
479 Ga0209129_1000037 3300025258 Bacteria 326534
480 Ga0209233_1000039 3300025261 Bacteria 542133
481 Ga0209233_1000057 3300025261 Bacteria 430619
482 Ga0209233_1001125 3300025261 Bacteria 10912
483 Ga0209675_1004567 3300025291 Bacteria 6107
484 Ga0209676_1000002 3300025292 Bacteria 1732948
485 Ga0209676_1000017 3300025292 Bacteria 643409
486 Ga0209676_1000696 3300025292 Bacteria 47256
487 Ga0209676_1004220 3300025292 Bacteria 8131
488 Ga0209676_1055738 3300025292 Bacteria 1011
489 Ga0209050_1000037 3300025298 Bacteria 415612
490 Ga0209050_1025723 3300025298 Bacteria 1991
491 Ga0209050_1026442 3300025298 Bacteria 1941
492 Ga0209051_1000001 3300025303 Bacteria 1732974
493 Ga0209051_1000666 3300025303 Bacteria 38569
494 Ga0209051_1033587 3300025303 Bacteria 1938
495 Ga0209257_1000056 3300025304 Bacteria 403132
496 Ga0209257_1019138 3300025304 Bacteria 2594
497 Ga0207656_10004868 3300025321 Bacteria 4713
498 Ga0207656_10043071 3300025321 Bacteria 1924
499 Ga0207696_1000001 3300025711 Bacteria 2579611
500 Ga0207696_1000013 3300025711 Bacteria 524881
501 Ga0207696_1000029 3300025711 Bacteria 398074
502 Ga0207696_1000067 3300025711 Bacteria 228478
503 Ga0207696_1000081 3300025711 Bacteria 198887
504 Ga0207696_1000100 3300025711 Bacteria 171029
505 Ga0207696_1000117 3300025711 Bacteria 148004
506 Ga0207696_1000124 3300025711 Bacteria 139229
507 Ga0207696_1000147 3300025711 Bacteria 120603
508 Ga0207696_1000185 3300025711 Bacteria 97304
509 Ga0207696_1000275 3300025711 Bacteria 61367
510 Ga0207696_1000766 3300025711 Bacteria 21229
511 Ga0207696_1001267 3300025711 Bacteria 14132
512 Ga0207696_1003770 3300025711 Bacteria 6758
513 Ga0207696_1011700 3300025711 Bacteria 3144
514 Ga0207696_1032044 3300025711 Bacteria 1586
515 Ga0207655_1000002 3300025728 Bacteria 1148694
516 Ga0207655_1000004 3300025728 Bacteria 1021221
517 Ga0207655_1000007 3300025728 Bacteria 773492
518 Ga0207655_1000041 3300025728 Bacteria 333962
519 Ga0207655_1000062 3300025728 Bacteria 258054
520 Ga0207655_1000094 3300025728 Bacteria 196748
521 Ga0207655_1000115 3300025728 Bacteria 162114
522 Ga0207655_1000205 3300025728 Bacteria 102993
523 Ga0207655_1000540 3300025728 Bacteria 47892
524 Ga0207655_1000769 3300025728 Bacteria 35833
525 Ga0207655_1003638 3300025728 Bacteria 11388
526 Ga0207655_1006042 3300025728 Bacteria 8094
527 Ga0207655_1007903 3300025728 Bacteria 6830
528 Ga0207655_1011548 3300025728 Bacteria 5248
529 Ga0207655_1011844 3300025728 Bacteria 5152
530 Ga0207655_1013784 3300025728 Bacteria 4613
531 Ga0207655_1014509 3300025728 Bacteria 4448
532 Ga0207655_1019433 3300025728 Bacteria 3550
533 Ga0207655_1019756 3300025728 Bacteria 3502
534 Ga0207655_1020977 3300025728 Bacteria 3335
535 Ga0207655_1026768 3300025728 Bacteria 2761
536 Ga0207655_1033923 3300025728 Bacteria 2304
537 Ga0207655_1041602 3300025728 Bacteria 1968
538 Ga0207655_1096446 3300025728 Bacteria 1028
539 Ga0207713_1000001 3300025735 Bacteria 2295391
540 Ga0207713_1000023 3300025735 Bacteria 346097
541 Ga0207713_1000083 3300025735 Bacteria 160973
542 Ga0207713_1000208 3300025735 Bacteria 79660
543 Ga0207713_1000241 3300025735 Bacteria 72891
544 Ga0207713_1000397 3300025735 Bacteria 46586
545 Ga0207713_1001290 3300025735 Bacteria 20648
546 Ga0207713_1001368 3300025735 Bacteria 19839
547 Ga0207713_1001926 3300025735 Bacteria 15706
548 Ga0207713_1002140 3300025735 Bacteria 14704
549 Ga0207713_1006051 3300025735 Bacteria 7462
550 Ga0207713_1006520 3300025735 Bacteria 7095
551 Ga0207713_1006730 3300025735 Bacteria 6944
552 Ga0207713_1011365 3300025735 Bacteria 4850
553 Ga0207713_1015136 3300025735 Bacteria 3972
554 Ga0207713_1022789 3300025735 Bacteria 2963
555 Ga0207713_1046537 3300025735 Bacteria 1763
556 Ga0207713_1048315 3300025735 Bacteria 1714
557 Ga0207713_1050065 3300025735 Bacteria 1670
558 Ga0207710_10000057 3300025900 Bacteria 177544
559 Ga0207710_10000116 3300025900 Bacteria 99007
560 Ga0207680_10010111 3300025903 Bacteria 4709
561 Ga0207699_10081485 3300025906 Bacteria 2008
562 Ga0207699_10617707 3300025906 Bacteria 790
563 Ga0207705_10010468 3300025909 Bacteria 6744
564 Ga0207705_10176978 3300025909 Bacteria 1608
565 Ga0207684_10000375 3300025910 Bacteria 60578
566 Ga0207684_10022809 3300025910 Bacteria 5345
567 Ga0207654_10000004 3300025911 Bacteria 902334
568 Ga0207654_10004979 3300025911 Bacteria 6716
569 Ga0207654_10075807 3300025911 Bacteria 2011
570 Ga0207654_10222427 3300025911 Bacteria 1253
571 Ga0207654_10355931 3300025911 Bacteria 1009
572 Ga0207707_10002960 3300025912 Bacteria 15130
573 Ga0207707_10018917 3300025912 Bacteria 6005
574 Ga0207707_10060015 3300025912 Bacteria 3309
575 Ga0207707_10068088 3300025912 Bacteria 3101
576 Ga0207707_10159012 3300025912 Bacteria 1976
577 Ga0207707_10173916 3300025912 Bacteria 1881
578 Ga0207707_10210230 3300025912 Bacteria 1695
579 Ga0207707_10277738 3300025912 Bacteria 1451
580 Ga0207707_10371650 3300025912 Bacteria 1230
581 Ga0207707_10611870 3300025912 Bacteria 921
582 Ga0207695_10000026 3300025913 Bacteria 624558
583 Ga0207695_10005663 3300025913 Bacteria 16491
584 Ga0207695_10019479 3300025913 Bacteria 7815
585 Ga0207695_10025210 3300025913 Bacteria 6664
586 Ga0207695_10050803 3300025913 Bacteria 4359
587 Ga0207695_10051504 3300025913 Bacteria 4323
588 Ga0207695_10052355 3300025913 Bacteria 4278
589 Ga0207695_10092453 3300025913 Bacteria 3036
590 Ga0207695_10131539 3300025913 Bacteria 2460
591 Ga0207695_10168277 3300025913 Bacteria 2119
592 Ga0207695_10480417 3300025913 Bacteria 1125
593 Ga0207671_10002402 3300025914 Bacteria 20078
594 Ga0207671_10034020 3300025914 Bacteria 3789
595 Ga0207671_10051567 3300025914 Bacteria 3049
596 Ga0207671_10208201 3300025914 Bacteria 1529
597 Ga0207671_10259363 3300025914 Bacteria 1368
598 Ga0207671_10520887 3300025914 Bacteria 948
599 Ga0207693_10252945 3300025915 Bacteria 1382
600 Ga0207663_10465201 3300025916 Bacteria 977
601 Ga0207663_10647141 3300025916 Bacteria 834
602 Ga0207660_10025625 3300025917 Bacteria 4006
603 Ga0207660_10169795 3300025917 Bacteria 1688
604 Ga0207660_10173051 3300025917 Bacteria 1672
605 Ga0207660_10315648 3300025917 Bacteria 1247
606 Ga0207657_10002216 3300025919 Bacteria 21083
607 Ga0207657_10004132 3300025919 Bacteria 15407
608 Ga0207657_10067879 3300025919 Bacteria 3031
609 Ga0207649_10000091 3300025920 Bacteria 75046
610 Ga0207652_10013412 3300025921 Bacteria 6633
611 Ga0207652_10050651 3300025921 Bacteria 3558
612 Ga0207652_10122102 3300025921 Bacteria 2318
613 Ga0207652_10123933 3300025921 Bacteria 2301
614 Ga0207652_10205194 3300025921 Bacteria 1774
615 Ga0207652_10265675 3300025921 Bacteria 1548
616 Ga0207652_10331840 3300025921 Bacteria 1373
617 Ga0207652_10332695 3300025921 Bacteria 1371
618 Ga0207646_10000646 3300025922 Bacteria 45189
619 Ga0207646_10001061 3300025922 Bacteria 34965
620 Ga0207681_10003927 3300025923 Bacteria 9220
621 Ga0207681_10009509 3300025923 Bacteria 5941
622 Ga0207681_10012158 3300025923 Bacteria 5306
623 Ga0207694_10001887 3300025924 Bacteria 17377
624 Ga0207694_10006117 3300025924 Bacteria 9201
625 Ga0207694_10016836 3300025924 Bacteria 5522
626 Ga0207694_10111105 3300025924 Bacteria 2180
627 Ga0207694_10207946 3300025924 Bacteria 1594
628 Ga0207650_10000002 3300025925 Bacteria 1439222
629 Ga0207650_10196516 3300025925 Bacteria 1614
630 Ga0207687_10016550 3300025927 Bacteria 4844
631 Ga0207687_10590549 3300025927 Bacteria 935
632 Ga0207700_10143008 3300025928 Bacteria 1968
633 Ga0207664_10021199 3300025929 Bacteria 4827
634 Ga0207664_10162988 3300025929 Bacteria 1903
635 Ga0207644_10000114 3300025931 Bacteria 59996
636 Ga0207690_10185857 3300025932 Bacteria 1568
637 Ga0207706_10005988 3300025933 Bacteria 11308
638 Ga0207706_10449114 3300025933 Bacteria 1115
639 Ga0207686_10018755 3300025934 Bacteria 3921
640 Ga0207686_10404358 3300025934 Bacteria 1041
641 Ga0207709_10000014 3300025935 Bacteria 526302
642 Ga0207709_10000057 3300025935 Bacteria 216617
643 Ga0207709_10044337 3300025935 Bacteria 2687
644 Ga0207709_10045254 3300025935 Bacteria 2664
645 Ga0207704_10267511 3300025938 Bacteria 1292
646 Ga0207665_10229470 3300025939 Bacteria 1364
647 Ga0207691_10011158 3300025940 Bacteria 8623
648 Ga0207711_10000540 3300025941 Bacteria 38701
649 Ga0207711_10094296 3300025941 Bacteria 2637
650 Ga0207661_10104321 3300025944 Bacteria 2387
651 Ga0207661_10162496 3300025944 Bacteria 1938
652 Ga0207661_10293109 3300025944 Bacteria 1457
653 Ga0207661_10336558 3300025944 Bacteria 1359
654 Ga0207679_10000016 3300025945 Bacteria 253494
655 Ga0207679_10003924 3300025945 Bacteria 9236
656 Ga0207679_10355068 3300025945 Bacteria 1279
657 Ga0207679_10565822 3300025945 Bacteria 1021
658 Ga0207667_10000056 3300025949 Bacteria 206107
659 Ga0207667_10007192 3300025949 Bacteria 13428
660 Ga0207667_10008358 3300025949 Bacteria 12301
661 Ga0207667_10011443 3300025949 Bacteria 10312
662 Ga0207667_10015452 3300025949 Bacteria 8671
663 Ga0207667_10047933 3300025949 Bacteria 4519
664 Ga0207667_10050239 3300025949 Bacteria 4400
665 Ga0207667_10332042 3300025949 Bacteria 1552
666 Ga0207651_10900677 3300025960 Bacteria 788
667 Ga0207712_10035652 3300025961 Bacteria 3382
668 Ga0207712_10098219 3300025961 Bacteria 2171
669 Ga0207712_10263888 3300025961 Bacteria 1398
670 Ga0207668_10056646 3300025972 Bacteria 2730
671 Ga0207640_10066017 3300025981 Bacteria 2416
672 Ga0207658_10000001 3300025986 Bacteria 1439333
673 Ga0207658_10278685 3300025986 Bacteria 1432
674 Ga0207658_10711757 3300025986 Bacteria 908
675 Ga0207703_10139240 3300026035 Bacteria 2104
676 Ga0207639_10002091 3300026041 Bacteria 13437
677 Ga0207639_10042648 3300026041 Bacteria 3401
678 Ga0207639_10134728 3300026041 Bacteria 2050
679 Ga0207708_10339945 3300026075 Bacteria 1229
680 Ga0207702_10222315 3300026078 Bacteria 1760
681 Ga0207702_10364738 3300026078 Bacteria 1385
682 Ga0207641_10010424 3300026088 Bacteria 7637
683 Ga0207641_10034576 3300026088 Bacteria 4205
684 Ga0207641_10043029 3300026088 Bacteria 3791
685 Ga0207641_10058260 3300026088 Bacteria 3287
686 Ga0207648_10122125 3300026089 Bacteria 2290
687 Ga0207648_10376716 3300026089 Bacteria 1283
688 Ga0207676_10000001 3300026095 Bacteria 1439222
689 Ga0207676_10033379 3300026095 Bacteria 3888
690 Ga0207676_10268177 3300026095 Bacteria 1545
691 Ga0207674_10006670 3300026116 Bacteria 13558
692 Ga0207674_10011684 3300026116 Bacteria 9857
693 Ga0207674_10023573 3300026116 Bacteria 6590
694 Ga0207674_10090377 3300026116 Bacteria 3053
695 Ga0207674_10127165 3300026116 Bacteria 2514
696 Ga0207674_10362769 3300026116 Bacteria 1400
697 Ga0207674_10393041 3300026116 Bacteria 1340
698 Ga0207683_10229593 3300026121 Bacteria 1692
699 Ga0207683_10500576 3300026121 Bacteria 1122
700 Ga0207698_10000016 3300026142 Bacteria 183355
701 Ga0207698_10008579 3300026142 Bacteria 6475
702 Ga0207698_10012294 3300026142 Bacteria 5595
703 Ga0207698_10028126 3300026142 Bacteria 4004
704 Ga0207698_11008029 3300026142 Bacteria 844
705 Ga0209281_1000004 3300027111 Bacteria 1253949
706 Ga0209281_1000014 3300027111 Bacteria 643021
707 Ga0209281_1000038 3300027111 Bacteria 361154
708 Ga0209281_1000073 3300027111 Bacteria 269036
709 Ga0209281_1000095 3300027111 Bacteria 238108
710 Ga0209281_1000219 3300027111 Bacteria 123456
711 Ga0209281_1000245 3300027111 Bacteria 109870
712 Ga0209281_1000286 3300027111 Bacteria 94163
713 Ga0209281_1000523 3300027111 Bacteria 49786
714 Ga0209281_1001391 3300027111 Bacteria 14786
715 Ga0209281_1001556 3300027111 Bacteria 12619
716 Ga0209281_1014319 3300027111 Bacteria 1683
717 Ga0209281_1034725 3300027111 Bacteria 880
718 Ga0209389_1000059 3300027296 Bacteria 106207
719 Ga0209371_1000001 3300027312 Bacteria 2771503
720 Ga0209371_1000005 3300027312 Bacteria 1061740
721 Ga0209371_1000015 3300027312 Bacteria 659640
722 Ga0209371_1000074 3300027312 Bacteria 198823
723 Ga0209371_1000108 3300027312 Bacteria 141822
724 Ga0209371_1000118 3300027312 Bacteria 134470
725 Ga0209371_1000559 3300027312 Bacteria 34100
726 Ga0209371_1000623 3300027312 Bacteria 31527
727 Ga0209371_1001065 3300027312 Bacteria 20506
728 Ga0209371_1001486 3300027312 Bacteria 15660
729 Ga0209371_1001911 3300027312 Bacteria 12728
730 Ga0209371_1001929 3300027312 Bacteria 12659
731 Ga0209371_1003423 3300027312 Bacteria 7729
732 Ga0209371_1005379 3300027312 Bacteria 5108
733 Ga0209371_1005669 3300027312 Bacteria 4884
734 Ga0209371_1005973 3300027312 Bacteria 4662
735 Ga0209371_1008915 3300027312 Bacteria 3257
736 Ga0209371_1039405 3300027312 Bacteria 968
737 Ga0209371_1047394 3300027312 Bacteria 840
738 Ga0209969_1038876 3300027360 Bacteria 736
739 Ga0209996_1001408 3300027395 Bacteria 2891
740 Ga0209995_1002861 3300027471 Bacteria 2737
741 Ga0209968_1017603 3300027526 Bacteria 1141
742 Ga0209999_1000815 3300027543 Bacteria 5139
743 Ga0209999_1003362 3300027543 Bacteria 2855
744 Ga0209982_1000570 3300027552 Bacteria 4616
745 Ga0209970_1051345 3300027614 Bacteria 746
746 Ga0210002_1014314 3300027617 Bacteria 1243
747 Ga0209983_1008056 3300027665 Bacteria 2154
748 Ga0209971_1002760 3300027682 Bacteria 4197
749 Ga0209974_10011293 3300027876 Bacteria 3004
750 Ga0209974_10020683 3300027876 Bacteria 2181
751 Ga0207428_10009183 3300027907 Bacteria 8883
752 Ga0207428_10307440 3300027907 Bacteria 1173
753 Ga0268266_10000260 3300028379 Bacteria 88643
754 Ga0268266_10000922 3300028379 Bacteria 37700
755 Ga0268266_10008882 3300028379 Bacteria 8898
756 Ga0268266_10014247 3300028379 Bacteria 6838
757 Ga0268266_10394983 3300028379 Bacteria 1307
758 Ga0268265_10001710 3300028380 Bacteria 17840
759 Ga0268265_10180571 3300028380 Bacteria 1813
760 Ga0268265_10364450 3300028380 Bacteria 1324
761 Ga0268265_10761446 3300028380 Bacteria 941
762 Ga0268264_10000004 3300028381 Bacteria 1116842
763 Ga0268264_10187921 3300028381 Bacteria 1881
764 Ga0268264_10432056 3300028381 Bacteria 1272
765 Ga0265334_10000027 3300028573 Bacteria 116133
766 Ga0265338_10005574 3300028800 Bacteria 16374
767 Ga0265338_10009230 3300028800 Bacteria 11804
768 Ga0265338_10703116 3300028800 Bacteria 697
769 Ga0268256_1000001 3300030500 Bacteria 2771065
770 Ga0268256_1000006 3300030500 Bacteria 1063991
771 Ga0268256_1000018 3300030500 Bacteria 594572
772 Ga0268256_1000035 3300030500 Bacteria 384794
773 Ga0268256_1000067 3300030500 Bacteria 198823
774 Ga0268256_1000076 3300030500 Bacteria 178295
775 Ga0268256_1000100 3300030500 Bacteria 134526
776 Ga0268256_1001225 3300030500 Bacteria 16220
777 Ga0268256_1001273 3300030500 Bacteria 15660
778 Ga0268256_1002311 3300030500 Bacteria 9873
779 Ga0268256_1003145 3300030500 Bacteria 7695
780 Ga0268256_1005534 3300030500 Bacteria 4927
781 Ga0268256_1005606 3300030500 Bacteria 4884
782 Ga0268256_1009434 3300030500 Bacteria 3238
783 Ga0268256_1009898 3300030500 Bacteria 3125
784 Ga0268256_1012362 3300030500 Bacteria 2643
785 Ga0268256_1019408 3300030500 Bacteria 1863
786 Ga0314311_1177641 3300030733 Bacteria 10294
787 Ga0316183_1021560 3300030742 Bacteria 1239
788 Ga0316181_1094953 3300030744 Bacteria 3560
789 Ga0265339_10010931 3300031249 Bacteria 5611
790 Ga0265331_10009805 3300031250 Bacteria 5342
791 Ga0265331_10085094 3300031250 Bacteria 1465
792 Ga0265327_10000014 3300031251 Bacteria 506288
793 Ga0265327_10000068 3300031251 Bacteria 219962
794 Ga0307408_100000004 3300031548 Bacteria 572889
795 Ga0316575_10034839 3300031665 Bacteria 1978
796 Ga0316575_10111770 3300031665 Bacteria 1115
797 Ga0316579_10077408 3300031691 Bacteria 1581
798 Ga0316579_10258132 3300031691 Bacteria 843
799 Ga0265314_10000200 3300031711 Bacteria 88202
800 Ga0265314_10170386 3300031711 Bacteria 1315
801 Ga0265314_10192298 3300031711 Bacteria 1213
802 Ga0316576_10007643 3300031727 Bacteria 6818
803 Ga0316576_10029210 3300031727 Bacteria 3894
804 Ga0316576_10073876 3300031727 Bacteria 2520
805 Ga0316576_10398958 3300031727 Bacteria 1019
806 Ga0316576_10450987 3300031727 Bacteria 950
807 Ga0316578_10039501 3300031728 Bacteria 2726
808 Ga0316578_10040877 3300031728 Bacteria 2683
809 Ga0316578_10051828 3300031728 Bacteria 2404
810 Ga0316578_10096159 3300031728 Bacteria 1773
811 Ga0316578_10130874 3300031728 Bacteria 1510
812 Ga0316578_10162476 3300031728 Bacteria 1346
813 Ga0316578_10164734 3300031728 Bacteria 1336
814 Ga0316578_10325902 3300031728 Bacteria 916
815 Ga0316577_10014110 3300031733 Bacteria 4385
816 Ga0316577_10025136 3300031733 Bacteria 3313
817 Ga0316577_10054961 3300031733 Bacteria 2222
818 Ga0307407_10926423 3300031903 Bacteria 670
819 Ga0307412_10204864 3300031911 Bacteria 1501
820 Ga0307414_10309274 3300032004 Bacteria 1340
821 Ga0307414_10354090 3300032004 Bacteria 1261
822 Ga0316583_10021544 3300032133 Bacteria 2310
823 Ga0316583_10063189 3300032133 Bacteria 1297
824 Ga0316583_10075812 3300032133 Bacteria 1176
825 Ga0316583_10149250 3300032133 Bacteria 814
826 Ga0316580_10094174 3300032139 Bacteria 917
827 Ga0307510_10149283 3300033180 Bacteria 1961
828 Ga0316588_1068150 3300033528 Bacteria 872
829 Ga0316574_0009492 3300035398 Bacteria 5451
830 Ga0316574_0057866 3300035398 Bacteria 2428
831 Ga0316574_0079136 3300035398 Bacteria 2085
832 Ga0373931_0113716 3300035691 Bacteria 1539
833 Ga0373931_0212543 3300035691 Bacteria 1161
834 Ga0373937_0138772 3300036401 Bacteria 2274
835 Ga0373937_0468333 3300036401 Bacteria 1197
836 Ga0373937_0994095 3300036401 Bacteria 788
837 Ga0316582_0002360 3300036647 Bacteria 8847
838 Ga0316582_0008667 3300036647 Bacteria 5475
839 Ga0316582_0043570 3300036647 Bacteria 2816
840 Ga0316582_0054014 3300036647 Bacteria 2556
841 Ga0316582_0067917 3300036647 Bacteria 2301
842 Ga0316582_0138315 3300036647 Unclassified 1641
843 Ga0316582_0301093 3300036647 Bacteria 1102
844 Ga0316582_0328019 3300036647 Bacteria 1052
845 Ga0316582_0478801 3300036647 Bacteria 858
846 Ga0316584_0003440 3300036712 Bacteria 10276
847 Ga0316584_0007542 3300036712 Bacteria 7453
848 Ga0316584_0026181 3300036712 Bacteria 4285
849 Ga0316584_0032332 3300036712 Bacteria 3873
850 Ga0316584_0118564 3300036712 Bacteria 1979
851 Ga0316584_0123617 3300036712 Bacteria 1933
852 Ga0316584_0189578 3300036712 Bacteria 1520
853 Ga0316584_0261120 3300036712 Bacteria 1263
854 Ga0316584_0315928 3300036712 Unclassified 1128
855 Ga0373925_0234933 3300037068 Bacteria 1467
856 Ga0373925_0253900 3300037068 Bacteria 1411
857 Ga0395899_0137518 3300037312 Bacteria 1741
858 Ga0395900_0050862 3300037418 Bacteria 4268
859 Ga0316581_0022472 3300037588 Bacteria 1860
860 Ga0316581_0143268 3300037588 Bacteria 737
861 Ga0436364_0207702 3300037853 Bacteria 15053
862 Ga0395901_0594051 3300038443 Bacteria 1117
863 Ga0237819_01448 3300038705 Bacteria 6101
864 Ga0436365_0965775 3300039437 Bacteria 470291
865 Ga0436361_0242772 3300039447 Bacteria 10101
866 Ga0436361_0245497 3300039447 Bacteria 13991
867 Ga0436362_0424287 3300039453 Bacteria 1473
868 Ga0439436_0009562 3300041404 Bacteria 2973
869 Ga0439438_000002 3300041405 Bacteria 618223
870 Ga0439438_005231 3300041405 Bacteria 4814
871 Ga0439438_010532 3300041405 Bacteria 2918
872 Ga0439438_013436 3300041405 Bacteria 2470
873 Ga0439438_039147 3300041405 Bacteria 1235
874 Ga0439447_000766 3300041407 Bacteria 11849
875 Ga0439447_001765 3300041407 Bacteria 7934
876 Ga0439447_004016 3300041407 Bacteria 5147
877 Ga0439466_0000001 3300041411 Bacteria 647258
878 Ga0439466_0043834 3300041411 Bacteria 1484
879 Ga0451807_2221466 3300041486 Bacteria 1549
880 Ga0451853_3687995 3300041512 Bacteria 1643
881 Ga0439431_0000701 3300041997 Bacteria 7210
882 Ga0439437_001932 3300042000 Bacteria 2202
883 Ga0439432_006455 3300042006 Bacteria 4187
884 Ga0439432_008550 3300042006 Bacteria 3592
885 Ga0439432_019197 3300042006 Bacteria 2278
886 Ga0439452_000002 3300042010 Bacteria 1377577
887 Ga0439452_000015 3300042010 Bacteria 342948
888 Ga0439452_000020 3300042010 Bacteria 309345
889 Ga0439452_002528 3300042010 Bacteria 6726
890 Ga0439452_003897 3300042010 Bacteria 5114
891 Ga0439452_010867 3300042010 Bacteria 2633
892 Ga0439452_013703 3300042010 Bacteria 2269
893 Ga0439456_002909 3300042013 Bacteria 3460
894 Ga0439463_008014 3300042016 Bacteria 2606
895 Ga0450911_000013 3300042115 Bacteria 129019
896 Ga0450891_003387 3300042129 Bacteria 1537
897 Ga0450900_006691 3300042136 Bacteria 1401
898 Ga0450904_000563 3300042139 Bacteria 6971
899 Ga0450905_003201 3300042142 Bacteria 2147
900 Ga0450907_001332 3300042146 Bacteria 5489
901 Ga0439464_0001265 3300042439 Bacteria 5876
902 Ga0439464_0008628 3300042439 Bacteria 2670
903 Ga0439464_0009525 3300042439 Bacteria 2558
904 Ga0450916_008641 3300042530 Bacteria 1243
905 Ga0450901_001122 3300042533 Bacteria 3104
906 Ga0451577_0189897 3300042876 Bacteria 1853
907 Ga0451577_0238178 3300042876 Bacteria 1646
908 Ga0451577_1074925 3300042876 Bacteria 721
909 Ga0466981_0000013 3300044669 Bacteria 129274
910 Ga0453683_0085063 3300044673 Unclassified 1981
911 Ga0466961_0262982 3300044693 Bacteria 1058
912 Ga0453684_0163432 3300044712 Bacteria 2631
913 Ga0453684_0205476 3300044712 Bacteria 2293
914 Ga0451576_0074345 3300045051 Bacteria 3536
915 Ga0495627_001293 3300046453 Bacteria 15345
916 Ga0495627_002814 3300046453 Bacteria 8071
917 Ga0495627_004099 3300046453 Bacteria 6194
918 Ga0495627_011664 3300046453 Bacteria 3146
919 Ga0495603_0001787 3300046455 Bacteria 12689
920 Ga0495603_0007169 3300046455 Bacteria 6696
921 Ga0495590_0065519 3300046457 Bacteria 1272
922 Ga0495591_000001 3300046458 Bacteria 503087
923 Ga0495591_000294 3300046458 Bacteria 45588
924 Ga0495591_002693 3300046458 Bacteria 9637
925 Ga0495591_003463 3300046458 Bacteria 8135
926 Ga0495591_018161 3300046458 Bacteria 2391
927 Ga0495591_019023 3300046458 Bacteria 2312
928 Ga0495591_022970 3300046458 Bacteria 2007
929 Ga0495629_0004989 3300046459 Bacteria 9953
930 Ga0495629_0041111 3300046459 Bacteria 3253
931 Ga0495651_0007356 3300046462 Bacteria 8420
932 Ga0495651_0075679 3300046462 Bacteria 2551
933 Ga0495651_0352907 3300046462 Bacteria 971
934 Ga0495653_0009486 3300046463 Bacteria 7967
935 Ga0495653_0096886 3300046463 Bacteria 2144
936 Ga0495650_0000018 3300046471 Bacteria 538888
937 Ga0495650_0000047 3300046471 Bacteria 335136
938 Ga0495650_0000065 3300046471 Bacteria 275124
939 Ga0495650_0034724 3300046471 Bacteria 2228
940 Ga0495650_0041541 3300046471 Bacteria 1966
941 Ga0495580_0097021 3300046472 Bacteria 2050
942 Ga0495580_0123367 3300046472 Bacteria 1798
943 Ga0495580_0278565 3300046472 Bacteria 1141
944 Ga0495580_0289104 3300046472 Bacteria 1117
945 Ga0495582_0001734 3300046473 Bacteria 12309
946 Ga0495605_0001329 3300046474 Bacteria 16353
947 Ga0495605_0003755 3300046474 Bacteria 9013
948 Ga0495605_0016097 3300046474 Bacteria 4053
949 Ga0495605_0062880 3300046474 Bacteria 1772
950 Ga0495639_0000745 3300046475 Bacteria 14896
951 Ga0495662_0001664 3300046476 Bacteria 11072
952 Ga0495664_0010856 3300046477 Bacteria 5120
953 Ga0495584_0009860 3300046491 Bacteria 4911
954 Ga0495584_0054593 3300046491 Bacteria 2010
955 Ga0495585_0004297 3300046492 Bacteria 9275
956 Ga0495585_0054882 3300046492 Bacteria 2202
957 Ga0495585_0073715 3300046492 Bacteria 1858
958 Ga0495594_0000216 3300046499 Bacteria 28040
959 Ga0495594_0000830 3300046499 Bacteria 15930
960 Ga0495594_0052832 3300046499 Bacteria 2237
961 Ga0495596_0031937 3300046500 Bacteria 2101
962 Ga0495596_0110699 3300046500 Bacteria 1066
963 Ga0495607_0007302 3300046501 Bacteria 7663
964 Ga0495607_0007331 3300046501 Bacteria 7645
965 Ga0495607_0013183 3300046501 Bacteria 5428
966 Ga0495607_0046555 3300046501 Bacteria 2546
967 Ga0495607_0144411 3300046501 Bacteria 1224
968 Ga0495583_0002373 3300046506 Bacteria 16250
969 Ga0495606_0002485 3300046507 Bacteria 21334
970 Ga0495606_0008696 3300046507 Bacteria 8745
971 Ga0495606_0018216 3300046507 Bacteria 5275
972 Ga0495606_0067958 3300046507 Bacteria 2256
973 Ga0495606_0111942 3300046507 Bacteria 1645
974 Ga0495608_0092071 3300046511 Bacteria 1960
975 Ga0495610_0005513 3300046512 Bacteria 8965
976 Ga0495610_0027951 3300046512 Bacteria 2989
977 Ga0495616_0130415 3300046513 Bacteria 1152
978 Ga0495620_0000442 3300046515 Bacteria 27759
979 Ga0495620_0020756 3300046515 Bacteria 3201
980 Ga0495620_0079176 3300046515 Bacteria 1332
981 Ga0495620_0086445 3300046515 Bacteria 1262
982 Ga0495628_0020708 3300046516 Bacteria 5420
983 Ga0495628_0247745 3300046516 Bacteria 1331
984 Ga0495631_0005429 3300046518 Bacteria 6672
985 Ga0495631_0024246 3300046518 Bacteria 2802
986 Ga0495632_0017242 3300046519 Bacteria 3992
987 Ga0495632_0022277 3300046519 Bacteria 3397
988 Ga0495632_0050001 3300046519 Bacteria 2064
989 Ga0495632_0060310 3300046519 Bacteria 1843
990 Ga0495637_0010588 3300046520 Bacteria 4453
991 Ga0495643_0012496 3300046522 Bacteria 5121
992 Ga0495643_0020777 3300046522 Bacteria 3778
993 Ga0495643_0033482 3300046522 Bacteria 2842
994 Ga0495643_0084001 3300046522 Bacteria 1652
995 Ga0495644_0000233 3300046523 Bacteria 26270
996 Ga0495644_0005253 3300046523 Bacteria 5060
997 Ga0495648_0012791 3300046524 Bacteria 6232
998 Ga0495648_0021611 3300046524 Bacteria 4452
999 Ga0495648_0034739 3300046524 Bacteria 3277
1000 Ga0495648_0049812 3300046524 Bacteria 2564
1001 Ga0495666_0003666 3300046526 Bacteria 7757
1002 Ga0495642_0079041 3300046528 Bacteria 1383
1003 Ga0495654_0000009 3300046530 Bacteria 381872
1004 Ga0495654_0001323 3300046530 Bacteria 17296
1005 Ga0495654_0002421 3300046530 Bacteria 12017
1006 Ga0495654_0015044 3300046530 Bacteria 4111
1007 Ga0495654_0030540 3300046530 Bacteria 2740
1008 Ga0495654_0133639 3300046530 Bacteria 1111
1009 Ga0495654_0179076 3300046530 Bacteria 919
1010 Ga0495665_0014859 3300046531 Bacteria 4193
1011 Ga0495640_0007292 3300046533 Bacteria 8712
1012 Ga0495586_0194202 3300046535 Bacteria 1150
1013 Ga0495587_0055535 3300046536 Bacteria 2332
1014 Ga0495609_0000051 3300046538 Bacteria 153822
1015 Ga0495609_0003299 3300046538 Bacteria 9307
1016 Ga0495609_0024685 3300046538 Bacteria 2756
1017 Ga0495597_0004166 3300046542 Bacteria 8020
1018 Ga0495645_0234118 3300046543 Bacteria 1229
1019 Ga0495622_0033549 3300046557 Bacteria 2395
1020 Ga0495633_0000915 3300046558 Bacteria 25017
1021 Ga0495633_0027564 3300046558 Bacteria 2776
1022 Ga0495667_0012738 3300046559 Bacteria 5699
1023 Ga0495634_0003158 3300046642 Bacteria 13334
1024 Ga0495611_0020449 3300046648 Bacteria 2849
1025 Ga0495611_0025207 3300046648 Bacteria 2590
1026 Ga0495611_0028487 3300046648 Bacteria 2446
1027 Ga0495625_0000004 3300046660 Bacteria 611314
1028 Ga0495625_0011960 3300046660 Bacteria 7044
1029 Ga0495625_0016366 3300046660 Bacteria 5839
1030 Ga0495635_0029627 3300046663 Bacteria 3806
1031 Ga0495661_0000013 3300046665 Bacteria 259387
1032 Ga0495661_0000548 3300046665 Bacteria 38896
1033 Ga0495661_0000809 3300046665 Bacteria 29384
1034 Ga0495588_0036433 3300046674 Bacteria 2496
1035 Ga0495588_0051895 3300046674 Bacteria 2113
1036 Ga0495657_0126901 3300046675 Bacteria 1602
1037 Ga0495599_0001842 3300046678 Bacteria 12288
1038 Ga0495599_0172334 3300046678 Bacteria 1335
1039 Ga0495623_0026675 3300046679 Bacteria 3717
1040 Ga0495623_0059092 3300046679 Bacteria 2409
1041 Ga0495646_0006639 3300046680 Bacteria 7336
1042 Ga0495658_0224910 3300046683 Bacteria 1176
1043 Ga0495669_0001216 3300046684 Bacteria 10714
1044 Ga0495613_0032456 3300046689 Bacteria 3879
1045 Ga0495613_0082068 3300046689 Bacteria 2341
1046 Ga0495613_0122210 3300046689 Bacteria 1869
1047 Ga0495613_0196759 3300046689 Bacteria 1423
1048 Ga0495624_0003705 3300046690 Bacteria 11297
1049 Ga0495670_0004477 3300046691 Bacteria 6853
1050 Ga0495671_0002913 3300046692 Bacteria 10671
1051 Ga0495671_0049519 3300046692 Bacteria 2094
1052 Ga0495671_0076738 3300046692 Bacteria 1638
1053 Ga0495649_0015931 3300046694 Bacteria 4268
1054 Ga0495649_0020506 3300046694 Bacteria 3708
1055 Ga0495649_0100822 3300046694 Bacteria 1534
1056 Ga0495649_0352189 3300046694 Bacteria 744
1057 Ga0495589_0000003 3300046794 Bacteria 453448
1058 Ga0495589_0015919 3300046794 Bacteria 3866
1059 Ga0495589_0048748 3300046794 Bacteria 2096
1060 Ga0495589_0089504 3300046794 Bacteria 1495
1061 Ga0495589_0091341 3300046794 Bacteria 1478
1062 Ga0495600_0000817 3300046809 Bacteria 16536
1063 Ga0495600_0107321 3300046809 Bacteria 1819
1064 Ga0495660_0000004 3300046810 Bacteria 1003183
1065 Ga0495660_0000017 3300046810 Bacteria 320655
1066 Ga0495660_0072561 3300046810 Bacteria 1822
1067 Ga0495660_0136060 3300046810 Bacteria 1227
1068 Ga0495581_0059696 3300047315 Bacteria 2204
1069 Ga0495604_0005986 3300047317 Bacteria 9655
1070 Ga0495604_0016655 3300047317 Bacteria 5878
1071 Ga0495674_0014787 3300047319 Bacteria 7300
1072 Ga0495674_0049201 3300047319 Bacteria 3726
1073 Ga0495672_0000001 3300047320 Bacteria 1458820
1074 Ga0495672_0000009 3300047320 Bacteria 557755
1075 Ga0495672_0000038 3300047320 Bacteria 273489
1076 Ga0495672_0053550 3300047320 Bacteria 2364
1077 Ga0495672_0126990 3300047320 Bacteria 1347
1078 Ga0495676_0000023 3300047321 Bacteria 156478
1079 Ga0495676_0006988 3300047321 Bacteria 10358
1080 Ga0495676_0054753 3300047321 Bacteria 3168
1081 Ga0495680_0085480 3300047322 Bacteria 2375
1082 Ga0495680_0107043 3300047322 Bacteria 2077
1083 Ga0495683_0000090 3300047323 Bacteria 91954
1084 Ga0495683_0000514 3300047323 Bacteria 29686
1085 Ga0495675_0000711 3300047444 Bacteria 20794
1086 Ga0495675_0021010 3300047444 Bacteria 4156
1087 Ga0495679_000032 3300047446 Bacteria 171636
1088 Ga0495679_000505 3300047446 Bacteria 27693
1089 Ga0495679_001387 3300047446 Bacteria 13885
1090 Ga0495679_004343 3300047446 Bacteria 6569
1091 Ga0495679_015469 3300047446 Bacteria 2789
1092 Ga0495673_0000019 3300047469 Bacteria 554389
1093 Ga0495673_0000071 3300047469 Bacteria 217117
1094 Ga0495673_0023667 3300047469 Bacteria 2982
1095 Ga0495673_0044074 3300047469 Bacteria 1992
1096 Ga0495673_0067656 3300047469 Bacteria 1511
1097 Ga0495684_0009188 3300047471 Bacteria 7633
1098 Ga0495686_0089975 3300047472 Bacteria 1864
1099 Ga0495614_0001515 3300048089 Bacteria 10066
1100 Ga0495614_0014267 3300048089 Bacteria 3481
1101 Ga0495626_0000095 3300048091 Bacteria 114682
1102 Ga0496100_0080311 3300048903 Bacteria 2200
1103 Ga0496100_0232381 3300048903 Bacteria 1357
1104 Ga0496100_0378827 3300048903 Bacteria 1074
1105 Ga0496101_0000060 3300048904 Bacteria 128504
1106 Ga0496101_0603971 3300048904 Bacteria 867
1107 Ga0496102_0029999 3300048905 Bacteria 4867
1108 Ga0496102_0150812 3300048905 Bacteria 2184
1109 Ga0496102_0171025 3300048905 Bacteria 2045
1110 Ga0496103_0110321 3300048906 Bacteria 1747
1111 Ga0496103_0382227 3300048906 Bacteria 905
1112 Ga0496104_0000212 3300048907 Bacteria 51443
1113 Ga0496104_0043660 3300048907 Bacteria 4210
1114 Ga0496105_0062827 3300048908 Bacteria 3064
1115 Ga0496105_0209586 3300048908 Bacteria 1589
1116 Ga0496106_0367030 3300048909 Bacteria 1157
1117 Ga0496108_0054724 3300048911 Bacteria 3349
1118 Ga0496109_0101743 3300048912 Bacteria 2667
1119 Ga0496110_0438032 3300048913 Bacteria 1191
1120 Ga0496112_0013081 3300048915 Bacteria 7655
1121 Ga0496112_0026555 3300048915 Bacteria 5574
1122 Ga0496112_0350858 3300048915 Bacteria 1418
1123 Ga0496113_0123491 3300048916 Bacteria 2026
1124 Ga0496113_0392597 3300048916 Bacteria 1114
1125 Ga0496114_0069631 3300048917 Bacteria 2954
1126 Ga0496116_0000007 3300048919 Bacteria 795464
1127 Ga0496116_0000118 3300048919 Bacteria 168946
1128 Ga0496116_0000132 3300048919 Bacteria 156427
1129 Ga0496116_0000420 3300048919 Bacteria 59988
1130 Ga0496116_0000446 3300048919 Bacteria 57660
1131 Ga0496116_0006113 3300048919 Bacteria 11011
1132 Ga0496116_0014310 3300048919 Bacteria 6342
1133 Ga0496116_0043259 3300048919 Bacteria 3070
1134 Ga0496116_0092235 3300048919 Bacteria 1838
1135 Ga0496116_0109529 3300048919 Bacteria 1627
1136 Ga0496116_0167310 3300048919 Bacteria 1196
1137 Ga0496117_0000009 3300048920 Bacteria 613759
1138 Ga0496117_0000113 3300048920 Bacteria 181737
1139 Ga0496117_0000504 3300048920 Bacteria 64550
1140 Ga0496117_0002374 3300048920 Bacteria 24004
1141 Ga0496117_0008055 3300048920 Bacteria 10097
1142 Ga0496117_0008355 3300048920 Bacteria 9843
1143 Ga0496117_0021821 3300048920 Bacteria 5163
1144 Ga0496117_0026137 3300048920 Bacteria 4572
1145 Ga0496117_0089242 3300048920 Bacteria 1992
1146 Ga0496117_0118344 3300048920 Bacteria 1633
1147 Ga0496117_0125419 3300048920 Bacteria 1568
1148 Ga0496118_0000017 3300048921 Bacteria 549445
1149 Ga0496118_0001101 3300048921 Bacteria 41978
1150 Ga0496118_0001258 3300048921 Bacteria 38870
1151 Ga0496118_0003548 3300048921 Bacteria 19494
1152 Ga0496118_0003973 3300048921 Bacteria 18041
1153 Ga0496118_0007913 3300048921 Bacteria 11131
1154 Ga0496118_0040635 3300048921 Bacteria 3695
1155 Ga0496118_0200729 3300048921 Bacteria 1181
1156 Ga0496119_0000011 3300048922 Bacteria 438315
1157 Ga0496119_0000012 3300048922 Bacteria 411917
1158 Ga0496119_0000129 3300048922 Bacteria 106571
1159 Ga0496119_0000194 3300048922 Bacteria 85475
1160 Ga0496119_0000860 3300048922 Bacteria 40109
1161 Ga0496119_0008725 3300048922 Bacteria 8846
1162 Ga0496119_0008995 3300048922 Bacteria 8669
1163 Ga0496119_0043407 3300048922 Bacteria 2840
1164 Ga0496119_0050436 3300048922 Bacteria 2565
1165 Ga0496119_0053625 3300048922 Bacteria 2461
1166 Ga0496119_0073749 3300048922 Bacteria 1989
1167 Ga0496119_0095156 3300048922 Bacteria 1683
1168 Ga0496120_0000004 3300048923 Bacteria 534793
1169 Ga0496120_0000081 3300048923 Bacteria 158294
1170 Ga0496120_0000179 3300048923 Bacteria 107658
1171 Ga0496120_0000186 3300048923 Bacteria 106450
1172 Ga0496120_0000206 3300048923 Bacteria 101409
1173 Ga0496120_0000632 3300048923 Bacteria 52410
1174 Ga0496120_0001420 3300048923 Bacteria 28924
1175 Ga0496120_0002896 3300048923 Bacteria 16415
1176 Ga0496120_0007219 3300048923 Bacteria 8318
1177 Ga0496120_0066813 3300048923 Bacteria 1987
1178 Ga0496120_0082862 3300048923 Bacteria 1732
1179 Ga0496121_0000224 3300048924 Bacteria 122378
1180 Ga0496121_0148900 3300048924 Bacteria 1725
1181 Ga0496121_0156685 3300048924 Bacteria 1670
1182 Ga0496122_0000003 3300048925 Bacteria 645810
1183 Ga0496122_0000303 3300048925 Bacteria 108668
1184 Ga0496122_0001758 3300048925 Bacteria 33261
1185 Ga0496122_0001770 3300048925 Bacteria 33106
1186 Ga0496122_0003568 3300048925 Bacteria 20322
1187 Ga0496122_0008975 3300048925 Bacteria 10628
1188 Ga0496122_0066730 3300048925 Bacteria 2597
1189 Ga0496122_0070219 3300048925 Bacteria 2504
1190 Ga0496123_0000012 3300048926 Bacteria 458760
1191 Ga0496123_0000250 3300048926 Bacteria 108668
1192 Ga0496123_0001176 3300048926 Bacteria 38560
1193 Ga0496123_0007059 3300048926 Bacteria 10686
1194 Ga0496123_0008944 3300048926 Bacteria 9107
1195 Ga0496123_0010352 3300048926 Bacteria 8256
1196 Ga0496123_0013533 3300048926 Bacteria 6833
1197 Ga0496123_0016478 3300048926 Bacteria 5998
1198 Ga0496123_0036419 3300048926 Bacteria 3490
1199 Ga0496123_0051401 3300048926 Bacteria 2744
1200 Ga0496123_0167035 3300048926 Bacteria 1165
1201 Ga0496124_0000027 3300048927 Bacteria 376097
1202 Ga0496124_0000028 3300048927 Bacteria 357219
1203 Ga0496124_0000738 3300048927 Bacteria 53538
1204 Ga0496124_0001085 3300048927 Bacteria 42903
1205 Ga0496124_0001441 3300048927 Bacteria 35169
1206 Ga0496124_0002677 3300048927 Bacteria 22827
1207 Ga0496124_0003289 3300048927 Bacteria 19924
1208 Ga0496124_0009187 3300048927 Bacteria 10204
1209 Ga0496124_0019429 3300048927 Bacteria 6322
1210 Ga0496124_0042797 3300048927 Bacteria 3896
1211 Ga0496124_0066234 3300048927 Bacteria 3009
1212 Ga0496124_0068604 3300048927 Bacteria 2946
1213 Ga0496124_0106428 3300048927 Bacteria 2264
1214 Ga0496124_0209412 3300048927 Bacteria 1476
1215 Ga0496125_0000052 3300048928 Bacteria 281862
1216 Ga0496125_0008709 3300048928 Bacteria 10558
1217 Ga0496125_0025608 3300048928 Bacteria 5398
1218 Ga0496125_0074463 3300048928 Bacteria 2632
1219 Ga0496125_0098242 3300048928 Bacteria 2166
1220 Ga0496126_0000410 3300048929 Bacteria 87052
1221 Ga0496126_0021260 3300048929 Bacteria 6341
1222 Ga0496126_0032462 3300048929 Bacteria 4918
1223 Ga0496126_0072885 3300048929 Bacteria 3054
1224 Ga0496126_0077966 3300048929 Bacteria 2936
1225 Ga0496126_0130998 3300048929 Bacteria 2167
1226 Ga0496126_0287348 3300048929 Bacteria 1361
1227 Ga0495678_001728 3300049459 Bacteria 16296
1228 Ga0495678_002124 3300049459 Bacteria 14078
1229 Ga0495678_030301 3300049459 Bacteria 2265
1230 Ga0495682_0001613 3300049460 Bacteria 11619
1231 Ga0495682_0011912 3300049460 Bacteria 3342
1232 Ga0495682_0044862 3300049460 Bacteria 1616
1233 Ga0501314_007074 3300049530 Bacteria 990
1234 Ga0501033_0185145 3300049570 Bacteria 1492
1235 Ga0501034_0000145 3300049571 Bacteria 133121
1236 Ga0501034_0012355 3300049571 Bacteria 8822
1237 Ga0501034_0083430 3300049571 Bacteria 3197
1238 Ga0501034_0177261 3300049571 Bacteria 2097
1239 Ga0501034_0456501 3300049571 Bacteria 1195
1240 Ga0501037_0002871 3300049573 Bacteria 12492
1241 Ga0501037_0105348 3300049573 Bacteria 2033
1242 Ga0501038_0255896 3300049574 Bacteria 1385
1243 Ga0501039_0294740 3300049575 Bacteria 1275
1244 Ga0501043_0559202 3300049579 Bacteria 849
1245 Ga0501047_0010623 3300049581 Bacteria 8706
1246 Ga0501047_0147036 3300049581 Bacteria 2233
1247 Ga0501048_0299509 3300049582 Bacteria 1144
1248 Ga0501069_0293676 3300049585 Bacteria 952
1249 Ga0501070_0007727 3300049586 Bacteria 9117
1250 Ga0501070_0034696 3300049586 Bacteria 4217
1251 Ga0501070_0386169 3300049586 Bacteria 1134
1252 Ga0501071_0307709 3300049587 Bacteria 1202
1253 Ga0501074_0091382 3300049590 Bacteria 2180
1254 Ga0501257_024449 3300049686 Bacteria 1435
1255 Ga0501080_0032637 3300049742 Bacteria 4857
1256 Ga0501080_0493553 3300049742 Bacteria 1095
1257 Ga0501035_0014148 3300049822 Bacteria 7361
1258 Ga0501035_0058356 3300049822 Bacteria 3439
1259 Ga0501035_0290828 3300049822 Bacteria 1379
1260 Ga0501044_0001205 3300049823 Bacteria 30688
1261 Ga0501044_0036795 3300049823 Bacteria 5119
1262 Ga0501044_0067954 3300049823 Bacteria 3631
1263 Ga0501044_0205911 3300049823 Bacteria 1924
1264 Ga0501044_0415624 3300049823 Bacteria 1256
1265 Ga0501226_000015 3300049853 Bacteria 164151
1266 nmdc:mga00v17_122775_c1 3300050491 Bacteria 1655
1267 nmdc:mga00v17_154009_c1 3300050491 Bacteria 1477
1268 nmdc:mga00v17_163505_c1 3300050491 Bacteria 1434
1269 nmdc:mga00v17_50237_c1 3300050491 Bacteria 2533
1270 nmdc:mga00v17_9293_c1 3300050491 Bacteria 5316
1271 nmdc:mga0k408_41598_c2 3300050493 Bacteria 2112
1272 nmdc:mga05p37_189680_c1 3300050507 Bacteria 2497
1273 nmdc:mga05p37_307347_c1 3300050507 Bacteria 1881
1274 nmdc:mga05p37_82202_c1 3300050507 Bacteria 3969
1275 nmdc:mga05p37_845023_c1 3300050507 Bacteria 995
1276 nmdc:mga09592_12903_c1 3300050508 Bacteria 6814
1277 nmdc:mga09592_387204_c1 3300050508 Bacteria 1209
1278 nmdc:mga06r32_34801_c1 3300050510 Bacteria 4751
1279 nmdc:mga06r32_67343_c1 3300050510 Bacteria 3457
1280 nmdc:mga08y16_10120_c1 3300050511 Bacteria 9900
1281 nmdc:mga08y16_3586_c1 3300050511 Bacteria 16123
1282 nmdc:mga0n895_1048318_c1 3300050512 Bacteria 795
1283 nmdc:mga0n895_330408_c1 3300050512 Bacteria 1545
1284 nmdc:mga0n895_33421_c1 3300050512 Bacteria 4944
1285 nmdc:mga0n895_506666_c1 3300050512 Bacteria 1216
1286 nmdc:mga0rr50_55568_c1 3300050513 Bacteria 2954
1287 nmdc:mga0rr50_71339_c1 3300050513 Bacteria 2650
1288 nmdc:mga0rr50_754191_c1 3300050513 Bacteria 831
1289 nmdc:mga08x19_1868_c1 3300050514 Bacteria 12906
1290 nmdc:mga08x19_2799_c1 3300050514 Bacteria 10518
1291 nmdc:mga08x19_579971_c1 3300050514 Bacteria 794
1292 nmdc:mga0a205_232877_c1 3300050515 Bacteria 1725
1293 nmdc:mga0a205_315202_c1 3300050515 Bacteria 1436
1294 Ga0500650_0000029 3300053098 Bacteria 54937
1295 Ga0500618_014747 3300053125 Bacteria 1989
1296 Ga0500621_000070 3300053126 Bacteria 11635
1297 Ga0500659_0071065 3300053135 Bacteria 1844
1298 Ga0500568_0112300 3300053139 Bacteria 1018
1299 Ga0501084_0530363 3300054114 Bacteria 995
1300 Ga0587091_047756 3300059511 Bacteria 868
1301 Ga0587094_006971 3300059513 Bacteria 1373
1302 Ga0587117_005138 3300059627 Bacteria 1401
1303 Ga0587062_003284 3300059639 Bacteria 1622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10085268 Ga0065704_100852682 204
2 3300027614 Ga0209970_1051345 Ga0209970_10513451 204
3 3300042876 Ga0451577_0189897 Ga0451577_0189897_674_1351 204
4 3300028800 Ga0265338_10005574 Ga0265338_1000557415 205
5 3300042876 Ga0451577_0238178 Ga0451577_0238178_725_1354 205
6 3300044673 Ga0453683_0085063 Ga0453683_0085063_785_1420 205
7 3300044712 Ga0453684_0163432 Ga0453684_0163432_1980_2615 205
8 3300031665 Ga0316575_10034839 Ga0316575_100348392 206
9 3300031665 Ga0316575_10111770 Ga0316575_101117701 206
10 3300031727 Ga0316576_10073876 Ga0316576_100738763 206
11 3300031727 Ga0316576_10450987 Ga0316576_104509871 206
12 3300031728 Ga0316578_10040877 Ga0316578_100408772 206
13 3300031728 Ga0316578_10096159 Ga0316578_100961592 206
14 3300031728 Ga0316578_10162476 Ga0316578_101624762 206
15 3300031728 Ga0316578_10325902 Ga0316578_103259022 206
16 3300031733 Ga0316577_10054961 Ga0316577_100549613 206
17 3300032133 Ga0316583_10021544 Ga0316583_100215442 206
18 3300032133 Ga0316583_10063189 Ga0316583_100631892 206
19 3300032133 Ga0316583_10075812 Ga0316583_100758122 206
20 3300032133 Ga0316583_10149250 Ga0316583_101492501 206
21 3300033528 Ga0316588_1068150 Ga0316588_10681502 206
22 3300035398 Ga0316574_0009492 Ga0316574_0009492_1154_1783 206
23 3300035398 Ga0316574_0057866 Ga0316574_0057866_1245_1874 206
24 3300036647 Ga0316582_0054014 Ga0316582_0054014_450_1079 206
25 3300036647 Ga0316582_0328019 Ga0316582_0328019_166_795 206
26 3300036712 Ga0316584_0007542 Ga0316584_0007542_1003_1632 206
27 3300036712 Ga0316584_0026181 Ga0316584_0026181_103_732 206
28 3300044712 Ga0453684_0205476 Ga0453684_0205476_1094_1732 206
29 3300009094 Ga0111539_10002472 Ga0111539_1000247213 208
30 iso_pu_bacteria 2883068021 2883069488 208
31 iso_pu_bacteria 2884791551 2884792082 208
32 iso_pu_bacteria 2896109856 2896110367 208
33 iso_pu_bacteria 2929177148 2929181927 208
34 iso_pu_bacteria 2945977869 2945984323 208
35 iso_pu_bacteria 2946013367 2946016284 208
36 iso_pu_bacteria 8001522603 8001525446 208
37 3300049686 Ga0501257_024449 Ga0501257_024449_172_801 209
38 3300050511 nmdc:mga08y16_10120_c1 nmdc:mga08y16_10120_c1_687_1319 209
39 3300049571 Ga0501034_0177261 Ga0501034_0177261_554_1186 210
40 3300003322 rootL2_10021840 rootL2_100218408 211
41 3300004803 Ga0058862_12840720 Ga0058862_128407203 211
42 3300005295 Ga0065707_10054040 Ga0065707_100540401 211
43 3300005518 Ga0070699_100203295 Ga0070699_1002032952 211
44 3300005530 Ga0070679_100094428 Ga0070679_1000944284 211
45 3300005536 Ga0070697_100414222 Ga0070697_1004142222 211
46 3300005548 Ga0070665_100003302 Ga0070665_10000330217 211
47 3300005563 Ga0068855_100552887 Ga0068855_1005528872 211
48 3300005983 Ga0081540_1109528 Ga0081540_11095282 211
49 3300006358 Ga0068871_100235910 Ga0068871_1002359102 211
50 3300006844 Ga0075428_100020857 Ga0075428_1000208575 211
51 3300006846 Ga0075430_100132088 Ga0075430_1001320883 211
52 3300006871 Ga0075434_100166915 Ga0075434_1001669152 211
53 3300007076 Ga0075435_100504872 Ga0075435_1005048722 211
54 3300009093 Ga0105240_10003087 Ga0105240_1000308711 211
55 3300009093 Ga0105240_10096438 Ga0105240_100964383 211
56 3300009093 Ga0105240_10522986 Ga0105240_105229862 211
57 3300009545 Ga0105237_10742196 Ga0105237_107421962 211
58 3300013104 Ga0157370_10260773 Ga0157370_102607732 211
59 3300013105 Ga0157369_10384259 Ga0157369_103842592 211
60 3300013306 Ga0163162_10010274 Ga0163162_100102742 211
61 3300014968 Ga0157379_10027141 Ga0157379_100271413 211
62 3300020069 Ga0197907_10316666 Ga0197907_103166663 211
63 3300020069 Ga0197907_10479836 Ga0197907_104798363 211
64 3300020069 Ga0197907_10974095 Ga0197907_109740954 211
65 3300020075 Ga0206349_1221543 Ga0206349_12215432 211
66 3300020076 Ga0206355_1041887 Ga0206355_10418874 211
67 3300020076 Ga0206355_1413860 Ga0206355_14138602 211
68 3300020077 Ga0206351_10679320 Ga0206351_106793204 211
69 3300020078 Ga0206352_10109537 Ga0206352_101095372 211
70 3300020078 Ga0206352_10517688 Ga0206352_105176883 211
71 3300020080 Ga0206350_10187858 Ga0206350_101878583 211
72 3300020080 Ga0206350_11177477 Ga0206350_111774771 211
73 3300020080 Ga0206350_11276978 Ga0206350_112769784 211
74 3300020081 Ga0206354_10132274 Ga0206354_101322741 211
75 3300022467 Ga0224712_10021233 Ga0224712_100212334 211
76 3300025912 Ga0207707_10159012 Ga0207707_101590122 211
77 3300025913 Ga0207695_10050803 Ga0207695_100508033 211
78 3300025916 Ga0207663_10465201 Ga0207663_104652011 211
79 3300025944 Ga0207661_10104321 Ga0207661_101043213 211
80 3300026089 Ga0207648_10376716 Ga0207648_103767162 211
81 3300028379 Ga0268266_10000260 Ga0268266_1000026052 211
82 3300028379 Ga0268266_10394983 Ga0268266_103949832 211
83 3300031691 Ga0316579_10077408 Ga0316579_100774082 211
84 3300031728 Ga0316578_10164734 Ga0316578_101647342 211
85 3300031733 Ga0316577_10025136 Ga0316577_100251362 211
86 3300032139 Ga0316580_10094174 Ga0316580_100941742 211
87 3300036401 Ga0373937_0468333 Ga0373937_0468333_445_1080 211
88 3300036647 Ga0316582_0067917 Ga0316582_0067917_1410_2063 211
89 3300036712 Ga0316584_0003440 Ga0316584_0003440_5965_6618 211
90 3300036712 Ga0316584_0189578 Ga0316584_0189578_198_863 211
91 3300037068 Ga0373925_0253900 Ga0373925_0253900_600_1235 211
92 3300037588 Ga0316581_0022472 Ga0316581_0022472_255_908 211
93 3300042876 Ga0451577_1074925 Ga0451577_1074925_48_683 211
94 3300046455 Ga0495603_0001787 Ga0495603_0001787_7672_8307 211
95 3300046455 Ga0495603_0007169 Ga0495603_0007169_1673_2308 211
96 3300046459 Ga0495629_0004989 Ga0495629_0004989_1566_2201 211
97 3300046459 Ga0495629_0041111 Ga0495629_0041111_291_926 211
98 3300046462 Ga0495651_0007356 Ga0495651_0007356_7765_8400 211
99 3300046462 Ga0495651_0075679 Ga0495651_0075679_1280_1915 211
100 3300046463 Ga0495653_0009486 Ga0495653_0009486_288_923 211
101 3300046472 Ga0495580_0097021 Ga0495580_0097021_926_1561 211
102 3300046472 Ga0495580_0123367 Ga0495580_0123367_450_1085 211
103 3300046472 Ga0495580_0289104 Ga0495580_0289104_238_873 211
104 3300046473 Ga0495582_0001734 Ga0495582_0001734_3093_3728 211
105 3300046475 Ga0495639_0000745 Ga0495639_0000745_7053_7688 211
106 3300046476 Ga0495662_0001664 Ga0495662_0001664_9632_10267 211
107 3300046477 Ga0495664_0010856 Ga0495664_0010856_1995_2630 211
108 3300046492 Ga0495585_0004297 Ga0495585_0004297_3965_4600 211
109 3300046499 Ga0495594_0000216 Ga0495594_0000216_24926_25561 211
110 3300046499 Ga0495594_0000830 Ga0495594_0000830_658_1293 211
111 3300046507 Ga0495606_0018216 Ga0495606_0018216_3675_4313 211
112 3300046511 Ga0495608_0092071 Ga0495608_0092071_314_949 211
113 3300046516 Ga0495628_0020708 Ga0495628_0020708_3058_3693 211
114 3300046516 Ga0495628_0247745 Ga0495628_0247745_553_1188 211
115 3300046523 Ga0495644_0000233 Ga0495644_0000233_20771_21406 211
116 3300046526 Ga0495666_0003666 Ga0495666_0003666_4654_5289 211
117 3300046528 Ga0495642_0079041 Ga0495642_0079041_278_913 211
118 3300046531 Ga0495665_0014859 Ga0495665_0014859_2752_3387 211
119 3300046533 Ga0495640_0007292 Ga0495640_0007292_7924_8559 211
120 3300046536 Ga0495587_0055535 Ga0495587_0055535_744_1379 211
121 3300046557 Ga0495622_0033549 Ga0495622_0033549_954_1589 211
122 3300046558 Ga0495633_0027564 Ga0495633_0027564_1273_1908 211
123 3300046559 Ga0495667_0012738 Ga0495667_0012738_2822_3457 211
124 3300046642 Ga0495634_0003158 Ga0495634_0003158_4634_5269 211
125 3300046648 Ga0495611_0028487 Ga0495611_0028487_1239_1874 211
126 3300046660 Ga0495625_0016366 Ga0495625_0016366_2752_3387 211
127 3300046663 Ga0495635_0029627 Ga0495635_0029627_1532_2167 211
128 3300046674 Ga0495588_0051895 Ga0495588_0051895_22_657 211
129 3300046675 Ga0495657_0126901 Ga0495657_0126901_492_1127 211
130 3300046678 Ga0495599_0001842 Ga0495599_0001842_635_1270 211
131 3300046678 Ga0495599_0172334 Ga0495599_0172334_226_861 211
132 3300046679 Ga0495623_0059092 Ga0495623_0059092_337_972 211
133 3300046680 Ga0495646_0006639 Ga0495646_0006639_5652_6287 211
134 3300046683 Ga0495658_0224910 Ga0495658_0224910_420_1055 211
135 3300046684 Ga0495669_0001216 Ga0495669_0001216_7577_8212 211
136 3300046689 Ga0495613_0032456 Ga0495613_0032456_725_1360 211
137 3300046689 Ga0495613_0082068 Ga0495613_0082068_1056_1691 211
138 3300046690 Ga0495624_0003705 Ga0495624_0003705_2373_3008 211
139 3300046694 Ga0495649_0100822 Ga0495649_0100822_723_1361 211
140 3300046694 Ga0495649_0352189 Ga0495649_0352189_17_652 211
141 3300046794 Ga0495589_0089504 Ga0495589_0089504_119_754 211
142 3300046809 Ga0495600_0000817 Ga0495600_0000817_3356_3991 211
143 3300046809 Ga0495600_0107321 Ga0495600_0107321_130_765 211
144 3300047315 Ga0495581_0059696 Ga0495581_0059696_1425_2060 211
145 3300047317 Ga0495604_0005986 Ga0495604_0005986_7124_7759 211
146 3300047317 Ga0495604_0016655 Ga0495604_0016655_290_925 211
147 3300047319 Ga0495674_0014787 Ga0495674_0014787_6054_6689 211
148 3300047320 Ga0495672_0126990 Ga0495672_0126990_528_1163 211
149 3300047321 Ga0495676_0006988 Ga0495676_0006988_4387_5022 211
150 3300047444 Ga0495675_0021010 Ga0495675_0021010_2929_3564 211
151 3300047469 Ga0495673_0044074 Ga0495673_0044074_865_1500 211
152 3300047471 Ga0495684_0009188 Ga0495684_0009188_2904_3539 211
153 3300048089 Ga0495614_0001515 Ga0495614_0001515_6310_6945 211
154 3300048089 Ga0495614_0014267 Ga0495614_0014267_1904_2539 211
155 3300048903 Ga0496100_0378827 Ga0496100_0378827_160_795 211
156 3300048908 Ga0496105_0209586 Ga0496105_0209586_778_1413 211
157 3300048929 Ga0496126_0287348 Ga0496126_0287348_131_766 211
158 3300050507 nmdc:mga05p37_82202_c1 nmdc:mga05p37_82202_c1_451_1086 211
159 3300050508 nmdc:mga09592_387204_c1 nmdc:mga09592_387204_c1_561_1196 211
160 3300050512 nmdc:mga0n895_1048318_c1 nmdc:mga0n895_1048318_c1_117_752 211
161 3300050512 nmdc:mga0n895_330408_c1 nmdc:mga0n895_330408_c1_514_1149 211
162 3300050515 nmdc:mga0a205_232877_c1 nmdc:mga0a205_232877_c1_492_1127 211
163 3300003320 rootH2_10085512 rootH2_100855125 212
164 3300005434 Ga0070709_10069602 Ga0070709_100696023 212
165 3300005435 Ga0070714_100002772 Ga0070714_1000027725 212
166 3300005436 Ga0070713_100258329 Ga0070713_1002583292 212
167 3300005458 Ga0070681_10068202 Ga0070681_100682023 212
168 3300005563 Ga0068855_100021270 Ga0068855_1000212702 212
169 3300005577 Ga0068857_100314938 Ga0068857_1003149382 212
170 3300005616 Ga0068852_100073313 Ga0068852_1000733134 212
171 3300005844 Ga0068862_100156884 Ga0068862_1001568842 212
172 3300005981 Ga0081538_10140994 Ga0081538_101409941 212
173 3300006237 Ga0097621_100093428 Ga0097621_1000934282 212
174 3300006358 Ga0068871_100024543 Ga0068871_1000245435 212
175 3300006844 Ga0075428_100029944 Ga0075428_1000299442 212
176 3300007265 Ga0099794_10149796 Ga0099794_101497962 212
177 3300007788 Ga0099795_10084934 Ga0099795_100849342 212
178 3300009093 Ga0105240_10051034 Ga0105240_100510345 212
179 3300009093 Ga0105240_10261833 Ga0105240_102618332 212
180 3300009094 Ga0111539_10058214 Ga0111539_100582143 212
181 3300013102 Ga0157371_10121242 Ga0157371_101212422 212
182 3300013104 Ga0157370_10207789 Ga0157370_102077891 212
183 3300013297 Ga0157378_10111171 Ga0157378_101111714 212
184 3300013306 Ga0163162_10040482 Ga0163162_100404825 212
185 3300020078 Ga0206352_10476527 Ga0206352_104765278 212
186 3300021361 Ga0213872_10010678 Ga0213872_100106784 212
187 3300021388 Ga0213875_10012137 Ga0213875_100121372 212
188 3300025906 Ga0207699_10081485 Ga0207699_100814854 212
189 3300025912 Ga0207707_10002960 Ga0207707_100029604 212
190 3300025913 Ga0207695_10025210 Ga0207695_100252107 212
191 3300025949 Ga0207667_10011443 Ga0207667_100114438 212
192 3300026078 Ga0207702_10222315 Ga0207702_102223152 212
193 3300026116 Ga0207674_10393041 Ga0207674_103930411 212
194 3300026121 Ga0207683_10500576 Ga0207683_105005761 212
195 3300026142 Ga0207698_10012294 Ga0207698_100122947 212
196 3300028800 Ga0265338_10703116 Ga0265338_107031161 212
197 3300031733 Ga0316577_10014110 Ga0316577_100141102 212
198 3300031903 Ga0307407_10926423 Ga0307407_109264231 212
199 3300031911 Ga0307412_10204864 Ga0307412_102048642 212
200 3300032004 Ga0307414_10309274 Ga0307414_103092742 212
201 3300036647 Ga0316582_0008667 Ga0316582_0008667_685_1323 212
202 3300036712 Ga0316584_0032332 Ga0316584_0032332_161_802 212
203 3300036712 Ga0316584_0261120 Ga0316584_0261120_450_1088 212
204 3300037853 Ga0436364_0207702 Ga0436364_0207702_464_1102 212
205 3300039447 Ga0436361_0242772 Ga0436361_0242772_5897_6535 212
206 3300041997 Ga0439431_0000701 Ga0439431_0000701_5575_6213 212
207 3300044693 Ga0466961_0262982 Ga0466961_0262982_165_803 212
208 3300049570 Ga0501033_0185145 Ga0501033_0185145_303_941 212
209 3300049573 Ga0501037_0002871 Ga0501037_0002871_849_1487 212
210 3300049575 Ga0501039_0294740 Ga0501039_0294740_500_1138 212
211 3300049582 Ga0501048_0299509 Ga0501048_0299509_165_803 212
212 3300049585 Ga0501069_0293676 Ga0501069_0293676_180_818 212
213 3300049586 Ga0501070_0034696 Ga0501070_0034696_2162_2800 212
214 3300049587 Ga0501071_0307709 Ga0501071_0307709_238_876 212
215 3300049590 Ga0501074_0091382 Ga0501074_0091382_462_1100 212
216 3300049823 Ga0501044_0205911 Ga0501044_0205911_179_817 212
217 3300003911 JGI25405J52794_10011315 JGI25405J52794_100113152 213
218 3300004799 Ga0058863_11745031 Ga0058863_117450312 213
219 3300004800 Ga0058861_11992559 Ga0058861_119925594 213
220 3300004803 Ga0058862_10209510 Ga0058862_102095102 213
221 3300005293 Ga0065715_10358674 Ga0065715_103586742 213
222 3300005327 Ga0070658_10078582 Ga0070658_100785822 213
223 3300005327 Ga0070658_10174300 Ga0070658_101743002 213
224 3300005336 Ga0070680_100182953 Ga0070680_1001829532 213
225 3300005339 Ga0070660_100001518 Ga0070660_1000015184 213
226 3300005366 Ga0070659_100401584 Ga0070659_1004015841 213
227 3300005434 Ga0070709_10482606 Ga0070709_104826062 213
228 3300005435 Ga0070714_100067450 Ga0070714_1000674502 213
229 3300005435 Ga0070714_100109240 Ga0070714_1001092403 213
230 3300005435 Ga0070714_100139294 Ga0070714_1001392943 213
231 3300005435 Ga0070714_100793847 Ga0070714_1007938471 213
232 3300005436 Ga0070713_100006711 Ga0070713_1000067116 213
233 3300005439 Ga0070711_100191254 Ga0070711_1001912541 213
234 3300005439 Ga0070711_100425488 Ga0070711_1004254881 213
235 3300005439 Ga0070711_100601621 Ga0070711_1006016211 213
236 3300005445 Ga0070708_100000392 Ga0070708_10000039228 213
237 3300005458 Ga0070681_10031259 Ga0070681_100312595 213
238 3300005458 Ga0070681_10093609 Ga0070681_100936092 213
239 3300005458 Ga0070681_10106869 Ga0070681_101068692 213
240 3300005458 Ga0070681_10170524 Ga0070681_101705242 213
241 3300005458 Ga0070681_10821945 Ga0070681_108219452 213
242 3300005467 Ga0070706_100001692 Ga0070706_1000016926 213
243 3300005468 Ga0070707_100000351 Ga0070707_10000035121 213
244 3300005468 Ga0070707_100004546 Ga0070707_1000045465 213
245 3300005471 Ga0070698_100000922 Ga0070698_10000092227 213
246 3300005471 Ga0070698_100019643 Ga0070698_1000196437 213
247 3300005518 Ga0070699_100000502 Ga0070699_10000050229 213
248 3300005518 Ga0070699_100037730 Ga0070699_1000377303 213
249 3300005530 Ga0070679_100000945 Ga0070679_10000094522 213
250 3300005530 Ga0070679_100168821 Ga0070679_1001688212 213
251 3300005530 Ga0070679_100330768 Ga0070679_1003307682 213
252 3300005530 Ga0070679_100360345 Ga0070679_1003603452 213
253 3300005530 Ga0070679_100957878 Ga0070679_1009578781 213
254 3300005535 Ga0070684_100033892 Ga0070684_1000338923 213
255 3300005535 Ga0070684_100066556 Ga0070684_1000665562 213
256 3300005536 Ga0070697_100002721 Ga0070697_1000027219 213
257 3300005536 Ga0070697_100189545 Ga0070697_1001895452 213
258 3300005539 Ga0068853_100016299 Ga0068853_1000162992 213
259 3300005543 Ga0070672_100200754 Ga0070672_1002007542 213
260 3300005563 Ga0068855_100016972 Ga0068855_1000169725 213
261 3300005563 Ga0068855_100018409 Ga0068855_1000184099 213
262 3300005563 Ga0068855_100032736 Ga0068855_1000327364 213
263 3300005564 Ga0070664_100004083 Ga0070664_1000040838 213
264 3300005577 Ga0068857_100039120 Ga0068857_1000391202 213
265 3300005577 Ga0068857_100146071 Ga0068857_1001460712 213
266 3300005577 Ga0068857_100209333 Ga0068857_1002093332 213
267 3300005614 Ga0068856_100153505 Ga0068856_1001535053 213
268 3300005614 Ga0068856_100185005 Ga0068856_1001850055 213
269 3300005616 Ga0068852_100000021 Ga0068852_10000002198 213
270 3300005618 Ga0068864_100210709 Ga0068864_1002107092 213
271 3300005841 Ga0068863_100012187 Ga0068863_1000121877 213
272 3300005937 Ga0081455_10001369 Ga0081455_1000136916 213
273 3300005983 Ga0081540_1179312 Ga0081540_11793121 213
274 3300006028 Ga0070717_10028565 Ga0070717_100285655 213
275 3300006173 Ga0070716_100089161 Ga0070716_1000891612 213
276 3300006237 Ga0097621_100112184 Ga0097621_1001121842 213
277 3300006844 Ga0075428_100086112 Ga0075428_1000861122 213
278 3300006844 Ga0075428_100746064 Ga0075428_1007460642 213
279 3300006847 Ga0075431_100005178 Ga0075431_1000051788 213
280 3300006847 Ga0075431_100196400 Ga0075431_1001964003 213
281 3300006852 Ga0075433_10206688 Ga0075433_102066882 213
282 3300006871 Ga0075434_100195313 Ga0075434_1001953132 213
283 3300006880 Ga0075429_100015070 Ga0075429_1000150704 213
284 3300006914 Ga0075436_100001541 Ga0075436_10000154112 213
285 3300006914 Ga0075436_100495628 Ga0075436_1004956282 213
286 3300007076 Ga0075435_100017057 Ga0075435_1000170572 213
287 3300007076 Ga0075435_100037815 Ga0075435_1000378152 213
288 3300009093 Ga0105240_10003055 Ga0105240_100030558 213
289 3300009093 Ga0105240_10275533 Ga0105240_102755332 213
290 3300009093 Ga0105240_10275860 Ga0105240_102758603 213
291 3300009093 Ga0105240_10318043 Ga0105240_103180432 213
292 3300009093 Ga0105240_10434415 Ga0105240_104344152 213
293 3300009098 Ga0105245_10350049 Ga0105245_103500492 213
294 3300009101 Ga0105247_10126947 Ga0105247_101269472 213
295 3300009147 Ga0114129_10085130 Ga0114129_100851302 213
296 3300009147 Ga0114129_10105084 Ga0114129_101050845 213
297 3300009174 Ga0105241_10005427 Ga0105241_100054272 213
298 3300009174 Ga0105241_10009030 Ga0105241_100090305 213
299 3300009174 Ga0105241_10631353 Ga0105241_106313532 213
300 3300009545 Ga0105237_10014816 Ga0105237_100148165 213
301 3300009545 Ga0105237_10038802 Ga0105237_100388024 213
302 3300009545 Ga0105237_10040136 Ga0105237_100401366 213
303 3300009545 Ga0105237_10120744 Ga0105237_101207442 213
304 3300009551 Ga0105238_10008807 Ga0105238_100088079 213
305 3300009551 Ga0105238_10015411 Ga0105238_100154114 213
306 3300009551 Ga0105238_10044289 Ga0105238_100442892 213
307 3300009551 Ga0105238_10217504 Ga0105238_102175042 213
308 3300010375 Ga0105239_10010544 Ga0105239_100105445 213
309 3300010375 Ga0105239_10372303 Ga0105239_103723032 213
310 3300013100 Ga0157373_10057651 Ga0157373_100576512 213
311 3300013102 Ga0157371_10105526 Ga0157371_101055263 213
312 3300013104 Ga0157370_10000067 Ga0157370_1000006779 213
313 3300013104 Ga0157370_10006254 Ga0157370_100062542 213
314 3300013104 Ga0157370_10183224 Ga0157370_101832242 213
315 3300013105 Ga0157369_10001168 Ga0157369_1000116823 213
316 3300013105 Ga0157369_10001656 Ga0157369_1000165616 213
317 3300013105 Ga0157369_10005638 Ga0157369_100056387 213
318 3300013105 Ga0157369_10040266 Ga0157369_100402666 213
319 3300013105 Ga0157369_10052776 Ga0157369_100527764 213
320 3300013105 Ga0157369_10103532 Ga0157369_101035323 213
321 3300013105 Ga0157369_10358959 Ga0157369_103589592 213
322 3300013105 Ga0157369_10874537 Ga0157369_108745371 213
323 3300013296 Ga0157374_10703756 Ga0157374_107037562 213
324 3300013307 Ga0157372_10023748 Ga0157372_100237485 213
325 3300013307 Ga0157372_10058132 Ga0157372_100581323 213
326 3300013307 Ga0157372_10092018 Ga0157372_100920181 213
327 3300013307 Ga0157372_10115970 Ga0157372_101159703 213
328 3300013307 Ga0157372_10281836 Ga0157372_102818362 213
329 3300014968 Ga0157379_10088473 Ga0157379_100884734 213
330 3300020069 Ga0197907_11438784 Ga0197907_114387842 213
331 3300020070 Ga0206356_11820743 Ga0206356_118207431 213
332 3300020077 Ga0206351_10535310 Ga0206351_105353102 213
333 3300020078 Ga0206352_11361616 Ga0206352_113616162 213
334 3300020080 Ga0206350_10008355 Ga0206350_100083551 213
335 3300020080 Ga0206350_10364460 Ga0206350_103644602 213
336 3300021361 Ga0213872_10001684 Ga0213872_1000168412 213
337 3300022467 Ga0224712_10035225 Ga0224712_100352252 213
338 3300022467 Ga0224712_10050639 Ga0224712_100506392 213
339 3300022467 Ga0224712_10146735 Ga0224712_101467351 213
340 3300025906 Ga0207699_10617707 Ga0207699_106177071 213
341 3300025909 Ga0207705_10010468 Ga0207705_100104686 213
342 3300025909 Ga0207705_10176978 Ga0207705_101769782 213
343 3300025910 Ga0207684_10000375 Ga0207684_1000037566 213
344 3300025910 Ga0207684_10022809 Ga0207684_100228094 213
345 3300025911 Ga0207654_10004979 Ga0207654_100049794 213
346 3300025911 Ga0207654_10075807 Ga0207654_100758072 213
347 3300025911 Ga0207654_10355931 Ga0207654_103559312 213
348 3300025912 Ga0207707_10018917 Ga0207707_100189173 213
349 3300025912 Ga0207707_10068088 Ga0207707_100680884 213
350 3300025912 Ga0207707_10173916 Ga0207707_101739162 213
351 3300025912 Ga0207707_10210230 Ga0207707_102102302 213
352 3300025912 Ga0207707_10371650 Ga0207707_103716502 213
353 3300025912 Ga0207707_10611870 Ga0207707_106118702 213
354 3300025913 Ga0207695_10000026 Ga0207695_1000002624 213
355 3300025913 Ga0207695_10005663 Ga0207695_100056639 213
356 3300025913 Ga0207695_10480417 Ga0207695_104804172 213
357 3300025914 Ga0207671_10034020 Ga0207671_100340204 213
358 3300025914 Ga0207671_10051567 Ga0207671_100515672 213
359 3300025914 Ga0207671_10208201 Ga0207671_102082011 213
360 3300025914 Ga0207671_10520887 Ga0207671_105208872 213
361 3300025915 Ga0207693_10252945 Ga0207693_102529453 213
362 3300025916 Ga0207663_10647141 Ga0207663_106471411 213
363 3300025917 Ga0207660_10025625 Ga0207660_100256254 213
364 3300025917 Ga0207660_10169795 Ga0207660_101697952 213
365 3300025917 Ga0207660_10315648 Ga0207660_103156482 213
366 3300025919 Ga0207657_10002216 Ga0207657_100022169 213
367 3300025919 Ga0207657_10004132 Ga0207657_1000413210 213
368 3300025919 Ga0207657_10067879 Ga0207657_100678791 213
369 3300025921 Ga0207652_10013412 Ga0207652_100134127 213
370 3300025921 Ga0207652_10050651 Ga0207652_100506516 213
371 3300025921 Ga0207652_10122102 Ga0207652_101221022 213
372 3300025921 Ga0207652_10123933 Ga0207652_101239332 213
373 3300025921 Ga0207652_10265675 Ga0207652_102656752 213
374 3300025921 Ga0207652_10331840 Ga0207652_103318402 213
375 3300025921 Ga0207652_10332695 Ga0207652_103326952 213
376 3300025922 Ga0207646_10000646 Ga0207646_1000064623 213
377 3300025922 Ga0207646_10001061 Ga0207646_1000106112 213
378 3300025924 Ga0207694_10006117 Ga0207694_100061179 213
379 3300025924 Ga0207694_10111105 Ga0207694_101111053 213
380 3300025924 Ga0207694_10207946 Ga0207694_102079462 213
381 3300025927 Ga0207687_10590549 Ga0207687_105905492 213
382 3300025928 Ga0207700_10143008 Ga0207700_101430082 213
383 3300025929 Ga0207664_10021199 Ga0207664_100211995 213
384 3300025929 Ga0207664_10162988 Ga0207664_101629882 213
385 3300025932 Ga0207690_10185857 Ga0207690_101858573 213
386 3300025933 Ga0207706_10449114 Ga0207706_104491141 213
387 3300025939 Ga0207665_10229470 Ga0207665_102294703 213
388 3300025940 Ga0207691_10011158 Ga0207691_100111582 213
389 3300025944 Ga0207661_10293109 Ga0207661_102931092 213
390 3300025945 Ga0207679_10003924 Ga0207679_100039243 213
391 3300025945 Ga0207679_10355068 Ga0207679_103550681 213
392 3300025949 Ga0207667_10000056 Ga0207667_10000056142 213
393 3300025949 Ga0207667_10007192 Ga0207667_1000719210 213
394 3300025949 Ga0207667_10015452 Ga0207667_100154525 213
395 3300025949 Ga0207667_10050239 Ga0207667_100502392 213
396 3300025960 Ga0207651_10900677 Ga0207651_109006771 213
397 3300025986 Ga0207658_10711757 Ga0207658_107117572 213
398 3300026041 Ga0207639_10002091 Ga0207639_100020912 213
399 3300026041 Ga0207639_10134728 Ga0207639_101347282 213
400 3300026095 Ga0207676_10268177 Ga0207676_102681772 213
401 3300026116 Ga0207674_10023573 Ga0207674_100235736 213
402 3300026116 Ga0207674_10127165 Ga0207674_101271652 213
403 3300026121 Ga0207683_10229593 Ga0207683_102295932 213
404 3300026142 Ga0207698_10000016 Ga0207698_1000001624 213
405 3300026142 Ga0207698_10028126 Ga0207698_100281264 213
406 3300026142 Ga0207698_11008029 Ga0207698_110080292 213
407 3300027907 Ga0207428_10009183 Ga0207428_100091832 213
408 3300028800 Ga0265338_10009230 Ga0265338_100092302 213
409 3300031249 Ga0265339_10010931 Ga0265339_100109312 213
410 3300031250 Ga0265331_10009805 Ga0265331_100098055 213
411 3300031711 Ga0265314_10000200 Ga0265314_1000020041 213
412 3300031711 Ga0265314_10170386 Ga0265314_101703862 213
413 3300031711 Ga0265314_10192298 Ga0265314_101922981 213
414 3300035691 Ga0373931_0113716 Ga0373931_0113716_563_1204 213
415 3300035691 Ga0373931_0212543 Ga0373931_0212543_468_1145 213
416 3300036401 Ga0373937_0138772 Ga0373937_0138772_699_1340 213
417 3300037068 Ga0373925_0234933 Ga0373925_0234933_546_1187 213
418 3300037418 Ga0395900_0050862 Ga0395900_0050862_3268_3909 213
419 3300037588 Ga0316581_0143268 Ga0316581_0143268_47_712 213
420 3300038443 Ga0395901_0594051 Ga0395901_0594051_15_656 213
421 3300039447 Ga0436361_0245497 Ga0436361_0245497_10892_11533 213
422 3300039453 Ga0436362_0424287 Ga0436362_0424287_658_1299 213
423 3300045051 Ga0451576_0074345 Ga0451576_0074345_794_1435 213
424 3300046462 Ga0495651_0352907 Ga0495651_0352907_45_686 213
425 3300046472 Ga0495580_0278565 Ga0495580_0278565_191_832 213
426 3300046543 Ga0495645_0234118 Ga0495645_0234118_164_805 213
427 3300046679 Ga0495623_0026675 Ga0495623_0026675_636_1277 213
428 3300046689 Ga0495613_0196759 Ga0495613_0196759_80_721 213
429 3300047319 Ga0495674_0049201 Ga0495674_0049201_654_1295 213
430 3300047322 Ga0495680_0085480 Ga0495680_0085480_312_953 213
431 3300047444 Ga0495675_0000711 Ga0495675_0000711_1137_1778 213
432 3300048905 Ga0496102_0029999 Ga0496102_0029999_1602_2279 213
433 3300048906 Ga0496103_0382227 Ga0496103_0382227_229_870 213
434 3300048909 Ga0496106_0367030 Ga0496106_0367030_100_741 213
435 3300048911 Ga0496108_0054724 Ga0496108_0054724_1566_2243 213
436 3300048912 Ga0496109_0101743 Ga0496109_0101743_1463_2140 213
437 3300048915 Ga0496112_0013081 Ga0496112_0013081_6789_7430 213
438 3300048915 Ga0496112_0026555 Ga0496112_0026555_920_1597 213
439 3300048915 Ga0496112_0350858 Ga0496112_0350858_706_1347 213
440 3300048916 Ga0496113_0123491 Ga0496113_0123491_1359_2000 213
441 3300048916 Ga0496113_0392597 Ga0496113_0392597_388_1065 213
442 3300048929 Ga0496126_0130998 Ga0496126_0130998_810_1451 213
443 3300049571 Ga0501034_0012355 Ga0501034_0012355_5872_6513 213
444 3300049579 Ga0501043_0559202 Ga0501043_0559202_22_663 213
445 3300049581 Ga0501047_0010623 Ga0501047_0010623_4710_5351 213
446 3300049586 Ga0501070_0007727 Ga0501070_0007727_5861_6502 213
447 3300049586 Ga0501070_0386169 Ga0501070_0386169_404_1045 213
448 3300049822 Ga0501035_0014148 Ga0501035_0014148_1706_2347 213
449 3300049823 Ga0501044_0067954 Ga0501044_0067954_261_902 213
450 3300050507 nmdc:mga05p37_189680_c1 nmdc:mga05p37_189680_c1_170_811 213
451 3300050507 nmdc:mga05p37_307347_c1 nmdc:mga05p37_307347_c1_438_1079 213
452 3300050507 nmdc:mga05p37_845023_c1 nmdc:mga05p37_845023_c1_237_878 213
453 3300050508 nmdc:mga09592_12903_c1 nmdc:mga09592_12903_c1_4081_4722 213
454 3300050510 nmdc:mga06r32_34801_c1 nmdc:mga06r32_34801_c1_2924_3565 213
455 3300050510 nmdc:mga06r32_67343_c1 nmdc:mga06r32_67343_c1_1053_1694 213
456 3300050511 nmdc:mga08y16_3586_c1 nmdc:mga08y16_3586_c1_8652_9293 213
457 3300050512 nmdc:mga0n895_33421_c1 nmdc:mga0n895_33421_c1_3963_4604 213
458 3300050512 nmdc:mga0n895_506666_c1 nmdc:mga0n895_506666_c1_362_1003 213
459 3300050513 nmdc:mga0rr50_55568_c1 nmdc:mga0rr50_55568_c1_108_749 213
460 3300050513 nmdc:mga0rr50_71339_c1 nmdc:mga0rr50_71339_c1_1747_2388 213
461 3300050513 nmdc:mga0rr50_754191_c1 nmdc:mga0rr50_754191_c1_164_805 213
462 3300050514 nmdc:mga08x19_1868_c1 nmdc:mga08x19_1868_c1_562_1203 213
463 3300050514 nmdc:mga08x19_2799_c1 nmdc:mga08x19_2799_c1_2106_2747 213
464 3300050514 nmdc:mga08x19_579971_c1 nmdc:mga08x19_579971_c1_14_655 213
465 3300050515 nmdc:mga0a205_315202_c1 nmdc:mga0a205_315202_c1_171_812 213
466 3300054114 Ga0501084_0530363 Ga0501084_0530363_37_678 213
467 3300003856 Ga0058692_1007969 Ga0058692_10079692 214
468 3300031691 Ga0316579_10258132 Ga0316579_102581322 214
469 3300031727 Ga0316576_10007643 Ga0316576_100076434 214
470 3300031727 Ga0316576_10029210 Ga0316576_100292102 214
471 3300031727 Ga0316576_10398958 Ga0316576_103989582 214
472 3300031728 Ga0316578_10039501 Ga0316578_100395013 214
473 3300031728 Ga0316578_10130874 Ga0316578_101308742 214
474 3300035398 Ga0316574_0079136 Ga0316574_0079136_755_1399 214
475 3300031728 Ga0316578_10051828 Ga0316578_100518282 215
476 3300036647 Ga0316582_0002360 Ga0316582_0002360_3322_3978 215
477 3300036647 Ga0316582_0478801 Ga0316582_0478801_167_820 215
478 3300036712 Ga0316584_0123617 Ga0316584_0123617_815_1462 215
479 3300036647 Ga0316582_0043570 Ga0316582_0043570_383_1036 216
480 3300036647 Ga0316582_0138315 Ga0316582_0138315_172_825 216
481 3300036647 Ga0316582_0301093 Ga0316582_0301093_241_894 216
482 3300036712 Ga0316584_0315928 Ga0316584_0315928_218_871 216
483 3300049742 Ga0501080_0493553 Ga0501080_0493553_239_892 216
484 iso_pu_bacteria 2609459761 2609909656 216
485 iso_pu_bacteria 2939573065 2939575361 216
486 iso_pu_bacteria 2945874760 2945876844 216
487 3300005329 Ga0070683_100294876 Ga0070683_1002948762 217
488 3300005344 Ga0070661_100335890 Ga0070661_1003358902 217
489 3300005345 Ga0070692_10331813 Ga0070692_103318132 217
490 3300005366 Ga0070659_100191861 Ga0070659_1001918612 217
491 3300005458 Ga0070681_10132687 Ga0070681_101326874 217
492 3300005459 Ga0068867_100092572 Ga0068867_1000925723 217
493 3300005530 Ga0070679_100031038 Ga0070679_1000310387 217
494 3300005535 Ga0070684_100535110 Ga0070684_1005351102 217
495 3300005563 Ga0068855_100082048 Ga0068855_1000820482 217
496 3300005563 Ga0068855_100235003 Ga0068855_1002350032 217
497 3300005577 Ga0068857_100737896 Ga0068857_1007378961 217
498 3300005614 Ga0068856_100018638 Ga0068856_1000186388 217
499 3300005616 Ga0068852_100606257 Ga0068852_1006062572 217
500 3300006237 Ga0097621_100247031 Ga0097621_1002470311 217
501 3300006358 Ga0068871_100002826 Ga0068871_10000282610 217
502 3300006881 Ga0068865_100021630 Ga0068865_1000216304 217
503 3300009093 Ga0105240_10030004 Ga0105240_100300049 217
504 3300009093 Ga0105240_10092102 Ga0105240_100921024 217
505 3300009551 Ga0105238_10062077 Ga0105238_100620772 217
506 3300013100 Ga0157373_10394651 Ga0157373_103946511 217
507 3300013102 Ga0157371_10098076 Ga0157371_100980762 217
508 3300020070 Ga0206356_10888656 Ga0206356_108886562 217
509 3300025911 Ga0207654_10222427 Ga0207654_102224272 217
510 3300025912 Ga0207707_10060015 Ga0207707_100600155 217
511 3300025912 Ga0207707_10277738 Ga0207707_102777382 217
512 3300025913 Ga0207695_10019479 Ga0207695_100194792 217
513 3300025913 Ga0207695_10051504 Ga0207695_100515044 217
514 3300025913 Ga0207695_10131539 Ga0207695_101315393 217
515 3300025913 Ga0207695_10168277 Ga0207695_101682772 217
516 3300025917 Ga0207660_10173051 Ga0207660_101730512 217
517 3300025921 Ga0207652_10205194 Ga0207652_102051942 217
518 3300025924 Ga0207694_10001887 Ga0207694_100018872 217
519 3300025924 Ga0207694_10016836 Ga0207694_100168364 217
520 3300025927 Ga0207687_10016550 Ga0207687_100165505 217
521 3300025934 Ga0207686_10018755 Ga0207686_100187555 217
522 3300025938 Ga0207704_10267511 Ga0207704_102675112 217
523 3300025944 Ga0207661_10162496 Ga0207661_101624961 217
524 3300025944 Ga0207661_10336558 Ga0207661_103365583 217
525 3300025945 Ga0207679_10565822 Ga0207679_105658221 217
526 3300025949 Ga0207667_10008358 Ga0207667_100083589 217
527 3300025949 Ga0207667_10047933 Ga0207667_100479334 217
528 3300025949 Ga0207667_10332042 Ga0207667_103320421 217
529 3300026078 Ga0207702_10364738 Ga0207702_103647383 217
530 3300026089 Ga0207648_10122125 Ga0207648_101221253 217
531 3300026116 Ga0207674_10011684 Ga0207674_100116842 217
532 3300026116 Ga0207674_10090377 Ga0207674_100903775 217
533 3300026142 Ga0207698_10008579 Ga0207698_100085792 217
534 3300036401 Ga0373937_0994095 Ga0373937_0994095_42_695 217
535 3300037312 Ga0395899_0137518 Ga0395899_0137518_229_903 217
536 3300026088 Ga0207641_10010424 Ga0207641_100104246 218
537 3300048922 Ga0496119_0000860 Ga0496119_0000860_14429_15091 218
538 3300048923 Ga0496120_0001420 Ga0496120_0001420_17665_18327 218
539 iso_pu_bacteria 2551306352 2552746586 219
540 iso_pu_bacteria 2639762793 2640733120 219
541 iso_pu_bacteria 2675903507 2678229828 219
542 iso_pu_bacteria 2773857761 2774391335 219
543 iso_pu_bacteria 2773857770 2774439472 219
544 iso_pu_bacteria 2919182534 2919185542 219
545 iso_pu_bacteria 2928515477 2928516300 219
546 iso_pu_bacteria 2984568884 2984572177 219
547 3300005293 Ga0065715_10100728 Ga0065715_101007282 220
548 3300005293 Ga0065715_10582615 Ga0065715_105826151 220
549 3300005617 Ga0068859_100101523 Ga0068859_1001015232 220
550 3300005618 Ga0068864_100022756 Ga0068864_1000227562 220
551 3300005841 Ga0068863_100009104 Ga0068863_1000091045 220
552 3300005843 Ga0068860_100175045 Ga0068860_1001750453 220
553 3300005844 Ga0068862_100595531 Ga0068862_1005955312 220
554 3300006931 Ga0097620_100101520 Ga0097620_1001015202 220
555 3300006946 Ga0079104_1000120 Ga0079104_1000120109 220
556 3300009092 Ga0105250_10000080 Ga0105250_1000008061 220
557 3300009177 Ga0105248_10035407 Ga0105248_100354075 220
558 3300009553 Ga0105249_10475794 Ga0105249_104757942 220
559 3300025711 Ga0207696_1000067 Ga0207696_100006780 220
560 3300025711 Ga0207696_1000100 Ga0207696_100010060 220
561 3300025941 Ga0207711_10094296 Ga0207711_100942962 220
562 3300025961 Ga0207712_10098219 Ga0207712_100982192 220
563 3300026088 Ga0207641_10043029 Ga0207641_100430295 220
564 3300026095 Ga0207676_10033379 Ga0207676_100333795 220
565 3300027111 Ga0209281_1000014 Ga0209281_1000014374 220
566 3300028380 Ga0268265_10180571 Ga0268265_101805713 220
567 3300028381 Ga0268264_10187921 Ga0268264_101879213 220
568 3300028381 Ga0268264_10432056 Ga0268264_104320562 220
569 3300036712 Ga0316584_0118564 Ga0316584_0118564_646_1341 220
570 3300046535 Ga0495586_0194202 Ga0495586_0194202_223_897 220
571 3300046689 Ga0495613_0122210 Ga0495613_0122210_966_1640 220
572 3300047322 Ga0495680_0107043 Ga0495680_0107043_1361_2035 220
573 3300048925 Ga0496122_0008975 Ga0496122_0008975_834_1496 220
574 3300048926 Ga0496123_0007059 Ga0496123_0007059_965_1627 220
575 iso_pu_bacteria 2506520007 2506579584 220
576 iso_pu_bacteria 2506520008 2506584723 220
577 iso_pu_bacteria 2508501071 2508853373 220
578 iso_pu_bacteria 2510065053 2510281668 220
579 iso_pu_bacteria 2510065055 2510292161 220
580 iso_pu_bacteria 2510065058 2510309816 220
581 iso_pu_bacteria 2511231004 2511257178 220
582 iso_pu_bacteria 2511231006 2511267301 220
583 iso_pu_bacteria 2511231007 2511273809 220
584 iso_pu_bacteria 2511231008 2511278357 220
585 iso_pu_bacteria 2511231010 2511288186 220
586 iso_pu_bacteria 2511231011 2511295980 220
587 iso_pu_bacteria 2511231012 2511299340 220
588 iso_pu_bacteria 2511231014 2511311217 220
589 iso_pu_bacteria 2511231015 2511317673 220
590 iso_pu_bacteria 2511231016 2511329341 220
591 iso_pu_bacteria 2511231017 2511334121 220
592 iso_pu_bacteria 2511231018 2511340236 220
593 iso_pu_bacteria 2511231019 2511345321 220
594 iso_pu_bacteria 2511231020 2511352734 220
595 iso_pu_bacteria 2511231021 2511357878 220
596 iso_pu_bacteria 2511231022 2511361100 220
597 iso_pu_bacteria 2511231023 2511369792 220
598 iso_pu_bacteria 2511231024 2511376132 220
599 iso_pu_bacteria 2511231025 2511380070 220
600 iso_pu_bacteria 2511231031 2511416408 220
601 iso_pu_bacteria 2511231035 2511434942 220
602 iso_pu_bacteria 2511231156 2511824148 220
603 iso_pu_bacteria 2512047018 2512325513 220
604 iso_pu_bacteria 2537561728 2538425393 220
605 iso_pu_bacteria 2547132181 2547697316 220
606 iso_pu_bacteria 2554235132 2554814806 220
607 iso_pu_bacteria 2554235231 2555246031 220
608 iso_pu_bacteria 2554235234 2555259855 220
609 iso_pu_bacteria 2554235341 2555670900 220
610 iso_pu_bacteria 2561511199 2562463596 220
611 iso_pu_bacteria 2582580891 2583793139 220
612 iso_pu_bacteria 2585427591 2585827733 220
613 iso_pu_bacteria 2585427592 2585835066 220
614 iso_pu_bacteria 2597489887 2597858915 220
615 iso_pu_bacteria 2597489888 2597864544 220
616 iso_pu_bacteria 2597489889 2597870352 220
617 iso_pu_bacteria 2599185155 2599329187 220
618 iso_pu_bacteria 2599185160 2599357539 220
619 iso_pu_bacteria 2599185161 2599364329 220
620 iso_pu_bacteria 2599185162 2599370650 220
621 iso_pu_bacteria 2599185163 2599377157 220
622 iso_pu_bacteria 2599185164 2599382744 220
623 iso_pu_bacteria 2599185165 2599389192 220
624 iso_pu_bacteria 2599185166 2599395875 220
625 iso_pu_bacteria 2599185167 2599397669 220
626 iso_pu_bacteria 2599185168 2599408265 220
627 iso_pu_bacteria 2599185169 2599411258 220
628 iso_pu_bacteria 2599185179 2599452115 220
629 iso_pu_bacteria 2599185181 2599463972 220
630 iso_pu_bacteria 2599185182 2599470999 220
631 iso_pu_bacteria 2599185185 2599487647 220
632 iso_pu_bacteria 2599185186 2599492991 220
633 iso_pu_bacteria 2599185188 2599502000 220
634 iso_pu_bacteria 2599185189 2599506756 220
635 iso_pu_bacteria 2599185190 2599513497 220
636 iso_pu_bacteria 2599185191 2599517995 220
637 iso_pu_bacteria 2599185212 2599611260 220
638 iso_pu_bacteria 2599185248 2599769885 220
639 iso_pu_bacteria 2599185257 2599806027 220
640 iso_pu_bacteria 2599185288 2599880862 220
641 iso_pu_bacteria 2599185289 2599887209 220
642 iso_pu_bacteria 2599185290 2599892174 220
643 iso_pu_bacteria 2599185291 2599898626 220
644 iso_pu_bacteria 2599185299 2599926515 220
645 iso_pu_bacteria 2599185300 2599932940 220
646 iso_pu_bacteria 2599185302 2599942698 220
647 iso_pu_bacteria 2599185303 2599949845 220
648 iso_pu_bacteria 2599185304 2599953447 220
649 iso_pu_bacteria 2599185305 2599959086 220
650 iso_pu_bacteria 2599185306 2599964351 220
651 iso_pu_bacteria 2599185307 2599970714 220
652 iso_pu_bacteria 2599185308 2599975777 220
653 iso_pu_bacteria 2599185309 2599982370 220
654 iso_pu_bacteria 2599185310 2599989152 220
655 iso_pu_bacteria 2599185311 2599994582 220
656 iso_pu_bacteria 2599185312 2599999439 220
657 iso_pu_bacteria 2599185313 2600005935 220
658 iso_pu_bacteria 2599185314 2600009586 220
659 iso_pu_bacteria 2599185315 2600017071 220
660 iso_pu_bacteria 2599185316 2600022247 220
661 iso_pu_bacteria 2599185317 2600029125 220
662 iso_pu_bacteria 2599185318 2600035573 220
663 iso_pu_bacteria 2599185319 2600042144 220
664 iso_pu_bacteria 2599185320 2600047051 220
665 iso_pu_bacteria 2599185321 2600051894 220
666 iso_pu_bacteria 2599185322 2600057206 220
667 iso_pu_bacteria 2599185323 2600064898 220
668 iso_pu_bacteria 2599185324 2600069874 220
669 iso_pu_bacteria 2599185325 2600075522 220
670 iso_pu_bacteria 2599185356 2600217113 220
671 iso_pu_bacteria 2600254930 2600358499 220
672 iso_pu_bacteria 2600254931 2600366733 220
673 iso_pu_bacteria 2600254954 2600444815 220
674 iso_pu_bacteria 2600255254 2601524253 220
675 iso_pu_bacteria 2600255255 2601529407 220
676 iso_pu_bacteria 2600255256 2601535009 220
677 iso_pu_bacteria 2600255257 2601539362 220
678 iso_pu_bacteria 2600255280 2601616241 220
679 iso_pu_bacteria 2600255281 2601620963 220
680 iso_pu_bacteria 2600255283 2601627817 220
681 iso_pu_bacteria 2600255287 2601644310 220
682 iso_pu_bacteria 2600255288 2601649360 220
683 iso_pu_bacteria 2600255289 2601654287 220
684 iso_pu_bacteria 2600255290 2601659709 220
685 iso_pu_bacteria 2600255291 2601664132 220
686 iso_pu_bacteria 2600255296 2601690153 220
687 iso_pu_bacteria 2600255298 2601697092 220
688 iso_pu_bacteria 2600255299 2601702138 220
689 iso_pu_bacteria 2600255300 2601707031 220
690 iso_pu_bacteria 2600255301 2601712017 220
691 iso_pu_bacteria 2600255302 2601717548 220
692 iso_pu_bacteria 2600255303 2601722182 220
693 iso_pu_bacteria 2600255304 2601727476 220
694 iso_pu_bacteria 2600255305 2601732459 220
695 iso_pu_bacteria 2600255306 2601737026 220
696 iso_pu_bacteria 2600255307 2601741308 220
697 iso_pu_bacteria 2600255309 2601752438 220
698 iso_pu_bacteria 2600255310 2601757712 220
699 iso_pu_bacteria 2600255311 2601764070 220
700 iso_pu_bacteria 2600255313 2601777284 220
701 iso_pu_bacteria 2600255318 2601797219 220
702 iso_pu_bacteria 2600255389 2602011881 220
703 iso_pu_bacteria 2600255392 2602019279 220
704 iso_pu_bacteria 2602042046 2603636880 220
705 iso_pu_bacteria 2602042047 2603645366 220
706 iso_pu_bacteria 2602042052 2603662295 220
707 iso_pu_bacteria 2602042053 2603667191 220
708 iso_pu_bacteria 2602042066 2603699340 220
709 iso_pu_bacteria 2602042067 2603705369 220
710 iso_pu_bacteria 2602042103 2603839900 220
711 iso_pu_bacteria 2602042104 2603844977 220
712 iso_pu_bacteria 2602042105 2603850019 220
713 iso_pu_bacteria 2602042106 2603855118 220
714 iso_pu_bacteria 2602042109 2603867935 220
715 iso_pu_bacteria 2602042110 2603872698 220
716 iso_pu_bacteria 2602042111 2603878002 220
717 iso_pu_bacteria 2603880178 2606049845 220
718 iso_pu_bacteria 2603880184 2606071505 220
719 iso_pu_bacteria 2603880185 2606076050 220
720 iso_pu_bacteria 2603880199 2606130661 220
721 iso_pu_bacteria 2603880202 2606147562 220
722 iso_pu_bacteria 2603880211 2606177734 220
723 iso_pu_bacteria 2606217733 2608383706 220
724 iso_pu_bacteria 2608642108 2608670030 220
725 iso_pu_bacteria 2619619299 2621298944 220
726 iso_pu_bacteria 2623620443 2624481495 220
727 iso_pu_bacteria 2623620446 2624493047 220
728 iso_pu_bacteria 2636415599 2637224075 220
729 iso_pu_bacteria 2643221565 2643843597 220
730 iso_pu_bacteria 2643221571 2643871250 220
731 iso_pu_bacteria 2643221589 2643953852 220
732 iso_pu_bacteria 2643221602 2644021786 220
733 iso_pu_bacteria 2643221633 2644185579 220
734 iso_pu_bacteria 2643221650 2644283755 220
735 iso_pu_bacteria 2643221713 2644620455 220
736 iso_pu_bacteria 2648501693 2650895756 220
737 iso_pu_bacteria 2651869719 2652545455 220
738 iso_pu_bacteria 2654587920 2656276983 220
739 iso_pu_bacteria 2667528170 2671091118 220
740 iso_pu_bacteria 2667528171 2671100493 220
741 iso_pu_bacteria 2667528172 2671101120 220
742 iso_pu_bacteria 2667528173 2671107104 220
743 iso_pu_bacteria 2667528176 2671124591 220
744 iso_pu_bacteria 2671180115 2671584545 220
745 iso_pu_bacteria 2671180172 2671772907 220
746 iso_pu_bacteria 2675903046 2676405483 220
747 iso_pu_bacteria 2675903420 2677899505 220
748 iso_pu_bacteria 2675903515 2678264105 220
749 iso_pu_bacteria 2681812866 2681996222 220
750 iso_pu_bacteria 2681812869 2682006442 220
751 iso_pu_bacteria 2684622997 2686354167 220
752 iso_pu_bacteria 2687453129 2687577466 220
753 iso_pu_bacteria 2687453601 2689446107 220
754 iso_pu_bacteria 2711768156 2712468879 220
755 iso_pu_bacteria 2713897148 2715753604 220
756 iso_pu_bacteria 2713897149 2715756012 220
757 iso_pu_bacteria 2718217725 2718634748 220
758 iso_pu_bacteria 2721755607 2723249330 220
759 iso_pu_bacteria 2728369097 2729148140 220
760 iso_pu_bacteria 2738541265 2738672190 220
761 iso_pu_bacteria 2738541271 2738691984 220
762 iso_pu_bacteria 2738541276 2738714952 220
763 iso_pu_bacteria 2738541282 2738750583 220
764 iso_pu_bacteria 2738541294 2738806084 220
765 iso_pu_bacteria 2738541303 2738859624 220
766 iso_pu_bacteria 2738541309 2738893444 220
767 iso_pu_bacteria 2738543004 2739199877 220
768 iso_pu_bacteria 2738543015 2739260250 220
769 iso_pu_bacteria 2738543016 2739267643 220
770 iso_pu_bacteria 2738543020 2739285246 220
771 iso_pu_bacteria 2738543021 2739290560 220
772 iso_pu_bacteria 2738543025 2739313715 220
773 iso_pu_bacteria 2740892503 2743738435 220
774 iso_pu_bacteria 2744054620 2745004561 220
775 iso_pu_bacteria 2751185917 2753856916 220
776 iso_pu_bacteria 2765235841 2765583076 220
777 iso_pu_bacteria 2765235842 2765590021 220
778 iso_pu_bacteria 2772190666 2772440015 220
779 iso_pu_bacteria 2773857670 2774119097 220
780 iso_pu_bacteria 2773857672 2774130185 220
781 iso_pu_bacteria 2773857673 2774135077 220
782 iso_pu_bacteria 2775506706 2775541307 220
783 iso_pu_bacteria 2775507074 2777020952 220
784 iso_pu_bacteria 2784132063 2784265148 220
785 iso_pu_bacteria 2784132072 2784317743 220
786 iso_pu_bacteria 2791354903 2791922290 220
787 iso_pu_bacteria 2791355010 2792312021 220
788 iso_pu_bacteria 2791355275 2793404741 220
789 iso_pu_bacteria 2791355520 2794596824 220
790 iso_pu_bacteria 2806310673 2807179701 220
791 iso_pu_bacteria 2806310737 2807407690 220
792 iso_pu_bacteria 2806310745 2807456005 220
793 iso_pu_bacteria 2808606361 2808858261 220
794 iso_pu_bacteria 2808606373 2808907816 220
795 iso_pu_bacteria 2808606376 2808925606 220
796 iso_pu_bacteria 2808606377 2808931745 220
797 iso_pu_bacteria 2808606378 2808938026 220
798 iso_pu_bacteria 2808606379 2808943554 220
799 iso_pu_bacteria 2808606380 2808947710 220
800 iso_pu_bacteria 2808606381 2808953865 220
801 iso_pu_bacteria 2808606382 2808959083 220
802 iso_pu_bacteria 2808606383 2808966746 220
803 iso_pu_bacteria 2808606385 2808978975 220
804 iso_pu_bacteria 2808606388 2808994710 220
805 iso_pu_bacteria 2808606389 2809001571 220
806 iso_pu_bacteria 2808606414 2809125198 220
807 iso_pu_bacteria 2808606445 2809214321 220
808 iso_pu_bacteria 2811994881 2812367464 220
809 iso_pu_bacteria 2811995292 2813727890 220
810 iso_pu_bacteria 2814123068 2814695433 220
811 iso_pu_bacteria 2816332298 2817491894 220
812 iso_pu_bacteria 2818991456 2819657733 220
813 iso_pu_bacteria 2818991464 2819706155 220
814 iso_pu_bacteria 2821118458 2821121040 220
815 iso_pu_bacteria 2823373977 2823375674 220
816 iso_pu_bacteria 2823421272 2823423817 220
817 iso_pu_bacteria 2825651385 2825657069 220
818 iso_pu_bacteria 2826581358 2826582305 220
819 iso_pu_bacteria 2834028612 2834032685 220
820 iso_pu_bacteria 2842805378 2842807039 220
821 iso_pu_bacteria 2842815866 2842816649 220
822 iso_pu_bacteria 2842826826 2842828315 220
823 iso_pu_bacteria 2842832357 2842836334 220
824 iso_pu_bacteria 2842837860 2842841078 220
825 iso_pu_bacteria 2842843487 2842844229 220
826 iso_pu_bacteria 2842849001 2842854055 220
827 iso_pu_bacteria 2842854478 2842855043 220
828 iso_pu_bacteria 2844425489 2844428365 220
829 iso_pu_bacteria 2844528606 2844529133 220
830 iso_pu_bacteria 2844665904 2844671455 220
831 iso_pu_bacteria 2846540461 2846540472 220
832 iso_pu_bacteria 2847085930 2847086613 220
833 iso_pu_bacteria 2847797336 2847798973 220
834 iso_pu_bacteria 2852103415 2852107027 220
835 iso_pu_bacteria 2852612431 2852613803 220
836 iso_pu_bacteria 2852657418 2852659412 220
837 iso_pu_bacteria 2852667396 2852668461 220
838 iso_pu_bacteria 2855195626 2855199623 220
839 iso_pu_bacteria 2858466076 2858466760 220
840 iso_pu_bacteria 2860339153 2860344281 220
841 iso_pu_bacteria 2860867994 2860871044 220
842 iso_pu_bacteria 2865014394 2865016565 220
843 iso_pu_bacteria 2869551831 2869555454 220
844 iso_pu_bacteria 2871272651 2871275949 220
845 iso_pu_bacteria 2871282230 2871285806 220
846 iso_pu_bacteria 2876601092 2876603272 220
847 iso_pu_bacteria 2878029506 2878033469 220
848 iso_pu_bacteria 2880230671 2880232815 220
849 iso_pu_bacteria 2881609920 2881612013 220
850 iso_pu_bacteria 2884086401 2884087876 220
851 iso_pu_bacteria 2888366609 2888370108 220
852 iso_pu_bacteria 2888373701 2888377368 220
853 iso_pu_bacteria 2891670763 2891672346 220
854 iso_pu_bacteria 2900051742 2900052974 220
855 iso_pu_bacteria 2904474040 2904476028 220
856 iso_pu_bacteria 2904504865 2904506451 220
857 iso_pu_bacteria 2904513164 2904515389 220
858 iso_pu_bacteria 2904518522 2904520447 220
859 iso_pu_bacteria 2904550169 2904553609 220
860 iso_pu_bacteria 2908446538 2908450343 220
861 iso_pu_bacteria 2908669403 2908672428 220
862 iso_pu_bacteria 2912963787 2912965689 220
863 iso_pu_bacteria 2913036834 2913040491 220
864 iso_pu_bacteria 2917070673 2917074759 220
865 iso_pu_bacteria 2917832318 2917832513 220
866 iso_pu_bacteria 2919063839 2919069169 220
867 iso_pu_bacteria 2919108558 2919110971 220
868 iso_pu_bacteria 2919125081 2919125312 220
869 iso_pu_bacteria 2919150387 2919152197 220
870 iso_pu_bacteria 2919155634 2919159541 220
871 iso_pu_bacteria 2919385768 2919387628 220
872 iso_pu_bacteria 2919456309 2919461312 220
873 iso_pu_bacteria 2919481497 2919482339 220
874 iso_pu_bacteria 2919487758 2919490372 220
875 iso_pu_bacteria 2919493220 2919493544 220
876 iso_pu_bacteria 2919501602 2919503559 220
877 iso_pu_bacteria 2919543075 2919545054 220
878 iso_pu_bacteria 2919697872 2919699677 220
879 iso_pu_bacteria 2923153595 2923157492 220
880 iso_pu_bacteria 2923519811 2923521513 220
881 iso_pu_bacteria 2923525760 2923528824 220
882 iso_pu_bacteria 2923586266 2923587905 220
883 iso_pu_bacteria 2923634449 2923635889 220
884 iso_pu_bacteria 2926063275 2926065869 220
885 iso_pu_bacteria 2927143783 2927144866 220
886 iso_pu_bacteria 2927833300 2927837613 220
887 iso_pu_bacteria 2929144301 2929146336 220
888 iso_pu_bacteria 2929189879 2929193113 220
889 iso_pu_bacteria 2931369376 2931374592 220
890 iso_pu_bacteria 2931390751 2931393379 220
891 iso_pu_bacteria 2931396565 2931403012 220
892 iso_pu_bacteria 2932406140 2932410812 220
893 iso_pu_bacteria 2935353572 2935355254 220
894 iso_pu_bacteria 2935625433 2935625765 220
895 iso_pu_bacteria 2937539931 2937542446 220
896 iso_pu_bacteria 2937967321 2937968639 220
897 iso_pu_bacteria 2939568625 2939570036 220
898 iso_pu_bacteria 2939577877 2939582315 220
899 iso_pu_bacteria 2939602548 2939604802 220
900 iso_pu_bacteria 2939607340 2939608680 220
901 iso_pu_bacteria 2939617950 2939618486 220
902 iso_pu_bacteria 2939636861 2939640306 220
903 iso_pu_bacteria 2939642701 2939642945 220
904 iso_pu_bacteria 2939651529 2939653849 220
905 iso_pu_bacteria 2945928738 2945932883 220
906 iso_pu_bacteria 2945951305 2945952219 220
907 iso_pu_bacteria 2945961074 2945964555 220
908 iso_pu_bacteria 2946006987 2946009156 220
909 iso_pu_bacteria 2946027586 2946031389 220
910 iso_pu_bacteria 2947233263 2947238359 220
911 iso_pu_bacteria 2952252522 2952254987 220
912 iso_pu_bacteria 2969079654 2969081109 220
913 iso_pu_bacteria 2969304461 2969308228 220
914 iso_pu_bacteria 2971820967 2971822491 220
915 iso_pu_bacteria 2974289157 2974290297 220
916 iso_pu_bacteria 2974298342 2974300555 220
917 iso_pu_bacteria 2974310843 2974311091 220
918 iso_pu_bacteria 2974435778 2974439281 220
919 iso_pu_bacteria 2978975091 2978978693 220
920 iso_pu_bacteria 2984286254 2984288647 220
921 iso_pu_bacteria 2984494565 2984497533 220
922 iso_pu_bacteria 2984499530 2984502937 220
923 iso_pu_bacteria 2984504281 2984508519 220
924 iso_pu_bacteria 2984559226 2984563567 220
925 iso_pu_bacteria 2984595703 2984596301 220
926 iso_pu_bacteria 2988728565 2988729694 220
927 iso_pu_bacteria 2990196909 2990199484 220
928 iso_pu_bacteria 2990261002 2990261482 220
929 iso_pu_bacteria 2998139840 2998143556 220
930 iso_pu_bacteria 3000376612 3000378358 220
931 iso_pu_bacteria 3007252601 3007252740 220
932 iso_pu_bacteria 3007315729 3007318616 220
933 iso_pu_bacteria 3007395558 3007396814 220
934 iso_pu_bacteria 3007419365 3007424028 220
935 iso_pu_bacteria 3007511990 3007515193 220
936 iso_pu_bacteria 3007614139 3007616659 220
937 iso_pu_bacteria 3007619802 3007620947 220
938 iso_pu_bacteria 3007718800 3007719671 220
939 iso_pu_bacteria 3007803356 3007808794 220
940 iso_pu_bacteria 3007855910 3007859014 220
941 iso_pu_bacteria 3007861166 3007861463 220
942 iso_pu_bacteria 3007866637 3007868506 220
943 iso_pu_bacteria 3007872151 3007874252 220
944 iso_pu_bacteria 637000220 637321235 220
945 iso_pu_bacteria 640753048 640938853 220
946 iso_pu_bacteria 8002745576 8002748585 220
947 iso_pu_bacteria 8004592986 8004596169 220
948 iso_pu_bacteria 8011350971 8011354076 220
949 iso_pu_bacteria 8015394850 8015397811 220
950 iso_pu_bacteria 8015687852 8015691654 220
951 iso_pu_bacteria 8016728285 8016729228 220
952 iso_pu_bacteria 8016733728 8016735064 220
953 iso_pu_bacteria 8018221730 8018224689 220
954 iso_pu_bacteria 8018405270 8018409241 220
955 iso_pu_bacteria 8019499862 8019501454 220
956 iso_pu_bacteria 8019504834 8019505176 220
957 iso_pu_bacteria 8019769354 8019772153 220
958 iso_pu_bacteria 8019775933 8019776052 220
959 iso_pu_bacteria 8029995093 8029997268 220
960 iso_pu_bacteria 8034962539 8034964679 220
961 iso_pu_bacteria 8052494512 8052498196 220
962 iso_pu_bacteria 8054285046 8054285048 220
963 iso_pu_bacteria 8054347763 8054347788 220
964 iso_pu_bacteria 8054503363 8054506885 220
965 iso_pu_bacteria 8054844752 8054846625 220
966 iso_pu_bacteria 8054849141 8054851967 220
967 iso_pu_bacteria 8054929484 8054932211 220
968 iso_pu_bacteria 8055087960 8055092167 220
969 iso_pu_bacteria 8055092621 8055095493 220
970 iso_pu_bacteria 8055097453 8055100203 220
971 iso_pu_bacteria 8055693939 8055696847 220
972 iso_pu_bacteria 8055770955 8055774843 220
973 iso_pu_bacteria 8055817908 8055821678 220
974 iso_pu_bacteria 8055878733 8055880867 220
975 iso_pu_bacteria 8056115690 8056118076 220
976 iso_pu_bacteria 8056120720 8056122714 220
977 iso_pu_bacteria 8056125926 8056129741 220
978 iso_pu_bacteria 8056131705 8056135346 220
979 iso_pu_bacteria 8056137416 8056141074 220
980 iso_pu_bacteria 8056143049 8056146942 220
981 iso_pu_bacteria 8056148874 8056154323 220
982 iso_pu_bacteria 8056155041 8056160281 220
983 iso_pu_bacteria 8056161164 8056165442 220
984 iso_pu_bacteria 8056166840 8056167655 220
985 iso_pu_bacteria 8056172158 8056173669 220
986 iso_pu_bacteria 8056177738 8056183872 220
987 iso_pu_bacteria 8056569372 8056573606 220
988 iso_pu_bacteria 8057160832 8057163440 220
989 iso_pu_bacteria 8057304971 8057306773 220
990 iso_pu_bacteria 8057798959 8057801377 220
991 3300005353 Ga0070669_100442327 Ga0070669_1004423272 221
992 3300005719 Ga0068861_100292923 Ga0068861_1002929232 221
993 3300005841 Ga0068863_100014553 Ga0068863_1000145532 221
994 3300005843 Ga0068860_100397565 Ga0068860_1003975652 221
995 3300005844 Ga0068862_100235134 Ga0068862_1002351341 221
996 3300005844 Ga0068862_100277796 Ga0068862_1002777962 221
997 3300009553 Ga0105249_10084861 Ga0105249_100848612 221
998 3300013306 Ga0163162_10151120 Ga0163162_101511201 221
999 3300013308 Ga0157375_10200618 Ga0157375_102006182 221
1000 3300025961 Ga0207712_10263888 Ga0207712_102638882 221
1001 3300025986 Ga0207658_10278685 Ga0207658_102786852 221
1002 3300026088 Ga0207641_10058260 Ga0207641_100582602 221
1003 3300028380 Ga0268265_10364450 Ga0268265_103644502 221
1004 3300005331 Ga0070670_100000054 Ga0070670_100000054102 222
1005 3300005335 Ga0070666_10009694 Ga0070666_100096945 222
1006 3300005353 Ga0070669_100005396 Ga0070669_1000053965 222
1007 3300005355 Ga0070671_100000037 Ga0070671_10000003776 222
1008 3300005365 Ga0070688_100004371 Ga0070688_1000043715 222
1009 3300005367 Ga0070667_100000002 Ga0070667_100000002456 222
1010 3300005466 Ga0070685_10000014 Ga0070685_1000001494 222
1011 3300005548 Ga0070665_100027961 Ga0070665_1000279616 222
1012 3300005577 Ga0068857_100127973 Ga0068857_1001279732 222
1013 3300005617 Ga0068859_100049835 Ga0068859_1000498353 222
1014 3300005618 Ga0068864_100000002 Ga0068864_10000000217 222
1015 3300005843 Ga0068860_100348249 Ga0068860_1003482491 222
1016 3300006931 Ga0097620_100049833 Ga0097620_1000498333 222
1017 3300009553 Ga0105249_10017291 Ga0105249_100172916 222
1018 3300013306 Ga0163162_10150800 Ga0163162_101508002 222
1019 3300014325 Ga0163163_10000687 Ga0163163_1000068724 222
1020 3300025903 Ga0207680_10010111 Ga0207680_100101116 222
1021 3300025923 Ga0207681_10003927 Ga0207681_100039275 222
1022 3300025925 Ga0207650_10000002 Ga0207650_1000000217 222
1023 3300025931 Ga0207644_10000114 Ga0207644_1000011420 222
1024 3300025941 Ga0207711_10000540 Ga0207711_1000054026 222
1025 3300025986 Ga0207658_10000001 Ga0207658_100000011337 222
1026 3300026035 Ga0207703_10139240 Ga0207703_101392404 222
1027 3300026088 Ga0207641_10034576 Ga0207641_100345762 222
1028 3300026095 Ga0207676_10000001 Ga0207676_1000000117 222
1029 3300026116 Ga0207674_10362769 Ga0207674_103627692 222
1030 3300028380 Ga0268265_10001710 Ga0268265_1000171015 222
1031 3300028381 Ga0268264_10000004 Ga0268264_1000000416 222
1032 3300031250 Ga0265331_10085094 Ga0265331_100850941 222
1033 3300031251 Ga0265327_10000068 Ga0265327_1000006852 222
1034 3300049571 Ga0501034_0456501 Ga0501034_0456501_444_1112 222
1035 3300049573 Ga0501037_0105348 Ga0501037_0105348_1248_1916 222
1036 3300049581 Ga0501047_0147036 Ga0501047_0147036_814_1587 222
1037 3300049822 Ga0501035_0058356 Ga0501035_0058356_1831_2499 222
1038 3300049823 Ga0501044_0415624 Ga0501044_0415624_62_730 222
1039 3300053098 Ga0500650_0000029 Ga0500650_0000029_52761_53429 222
1040 2162886007 SwRhRL2b_contig_297133 SwRhRL2b_0614.00001780 223
1041 3300005272 Ga0065703_1000185 Ga0065703_10001857 223
1042 3300005289 Ga0065704_10014544 Ga0065704_100145443 223
1043 3300005353 Ga0070669_100004838 Ga0070669_1000048385 223
1044 3300005548 Ga0070665_100012924 Ga0070665_1000129243 223
1045 3300006051 Ga0075364_10093100 Ga0075364_100931002 223
1046 3300009011 Ga0105251_10051689 Ga0105251_100516892 223
1047 3300009036 Ga0105244_10073265 Ga0105244_100732652 223
1048 3300009093 Ga0105240_10016586 Ga0105240_100165865 223
1049 3300009101 Ga0105247_10003341 Ga0105247_100033416 223
1050 3300009148 Ga0105243_10000123 Ga0105243_100001238 223
1051 3300025711 Ga0207696_1003770 Ga0207696_10037705 223
1052 3300025728 Ga0207655_1041602 Ga0207655_10416022 223
1053 3300025735 Ga0207713_1001290 Ga0207713_100129015 223
1054 3300025900 Ga0207710_10000057 Ga0207710_1000005789 223
1055 3300025913 Ga0207695_10052355 Ga0207695_100523554 223
1056 3300025923 Ga0207681_10009509 Ga0207681_100095094 223
1057 3300025935 Ga0207709_10000057 Ga0207709_10000057110 223
1058 3300027312 Ga0209371_1000074 Ga0209371_100007486 223
1059 3300028379 Ga0268266_10008882 Ga0268266_100088825 223
1060 3300030500 Ga0268256_1000067 Ga0268256_100006786 223
1061 3300031251 Ga0265327_10000014 Ga0265327_10000014260 223
1062 3300048920 Ga0496117_0118344 Ga0496117_0118344_183_854 223
1063 3300049822 Ga0501035_0290828 Ga0501035_0290828_153_824 223
1064 3300049823 Ga0501044_0001205 Ga0501044_0001205_24403_25074 223
1065 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002392 224
1066 3300002737 JGI25162J39368_1005314 JGI25162J39368_10053142 224
1067 3300002738 JGI25154J39366_1012551 JGI25154J39366_10125511 224
1068 3300002771 JGI25163J39215_1000024 JGI25163J39215_100002431 224
1069 3300002771 JGI25163J39215_1003812 JGI25163J39215_10038122 224
1070 3300002772 JGI25164J39214_1000006 JGI25164J39214_1000006277 224
1071 3300002772 JGI25164J39214_1000069 JGI25164J39214_10000692 224
1072 3300002772 JGI25164J39214_1000228 JGI25164J39214_10002282 224
1073 3300002773 JGI25152J39213_1000602 JGI25152J39213_100060211 224
1074 3300003214 JGI25165J46597_1000168 JGI25165J46597_100016891 224
1075 3300003214 JGI25165J46597_1000424 JGI25165J46597_100042436 224
1076 3300003320 rootH2_10052056 rootH2_100520565 224
1077 3300003323 rootH1_10005050 rootH1_100050502 224
1078 3300003578 Ga0006562J51391_1025316 Ga0006562J51391_10253163 224
1079 3300003751 Ga0055538_1000003 Ga0055538_1000003392 224
1080 3300003751 Ga0055538_1000088 Ga0055538_100008861 224
1081 3300003752 Ga0055539_1000003 Ga0055539_1000003227 224
1082 3300003752 Ga0055539_1000132 Ga0055539_100013261 224
1083 3300003756 Ga0055533_1000005 Ga0055533_1000005227 224
1084 3300003756 Ga0055533_1000135 Ga0055533_100013561 224
1085 3300003758 Ga0055532_1000178 Ga0055532_100017824 224
1086 3300003759 Ga0055525_1000005 Ga0055525_1000005392 224
1087 3300003759 Ga0055525_1000449 Ga0055525_100044924 224
1088 3300003761 Ga0055535_1016059 Ga0055535_10160592 224
1089 3300003781 Ga0055536_1015762 Ga0055536_10157622 224
1090 3300003781 Ga0055536_1022882 Ga0055536_10228822 224
1091 3300003781 Ga0055536_1024507 Ga0055536_10245072 224
1092 3300003781 Ga0055536_1031303 Ga0055536_10313032 224
1093 3300003781 Ga0055536_1049300 Ga0055536_10493002 224
1094 3300003791 Ga0055530_10021619 Ga0055530_100216192 224
1095 3300003791 Ga0055530_10023625 Ga0055530_100236252 224
1096 3300003791 Ga0055530_10049125 Ga0055530_100491252 224
1097 3300003791 Ga0055530_10060716 Ga0055530_100607161 224
1098 3300003792 Ga0055540_1005526 Ga0055540_10055265 224
1099 3300003792 Ga0055540_1013134 Ga0055540_10131342 224
1100 3300003792 Ga0055540_1020296 Ga0055540_10202962 224
1101 3300003794 Ga0055531_10004591 Ga0055531_100045912 224
1102 3300003841 Ga0055541_1000003 Ga0055541_1000003392 224
1103 3300003841 Ga0055541_1000087 Ga0055541_100008724 224
1104 3300003856 Ga0058692_1000092 Ga0058692_100009233 224
1105 3300003856 Ga0058692_1000734 Ga0058692_10007344 224
1106 3300003856 Ga0058692_1020156 Ga0058692_10201562 224
1107 3300003856 Ga0058692_1020519 Ga0058692_10205191 224
1108 3300005272 Ga0065703_1020317 Ga0065703_10203172 224
1109 3300005288 Ga0065714_10000291 Ga0065714_100002912 224
1110 3300005288 Ga0065714_10022500 Ga0065714_100225001 224
1111 3300005288 Ga0065714_10024032 Ga0065714_100240322 224
1112 3300005288 Ga0065714_10042677 Ga0065714_100426772 224
1113 3300005289 Ga0065704_10000641 Ga0065704_100006416 224
1114 3300005289 Ga0065704_10001523 Ga0065704_100015231 224
1115 3300005289 Ga0065704_10007486 Ga0065704_100074861 224
1116 3300005289 Ga0065704_10071962 Ga0065704_1007196210 224
1117 3300005289 Ga0065704_10110828 Ga0065704_101108282 224
1118 3300005289 Ga0065704_10314531 Ga0065704_103145311 224
1119 3300005290 Ga0065712_10085148 Ga0065712_100851482 224
1120 3300005290 Ga0065712_10090299 Ga0065712_100902992 224
1121 3300005290 Ga0065712_10166150 Ga0065712_101661502 224
1122 3300005290 Ga0065712_10177747 Ga0065712_101777472 224
1123 3300005293 Ga0065715_10009777 Ga0065715_100097771 224
1124 3300005344 Ga0070661_100000221 Ga0070661_10000022112 224
1125 3300005353 Ga0070669_100017073 Ga0070669_1000170736 224
1126 3300005441 Ga0070700_100440784 Ga0070700_1004407841 224
1127 3300005456 Ga0070678_100412312 Ga0070678_1004123122 224
1128 3300005539 Ga0068853_100067432 Ga0068853_1000674323 224
1129 3300005548 Ga0070665_100090630 Ga0070665_1000906302 224
1130 3300005548 Ga0070665_100117303 Ga0070665_1001173032 224
1131 3300005548 Ga0070665_100233214 Ga0070665_1002332142 224
1132 3300005564 Ga0070664_100001101 Ga0070664_1000011018 224
1133 3300005577 Ga0068857_100003218 Ga0068857_1000032184 224
1134 3300005578 Ga0068854_100078594 Ga0068854_1000785942 224
1135 3300005834 Ga0068851_10011603 Ga0068851_100116034 224
1136 3300006048 Ga0075363_100468782 Ga0075363_1004687821 224
1137 3300006051 Ga0075364_10072909 Ga0075364_100729091 224
1138 3300006051 Ga0075364_10085946 Ga0075364_100859462 224
1139 3300006051 Ga0075364_10216662 Ga0075364_102166622 224
1140 3300006195 Ga0075366_10005676 Ga0075366_100056765 224
1141 3300006195 Ga0075366_10091668 Ga0075366_100916682 224
1142 3300006353 Ga0075370_10230606 Ga0075370_102306062 224
1143 3300006944 Ga0099823_1000397 Ga0099823_100039724 224
1144 3300006946 Ga0079104_1000135 Ga0079104_100013550 224
1145 3300006946 Ga0079104_1000487 Ga0079104_100048710 224
1146 3300006946 Ga0079104_1001580 Ga0079104_10015807 224
1147 3300006946 Ga0079104_1002605 Ga0079104_10026058 224
1148 3300006946 Ga0079104_1002650 Ga0079104_10026501 224
1149 3300006946 Ga0079104_1006134 Ga0079104_10061341 224
1150 3300006946 Ga0079104_1028407 Ga0079104_10284071 224
1151 3300006946 Ga0079104_1073335 Ga0079104_10733351 224
1152 3300006948 Ga0099826_10012472 Ga0099826_100124725 224
1153 3300009011 Ga0105251_10000500 Ga0105251_100005002 224
1154 3300009011 Ga0105251_10000649 Ga0105251_100006499 224
1155 3300009011 Ga0105251_10002203 Ga0105251_100022037 224
1156 3300009011 Ga0105251_10002226 Ga0105251_1000222612 224
1157 3300009011 Ga0105251_10019937 Ga0105251_100199371 224
1158 3300009011 Ga0105251_10021742 Ga0105251_100217423 224
1159 3300009011 Ga0105251_10025169 Ga0105251_100251691 224
1160 3300009011 Ga0105251_10059723 Ga0105251_100597232 224
1161 3300009011 Ga0105251_10088202 Ga0105251_100882022 224
1162 3300009011 Ga0105251_10089046 Ga0105251_100890462 224
1163 3300009011 Ga0105251_10092604 Ga0105251_100926042 224
1164 3300009011 Ga0105251_10195998 Ga0105251_101959982 224
1165 3300009036 Ga0105244_10000246 Ga0105244_1000024635 224
1166 3300009036 Ga0105244_10000337 Ga0105244_1000033728 224
1167 3300009036 Ga0105244_10000342 Ga0105244_100003424 224
1168 3300009036 Ga0105244_10001474 Ga0105244_1000147410 224
1169 3300009036 Ga0105244_10002267 Ga0105244_1000226711 224
1170 3300009036 Ga0105244_10007923 Ga0105244_100079234 224
1171 3300009036 Ga0105244_10022204 Ga0105244_100222043 224
1172 3300009036 Ga0105244_10025529 Ga0105244_100255292 224
1173 3300009036 Ga0105244_10028040 Ga0105244_100280402 224
1174 3300009036 Ga0105244_10033494 Ga0105244_100334942 224
1175 3300009036 Ga0105244_10057283 Ga0105244_100572832 224
1176 3300009036 Ga0105244_10060740 Ga0105244_100607402 224
1177 3300009036 Ga0105244_10066137 Ga0105244_100661372 224
1178 3300009036 Ga0105244_10067245 Ga0105244_100672452 224
1179 3300009036 Ga0105244_10110909 Ga0105244_101109093 224
1180 3300009036 Ga0105244_10119654 Ga0105244_101196541 224
1181 3300009036 Ga0105244_10120223 Ga0105244_101202232 224
1182 3300009036 Ga0105244_10125113 Ga0105244_101251131 224
1183 3300009036 Ga0105244_10125660 Ga0105244_101256601 224
1184 3300009092 Ga0105250_10000007 Ga0105250_10000007182 224
1185 3300009092 Ga0105250_10000018 Ga0105250_1000001875 224
1186 3300009092 Ga0105250_10002387 Ga0105250_100023874 224
1187 3300009092 Ga0105250_10003285 Ga0105250_100032852 224
1188 3300009092 Ga0105250_10006776 Ga0105250_100067762 224
1189 3300009092 Ga0105250_10013064 Ga0105250_100130644 224
1190 3300009092 Ga0105250_10023962 Ga0105250_100239622 224
1191 3300009092 Ga0105250_10073013 Ga0105250_100730132 224
1192 3300009101 Ga0105247_10000416 Ga0105247_1000041625 224
1193 3300009148 Ga0105243_10000587 Ga0105243_100005873 224
1194 3300009148 Ga0105243_10040506 Ga0105243_100405064 224
1195 3300009148 Ga0105243_10068541 Ga0105243_100685412 224
1196 3300009174 Ga0105241_10000001 Ga0105241_10000001693 224
1197 3300009176 Ga0105242_10006800 Ga0105242_100068006 224
1198 3300009176 Ga0105242_10515440 Ga0105242_105154402 224
1199 3300009177 Ga0105248_10174768 Ga0105248_101747683 224
1200 3300009545 Ga0105237_10000582 Ga0105237_1000058231 224
1201 3300009545 Ga0105237_10274158 Ga0105237_102741582 224
1202 3300011119 Ga0105246_10086246 Ga0105246_100862462 224
1203 3300011119 Ga0105246_10139431 Ga0105246_101394312 224
1204 3300011119 Ga0105246_10146747 Ga0105246_101467472 224
1205 3300011119 Ga0105246_10949496 Ga0105246_109494961 224
1206 3300011119 Ga0105246_10949497 Ga0105246_109494971 224
1207 3300013100 Ga0157373_10000400 Ga0157373_100004002 224
1208 3300013100 Ga0157373_10003007 Ga0157373_1000300710 224
1209 3300013100 Ga0157373_10005419 Ga0157373_100054196 224
1210 3300013100 Ga0157373_10063017 Ga0157373_100630172 224
1211 3300013100 Ga0157373_10102302 Ga0157373_101023022 224
1212 3300013100 Ga0157373_10222974 Ga0157373_102229742 224
1213 3300013102 Ga0157371_10000006 Ga0157371_10000006140 224
1214 3300013102 Ga0157371_10000560 Ga0157371_1000056021 224
1215 3300013102 Ga0157371_10001683 Ga0157371_1000168312 224
1216 3300013102 Ga0157371_10002562 Ga0157371_1000256215 224
1217 3300013102 Ga0157371_10002986 Ga0157371_1000298611 224
1218 3300013102 Ga0157371_10016802 Ga0157371_100168024 224
1219 3300013102 Ga0157371_10043415 Ga0157371_100434152 224
1220 3300013104 Ga0157370_10000618 Ga0157370_100006184 224
1221 3300013104 Ga0157370_10000644 Ga0157370_1000064426 224
1222 3300013104 Ga0157370_10026206 Ga0157370_100262062 224
1223 3300013104 Ga0157370_10063557 Ga0157370_100635571 224
1224 3300013104 Ga0157370_10121597 Ga0157370_101215972 224
1225 3300013104 Ga0157370_10254613 Ga0157370_102546132 224
1226 3300013104 Ga0157370_10733782 Ga0157370_107337821 224
1227 3300013105 Ga0157369_10000375 Ga0157369_100003754 224
1228 3300013105 Ga0157369_10001060 Ga0157369_1000106031 224
1229 3300013306 Ga0163162_10022107 Ga0163162_100221072 224
1230 3300013307 Ga0157372_10001955 Ga0157372_1000195510 224
1231 3300013307 Ga0157372_10002168 Ga0157372_1000216810 224
1232 3300013307 Ga0157372_10016311 Ga0157372_100163115 224
1233 3300013307 Ga0157372_10021477 Ga0157372_100214774 224
1234 3300013307 Ga0157372_10062065 Ga0157372_100620653 224
1235 3300013307 Ga0157372_10144931 Ga0157372_101449311 224
1236 3300013307 Ga0157372_10144933 Ga0157372_101449331 224
1237 3300013308 Ga0157375_10662900 Ga0157375_106629002 224
1238 3300014497 Ga0182008_10001623 Ga0182008_100016232 224
1239 3300014497 Ga0182008_10029374 Ga0182008_100293743 224
1240 3300015261 Ga0182006_1000024 Ga0182006_100002411 224
1241 3300015261 Ga0182006_1014014 Ga0182006_10140143 224
1242 3300015261 Ga0182006_1023446 Ga0182006_10234464 224
1243 3300015261 Ga0182006_1035307 Ga0182006_10353072 224
1244 3300015262 Ga0182007_10048505 Ga0182007_100485052 224
1245 3300015262 Ga0182007_10062034 Ga0182007_100620341 224
1246 3300015265 Ga0182005_1093785 Ga0182005_10937851 224
1247 3300015679 Ga0183366_1001 Ga0183366_10012382 224
1248 3300015680 Ga0183370_1001 Ga0183370_10012382 224
1249 3300015685 Ga0183369_1001 Ga0183369_10012383 224
1250 3300015687 Ga0183368_1001 Ga0183368_10012382 224
1251 3300017792 Ga0163161_10000003 Ga0163161_10000003186 224
1252 3300017792 Ga0163161_10034504 Ga0163161_100345043 224
1253 3300017792 Ga0163161_10095441 Ga0163161_100954412 224
1254 3300017792 Ga0163161_10231290 Ga0163161_102312902 224
1255 3300017792 Ga0163161_10563445 Ga0163161_105634451 224
1256 3300021384 Ga0213876_10000023 Ga0213876_1000002367 224
1257 3300025206 Ga0209435_103421 Ga0209435_1034212 224
1258 3300025207 Ga0209760_100018 Ga0209760_100018161 224
1259 3300025207 Ga0209760_100089 Ga0209760_10008926 224
1260 3300025207 Ga0209760_100093 Ga0209760_10009316 224
1261 3300025224 Ga0209784_100001 Ga0209784_1000012986 224
1262 3300025224 Ga0209784_100126 Ga0209784_10012624 224
1263 3300025225 Ga0209566_100001 Ga0209566_1000012986 224
1264 3300025225 Ga0209566_100152 Ga0209566_10015224 224
1265 3300025226 Ga0209674_100002 Ga0209674_1000022986 224
1266 3300025226 Ga0209674_100177 Ga0209674_10017724 224
1267 3300025229 Ga0209147_100179 Ga0209147_10017924 224
1268 3300025230 Ga0209563_100002 Ga0209563_1000021521 224
1269 3300025230 Ga0209563_100142 Ga0209563_10014224 224
1270 3300025230 Ga0209563_101212 Ga0209563_1012126 224
1271 3300025231 Ga0207427_100009 Ga0207427_100009387 224
1272 3300025231 Ga0207427_100011 Ga0207427_100011206 224
1273 3300025231 Ga0207427_100015 Ga0207427_100015347 224
1274 3300025233 Ga0209437_100001 Ga0209437_1000011521 224
1275 3300025233 Ga0209437_100027 Ga0209437_100027168 224
1276 3300025233 Ga0209437_100044 Ga0209437_100044206 224
1277 3300025233 Ga0209437_100103 Ga0209437_10010397 224
1278 3300025242 Ga0209258_100366 Ga0209258_10036652 224
1279 3300025246 Ga0209646_1000380 Ga0209646_100038024 224
1280 3300025253 Ga0209677_100002 Ga0209677_1000021521 224
1281 3300025253 Ga0209677_100125 Ga0209677_10012524 224
1282 3300025256 Ga0209759_1001848 Ga0209759_10018484 224
1283 3300025256 Ga0209759_1021634 Ga0209759_10216342 224
1284 3300025258 Ga0209129_1000037 Ga0209129_1000037187 224
1285 3300025261 Ga0209233_1000039 Ga0209233_1000039347 224
1286 3300025261 Ga0209233_1000057 Ga0209233_1000057206 224
1287 3300025261 Ga0209233_1001125 Ga0209233_10011252 224
1288 3300025291 Ga0209675_1004567 Ga0209675_10045672 224
1289 3300025292 Ga0209676_1000002 Ga0209676_1000002333 224
1290 3300025292 Ga0209676_1000017 Ga0209676_1000017312 224
1291 3300025292 Ga0209676_1000696 Ga0209676_100069632 224
1292 3300025292 Ga0209676_1004220 Ga0209676_10042206 224
1293 3300025292 Ga0209676_1055738 Ga0209676_10557381 224
1294 3300025298 Ga0209050_1000037 Ga0209050_1000037346 224
1295 3300025298 Ga0209050_1025723 Ga0209050_10257233 224
1296 3300025298 Ga0209050_1026442 Ga0209050_10264422 224
1297 3300025303 Ga0209051_1000001 Ga0209051_1000001333 224
1298 3300025303 Ga0209051_1000666 Ga0209051_100066625 224
1299 3300025303 Ga0209051_1033587 Ga0209051_10335872 224
1300 3300025304 Ga0209257_1000056 Ga0209257_10000562 224
1301 3300025304 Ga0209257_1019138 Ga0209257_10191382 224
1302 3300025321 Ga0207656_10004868 Ga0207656_100048684 224
1303 3300025321 Ga0207656_10043071 Ga0207656_100430712 224
1304 3300025711 Ga0207696_1000001 Ga0207696_10000012331 224
1305 3300025711 Ga0207696_1000013 Ga0207696_1000013333 224
1306 3300025711 Ga0207696_1000029 Ga0207696_1000029217 224
1307 3300025711 Ga0207696_1000081 Ga0207696_100008184 224
1308 3300025711 Ga0207696_1000117 Ga0207696_100011734 224
1309 3300025711 Ga0207696_1000124 Ga0207696_100012452 224
1310 3300025711 Ga0207696_1000147 Ga0207696_1000147107 224
1311 3300025711 Ga0207696_1000185 Ga0207696_100018537 224
1312 3300025711 Ga0207696_1000275 Ga0207696_10002757 224
1313 3300025711 Ga0207696_1000766 Ga0207696_100076618 224
1314 3300025711 Ga0207696_1001267 Ga0207696_100126713 224
1315 3300025711 Ga0207696_1011700 Ga0207696_10117003 224
1316 3300025711 Ga0207696_1032044 Ga0207696_10320441 224
1317 3300025728 Ga0207655_1000002 Ga0207655_1000002259 224
1318 3300025728 Ga0207655_1000004 Ga0207655_1000004247 224
1319 3300025728 Ga0207655_1000007 Ga0207655_1000007585 224
1320 3300025728 Ga0207655_1000041 Ga0207655_100004174 224
1321 3300025728 Ga0207655_1000062 Ga0207655_10000626 224
1322 3300025728 Ga0207655_1000094 Ga0207655_100009424 224
1323 3300025728 Ga0207655_1000115 Ga0207655_100011558 224
1324 3300025728 Ga0207655_1000205 Ga0207655_100020545 224
1325 3300025728 Ga0207655_1000540 Ga0207655_100054020 224
1326 3300025728 Ga0207655_1000769 Ga0207655_10007693 224
1327 3300025728 Ga0207655_1003638 Ga0207655_10036384 224
1328 3300025728 Ga0207655_1006042 Ga0207655_10060428 224
1329 3300025728 Ga0207655_1007903 Ga0207655_10079035 224
1330 3300025728 Ga0207655_1011548 Ga0207655_10115482 224
1331 3300025728 Ga0207655_1011844 Ga0207655_10118444 224
1332 3300025728 Ga0207655_1013784 Ga0207655_10137844 224
1333 3300025728 Ga0207655_1014509 Ga0207655_10145093 224
1334 3300025728 Ga0207655_1019433 Ga0207655_10194332 224
1335 3300025728 Ga0207655_1019756 Ga0207655_10197562 224
1336 3300025728 Ga0207655_1020977 Ga0207655_10209774 224
1337 3300025728 Ga0207655_1026768 Ga0207655_10267683 224
1338 3300025728 Ga0207655_1033923 Ga0207655_10339233 224
1339 3300025728 Ga0207655_1096446 Ga0207655_10964462 224
1340 3300025735 Ga0207713_1000001 Ga0207713_10000011832 224
1341 3300025735 Ga0207713_1000023 Ga0207713_100002395 224
1342 3300025735 Ga0207713_1000083 Ga0207713_1000083118 224
1343 3300025735 Ga0207713_1000208 Ga0207713_10002087 224
1344 3300025735 Ga0207713_1000241 Ga0207713_100024168 224
1345 3300025735 Ga0207713_1000397 Ga0207713_100039711 224
1346 3300025735 Ga0207713_1001368 Ga0207713_100136820 224
1347 3300025735 Ga0207713_1001926 Ga0207713_10019267 224
1348 3300025735 Ga0207713_1002140 Ga0207713_100214010 224
1349 3300025735 Ga0207713_1006051 Ga0207713_10060518 224
1350 3300025735 Ga0207713_1006520 Ga0207713_10065204 224
1351 3300025735 Ga0207713_1006730 Ga0207713_10067306 224
1352 3300025735 Ga0207713_1011365 Ga0207713_10113655 224
1353 3300025735 Ga0207713_1015136 Ga0207713_10151362 224
1354 3300025735 Ga0207713_1022789 Ga0207713_10227893 224
1355 3300025735 Ga0207713_1046537 Ga0207713_10465372 224
1356 3300025735 Ga0207713_1048315 Ga0207713_10483153 224
1357 3300025735 Ga0207713_1050065 Ga0207713_10500652 224
1358 3300025900 Ga0207710_10000116 Ga0207710_100001162 224
1359 3300025911 Ga0207654_10000004 Ga0207654_10000004721 224
1360 3300025913 Ga0207695_10092453 Ga0207695_100924532 224
1361 3300025914 Ga0207671_10002402 Ga0207671_1000240215 224
1362 3300025914 Ga0207671_10259363 Ga0207671_102593632 224
1363 3300025920 Ga0207649_10000091 Ga0207649_1000009143 224
1364 3300025923 Ga0207681_10012158 Ga0207681_100121584 224
1365 3300025925 Ga0207650_10196516 Ga0207650_101965162 224
1366 3300025933 Ga0207706_10005988 Ga0207706_100059889 224
1367 3300025934 Ga0207686_10404358 Ga0207686_104043582 224
1368 3300025935 Ga0207709_10000014 Ga0207709_10000014371 224
1369 3300025935 Ga0207709_10044337 Ga0207709_100443373 224
1370 3300025935 Ga0207709_10045254 Ga0207709_100452542 224
1371 3300025945 Ga0207679_10000016 Ga0207679_10000016191 224
1372 3300025961 Ga0207712_10035652 Ga0207712_100356522 224
1373 3300025972 Ga0207668_10056646 Ga0207668_100566462 224
1374 3300025981 Ga0207640_10066017 Ga0207640_100660173 224
1375 3300026041 Ga0207639_10042648 Ga0207639_100426483 224
1376 3300026075 Ga0207708_10339945 Ga0207708_103399452 224
1377 3300026116 Ga0207674_10006670 Ga0207674_100066708 224
1378 3300027111 Ga0209281_1000004 Ga0209281_1000004217 224
1379 3300027111 Ga0209281_1000038 Ga0209281_1000038191 224
1380 3300027111 Ga0209281_1000073 Ga0209281_1000073222 224
1381 3300027111 Ga0209281_1000095 Ga0209281_1000095189 224
1382 3300027111 Ga0209281_1000219 Ga0209281_100021984 224
1383 3300027111 Ga0209281_1000245 Ga0209281_100024517 224
1384 3300027111 Ga0209281_1000286 Ga0209281_100028688 224
1385 3300027111 Ga0209281_1000523 Ga0209281_100052332 224
1386 3300027111 Ga0209281_1001391 Ga0209281_10013919 224
1387 3300027111 Ga0209281_1001556 Ga0209281_10015567 224
1388 3300027111 Ga0209281_1014319 Ga0209281_10143191 224
1389 3300027111 Ga0209281_1034725 Ga0209281_10347251 224
1390 3300027296 Ga0209389_1000059 Ga0209389_100005938 224
1391 3300027312 Ga0209371_1000001 Ga0209371_10000012374 224
1392 3300027312 Ga0209371_1000005 Ga0209371_1000005904 224
1393 3300027312 Ga0209371_1000015 Ga0209371_1000015295 224
1394 3300027312 Ga0209371_1000108 Ga0209371_100010830 224
1395 3300027312 Ga0209371_1000118 Ga0209371_100011892 224
1396 3300027312 Ga0209371_1000559 Ga0209371_10005596 224
1397 3300027312 Ga0209371_1000623 Ga0209371_10006238 224
1398 3300027312 Ga0209371_1001065 Ga0209371_100106518 224
1399 3300027312 Ga0209371_1001486 Ga0209371_100148610 224
1400 3300027312 Ga0209371_1001911 Ga0209371_10019115 224
1401 3300027312 Ga0209371_1001929 Ga0209371_100192912 224
1402 3300027312 Ga0209371_1003423 Ga0209371_10034238 224
1403 3300027312 Ga0209371_1005379 Ga0209371_10053792 224
1404 3300027312 Ga0209371_1005669 Ga0209371_10056692 224
1405 3300027312 Ga0209371_1005973 Ga0209371_10059734 224
1406 3300027312 Ga0209371_1008915 Ga0209371_10089153 224
1407 3300027312 Ga0209371_1039405 Ga0209371_10394052 224
1408 3300027312 Ga0209371_1047394 Ga0209371_10473941 224
1409 3300027360 Ga0209969_1038876 Ga0209969_10388761 224
1410 3300027395 Ga0209996_1001408 Ga0209996_10014082 224
1411 3300027471 Ga0209995_1002861 Ga0209995_10028612 224
1412 3300027526 Ga0209968_1017603 Ga0209968_10176032 224
1413 3300027543 Ga0209999_1000815 Ga0209999_10008155 224
1414 3300027543 Ga0209999_1003362 Ga0209999_10033622 224
1415 3300027552 Ga0209982_1000570 Ga0209982_10005702 224
1416 3300027617 Ga0210002_1014314 Ga0210002_10143142 224
1417 3300027665 Ga0209983_1008056 Ga0209983_10080562 224
1418 3300027682 Ga0209971_1002760 Ga0209971_10027604 224
1419 3300027876 Ga0209974_10011293 Ga0209974_100112932 224
1420 3300027876 Ga0209974_10020683 Ga0209974_100206833 224
1421 3300027907 Ga0207428_10307440 Ga0207428_103074402 224
1422 3300028379 Ga0268266_10000922 Ga0268266_100009228 224
1423 3300028379 Ga0268266_10014247 Ga0268266_100142473 224
1424 3300028573 Ga0265334_10000027 Ga0265334_1000002722 224
1425 3300030500 Ga0268256_1000001 Ga0268256_1000001266 224
1426 3300030500 Ga0268256_1000006 Ga0268256_1000006153 224
1427 3300030500 Ga0268256_1000018 Ga0268256_1000018329 224
1428 3300030500 Ga0268256_1000035 Ga0268256_10000351 224
1429 3300030500 Ga0268256_1000076 Ga0268256_1000076171 224
1430 3300030500 Ga0268256_1000100 Ga0268256_100010092 224
1431 3300030500 Ga0268256_1001225 Ga0268256_100122512 224
1432 3300030500 Ga0268256_1001273 Ga0268256_10012735 224
1433 3300030500 Ga0268256_1002311 Ga0268256_10023118 224
1434 3300030500 Ga0268256_1003145 Ga0268256_10031455 224
1435 3300030500 Ga0268256_1005534 Ga0268256_10055344 224
1436 3300030500 Ga0268256_1005606 Ga0268256_10056063 224
1437 3300030500 Ga0268256_1009434 Ga0268256_10094343 224
1438 3300030500 Ga0268256_1009898 Ga0268256_10098983 224
1439 3300030500 Ga0268256_1012362 Ga0268256_10123622 224
1440 3300030500 Ga0268256_1019408 Ga0268256_10194082 224
1441 3300030733 Ga0314311_1177641 Ga0314311_11776415 224
1442 3300030742 Ga0316183_1021560 Ga0316183_10215602 224
1443 3300030744 Ga0316181_1094953 Ga0316181_10949531 224
1444 3300031548 Ga0307408_100000004 Ga0307408_100000004562 224
1445 3300032004 Ga0307414_10354090 Ga0307414_103540902 224
1446 3300033180 Ga0307510_10149283 Ga0307510_101492832 224
1447 3300038705 Ga0237819_01448 Ga0237819_01448_2290_2964 224
1448 3300039437 Ga0436365_0965775 Ga0436365_0965775_79983_80657 224
1449 3300041404 Ga0439436_0009562 Ga0439436_0009562_1005_1682 224
1450 3300041405 Ga0439438_000002 Ga0439438_000002_347874_348551 224
1451 3300041405 Ga0439438_005231 Ga0439438_005231_806_1480 224
1452 3300041405 Ga0439438_010532 Ga0439438_010532_1867_2544 224
1453 3300041405 Ga0439438_013436 Ga0439438_013436_696_1370 224
1454 3300041405 Ga0439438_039147 Ga0439438_039147_469_1143 224
1455 3300041407 Ga0439447_000766 Ga0439447_000766_9870_10547 224
1456 3300041407 Ga0439447_001765 Ga0439447_001765_5912_6589 224
1457 3300041407 Ga0439447_004016 Ga0439447_004016_3862_4536 224
1458 3300041411 Ga0439466_0000001 Ga0439466_0000001_402950_403627 224
1459 3300041411 Ga0439466_0043834 Ga0439466_0043834_168_845 224
1460 3300041486 Ga0451807_2221466 Ga0451807_2221466_266_940 224
1461 3300041512 Ga0451853_3687995 Ga0451853_3687995_920_1597 224
1462 3300042000 Ga0439437_001932 Ga0439437_001932_598_1275 224
1463 3300042006 Ga0439432_006455 Ga0439432_006455_1114_1788 224
1464 3300042006 Ga0439432_008550 Ga0439432_008550_1408_2085 224
1465 3300042006 Ga0439432_019197 Ga0439432_019197_831_1508 224
1466 3300042010 Ga0439452_000002 Ga0439452_000002_243396_244070 224
1467 3300042010 Ga0439452_000015 Ga0439452_000015_38423_39100 224
1468 3300042010 Ga0439452_000020 Ga0439452_000020_23668_24342 224
1469 3300042010 Ga0439452_002528 Ga0439452_002528_3973_4647 224
1470 3300042010 Ga0439452_003897 Ga0439452_003897_400_1074 224
1471 3300042010 Ga0439452_010867 Ga0439452_010867_748_1425 224
1472 3300042010 Ga0439452_013703 Ga0439452_013703_583_1260 224
1473 3300042013 Ga0439456_002909 Ga0439456_002909_1970_2647 224
1474 3300042016 Ga0439463_008014 Ga0439463_008014_996_1673 224
1475 3300042115 Ga0450911_000013 Ga0450911_000013_1694_2371 224
1476 3300042129 Ga0450891_003387 Ga0450891_003387_164_841 224
1477 3300042136 Ga0450900_006691 Ga0450900_006691_70_747 224
1478 3300042139 Ga0450904_000563 Ga0450904_000563_3202_3879 224
1479 3300042142 Ga0450905_003201 Ga0450905_003201_1008_1685 224
1480 3300042146 Ga0450907_001332 Ga0450907_001332_1824_2501 224
1481 3300042439 Ga0439464_0001265 Ga0439464_0001265_1401_2078 224
1482 3300042439 Ga0439464_0008628 Ga0439464_0008628_981_1658 224
1483 3300042439 Ga0439464_0009525 Ga0439464_0009525_667_1344 224
1484 3300042530 Ga0450916_008641 Ga0450916_008641_541_1218 224
1485 3300042533 Ga0450901_001122 Ga0450901_001122_602_1279 224
1486 3300044669 Ga0466981_0000013 Ga0466981_0000013_90286_90960 224
1487 3300046453 Ga0495627_001293 Ga0495627_001293_777_1451 224
1488 3300046453 Ga0495627_002814 Ga0495627_002814_1605_2279 224
1489 3300046453 Ga0495627_004099 Ga0495627_004099_994_1668 224
1490 3300046453 Ga0495627_011664 Ga0495627_011664_683_1357 224
1491 3300046457 Ga0495590_0065519 Ga0495590_0065519_578_1252 224
1492 3300046458 Ga0495591_000001 Ga0495591_000001_314214_314894 224
1493 3300046458 Ga0495591_000294 Ga0495591_000294_34470_35144 224
1494 3300046458 Ga0495591_002693 Ga0495591_002693_5612_6286 224
1495 3300046458 Ga0495591_003463 Ga0495591_003463_1533_2207 224
1496 3300046458 Ga0495591_018161 Ga0495591_018161_650_1324 224
1497 3300046458 Ga0495591_019023 Ga0495591_019023_1003_1680 224
1498 3300046458 Ga0495591_022970 Ga0495591_022970_1120_1794 224
1499 3300046463 Ga0495653_0096886 Ga0495653_0096886_760_1434 224
1500 3300046471 Ga0495650_0000018 Ga0495650_0000018_63504_64178 224
1501 3300046471 Ga0495650_0000047 Ga0495650_0000047_59579_60253 224
1502 3300046471 Ga0495650_0000065 Ga0495650_0000065_101560_102234 224
1503 3300046471 Ga0495650_0034724 Ga0495650_0034724_837_1511 224
1504 3300046471 Ga0495650_0041541 Ga0495650_0041541_404_1078 224
1505 3300046474 Ga0495605_0001329 Ga0495605_0001329_9977_10651 224
1506 3300046474 Ga0495605_0003755 Ga0495605_0003755_905_1579 224
1507 3300046474 Ga0495605_0016097 Ga0495605_0016097_2035_2709 224
1508 3300046474 Ga0495605_0062880 Ga0495605_0062880_219_893 224
1509 3300046491 Ga0495584_0009860 Ga0495584_0009860_4102_4776 224
1510 3300046491 Ga0495584_0054593 Ga0495584_0054593_1082_1756 224
1511 3300046492 Ga0495585_0054882 Ga0495585_0054882_904_1578 224
1512 3300046492 Ga0495585_0073715 Ga0495585_0073715_666_1343 224
1513 3300046499 Ga0495594_0052832 Ga0495594_0052832_1055_1729 224
1514 3300046500 Ga0495596_0031937 Ga0495596_0031937_635_1312 224
1515 3300046500 Ga0495596_0110699 Ga0495596_0110699_157_831 224
1516 3300046501 Ga0495607_0007302 Ga0495607_0007302_1216_1890 224
1517 3300046501 Ga0495607_0007331 Ga0495607_0007331_5971_6645 224
1518 3300046501 Ga0495607_0013183 Ga0495607_0013183_471_1145 224
1519 3300046501 Ga0495607_0046555 Ga0495607_0046555_144_818 224
1520 3300046501 Ga0495607_0144411 Ga0495607_0144411_71_745 224
1521 3300046506 Ga0495583_0002373 Ga0495583_0002373_5605_6279 224
1522 3300046507 Ga0495606_0002485 Ga0495606_0002485_9177_9851 224
1523 3300046507 Ga0495606_0008696 Ga0495606_0008696_825_1499 224
1524 3300046507 Ga0495606_0067958 Ga0495606_0067958_735_1409 224
1525 3300046507 Ga0495606_0111942 Ga0495606_0111942_236_910 224
1526 3300046512 Ga0495610_0005513 Ga0495610_0005513_5663_6337 224
1527 3300046512 Ga0495610_0027951 Ga0495610_0027951_127_801 224
1528 3300046513 Ga0495616_0130415 Ga0495616_0130415_16_690 224
1529 3300046515 Ga0495620_0000442 Ga0495620_0000442_25757_26434 224
1530 3300046515 Ga0495620_0020756 Ga0495620_0020756_745_1419 224
1531 3300046515 Ga0495620_0079176 Ga0495620_0079176_104_778 224
1532 3300046515 Ga0495620_0086445 Ga0495620_0086445_462_1136 224
1533 3300046518 Ga0495631_0005429 Ga0495631_0005429_272_946 224
1534 3300046518 Ga0495631_0024246 Ga0495631_0024246_1742_2416 224
1535 3300046519 Ga0495632_0017242 Ga0495632_0017242_2759_3436 224
1536 3300046519 Ga0495632_0022277 Ga0495632_0022277_1898_2572 224
1537 3300046519 Ga0495632_0050001 Ga0495632_0050001_417_1091 224
1538 3300046519 Ga0495632_0060310 Ga0495632_0060310_606_1280 224
1539 3300046520 Ga0495637_0010588 Ga0495637_0010588_1475_2149 224
1540 3300046522 Ga0495643_0012496 Ga0495643_0012496_3946_4623 224
1541 3300046522 Ga0495643_0020777 Ga0495643_0020777_2910_3587 224
1542 3300046522 Ga0495643_0033482 Ga0495643_0033482_101_775 224
1543 3300046522 Ga0495643_0084001 Ga0495643_0084001_743_1417 224
1544 3300046523 Ga0495644_0005253 Ga0495644_0005253_2648_3322 224
1545 3300046524 Ga0495648_0012791 Ga0495648_0012791_2609_3286 224
1546 3300046524 Ga0495648_0021611 Ga0495648_0021611_1561_2235 224
1547 3300046524 Ga0495648_0034739 Ga0495648_0034739_918_1592 224
1548 3300046524 Ga0495648_0049812 Ga0495648_0049812_1019_1696 224
1549 3300046530 Ga0495654_0000009 Ga0495654_0000009_286837_287517 224
1550 3300046530 Ga0495654_0001323 Ga0495654_0001323_6531_7205 224
1551 3300046530 Ga0495654_0002421 Ga0495654_0002421_1068_1742 224
1552 3300046530 Ga0495654_0015044 Ga0495654_0015044_516_1190 224
1553 3300046530 Ga0495654_0030540 Ga0495654_0030540_739_1413 224
1554 3300046530 Ga0495654_0133639 Ga0495654_0133639_54_728 224
1555 3300046530 Ga0495654_0179076 Ga0495654_0179076_32_706 224
1556 3300046538 Ga0495609_0000051 Ga0495609_0000051_4106_4780 224
1557 3300046538 Ga0495609_0003299 Ga0495609_0003299_2981_3655 224
1558 3300046538 Ga0495609_0024685 Ga0495609_0024685_895_1569 224
1559 3300046542 Ga0495597_0004166 Ga0495597_0004166_1424_2098 224
1560 3300046558 Ga0495633_0000915 Ga0495633_0000915_23273_23947 224
1561 3300046648 Ga0495611_0020449 Ga0495611_0020449_1184_1858 224
1562 3300046648 Ga0495611_0025207 Ga0495611_0025207_846_1520 224
1563 3300046660 Ga0495625_0000004 Ga0495625_0000004_1539_2213 224
1564 3300046660 Ga0495625_0011960 Ga0495625_0011960_402_1076 224
1565 3300046665 Ga0495661_0000013 Ga0495661_0000013_1105_1779 224
1566 3300046665 Ga0495661_0000548 Ga0495661_0000548_37302_37976 224
1567 3300046665 Ga0495661_0000809 Ga0495661_0000809_23017_23691 224
1568 3300046674 Ga0495588_0036433 Ga0495588_0036433_1647_2321 224
1569 3300046691 Ga0495670_0004477 Ga0495670_0004477_5615_6289 224
1570 3300046692 Ga0495671_0002913 Ga0495671_0002913_2980_3654 224
1571 3300046692 Ga0495671_0049519 Ga0495671_0049519_747_1421 224
1572 3300046692 Ga0495671_0076738 Ga0495671_0076738_811_1485 224
1573 3300046694 Ga0495649_0015931 Ga0495649_0015931_2684_3358 224
1574 3300046694 Ga0495649_0020506 Ga0495649_0020506_1579_2253 224
1575 3300046794 Ga0495589_0000003 Ga0495589_0000003_260038_260712 224
1576 3300046794 Ga0495589_0015919 Ga0495589_0015919_954_1628 224
1577 3300046794 Ga0495589_0048748 Ga0495589_0048748_1007_1681 224
1578 3300046794 Ga0495589_0091341 Ga0495589_0091341_400_1074 224
1579 3300046810 Ga0495660_0000004 Ga0495660_0000004_298611_299285 224
1580 3300046810 Ga0495660_0000017 Ga0495660_0000017_3209_3883 224
1581 3300046810 Ga0495660_0072561 Ga0495660_0072561_523_1197 224
1582 3300046810 Ga0495660_0136060 Ga0495660_0136060_219_896 224
1583 3300047320 Ga0495672_0000001 Ga0495672_0000001_1125359_1126033 224
1584 3300047320 Ga0495672_0000009 Ga0495672_0000009_158103_158777 224
1585 3300047320 Ga0495672_0000038 Ga0495672_0000038_123438_124115 224
1586 3300047320 Ga0495672_0053550 Ga0495672_0053550_608_1282 224
1587 3300047321 Ga0495676_0000023 Ga0495676_0000023_154906_155580 224
1588 3300047321 Ga0495676_0054753 Ga0495676_0054753_824_1498 224
1589 3300047323 Ga0495683_0000090 Ga0495683_0000090_89621_90295 224
1590 3300047323 Ga0495683_0000514 Ga0495683_0000514_5642_6316 224
1591 3300047446 Ga0495679_000032 Ga0495679_000032_71207_71881 224
1592 3300047446 Ga0495679_000505 Ga0495679_000505_1040_1714 224
1593 3300047446 Ga0495679_001387 Ga0495679_001387_4059_4733 224
1594 3300047446 Ga0495679_004343 Ga0495679_004343_5507_6184 224
1595 3300047446 Ga0495679_015469 Ga0495679_015469_558_1232 224
1596 3300047469 Ga0495673_0000019 Ga0495673_0000019_235075_235749 224
1597 3300047469 Ga0495673_0000071 Ga0495673_0000071_190231_190905 224
1598 3300047469 Ga0495673_0023667 Ga0495673_0023667_542_1216 224
1599 3300047469 Ga0495673_0067656 Ga0495673_0067656_747_1421 224
1600 3300047472 Ga0495686_0089975 Ga0495686_0089975_421_1095 224
1601 3300048091 Ga0495626_0000095 Ga0495626_0000095_113116_113790 224
1602 3300048903 Ga0496100_0080311 Ga0496100_0080311_872_1549 224
1603 3300048903 Ga0496100_0232381 Ga0496100_0232381_83_763 224
1604 3300048904 Ga0496101_0000060 Ga0496101_0000060_697_1377 224
1605 3300048904 Ga0496101_0603971 Ga0496101_0603971_105_779 224
1606 3300048905 Ga0496102_0150812 Ga0496102_0150812_989_1663 224
1607 3300048905 Ga0496102_0171025 Ga0496102_0171025_380_1057 224
1608 3300048906 Ga0496103_0110321 Ga0496103_0110321_279_956 224
1609 3300048907 Ga0496104_0000212 Ga0496104_0000212_8044_8718 224
1610 3300048907 Ga0496104_0043660 Ga0496104_0043660_618_1292 224
1611 3300048908 Ga0496105_0062827 Ga0496105_0062827_244_921 224
1612 3300048913 Ga0496110_0438032 Ga0496110_0438032_184_861 224
1613 3300048917 Ga0496114_0069631 Ga0496114_0069631_596_1273 224
1614 3300048919 Ga0496116_0000007 Ga0496116_0000007_298808_299482 224
1615 3300048919 Ga0496116_0000118 Ga0496116_0000118_104036_104710 224
1616 3300048919 Ga0496116_0000132 Ga0496116_0000132_154099_154773 224
1617 3300048919 Ga0496116_0000420 Ga0496116_0000420_37531_38208 224
1618 3300048919 Ga0496116_0000446 Ga0496116_0000446_831_1508 224
1619 3300048919 Ga0496116_0006113 Ga0496116_0006113_825_1499 224
1620 3300048919 Ga0496116_0014310 Ga0496116_0014310_5479_6156 224
1621 3300048919 Ga0496116_0043259 Ga0496116_0043259_476_1150 224
1622 3300048919 Ga0496116_0092235 Ga0496116_0092235_1121_1801 224
1623 3300048919 Ga0496116_0109529 Ga0496116_0109529_805_1479 224
1624 3300048919 Ga0496116_0167310 Ga0496116_0167310_373_1050 224
1625 3300048920 Ga0496117_0000009 Ga0496117_0000009_521539_522216 224
1626 3300048920 Ga0496117_0000113 Ga0496117_0000113_88322_88999 224
1627 3300048920 Ga0496117_0000504 Ga0496117_0000504_26981_27658 224
1628 3300048920 Ga0496117_0002374 Ga0496117_0002374_17413_18087 224
1629 3300048920 Ga0496117_0008055 Ga0496117_0008055_3473_4147 224
1630 3300048920 Ga0496117_0008355 Ga0496117_0008355_8889_9563 224
1631 3300048920 Ga0496117_0021821 Ga0496117_0021821_4009_4683 224
1632 3300048920 Ga0496117_0026137 Ga0496117_0026137_924_1598 224
1633 3300048920 Ga0496117_0089242 Ga0496117_0089242_689_1369 224
1634 3300048920 Ga0496117_0125419 Ga0496117_0125419_48_725 224
1635 3300048921 Ga0496118_0000017 Ga0496118_0000017_457225_457902 224
1636 3300048921 Ga0496118_0001101 Ga0496118_0001101_31894_32568 224
1637 3300048921 Ga0496118_0001258 Ga0496118_0001258_20944_21621 224
1638 3300048921 Ga0496118_0003548 Ga0496118_0003548_18529_19203 224
1639 3300048921 Ga0496118_0003973 Ga0496118_0003973_7649_8326 224
1640 3300048921 Ga0496118_0007913 Ga0496118_0007913_6910_7584 224
1641 3300048921 Ga0496118_0040635 Ga0496118_0040635_2259_2936 224
1642 3300048921 Ga0496118_0200729 Ga0496118_0200729_35_709 224
1643 3300048922 Ga0496119_0000011 Ga0496119_0000011_402784_403461 224
1644 3300048922 Ga0496119_0000012 Ga0496119_0000012_318582_319256 224
1645 3300048922 Ga0496119_0000129 Ga0496119_0000129_86980_87657 224
1646 3300048922 Ga0496119_0000194 Ga0496119_0000194_61372_62046 224
1647 3300048922 Ga0496119_0008725 Ga0496119_0008725_7561_8235 224
1648 3300048922 Ga0496119_0008995 Ga0496119_0008995_616_1293 224
1649 3300048922 Ga0496119_0043407 Ga0496119_0043407_1252_1926 224
1650 3300048922 Ga0496119_0050436 Ga0496119_0050436_717_1397 224
1651 3300048922 Ga0496119_0053625 Ga0496119_0053625_1249_1923 224
1652 3300048922 Ga0496119_0073749 Ga0496119_0073749_825_1499 224
1653 3300048922 Ga0496119_0095156 Ga0496119_0095156_412_1086 224
1654 3300048923 Ga0496120_0000004 Ga0496120_0000004_92662_93336 224
1655 3300048923 Ga0496120_0000081 Ga0496120_0000081_31686_32360 224
1656 3300048923 Ga0496120_0000179 Ga0496120_0000179_9832_10509 224
1657 3300048923 Ga0496120_0000186 Ga0496120_0000186_18915_19592 224
1658 3300048923 Ga0496120_0000206 Ga0496120_0000206_1260_1937 224
1659 3300048923 Ga0496120_0000632 Ga0496120_0000632_28873_29553 224
1660 3300048923 Ga0496120_0002896 Ga0496120_0002896_5899_6573 224
1661 3300048923 Ga0496120_0007219 Ga0496120_0007219_6144_6818 224
1662 3300048923 Ga0496120_0066813 Ga0496120_0066813_915_1589 224
1663 3300048923 Ga0496120_0082862 Ga0496120_0082862_348_1022 224
1664 3300048924 Ga0496121_0000224 Ga0496121_0000224_101996_102673 224
1665 3300048924 Ga0496121_0148900 Ga0496121_0148900_180_854 224
1666 3300048924 Ga0496121_0156685 Ga0496121_0156685_175_849 224
1667 3300048925 Ga0496122_0000003 Ga0496122_0000003_490822_491496 224
1668 3300048925 Ga0496122_0000303 Ga0496122_0000303_64425_65099 224
1669 3300048925 Ga0496122_0001758 Ga0496122_0001758_21807_22481 224
1670 3300048925 Ga0496122_0001770 Ga0496122_0001770_29442_30122 224
1671 3300048925 Ga0496122_0003568 Ga0496122_0003568_18583_19260 224
1672 3300048925 Ga0496122_0066730 Ga0496122_0066730_823_1497 224
1673 3300048925 Ga0496122_0070219 Ga0496122_0070219_1071_1745 224
1674 3300048926 Ga0496123_0000012 Ga0496123_0000012_246005_246679 224
1675 3300048926 Ga0496123_0000250 Ga0496123_0000250_43570_44244 224
1676 3300048926 Ga0496123_0001176 Ga0496123_0001176_7404_8078 224
1677 3300048926 Ga0496123_0008944 Ga0496123_0008944_254_928 224
1678 3300048926 Ga0496123_0010352 Ga0496123_0010352_5842_6522 224
1679 3300048926 Ga0496123_0013533 Ga0496123_0013533_442_1119 224
1680 3300048926 Ga0496123_0016478 Ga0496123_0016478_3874_4551 224
1681 3300048926 Ga0496123_0036419 Ga0496123_0036419_810_1484 224
1682 3300048926 Ga0496123_0051401 Ga0496123_0051401_962_1636 224
1683 3300048926 Ga0496123_0167035 Ga0496123_0167035_52_726 224
1684 3300048927 Ga0496124_0000027 Ga0496124_0000027_290115_290789 224
1685 3300048927 Ga0496124_0000028 Ga0496124_0000028_179039_179713 224
1686 3300048927 Ga0496124_0000738 Ga0496124_0000738_49709_50386 224
1687 3300048927 Ga0496124_0001085 Ga0496124_0001085_887_1561 224
1688 3300048927 Ga0496124_0001441 Ga0496124_0001441_1152_1826 224
1689 3300048927 Ga0496124_0002677 Ga0496124_0002677_1590_2264 224
1690 3300048927 Ga0496124_0003289 Ga0496124_0003289_4465_5139 224
1691 3300048927 Ga0496124_0009187 Ga0496124_0009187_9056_9730 224
1692 3300048927 Ga0496124_0019429 Ga0496124_0019429_818_1498 224
1693 3300048927 Ga0496124_0042797 Ga0496124_0042797_1291_1968 224
1694 3300048927 Ga0496124_0066234 Ga0496124_0066234_662_1339 224
1695 3300048927 Ga0496124_0068604 Ga0496124_0068604_1106_1783 224
1696 3300048927 Ga0496124_0106428 Ga0496124_0106428_475_1149 224
1697 3300048927 Ga0496124_0209412 Ga0496124_0209412_620_1297 224
1698 3300048928 Ga0496125_0000052 Ga0496125_0000052_202275_202949 224
1699 3300048928 Ga0496125_0008709 Ga0496125_0008709_1366_2040 224
1700 3300048928 Ga0496125_0025608 Ga0496125_0025608_1631_2308 224
1701 3300048928 Ga0496125_0074463 Ga0496125_0074463_902_1579 224
1702 3300048928 Ga0496125_0098242 Ga0496125_0098242_668_1342 224
1703 3300048929 Ga0496126_0000410 Ga0496126_0000410_64760_65434 224
1704 3300048929 Ga0496126_0021260 Ga0496126_0021260_4753_5427 224
1705 3300048929 Ga0496126_0032462 Ga0496126_0032462_993_1667 224
1706 3300048929 Ga0496126_0072885 Ga0496126_0072885_1660_2340 224
1707 3300048929 Ga0496126_0077966 Ga0496126_0077966_914_1591 224
1708 3300049459 Ga0495678_001728 Ga0495678_001728_9980_10654 224
1709 3300049459 Ga0495678_002124 Ga0495678_002124_2622_3296 224
1710 3300049459 Ga0495678_030301 Ga0495678_030301_1362_2039 224
1711 3300049460 Ga0495682_0001613 Ga0495682_0001613_1677_2351 224
1712 3300049460 Ga0495682_0011912 Ga0495682_0011912_1766_2440 224
1713 3300049460 Ga0495682_0044862 Ga0495682_0044862_158_832 224
1714 3300049530 Ga0501314_007074 Ga0501314_007074_94_771 224
1715 3300049571 Ga0501034_0000145 Ga0501034_0000145_125272_125949 224
1716 3300049571 Ga0501034_0083430 Ga0501034_0083430_1641_2318 224
1717 3300049574 Ga0501038_0255896 Ga0501038_0255896_34_711 224
1718 3300049742 Ga0501080_0032637 Ga0501080_0032637_1760_2434 224
1719 3300049823 Ga0501044_0036795 Ga0501044_0036795_4178_4852 224
1720 3300049853 Ga0501226_000015 Ga0501226_000015_26126_26803 224
1721 3300050491 nmdc:mga00v17_122775_c1 nmdc:mga00v17_122775_c1_450_1130 224
1722 3300050491 nmdc:mga00v17_154009_c1 nmdc:mga00v17_154009_c1_255_929 224
1723 3300050491 nmdc:mga00v17_163505_c1 nmdc:mga00v17_163505_c1_376_1053 224
1724 3300050491 nmdc:mga00v17_50237_c1 nmdc:mga00v17_50237_c1_955_1629 224
1725 3300050491 nmdc:mga00v17_9293_c1 nmdc:mga00v17_9293_c1_3430_4104 224
1726 3300050493 nmdc:mga0k408_41598_c2 nmdc:mga0k408_41598_c2_468_1142 224
1727 3300053125 Ga0500618_014747 Ga0500618_014747_452_1126 224
1728 3300053126 Ga0500621_000070 Ga0500621_000070_9268_9942 224
1729 3300053135 Ga0500659_0071065 Ga0500659_0071065_306_983 224
1730 3300053139 Ga0500568_0112300 Ga0500568_0112300_231_905 224
1731 3300059511 Ga0587091_047756 Ga0587091_047756_28_702 224
1732 3300059513 Ga0587094_006971 Ga0587094_006971_449_1123 224
1733 3300059627 Ga0587117_005138 Ga0587117_005138_315_989 224
1734 3300059639 Ga0587062_003284 Ga0587062_003284_544_1218 224
1735 3300028380 Ga0268265_10761446 Ga0268265_107614461 231
1736 2124908027 MRS2a_Contig_29 MRS2a_00189250 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

47

157

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7e-assembly1.cif.gz_B complex i from e. coli, ddm/lmng-purified, apo, resting state 0.815 44 217
4wz7-assembly1.cif.gz_K crystal structure of mitochondrial nadh:ubiquinone oxidoreductase from yarrowia lipolytica. 0.8093 44 180
6h8k-assembly1.cif.gz_K crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.7977 46 180
4hea-assembly2.cif.gz_G crystal structure of the entire respiratory complex i from thermus thermophilus 0.7948 48 178
7ard-assembly1.cif.gz_B cryo-em structure of polytomella complex-i (complete composition) 0.7919 46 181
ID Description Score Start End Superfamily
af_Q5ADP7_59_222_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7824 45 180 3.40.50.12280
af_P06670_7_180_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7667 42 181 3.40.50.12280
af_P9WJH1_2_170_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7561 42 186 3.40.50.12280
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7522 56 173 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7443 55 175 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A1F5AW62-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.8019 26 216 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A7L9C5A6-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.8017 31 181 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A7R8WTC0-F1-model_v4 NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein 0.7968 45 181 GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0051539
AF-A0A812NP09-F1-model_v4 NADH-ubiquinone oxidoreductase chain 3 (NADH dehydrogenase subunit 3) 0.7968 42 181 GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0051539
AF-A0A2M7YUV5-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.7964 42 181 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539

Feature Viewer

pLDDT pTM Quality
63.04 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map