F495398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1702 | 553 | 3404 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300034816|Ga0373930_0101847|Ga0373930_0101847_223_558 |
| Length | 105 |
| Sequence | MTERRRDTDLLFKALADPGRRKLLDLLHAHDGQTLNELCEHLDMTRQGLLQAANLVASVRRGREKLHFLNPVPLQEIYERWIAKFEKPRLKALGDLKRRLEKGNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 130 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 133 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 152 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 172 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 173 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 174 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 175 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 266 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 271 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 276 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 277 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 278 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 279 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 280 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 281 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 282 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 286 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 287 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 288 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 289 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 290 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 292 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 293 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 294 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 295 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 296 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 297 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 298 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 299 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 301 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 303 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 304 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 305 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 306 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 307 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 308 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 309 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 310 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 311 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 312 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 313 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 315 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 316 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 318 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 319 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 321 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 322 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 323 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 325 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 326 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 327 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 328 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 330 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 331 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 332 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 333 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 334 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 335 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 338 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 339 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 340 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 341 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 342 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 343 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 344 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 345 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 346 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 347 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 348 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 349 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 350 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 351 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 352 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 353 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 354 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 355 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 356 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 357 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 358 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 359 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 360 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 361 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 362 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 363 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 364 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 365 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 366 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 367 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 368 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 369 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 370 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 371 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 372 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 373 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 374 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 432 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 433 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 434 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 435 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 436 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 437 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 440 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 441 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 442 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 443 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 444 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 445 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 446 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 447 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 448 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 449 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 450 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 451 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 452 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 453 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 454 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 456 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 457 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 477 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 478 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 479 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 480 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 481 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 482 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 489 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 490 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 493 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 505 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 509 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 510 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 511 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 512 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 513 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 515 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 517 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 518 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 520 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 521 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 522 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 523 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 525 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 526 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 527 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 528 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 532 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 533 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 534 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 535 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 536 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 537 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 538 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 539 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 540 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 541 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 542 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 543 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 544 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 545 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 546 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 547 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 548 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 549 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 550 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 551 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 552 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 553 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.65 |
| Metatranscriptomes | 0.06 |
| Isolates | 1.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.82 |
| Nodule | 1.35 |
| Rhizoplane | 2.47 |
| Rhizosphere | 84.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373930_0101847 | 3300034816 | Bacteria | 684 |
| 2 | JGI24736J21556_1015368 | 3300001904 | Bacteria | 1226 |
| 3 | JGI24736J21556_1021579 | 3300001904 | Bacteria | 1010 |
| 4 | JGI24739J22299_10073599 | 3300001989 | Bacteria | 1060 |
| 5 | JGI24737J22298_10091082 | 3300001990 | Bacteria | 904 |
| 6 | JGI24748J21848_1001755 | 3300002074 | Bacteria | 2404 |
| 7 | JGI24751J29686_10050174 | 3300002459 | Bacteria | 861 |
| 8 | JGI24751J29686_10130390 | 3300002459 | Bacteria | 530 |
| 9 | JGI25156J39149_1008617 | 3300002705 | Bacteria | 2550 |
| 10 | JGI25162J39368_1003180 | 3300002737 | Bacteria | 5119 |
| 11 | JGI25157J39369_1004429 | 3300002741 | Bacteria | 2547 |
| 12 | JGI25164J39214_1001517 | 3300002772 | Bacteria | 5189 |
| 13 | JGI25165J46597_1002740 | 3300003214 | Bacteria | 5189 |
| 14 | JGI25153J46596_10006212 | 3300003215 | Bacteria | 6113 |
| 15 | JGI25153J46596_10027181 | 3300003215 | Bacteria | 2010 |
| 16 | rootH2_10080896 | 3300003320 | Bacteria | 2066 |
| 17 | JGI25160J50197_1027724 | 3300003354 | Bacteria | 1535 |
| 18 | JGI25404J52841_10005248 | 3300003659 | Bacteria | 2671 |
| 19 | Ga0055525_1003849 | 3300003759 | Bacteria | 1309 |
| 20 | Ga0055527_1001410 | 3300003760 | Bacteria | 5081 |
| 21 | Ga0055535_1000762 | 3300003761 | Bacteria | 23888 |
| 22 | Ga0055535_1001669 | 3300003761 | Bacteria | 10205 |
| 23 | Ga0055542_1001204 | 3300003762 | Bacteria | 14617 |
| 24 | Ga0055542_1001618 | 3300003762 | Bacteria | 10232 |
| 25 | Ga0055542_1028182 | 3300003762 | Bacteria | 742 |
| 26 | Ga0055529_1000969 | 3300003763 | Bacteria | 14617 |
| 27 | Ga0055529_1011211 | 3300003763 | Bacteria | 1154 |
| 28 | Ga0055524_1032917 | 3300003775 | Bacteria | 1460 |
| 29 | Ga0055540_1002653 | 3300003792 | Bacteria | 9250 |
| 30 | Ga0055540_1089684 | 3300003792 | Bacteria | 581 |
| 31 | Ga0055531_10000002 | 3300003794 | Bacteria | 421971 |
| 32 | Ga0055531_10000234 | 3300003794 | Bacteria | 60772 |
| 33 | Ga0055531_10001156 | 3300003794 | Bacteria | 20372 |
| 34 | Ga0055531_10054756 | 3300003794 | Bacteria | 1020 |
| 35 | Ga0065165_1001827 | 3300005262 | Bacteria | 20819 |
| 36 | Ga0065165_1004722 | 3300005262 | Bacteria | 8180 |
| 37 | Ga0065714_10156014 | 3300005288 | Bacteria | 1078 |
| 38 | Ga0065712_10004533 | 3300005290 | Bacteria | 3471 |
| 39 | Ga0065712_10086972 | 3300005290 | Bacteria | 2605 |
| 40 | Ga0065715_10032818 | 3300005293 | Bacteria | 2390 |
| 41 | Ga0065715_10092414 | 3300005293 | Bacteria | 5131 |
| 42 | Ga0065715_10100822 | 3300005293 | Bacteria | 3266 |
| 43 | Ga0065715_10348883 | 3300005293 | Bacteria | 954 |
| 44 | Ga0065707_10088244 | 3300005295 | Bacteria | 4726 |
| 45 | Ga0070658_10041393 | 3300005327 | Bacteria | 3717 |
| 46 | Ga0070658_10047697 | 3300005327 | Bacteria | 3466 |
| 47 | Ga0070676_10136820 | 3300005328 | Bacteria | 1555 |
| 48 | Ga0070676_10654731 | 3300005328 | Bacteria | 763 |
| 49 | Ga0070683_100020285 | 3300005329 | Bacteria | 5914 |
| 50 | Ga0070683_100049047 | 3300005329 | Bacteria | 3904 |
| 51 | Ga0070683_100277955 | 3300005329 | Bacteria | 1593 |
| 52 | Ga0070683_100290013 | 3300005329 | Bacteria | 1556 |
| 53 | Ga0070683_100813273 | 3300005329 | Bacteria | 896 |
| 54 | Ga0070690_100000659 | 3300005330 | Bacteria | 17618 |
| 55 | Ga0070690_100016640 | 3300005330 | Bacteria | 4409 |
| 56 | Ga0070690_100050230 | 3300005330 | Bacteria | 2660 |
| 57 | Ga0070690_100229506 | 3300005330 | Bacteria | 1304 |
| 58 | Ga0070690_100520157 | 3300005330 | Bacteria | 893 |
| 59 | Ga0070670_100006270 | 3300005331 | Bacteria | 10067 |
| 60 | Ga0070670_100130867 | 3300005331 | Bacteria | 2167 |
| 61 | Ga0070670_100131109 | 3300005331 | Bacteria | 2164 |
| 62 | Ga0070670_100143258 | 3300005331 | Bacteria | 2067 |
| 63 | Ga0070670_100200923 | 3300005331 | Bacteria | 1732 |
| 64 | Ga0070677_10014260 | 3300005333 | Bacteria | 2795 |
| 65 | Ga0070677_10801587 | 3300005333 | Bacteria | 538 |
| 66 | Ga0068869_100015358 | 3300005334 | Bacteria | 5135 |
| 67 | Ga0068869_100274307 | 3300005334 | Bacteria | 1354 |
| 68 | Ga0068869_101044454 | 3300005334 | Bacteria | 713 |
| 69 | Ga0068869_101799850 | 3300005334 | Bacteria | 548 |
| 70 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 71 | Ga0070666_10007556 | 3300005335 | Bacteria | 6702 |
| 72 | Ga0070666_10009620 | 3300005335 | Bacteria | 6033 |
| 73 | Ga0070666_10035307 | 3300005335 | Bacteria | 3316 |
| 74 | Ga0070666_10787675 | 3300005335 | Bacteria | 700 |
| 75 | Ga0070666_11011814 | 3300005335 | Bacteria | 617 |
| 76 | Ga0070666_11095102 | 3300005335 | Bacteria | 592 |
| 77 | Ga0070680_100000638 | 3300005336 | Bacteria | 24374 |
| 78 | Ga0070680_100031410 | 3300005336 | Bacteria | 4270 |
| 79 | Ga0070680_100175521 | 3300005336 | Bacteria | 1804 |
| 80 | Ga0070680_100711817 | 3300005336 | Bacteria | 864 |
| 81 | Ga0070680_100738049 | 3300005336 | Bacteria | 848 |
| 82 | Ga0070680_100791529 | 3300005336 | Bacteria | 817 |
| 83 | Ga0070680_100847624 | 3300005336 | Bacteria | 788 |
| 84 | Ga0070680_101074013 | 3300005336 | Bacteria | 696 |
| 85 | Ga0070682_100116774 | 3300005337 | Bacteria | 1786 |
| 86 | Ga0070682_101015800 | 3300005337 | Bacteria | 689 |
| 87 | Ga0068868_100228042 | 3300005338 | Bacteria | 1562 |
| 88 | Ga0068868_100248784 | 3300005338 | Bacteria | 1496 |
| 89 | Ga0068868_101437998 | 3300005338 | Bacteria | 644 |
| 90 | Ga0068868_101569680 | 3300005338 | Bacteria | 618 |
| 91 | Ga0068868_102172133 | 3300005338 | Bacteria | 529 |
| 92 | Ga0070660_100140461 | 3300005339 | Bacteria | 1937 |
| 93 | Ga0070660_101467951 | 3300005339 | Bacteria | 580 |
| 94 | Ga0070689_100055855 | 3300005340 | Bacteria | 3061 |
| 95 | Ga0070689_101112229 | 3300005340 | Bacteria | 706 |
| 96 | Ga0070691_10046365 | 3300005341 | Bacteria | 2064 |
| 97 | Ga0070691_10647447 | 3300005341 | Bacteria | 629 |
| 98 | Ga0070691_10869850 | 3300005341 | Bacteria | 554 |
| 99 | Ga0070687_100088033 | 3300005343 | Bacteria | 1711 |
| 100 | Ga0070687_100099644 | 3300005343 | Bacteria | 1624 |
| 101 | Ga0070687_100107919 | 3300005343 | Bacteria | 1570 |
| 102 | Ga0070661_100034824 | 3300005344 | Bacteria | 3654 |
| 103 | Ga0070661_100062488 | 3300005344 | Bacteria | 2734 |
| 104 | Ga0070661_100153662 | 3300005344 | Bacteria | 1741 |
| 105 | Ga0070661_101515868 | 3300005344 | Bacteria | 566 |
| 106 | Ga0070692_10000442 | 3300005345 | Bacteria | 12631 |
| 107 | Ga0070692_11237327 | 3300005345 | Bacteria | 533 |
| 108 | Ga0070668_100016018 | 3300005347 | Bacteria | 5609 |
| 109 | Ga0070668_100211729 | 3300005347 | Bacteria | 1595 |
| 110 | Ga0070668_100283304 | 3300005347 | Bacteria | 1385 |
| 111 | Ga0070668_101795866 | 3300005347 | Bacteria | 564 |
| 112 | Ga0070668_102059136 | 3300005347 | Bacteria | 527 |
| 113 | Ga0070669_100007961 | 3300005353 | Bacteria | 7570 |
| 114 | Ga0070669_100008649 | 3300005353 | Bacteria | 7263 |
| 115 | Ga0070669_100681976 | 3300005353 | Bacteria | 866 |
| 116 | Ga0070675_100001805 | 3300005354 | Bacteria | 15819 |
| 117 | Ga0070675_100051449 | 3300005354 | Bacteria | 3385 |
| 118 | Ga0070675_100119903 | 3300005354 | Bacteria | 2234 |
| 119 | Ga0070675_100309809 | 3300005354 | Bacteria | 1393 |
| 120 | Ga0070675_101082719 | 3300005354 | Bacteria | 737 |
| 121 | Ga0070671_100007395 | 3300005355 | Bacteria | 8775 |
| 122 | Ga0070671_100024351 | 3300005355 | Bacteria | 4955 |
| 123 | Ga0070671_100093484 | 3300005355 | Bacteria | 2520 |
| 124 | Ga0070671_100289321 | 3300005355 | Bacteria | 1394 |
| 125 | Ga0070671_100455641 | 3300005355 | Bacteria | 1098 |
| 126 | Ga0070671_100491859 | 3300005355 | Bacteria | 1055 |
| 127 | Ga0070674_100022583 | 3300005356 | Bacteria | 4060 |
| 128 | Ga0070674_100042177 | 3300005356 | Bacteria | 3098 |
| 129 | Ga0070674_100045473 | 3300005356 | Bacteria | 3000 |
| 130 | Ga0070674_101501177 | 3300005356 | Bacteria | 606 |
| 131 | Ga0070673_100023355 | 3300005364 | Bacteria | 4518 |
| 132 | Ga0070673_100123685 | 3300005364 | Bacteria | 2162 |
| 133 | Ga0070673_100257426 | 3300005364 | Bacteria | 1523 |
| 134 | Ga0070673_100415335 | 3300005364 | Bacteria | 1205 |
| 135 | Ga0070673_100862872 | 3300005364 | Bacteria | 838 |
| 136 | Ga0070673_101726887 | 3300005364 | Bacteria | 592 |
| 137 | Ga0070688_100014662 | 3300005365 | Bacteria | 4445 |
| 138 | Ga0070688_100031832 | 3300005365 | Bacteria | 3175 |
| 139 | Ga0070688_100089508 | 3300005365 | Bacteria | 2009 |
| 140 | Ga0070688_100590431 | 3300005365 | Bacteria | 849 |
| 141 | Ga0070688_100597938 | 3300005365 | Bacteria | 844 |
| 142 | Ga0070659_100015121 | 3300005366 | Bacteria | 5773 |
| 143 | Ga0070659_100160980 | 3300005366 | Bacteria | 1835 |
| 144 | Ga0070659_101317445 | 3300005366 | Bacteria | 641 |
| 145 | Ga0070667_100000049 | 3300005367 | Bacteria | 158483 |
| 146 | Ga0070667_100000129 | 3300005367 | Bacteria | 95291 |
| 147 | Ga0070667_100012603 | 3300005367 | Bacteria | 6992 |
| 148 | Ga0070667_100026817 | 3300005367 | Bacteria | 4795 |
| 149 | Ga0070667_100040730 | 3300005367 | Bacteria | 3896 |
| 150 | Ga0070667_100247162 | 3300005367 | Bacteria | 1594 |
| 151 | Ga0070667_100312819 | 3300005367 | Bacteria | 1416 |
| 152 | Ga0070667_100342111 | 3300005367 | Bacteria | 1353 |
| 153 | Ga0070667_100410628 | 3300005367 | Bacteria | 1233 |
| 154 | Ga0070709_10014894 | 3300005434 | Bacteria | 4412 |
| 155 | Ga0070709_10305038 | 3300005434 | Bacteria | 1164 |
| 156 | Ga0070714_101106298 | 3300005435 | Bacteria | 772 |
| 157 | Ga0070714_102492986 | 3300005435 | Bacteria | 502 |
| 158 | Ga0070713_100041356 | 3300005436 | Bacteria | 3755 |
| 159 | Ga0070713_100347421 | 3300005436 | Bacteria | 1376 |
| 160 | Ga0070713_101044927 | 3300005436 | Bacteria | 789 |
| 161 | Ga0070710_10140852 | 3300005437 | Bacteria | 1479 |
| 162 | Ga0070701_10021041 | 3300005438 | Bacteria | 3107 |
| 163 | Ga0070711_100057363 | 3300005439 | Bacteria | 2696 |
| 164 | Ga0070711_100576702 | 3300005439 | Bacteria | 936 |
| 165 | Ga0070711_100823062 | 3300005439 | Bacteria | 789 |
| 166 | Ga0070711_100954301 | 3300005439 | Bacteria | 734 |
| 167 | Ga0070711_101217193 | 3300005439 | Bacteria | 652 |
| 168 | Ga0070705_100015101 | 3300005440 | Bacteria | 3984 |
| 169 | Ga0070705_100043853 | 3300005440 | Bacteria | 2566 |
| 170 | Ga0070705_101119988 | 3300005440 | Bacteria | 645 |
| 171 | Ga0070700_100017632 | 3300005441 | Bacteria | 4089 |
| 172 | Ga0070700_100032982 | 3300005441 | Bacteria | 3117 |
| 173 | Ga0070700_101287421 | 3300005441 | Bacteria | 614 |
| 174 | Ga0070700_101445052 | 3300005441 | Bacteria | 583 |
| 175 | Ga0070694_100046149 | 3300005444 | Bacteria | 2923 |
| 176 | Ga0070694_100238867 | 3300005444 | Bacteria | 1370 |
| 177 | Ga0070708_100007506 | 3300005445 | Bacteria | 8732 |
| 178 | Ga0070708_100104501 | 3300005445 | Bacteria | 2597 |
| 179 | Ga0070708_100250706 | 3300005445 | Bacteria | 1663 |
| 180 | Ga0070708_101612547 | 3300005445 | Bacteria | 604 |
| 181 | Ga0070663_100000996 | 3300005455 | Bacteria | 15418 |
| 182 | Ga0070663_100056941 | 3300005455 | Bacteria | 2802 |
| 183 | Ga0070663_100376719 | 3300005455 | Bacteria | 1155 |
| 184 | Ga0070663_100771079 | 3300005455 | Bacteria | 823 |
| 185 | Ga0070678_100004888 | 3300005456 | Bacteria | 7662 |
| 186 | Ga0070678_100009831 | 3300005456 | Bacteria | 5815 |
| 187 | Ga0070678_100017870 | 3300005456 | Bacteria | 4579 |
| 188 | Ga0070678_100239862 | 3300005456 | Bacteria | 1515 |
| 189 | Ga0070678_100244482 | 3300005456 | Bacteria | 1502 |
| 190 | Ga0070678_100522920 | 3300005456 | Bacteria | 1050 |
| 191 | Ga0070678_100853711 | 3300005456 | Bacteria | 830 |
| 192 | Ga0070662_100009850 | 3300005457 | Bacteria | 6263 |
| 193 | Ga0070662_100034756 | 3300005457 | Bacteria | 3556 |
| 194 | Ga0070662_100131686 | 3300005457 | Bacteria | 1929 |
| 195 | Ga0070662_100153920 | 3300005457 | Bacteria | 1793 |
| 196 | Ga0070662_100680658 | 3300005457 | Bacteria | 869 |
| 197 | Ga0070662_101468429 | 3300005457 | Bacteria | 588 |
| 198 | Ga0070681_10007731 | 3300005458 | Bacteria | 10509 |
| 199 | Ga0070681_10014089 | 3300005458 | Bacteria | 7958 |
| 200 | Ga0070681_10030015 | 3300005458 | Bacteria | 5456 |
| 201 | Ga0070681_10032470 | 3300005458 | Bacteria | 5239 |
| 202 | Ga0070681_10033693 | 3300005458 | Bacteria | 5142 |
| 203 | Ga0070681_10081128 | 3300005458 | Bacteria | 3199 |
| 204 | Ga0068867_100006360 | 3300005459 | Bacteria | 8349 |
| 205 | Ga0068867_100070879 | 3300005459 | Bacteria | 2606 |
| 206 | Ga0068867_100113935 | 3300005459 | Bacteria | 2081 |
| 207 | Ga0068867_100215995 | 3300005459 | Bacteria | 1543 |
| 208 | Ga0068867_100696485 | 3300005459 | Bacteria | 896 |
| 209 | Ga0068867_100741118 | 3300005459 | Bacteria | 871 |
| 210 | Ga0070685_10007147 | 3300005466 | Bacteria | 5702 |
| 211 | Ga0070685_10036196 | 3300005466 | Bacteria | 2789 |
| 212 | Ga0070685_10120106 | 3300005466 | Bacteria | 1631 |
| 213 | Ga0070685_10144937 | 3300005466 | Bacteria | 1499 |
| 214 | Ga0070706_100027551 | 3300005467 | Bacteria | 5230 |
| 215 | Ga0070706_100029141 | 3300005467 | Bacteria | 5086 |
| 216 | Ga0070706_100081152 | 3300005467 | Bacteria | 3003 |
| 217 | Ga0070706_100083087 | 3300005467 | Bacteria | 2967 |
| 218 | Ga0070706_100342122 | 3300005467 | Bacteria | 1395 |
| 219 | Ga0070707_100013711 | 3300005468 | Bacteria | 7589 |
| 220 | Ga0070707_100318835 | 3300005468 | Bacteria | 1510 |
| 221 | Ga0070707_100428217 | 3300005468 | Unclassified | 1284 |
| 222 | Ga0070707_100630514 | 3300005468 | Bacteria | 1034 |
| 223 | Ga0070698_100013139 | 3300005471 | Bacteria | 8761 |
| 224 | Ga0070698_100080159 | 3300005471 | Bacteria | 3260 |
| 225 | Ga0070698_101058083 | 3300005471 | Bacteria | 759 |
| 226 | Ga0070698_101499655 | 3300005471 | Bacteria | 626 |
| 227 | Ga0070699_100003254 | 3300005518 | Bacteria | 14368 |
| 228 | Ga0070699_100035623 | 3300005518 | Bacteria | 4302 |
| 229 | Ga0070699_101109535 | 3300005518 | Bacteria | 726 |
| 230 | Ga0070699_101776121 | 3300005518 | Bacteria | 565 |
| 231 | Ga0070679_100021255 | 3300005530 | Bacteria | 6332 |
| 232 | Ga0070679_100123725 | 3300005530 | Bacteria | 2570 |
| 233 | Ga0070679_100124837 | 3300005530 | Bacteria | 2557 |
| 234 | Ga0070679_100213575 | 3300005530 | Bacteria | 1892 |
| 235 | Ga0070679_100382984 | 3300005530 | Unclassified | 1353 |
| 236 | Ga0070679_100967722 | 3300005530 | Bacteria | 795 |
| 237 | Ga0070684_100004144 | 3300005535 | Bacteria | 10977 |
| 238 | Ga0070684_100028623 | 3300005535 | Bacteria | 4714 |
| 239 | Ga0070684_100683871 | 3300005535 | Bacteria | 956 |
| 240 | Ga0070684_101069725 | 3300005535 | Bacteria | 758 |
| 241 | Ga0070697_100214933 | 3300005536 | Bacteria | 1638 |
| 242 | Ga0068853_100036182 | 3300005539 | Bacteria | 4196 |
| 243 | Ga0068853_100099539 | 3300005539 | Bacteria | 2569 |
| 244 | Ga0068853_100151065 | 3300005539 | Bacteria | 2091 |
| 245 | Ga0068853_100423338 | 3300005539 | Bacteria | 1249 |
| 246 | Ga0068853_100487050 | 3300005539 | Bacteria | 1163 |
| 247 | Ga0068853_100531181 | 3300005539 | Bacteria | 1113 |
| 248 | Ga0068853_100864318 | 3300005539 | Bacteria | 868 |
| 249 | Ga0068853_101228614 | 3300005539 | Bacteria | 724 |
| 250 | Ga0068853_101428108 | 3300005539 | Bacteria | 669 |
| 251 | Ga0070672_100006524 | 3300005543 | Bacteria | 7845 |
| 252 | Ga0070672_100015810 | 3300005543 | Bacteria | 5388 |
| 253 | Ga0070672_100058961 | 3300005543 | Bacteria | 3019 |
| 254 | Ga0070672_100080617 | 3300005543 | Bacteria | 2608 |
| 255 | Ga0070672_100123772 | 3300005543 | Bacteria | 2119 |
| 256 | Ga0070672_100760359 | 3300005543 | Bacteria | 851 |
| 257 | Ga0070686_100002162 | 3300005544 | Bacteria | 10852 |
| 258 | Ga0070686_100023877 | 3300005544 | Bacteria | 3660 |
| 259 | Ga0070686_100377933 | 3300005544 | Bacteria | 1072 |
| 260 | Ga0070686_100860861 | 3300005544 | Bacteria | 735 |
| 261 | Ga0070695_100093500 | 3300005545 | Bacteria | 2012 |
| 262 | Ga0070695_100466232 | 3300005545 | Bacteria | 971 |
| 263 | Ga0070695_100878395 | 3300005545 | Bacteria | 723 |
| 264 | Ga0070696_100010558 | 3300005546 | Bacteria | 6191 |
| 265 | Ga0070696_100363884 | 3300005546 | Bacteria | 1123 |
| 266 | Ga0070696_100579027 | 3300005546 | Bacteria | 903 |
| 267 | Ga0070696_100865066 | 3300005546 | Bacteria | 748 |
| 268 | Ga0070696_101490183 | 3300005546 | Bacteria | 579 |
| 269 | Ga0070693_100014679 | 3300005547 | Bacteria | 4020 |
| 270 | Ga0070693_100040083 | 3300005547 | Bacteria | 2628 |
| 271 | Ga0070693_100148259 | 3300005547 | Bacteria | 1483 |
| 272 | Ga0070693_100335024 | 3300005547 | Bacteria | 1031 |
| 273 | Ga0070693_100586110 | 3300005547 | Bacteria | 803 |
| 274 | Ga0070665_100000237 | 3300005548 | Bacteria | 91478 |
| 275 | Ga0070665_100000467 | 3300005548 | Bacteria | 58613 |
| 276 | Ga0070665_100003434 | 3300005548 | Bacteria | 16915 |
| 277 | Ga0070665_100017979 | 3300005548 | Bacteria | 7098 |
| 278 | Ga0070665_100088467 | 3300005548 | Bacteria | 3103 |
| 279 | Ga0070665_100099051 | 3300005548 | Bacteria | 2919 |
| 280 | Ga0070665_100250580 | 3300005548 | Bacteria | 1771 |
| 281 | Ga0070665_101173373 | 3300005548 | Bacteria | 779 |
| 282 | Ga0070704_100045537 | 3300005549 | Bacteria | 3053 |
| 283 | Ga0070704_100351708 | 3300005549 | Bacteria | 1244 |
| 284 | Ga0068855_100002756 | 3300005563 | Bacteria | 21628 |
| 285 | Ga0068855_100020476 | 3300005563 | Bacteria | 7931 |
| 286 | Ga0068855_100030244 | 3300005563 | Bacteria | 6478 |
| 287 | Ga0068855_100135511 | 3300005563 | Bacteria | 2810 |
| 288 | Ga0068855_100339807 | 3300005563 | Bacteria | 1656 |
| 289 | Ga0068855_100342971 | 3300005563 | Bacteria | 1647 |
| 290 | Ga0068855_100982028 | 3300005563 | Bacteria | 888 |
| 291 | Ga0068855_101052532 | 3300005563 | Bacteria | 853 |
| 292 | Ga0068855_101125542 | 3300005563 | Unclassified | 820 |
| 293 | Ga0070664_100000362 | 3300005564 | Bacteria | 33490 |
| 294 | Ga0070664_100041317 | 3300005564 | Bacteria | 3891 |
| 295 | Ga0068857_100073578 | 3300005577 | Bacteria | 3045 |
| 296 | Ga0068857_100079857 | 3300005577 | Bacteria | 2920 |
| 297 | Ga0068857_100099565 | 3300005577 | Bacteria | 2608 |
| 298 | Ga0068857_100110701 | 3300005577 | Bacteria | 2468 |
| 299 | Ga0068857_100206056 | 3300005577 | Bacteria | 1794 |
| 300 | Ga0068854_100011931 | 3300005578 | Bacteria | 5678 |
| 301 | Ga0068854_100045286 | 3300005578 | Bacteria | 3127 |
| 302 | Ga0068854_100791533 | 3300005578 | Bacteria | 826 |
| 303 | Ga0068854_102008009 | 3300005578 | Bacteria | 533 |
| 304 | Ga0068856_100044226 | 3300005614 | Bacteria | 4382 |
| 305 | Ga0068856_100064653 | 3300005614 | Bacteria | 3615 |
| 306 | Ga0068856_100094722 | 3300005614 | Bacteria | 2973 |
| 307 | Ga0068856_100219676 | 3300005614 | Bacteria | 1916 |
| 308 | Ga0068856_102496730 | 3300005614 | Bacteria | 523 |
| 309 | Ga0068856_102709913 | 3300005614 | Bacteria | 501 |
| 310 | Ga0070702_100026748 | 3300005615 | Bacteria | 3104 |
| 311 | Ga0070702_100072830 | 3300005615 | Bacteria | 2034 |
| 312 | Ga0068852_100231081 | 3300005616 | Bacteria | 1763 |
| 313 | Ga0068852_100943426 | 3300005616 | Bacteria | 881 |
| 314 | Ga0068859_100005230 | 3300005617 | Bacteria | 13184 |
| 315 | Ga0068859_100028400 | 3300005617 | Bacteria | 5608 |
| 316 | Ga0068859_100037124 | 3300005617 | Bacteria | 4890 |
| 317 | Ga0068859_100097986 | 3300005617 | Bacteria | 2985 |
| 318 | Ga0068859_100311441 | 3300005617 | Bacteria | 1668 |
| 319 | Ga0068859_100319350 | 3300005617 | Bacteria | 1647 |
| 320 | Ga0068859_102100052 | 3300005617 | Bacteria | 624 |
| 321 | Ga0068864_100011349 | 3300005618 | Bacteria | 7362 |
| 322 | Ga0068864_100319550 | 3300005618 | Bacteria | 1458 |
| 323 | Ga0068866_10002285 | 3300005718 | Bacteria | 7933 |
| 324 | Ga0068861_100003766 | 3300005719 | Bacteria | 10123 |
| 325 | Ga0068861_100006557 | 3300005719 | Bacteria | 7940 |
| 326 | Ga0068861_100007838 | 3300005719 | Bacteria | 7343 |
| 327 | Ga0068861_100068962 | 3300005719 | Bacteria | 2734 |
| 328 | Ga0068861_100268072 | 3300005719 | Bacteria | 1465 |
| 329 | Ga0068861_100319549 | 3300005719 | Bacteria | 1351 |
| 330 | Ga0068861_100641916 | 3300005719 | Bacteria | 980 |
| 331 | Ga0068861_101207406 | 3300005719 | Bacteria | 732 |
| 332 | Ga0068851_10014356 | 3300005834 | Bacteria | 3760 |
| 333 | Ga0068870_10009855 | 3300005840 | Bacteria | 4362 |
| 334 | Ga0068870_10370568 | 3300005840 | Bacteria | 924 |
| 335 | Ga0068863_100004078 | 3300005841 | Bacteria | 14429 |
| 336 | Ga0068863_100033197 | 3300005841 | Bacteria | 4917 |
| 337 | Ga0068863_100061050 | 3300005841 | Bacteria | 3564 |
| 338 | Ga0068863_100074994 | 3300005841 | Bacteria | 3201 |
| 339 | Ga0068863_100385673 | 3300005841 | Bacteria | 1369 |
| 340 | Ga0068863_100838622 | 3300005841 | Bacteria | 918 |
| 341 | Ga0068863_101147526 | 3300005841 | Bacteria | 782 |
| 342 | Ga0068863_102385079 | 3300005841 | Bacteria | 539 |
| 343 | Ga0068858_100003914 | 3300005842 | Bacteria | 14709 |
| 344 | Ga0068858_100990037 | 3300005842 | Bacteria | 824 |
| 345 | Ga0068858_101034605 | 3300005842 | Bacteria | 805 |
| 346 | Ga0068858_101151667 | 3300005842 | Bacteria | 762 |
| 347 | Ga0068858_101703257 | 3300005842 | Bacteria | 623 |
| 348 | Ga0068860_100014505 | 3300005843 | Bacteria | 7712 |
| 349 | Ga0068860_100025718 | 3300005843 | Bacteria | 5677 |
| 350 | Ga0068860_100242578 | 3300005843 | Bacteria | 1753 |
| 351 | Ga0068860_100337738 | 3300005843 | Bacteria | 1481 |
| 352 | Ga0068860_101127087 | 3300005843 | Bacteria | 804 |
| 353 | Ga0068862_100000710 | 3300005844 | Bacteria | 33992 |
| 354 | Ga0068862_100000773 | 3300005844 | Bacteria | 31853 |
| 355 | Ga0068862_100006742 | 3300005844 | Bacteria | 9521 |
| 356 | Ga0068862_100082694 | 3300005844 | Bacteria | 2787 |
| 357 | Ga0068862_101169141 | 3300005844 | Bacteria | 767 |
| 358 | Ga0081455_10003552 | 3300005937 | Bacteria | 17896 |
| 359 | Ga0081455_10100711 | 3300005937 | Bacteria | 2320 |
| 360 | Ga0081540_1000377 | 3300005983 | Bacteria | 44639 |
| 361 | Ga0081540_1003811 | 3300005983 | Bacteria | 11795 |
| 362 | Ga0081540_1027419 | 3300005983 | Bacteria | 3228 |
| 363 | Ga0081539_10197392 | 3300005985 | Bacteria | 932 |
| 364 | Ga0081539_10240319 | 3300005985 | Bacteria | 811 |
| 365 | Ga0070717_10243931 | 3300006028 | Bacteria | 1585 |
| 366 | Ga0070717_10285058 | 3300006028 | Bacteria | 1466 |
| 367 | Ga0070717_10708318 | 3300006028 | Bacteria | 915 |
| 368 | Ga0070717_10713291 | 3300006028 | Bacteria | 911 |
| 369 | Ga0070717_10771724 | 3300006028 | Bacteria | 874 |
| 370 | Ga0070717_11162532 | 3300006028 | Bacteria | 702 |
| 371 | Ga0075365_10100758 | 3300006038 | Bacteria | 1977 |
| 372 | Ga0075368_10003413 | 3300006042 | Bacteria | 5303 |
| 373 | Ga0075364_10052682 | 3300006051 | Bacteria | 2660 |
| 374 | Ga0075364_10124293 | 3300006051 | Bacteria | 1729 |
| 375 | Ga0075364_10320818 | 3300006051 | Bacteria | 1055 |
| 376 | Ga0075364_10613139 | 3300006051 | Bacteria | 743 |
| 377 | Ga0070715_10111121 | 3300006163 | Bacteria | 1293 |
| 378 | Ga0070715_10121350 | 3300006163 | Bacteria | 1246 |
| 379 | Ga0070715_10683742 | 3300006163 | Bacteria | 611 |
| 380 | Ga0070716_100019808 | 3300006173 | Bacteria | 3522 |
| 381 | Ga0070716_100350564 | 3300006173 | Bacteria | 1045 |
| 382 | Ga0070712_100000441 | 3300006175 | Bacteria | 23726 |
| 383 | Ga0070712_100641030 | 3300006175 | Bacteria | 902 |
| 384 | Ga0070712_101444222 | 3300006175 | Bacteria | 601 |
| 385 | Ga0070712_102005083 | 3300006175 | Bacteria | 507 |
| 386 | Ga0075362_10112367 | 3300006177 | Bacteria | 1283 |
| 387 | Ga0075367_10156006 | 3300006178 | Bacteria | 1418 |
| 388 | Ga0075367_10822278 | 3300006178 | Bacteria | 592 |
| 389 | Ga0075369_10132280 | 3300006186 | Bacteria | 1134 |
| 390 | Ga0075369_10340059 | 3300006186 | Bacteria | 703 |
| 391 | Ga0075366_10002121 | 3300006195 | Bacteria | 10087 |
| 392 | Ga0075366_10128161 | 3300006195 | Bacteria | 1531 |
| 393 | Ga0097621_100004137 | 3300006237 | Bacteria | 10062 |
| 394 | Ga0097621_100004245 | 3300006237 | Bacteria | 9958 |
| 395 | Ga0097621_100020255 | 3300006237 | Bacteria | 5124 |
| 396 | Ga0097621_100034057 | 3300006237 | Bacteria | 4060 |
| 397 | Ga0097621_100228862 | 3300006237 | Bacteria | 1622 |
| 398 | Ga0097621_100567324 | 3300006237 | Bacteria | 1034 |
| 399 | Ga0097621_100584820 | 3300006237 | Bacteria | 1019 |
| 400 | Ga0097621_101765675 | 3300006237 | Bacteria | 589 |
| 401 | Ga0075370_10013002 | 3300006353 | Bacteria | 4415 |
| 402 | Ga0068871_100009393 | 3300006358 | Bacteria | 7084 |
| 403 | Ga0068871_100011257 | 3300006358 | Bacteria | 6558 |
| 404 | Ga0068871_100023303 | 3300006358 | Bacteria | 4786 |
| 405 | Ga0068871_100162194 | 3300006358 | Bacteria | 1912 |
| 406 | Ga0068871_100220779 | 3300006358 | Bacteria | 1642 |
| 407 | Ga0068871_100391849 | 3300006358 | Bacteria | 1236 |
| 408 | Ga0068871_101575222 | 3300006358 | Bacteria | 622 |
| 409 | Ga0075428_100035750 | 3300006844 | Bacteria | 5475 |
| 410 | Ga0075428_102684018 | 3300006844 | Bacteria | 508 |
| 411 | Ga0075430_100009406 | 3300006846 | Bacteria | 8261 |
| 412 | Ga0075430_100363684 | 3300006846 | Bacteria | 1195 |
| 413 | Ga0075430_101133096 | 3300006846 | Bacteria | 644 |
| 414 | Ga0075431_100050721 | 3300006847 | Bacteria | 4278 |
| 415 | Ga0075431_100076297 | 3300006847 | Bacteria | 3459 |
| 416 | Ga0075431_100594542 | 3300006847 | Bacteria | 1091 |
| 417 | Ga0075433_10012601 | 3300006852 | Bacteria | 6840 |
| 418 | Ga0075433_10054490 | 3300006852 | Bacteria | 3489 |
| 419 | Ga0075433_10272924 | 3300006852 | Bacteria | 1499 |
| 420 | Ga0075433_10492196 | 3300006852 | Bacteria | 1080 |
| 421 | Ga0075433_10526698 | 3300006852 | Bacteria | 1040 |
| 422 | Ga0075433_10630724 | 3300006852 | Bacteria | 940 |
| 423 | Ga0075434_100000002 | 3300006871 | Bacteria | 135661 |
| 424 | Ga0075434_100005428 | 3300006871 | Bacteria | 11609 |
| 425 | Ga0075434_100029901 | 3300006871 | Bacteria | 5362 |
| 426 | Ga0075434_100134162 | 3300006871 | Bacteria | 2495 |
| 427 | Ga0075434_100181741 | 3300006871 | Bacteria | 2123 |
| 428 | Ga0075429_100318568 | 3300006880 | Bacteria | 1361 |
| 429 | Ga0075429_100501227 | 3300006880 | Bacteria | 1064 |
| 430 | Ga0075429_100669176 | 3300006880 | Bacteria | 909 |
| 431 | Ga0075429_100893225 | 3300006880 | Bacteria | 778 |
| 432 | Ga0068865_100002587 | 3300006881 | Bacteria | 10743 |
| 433 | Ga0068865_100011373 | 3300006881 | Bacteria | 5566 |
| 434 | Ga0068865_100016392 | 3300006881 | Bacteria | 4742 |
| 435 | Ga0068865_100075379 | 3300006881 | Bacteria | 2405 |
| 436 | Ga0068865_100351803 | 3300006881 | Bacteria | 1194 |
| 437 | Ga0075436_100011488 | 3300006914 | Bacteria | 6077 |
| 438 | Ga0075436_100202616 | 3300006914 | Bacteria | 1406 |
| 439 | Ga0075436_100304506 | 3300006914 | Bacteria | 1143 |
| 440 | Ga0075436_100355278 | 3300006914 | Bacteria | 1056 |
| 441 | Ga0075436_100736622 | 3300006914 | Bacteria | 731 |
| 442 | Ga0075436_101019388 | 3300006914 | Bacteria | 622 |
| 443 | Ga0097620_100005230 | 3300006931 | Bacteria | 13184 |
| 444 | Ga0097620_100028400 | 3300006931 | Bacteria | 5608 |
| 445 | Ga0097620_100037124 | 3300006931 | Bacteria | 4890 |
| 446 | Ga0097620_100097987 | 3300006931 | Bacteria | 2985 |
| 447 | Ga0097620_100311405 | 3300006931 | Bacteria | 1668 |
| 448 | Ga0097620_100319361 | 3300006931 | Bacteria | 1647 |
| 449 | Ga0097620_102099982 | 3300006931 | Bacteria | 624 |
| 450 | Ga0099825_1035219 | 3300006941 | Bacteria | 1804 |
| 451 | Ga0099823_1032609 | 3300006944 | Bacteria | 4230 |
| 452 | Ga0075435_100018975 | 3300007076 | Bacteria | 5241 |
| 453 | Ga0075435_100038058 | 3300007076 | Bacteria | 3834 |
| 454 | Ga0075435_100630745 | 3300007076 | Bacteria | 930 |
| 455 | Ga0075435_100988209 | 3300007076 | Bacteria | 735 |
| 456 | Ga0075435_101410689 | 3300007076 | Unclassified | 610 |
| 457 | Ga0075435_102040561 | 3300007076 | Bacteria | 503 |
| 458 | Ga0099794_10092477 | 3300007265 | Bacteria | 1502 |
| 459 | Ga0099795_10173993 | 3300007788 | Bacteria | 896 |
| 460 | Ga0105251_10231350 | 3300009011 | Bacteria | 832 |
| 461 | Ga0105250_10044625 | 3300009092 | Bacteria | 1778 |
| 462 | Ga0105250_10097401 | 3300009092 | Bacteria | 1199 |
| 463 | Ga0105240_10003909 | 3300009093 | Bacteria | 23015 |
| 464 | Ga0105240_10013511 | 3300009093 | Bacteria | 11208 |
| 465 | Ga0105240_10040761 | 3300009093 | Bacteria | 5934 |
| 466 | Ga0105240_10048726 | 3300009093 | Bacteria | 5352 |
| 467 | Ga0105240_10051298 | 3300009093 | Bacteria | 5193 |
| 468 | Ga0105240_10086700 | 3300009093 | Bacteria | 3835 |
| 469 | Ga0105240_10102240 | 3300009093 | Bacteria | 3483 |
| 470 | Ga0105240_10117208 | 3300009093 | Bacteria | 3211 |
| 471 | Ga0105240_10201237 | 3300009093 | Bacteria | 2334 |
| 472 | Ga0105240_10415260 | 3300009093 | Bacteria | 1513 |
| 473 | Ga0105240_10599914 | 3300009093 | Bacteria | 1212 |
| 474 | Ga0105240_11396336 | 3300009093 | Bacteria | 736 |
| 475 | Ga0111539_10007838 | 3300009094 | Bacteria | 13639 |
| 476 | Ga0111539_10026480 | 3300009094 | Bacteria | 7089 |
| 477 | Ga0111539_10176275 | 3300009094 | Bacteria | 2497 |
| 478 | Ga0111539_10629336 | 3300009094 | Bacteria | 1250 |
| 479 | Ga0111539_10685271 | 3300009094 | Bacteria | 1193 |
| 480 | Ga0111539_11458717 | 3300009094 | Bacteria | 794 |
| 481 | Ga0111539_11460512 | 3300009094 | Bacteria | 793 |
| 482 | Ga0111539_11720912 | 3300009094 | Bacteria | 727 |
| 483 | Ga0111539_12605516 | 3300009094 | Bacteria | 586 |
| 484 | Ga0111539_13040900 | 3300009094 | Bacteria | 542 |
| 485 | Ga0105245_10016953 | 3300009098 | Bacteria | 6360 |
| 486 | Ga0105245_10038887 | 3300009098 | Bacteria | 4233 |
| 487 | Ga0105245_10056008 | 3300009098 | Bacteria | 3543 |
| 488 | Ga0105245_11095244 | 3300009098 | Bacteria | 843 |
| 489 | Ga0105245_11269450 | 3300009098 | Bacteria | 785 |
| 490 | Ga0105245_11719593 | 3300009098 | Bacteria | 680 |
| 491 | Ga0105247_10008282 | 3300009101 | Bacteria | 6342 |
| 492 | Ga0105247_10080733 | 3300009101 | Bacteria | 2049 |
| 493 | Ga0105247_10133923 | 3300009101 | Bacteria | 1617 |
| 494 | Ga0105247_10595536 | 3300009101 | Bacteria | 819 |
| 495 | Ga0105247_10847183 | 3300009101 | Bacteria | 701 |
| 496 | Ga0105247_10887497 | 3300009101 | Bacteria | 687 |
| 497 | Ga0114129_10104235 | 3300009147 | Bacteria | 3919 |
| 498 | Ga0114129_10440316 | 3300009147 | Bacteria | 1711 |
| 499 | Ga0114129_10598538 | 3300009147 | Bacteria | 1429 |
| 500 | Ga0114129_11194042 | 3300009147 | Bacteria | 948 |
| 501 | Ga0114129_12017311 | 3300009147 | Bacteria | 697 |
| 502 | Ga0105243_10005625 | 3300009148 | Bacteria | 9759 |
| 503 | Ga0105243_10113365 | 3300009148 | Bacteria | 2273 |
| 504 | Ga0105243_10257907 | 3300009148 | Bacteria | 1560 |
| 505 | Ga0105243_10444720 | 3300009148 | Bacteria | 1214 |
| 506 | Ga0105243_11733039 | 3300009148 | Bacteria | 654 |
| 507 | Ga0105243_12046080 | 3300009148 | Bacteria | 608 |
| 508 | Ga0105241_10003663 | 3300009174 | Bacteria | 11413 |
| 509 | Ga0105241_10035647 | 3300009174 | Bacteria | 3742 |
| 510 | Ga0105241_10073208 | 3300009174 | Bacteria | 2664 |
| 511 | Ga0105241_10161064 | 3300009174 | Bacteria | 1844 |
| 512 | Ga0105241_10377097 | 3300009174 | Bacteria | 1238 |
| 513 | Ga0105241_10379407 | 3300009174 | Bacteria | 1235 |
| 514 | Ga0105241_10477501 | 3300009174 | Bacteria | 1107 |
| 515 | Ga0105241_11253685 | 3300009174 | Bacteria | 704 |
| 516 | Ga0105241_12014663 | 3300009174 | Bacteria | 569 |
| 517 | Ga0105241_12400940 | 3300009174 | Bacteria | 526 |
| 518 | Ga0105241_12577336 | 3300009174 | Unclassified | 510 |
| 519 | Ga0105241_12649383 | 3300009174 | Bacteria | 504 |
| 520 | Ga0105242_10007918 | 3300009176 | Bacteria | 8180 |
| 521 | Ga0105242_10024897 | 3300009176 | Bacteria | 4730 |
| 522 | Ga0105242_10042533 | 3300009176 | Bacteria | 3670 |
| 523 | Ga0105242_10204361 | 3300009176 | Bacteria | 1756 |
| 524 | Ga0105242_10307067 | 3300009176 | Bacteria | 1450 |
| 525 | Ga0105242_10373877 | 3300009176 | Bacteria | 1323 |
| 526 | Ga0105242_11033000 | 3300009176 | Bacteria | 832 |
| 527 | Ga0105242_11100353 | 3300009176 | Bacteria | 808 |
| 528 | Ga0105248_10000120 | 3300009177 | Bacteria | 89960 |
| 529 | Ga0105248_10003190 | 3300009177 | Bacteria | 18173 |
| 530 | Ga0105248_10125563 | 3300009177 | Bacteria | 2895 |
| 531 | Ga0105248_10225214 | 3300009177 | Bacteria | 2111 |
| 532 | Ga0105248_10426680 | 3300009177 | Bacteria | 1493 |
| 533 | Ga0105248_10588588 | 3300009177 | Bacteria | 1255 |
| 534 | Ga0105248_10706702 | 3300009177 | Bacteria | 1137 |
| 535 | Ga0105248_11127324 | 3300009177 | Bacteria | 887 |
| 536 | Ga0105237_10000585 | 3300009545 | Bacteria | 50881 |
| 537 | Ga0105237_10041317 | 3300009545 | Bacteria | 4651 |
| 538 | Ga0105237_10060749 | 3300009545 | Bacteria | 3779 |
| 539 | Ga0105237_10066556 | 3300009545 | Bacteria | 3598 |
| 540 | Ga0105237_10067357 | 3300009545 | Bacteria | 3574 |
| 541 | Ga0105237_10092757 | 3300009545 | Bacteria | 3009 |
| 542 | Ga0105237_10227066 | 3300009545 | Bacteria | 1867 |
| 543 | Ga0105237_10371359 | 3300009545 | Bacteria | 1435 |
| 544 | Ga0105237_10415168 | 3300009545 | Unclassified | 1351 |
| 545 | Ga0105237_10540869 | 3300009545 | Bacteria | 1171 |
| 546 | Ga0105237_10557624 | 3300009545 | Bacteria | 1152 |
| 547 | Ga0105237_10588664 | 3300009545 | Bacteria | 1119 |
| 548 | Ga0105237_10661281 | 3300009545 | Bacteria | 1051 |
| 549 | Ga0105237_11217536 | 3300009545 | Bacteria | 759 |
| 550 | Ga0105237_11268837 | 3300009545 | Bacteria | 743 |
| 551 | Ga0105237_11382107 | 3300009545 | Bacteria | 710 |
| 552 | Ga0105237_11949654 | 3300009545 | Bacteria | 596 |
| 553 | Ga0105238_10000686 | 3300009551 | Bacteria | 35493 |
| 554 | Ga0105238_10000802 | 3300009551 | Bacteria | 32599 |
| 555 | Ga0105238_10018812 | 3300009551 | Bacteria | 7032 |
| 556 | Ga0105238_10029428 | 3300009551 | Bacteria | 5595 |
| 557 | Ga0105238_10055256 | 3300009551 | Bacteria | 3986 |
| 558 | Ga0105238_10087229 | 3300009551 | Bacteria | 3107 |
| 559 | Ga0105238_10143999 | 3300009551 | Bacteria | 2360 |
| 560 | Ga0105238_10218335 | 3300009551 | Bacteria | 1882 |
| 561 | Ga0105238_10641169 | 3300009551 | Bacteria | 1072 |
| 562 | Ga0105238_11020635 | 3300009551 | Bacteria | 848 |
| 563 | Ga0105238_11246987 | 3300009551 | Bacteria | 769 |
| 564 | Ga0105238_11294984 | 3300009551 | Bacteria | 755 |
| 565 | Ga0105238_11354002 | 3300009551 | Bacteria | 738 |
| 566 | Ga0105238_11670298 | 3300009551 | Bacteria | 668 |
| 567 | Ga0105238_11885083 | 3300009551 | Bacteria | 631 |
| 568 | Ga0105238_11929575 | 3300009551 | Bacteria | 624 |
| 569 | Ga0105249_10001381 | 3300009553 | Bacteria | 21241 |
| 570 | Ga0105249_10007711 | 3300009553 | Bacteria | 9380 |
| 571 | Ga0105249_10082416 | 3300009553 | Bacteria | 2993 |
| 572 | Ga0105249_10292199 | 3300009553 | Bacteria | 1631 |
| 573 | Ga0105249_10475176 | 3300009553 | Bacteria | 1292 |
| 574 | Ga0105249_10539082 | 3300009553 | Bacteria | 1216 |
| 575 | Ga0105249_10826291 | 3300009553 | Bacteria | 991 |
| 576 | Ga0105249_11050759 | 3300009553 | Bacteria | 884 |
| 577 | Ga0105249_11298262 | 3300009553 | Bacteria | 799 |
| 578 | Ga0099796_10438865 | 3300010159 | Bacteria | 579 |
| 579 | Ga0105239_10000598 | 3300010375 | Bacteria | 51483 |
| 580 | Ga0105239_10024313 | 3300010375 | Bacteria | 6673 |
| 581 | Ga0105239_10039543 | 3300010375 | Bacteria | 5167 |
| 582 | Ga0105239_10055913 | 3300010375 | Bacteria | 4329 |
| 583 | Ga0105239_10108698 | 3300010375 | Bacteria | 3072 |
| 584 | Ga0105239_10153783 | 3300010375 | Bacteria | 2568 |
| 585 | Ga0105239_10219536 | 3300010375 | Bacteria | 2132 |
| 586 | Ga0105239_10565564 | 3300010375 | Bacteria | 1295 |
| 587 | Ga0105239_10713489 | 3300010375 | Bacteria | 1147 |
| 588 | Ga0105239_11914828 | 3300010375 | Bacteria | 688 |
| 589 | Ga0105246_10003169 | 3300011119 | Bacteria | 9993 |
| 590 | Ga0105246_10056601 | 3300011119 | Bacteria | 2711 |
| 591 | Ga0105246_10119130 | 3300011119 | Bacteria | 1953 |
| 592 | Ga0105246_10376905 | 3300011119 | Bacteria | 1171 |
| 593 | Ga0105246_10523567 | 3300011119 | Bacteria | 1011 |
| 594 | Ga0105246_11197202 | 3300011119 | Bacteria | 699 |
| 595 | Ga0105246_12511814 | 3300011119 | Bacteria | 507 |
| 596 | Ga0157322_1036643 | 3300012490 | Bacteria | 547 |
| 597 | Ga0157314_1052243 | 3300012500 | Bacteria | 525 |
| 598 | Ga0157371_10011090 | 3300013102 | Bacteria | 6978 |
| 599 | Ga0157370_10001505 | 3300013104 | Bacteria | 28782 |
| 600 | Ga0157370_10422990 | 3300013104 | Bacteria | 1225 |
| 601 | Ga0157370_10617434 | 3300013104 | Unclassified | 992 |
| 602 | Ga0157370_11060541 | 3300013104 | Bacteria | 733 |
| 603 | Ga0157369_10001137 | 3300013105 | Bacteria | 33284 |
| 604 | Ga0157369_10007085 | 3300013105 | Bacteria | 12932 |
| 605 | Ga0157369_10043435 | 3300013105 | Bacteria | 4899 |
| 606 | Ga0157369_10120068 | 3300013105 | Bacteria | 2789 |
| 607 | Ga0157374_10013680 | 3300013296 | Bacteria | 7089 |
| 608 | Ga0157374_10033535 | 3300013296 | Bacteria | 4684 |
| 609 | Ga0157374_10036715 | 3300013296 | Bacteria | 4491 |
| 610 | Ga0157374_10354282 | 3300013296 | Unclassified | 1459 |
| 611 | Ga0157374_10579161 | 3300013296 | Bacteria | 1131 |
| 612 | Ga0157374_11292454 | 3300013296 | Bacteria | 751 |
| 613 | Ga0157378_10019633 | 3300013297 | Bacteria | 5940 |
| 614 | Ga0157378_10028655 | 3300013297 | Bacteria | 4915 |
| 615 | Ga0157378_10061729 | 3300013297 | Bacteria | 3346 |
| 616 | Ga0157378_10407877 | 3300013297 | Bacteria | 1340 |
| 617 | Ga0157378_10913935 | 3300013297 | Bacteria | 909 |
| 618 | Ga0157378_11228592 | 3300013297 | Bacteria | 789 |
| 619 | Ga0157378_12265422 | 3300013297 | Bacteria | 595 |
| 620 | Ga0163162_10001651 | 3300013306 | Bacteria | 20905 |
| 621 | Ga0163162_10012697 | 3300013306 | Bacteria | 8223 |
| 622 | Ga0163162_10017443 | 3300013306 | Bacteria | 7025 |
| 623 | Ga0163162_10024940 | 3300013306 | Bacteria | 5907 |
| 624 | Ga0163162_10051897 | 3300013306 | Bacteria | 4116 |
| 625 | Ga0163162_10109029 | 3300013306 | Bacteria | 2865 |
| 626 | Ga0163162_10126629 | 3300013306 | Bacteria | 2661 |
| 627 | Ga0163162_10407075 | 3300013306 | Bacteria | 1493 |
| 628 | Ga0163162_10436120 | 3300013306 | Bacteria | 1442 |
| 629 | Ga0163162_10518344 | 3300013306 | Bacteria | 1322 |
| 630 | Ga0163162_12065338 | 3300013306 | Bacteria | 653 |
| 631 | Ga0157372_10035411 | 3300013307 | Bacteria | 5496 |
| 632 | Ga0157372_10049782 | 3300013307 | Bacteria | 4660 |
| 633 | Ga0157372_10580609 | 3300013307 | Bacteria | 1306 |
| 634 | Ga0157372_10616187 | 3300013307 | Bacteria | 1265 |
| 635 | Ga0157372_10963796 | 3300013307 | Bacteria | 989 |
| 636 | Ga0157372_11564923 | 3300013307 | Bacteria | 759 |
| 637 | Ga0157372_12868801 | 3300013307 | Bacteria | 552 |
| 638 | Ga0157375_10001711 | 3300013308 | Bacteria | 18837 |
| 639 | Ga0157375_10085834 | 3300013308 | Bacteria | 3198 |
| 640 | Ga0157375_10087695 | 3300013308 | Bacteria | 3164 |
| 641 | Ga0157375_10260540 | 3300013308 | Bacteria | 1896 |
| 642 | Ga0157375_10371726 | 3300013308 | Bacteria | 1596 |
| 643 | Ga0157375_10388667 | 3300013308 | Bacteria | 1562 |
| 644 | Ga0157375_11086535 | 3300013308 | Bacteria | 936 |
| 645 | Ga0163163_10000639 | 3300014325 | Bacteria | 30088 |
| 646 | Ga0163163_10009921 | 3300014325 | Bacteria | 8539 |
| 647 | Ga0163163_10049124 | 3300014325 | Bacteria | 4150 |
| 648 | Ga0163163_10237641 | 3300014325 | Bacteria | 1871 |
| 649 | Ga0163163_10359865 | 3300014325 | Bacteria | 1512 |
| 650 | Ga0157380_10264090 | 3300014326 | Bacteria | 1565 |
| 651 | Ga0157380_10942054 | 3300014326 | Bacteria | 893 |
| 652 | Ga0157380_11517697 | 3300014326 | Bacteria | 723 |
| 653 | Ga0157380_12895059 | 3300014326 | Bacteria | 546 |
| 654 | Ga0157380_13215095 | 3300014326 | Bacteria | 522 |
| 655 | Ga0182008_10120559 | 3300014497 | Bacteria | 1303 |
| 656 | Ga0182008_10220072 | 3300014497 | Bacteria | 971 |
| 657 | Ga0182008_10391064 | 3300014497 | Bacteria | 745 |
| 658 | Ga0157377_10001805 | 3300014745 | Bacteria | 9328 |
| 659 | Ga0157377_10003066 | 3300014745 | Bacteria | 7496 |
| 660 | Ga0157379_10016645 | 3300014968 | Bacteria | 6465 |
| 661 | Ga0157379_10048305 | 3300014968 | Bacteria | 3798 |
| 662 | Ga0157379_10066120 | 3300014968 | Bacteria | 3232 |
| 663 | Ga0157379_10066986 | 3300014968 | Bacteria | 3210 |
| 664 | Ga0157379_10219277 | 3300014968 | Bacteria | 1723 |
| 665 | Ga0157379_10227584 | 3300014968 | Bacteria | 1690 |
| 666 | Ga0157379_10463952 | 3300014968 | Bacteria | 1171 |
| 667 | Ga0157379_10567712 | 3300014968 | Bacteria | 1057 |
| 668 | Ga0157379_11580199 | 3300014968 | Bacteria | 640 |
| 669 | Ga0157379_12067041 | 3300014968 | Bacteria | 564 |
| 670 | Ga0157379_12101320 | 3300014968 | Bacteria | 560 |
| 671 | Ga0157376_10012122 | 3300014969 | Bacteria | 6385 |
| 672 | Ga0157376_10013167 | 3300014969 | Bacteria | 6164 |
| 673 | Ga0157376_10024072 | 3300014969 | Bacteria | 4775 |
| 674 | Ga0157376_10430519 | 3300014969 | Bacteria | 1282 |
| 675 | Ga0157376_10907787 | 3300014969 | Bacteria | 899 |
| 676 | Ga0157376_11242779 | 3300014969 | Bacteria | 774 |
| 677 | Ga0157376_13151042 | 3300014969 | Bacteria | 500 |
| 678 | Ga0182007_10004162 | 3300015262 | Bacteria | 6631 |
| 679 | Ga0182007_10075671 | 3300015262 | Bacteria | 1104 |
| 680 | Ga0163161_10010057 | 3300017792 | Bacteria | 6549 |
| 681 | Ga0163161_10030360 | 3300017792 | Bacteria | 3846 |
| 682 | Ga0163161_10088146 | 3300017792 | Bacteria | 2294 |
| 683 | Ga0163161_11738495 | 3300017792 | Bacteria | 553 |
| 684 | Ga0213873_10279657 | 3300021358 | Bacteria | 534 |
| 685 | Ga0213872_10000304 | 3300021361 | Bacteria | 42020 |
| 686 | Ga0213872_10008216 | 3300021361 | Bacteria | 5058 |
| 687 | Ga0213872_10071172 | 3300021361 | Bacteria | 1568 |
| 688 | Ga0213872_10251186 | 3300021361 | Bacteria | 745 |
| 689 | Ga0213872_10406076 | 3300021361 | Bacteria | 552 |
| 690 | Ga0213876_10026589 | 3300021384 | Bacteria | 3052 |
| 691 | Ga0213876_10066199 | 3300021384 | Bacteria | 1907 |
| 692 | Ga0213876_10175445 | 3300021384 | Bacteria | 1141 |
| 693 | Ga0213875_10061108 | 3300021388 | Bacteria | 1761 |
| 694 | Ga0213875_10118890 | 3300021388 | Bacteria | 1235 |
| 695 | Ga0213875_10143471 | 3300021388 | Bacteria | 1118 |
| 696 | Ga0213871_10028888 | 3300021441 | Bacteria | 1434 |
| 697 | Ga0213871_10132264 | 3300021441 | Bacteria | 750 |
| 698 | Ga0228598_1012452 | 3300024227 | Bacteria | 1690 |
| 699 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 700 | Ga0209672_101212 | 3300025228 | Bacteria | 10412 |
| 701 | Ga0209563_101608 | 3300025230 | Bacteria | 5843 |
| 702 | Ga0207427_101318 | 3300025231 | Bacteria | 9320 |
| 703 | Ga0209437_101040 | 3300025233 | Bacteria | 9320 |
| 704 | Ga0209258_100164 | 3300025242 | Bacteria | 148838 |
| 705 | Ga0209258_101181 | 3300025242 | Bacteria | 10543 |
| 706 | Ga0209258_109811 | 3300025242 | Bacteria | 1270 |
| 707 | Ga0207425_1037931 | 3300025245 | Bacteria | 928 |
| 708 | Ga0209646_1001751 | 3300025246 | Bacteria | 5477 |
| 709 | Ga0209026_1000280 | 3300025250 | Bacteria | 58823 |
| 710 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 711 | Ga0209148_1001605 | 3300025254 | Bacteria | 10543 |
| 712 | Ga0209148_1002895 | 3300025254 | Bacteria | 5246 |
| 713 | Ga0209759_1001011 | 3300025256 | Bacteria | 18928 |
| 714 | Ga0209129_1024705 | 3300025258 | Bacteria | 1054 |
| 715 | Ga0209233_1001383 | 3300025261 | Bacteria | 9625 |
| 716 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 717 | Ga0209455_1000450 | 3300025272 | Bacteria | 31556 |
| 718 | Ga0209455_1000920 | 3300025272 | Bacteria | 15191 |
| 719 | Ga0209673_1007773 | 3300025273 | Bacteria | 4872 |
| 720 | Ga0207673_1016523 | 3300025290 | Bacteria | 981 |
| 721 | Ga0209564_1006041 | 3300025295 | Bacteria | 6672 |
| 722 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 723 | Ga0209758_1000109 | 3300025297 | Bacteria | 214759 |
| 724 | Ga0209050_1002121 | 3300025298 | Bacteria | 18068 |
| 725 | Ga0209256_1003201 | 3300025299 | Bacteria | 11828 |
| 726 | Ga0209256_1018586 | 3300025299 | Bacteria | 2249 |
| 727 | Ga0207426_1002293 | 3300025302 | Bacteria | 12619 |
| 728 | Ga0207426_1048932 | 3300025302 | Bacteria | 1267 |
| 729 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 730 | Ga0209051_1005357 | 3300025303 | Bacteria | 7533 |
| 731 | Ga0209051_1068084 | 3300025303 | Bacteria | 1085 |
| 732 | Ga0209051_1074559 | 3300025303 | Bacteria | 1005 |
| 733 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 734 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 735 | Ga0209257_1001604 | 3300025304 | Bacteria | 25883 |
| 736 | Ga0209257_1012281 | 3300025304 | Bacteria | 3983 |
| 737 | Ga0207697_10000498 | 3300025315 | Bacteria | 22072 |
| 738 | Ga0207697_10076753 | 3300025315 | Bacteria | 1404 |
| 739 | Ga0207656_10062321 | 3300025321 | Bacteria | 1639 |
| 740 | Ga0207656_10239746 | 3300025321 | Unclassified | 886 |
| 741 | Ga0207682_10001642 | 3300025893 | Bacteria | 10254 |
| 742 | Ga0207682_10001768 | 3300025893 | Bacteria | 9912 |
| 743 | Ga0207692_10865573 | 3300025898 | Bacteria | 593 |
| 744 | Ga0207642_10001970 | 3300025899 | Bacteria | 6342 |
| 745 | Ga0207642_10002638 | 3300025899 | Bacteria | 5590 |
| 746 | Ga0207642_10604748 | 3300025899 | Bacteria | 683 |
| 747 | Ga0207642_10623380 | 3300025899 | Bacteria | 673 |
| 748 | Ga0207710_10008398 | 3300025900 | Bacteria | 4355 |
| 749 | Ga0207710_10041401 | 3300025900 | Bacteria | 2043 |
| 750 | Ga0207710_10077577 | 3300025900 | Bacteria | 1535 |
| 751 | Ga0207688_10000572 | 3300025901 | Bacteria | 18079 |
| 752 | Ga0207688_10020505 | 3300025901 | Bacteria | 3610 |
| 753 | Ga0207688_10064630 | 3300025901 | Bacteria | 2066 |
| 754 | Ga0207688_10326648 | 3300025901 | Bacteria | 942 |
| 755 | Ga0207688_10476554 | 3300025901 | Bacteria | 780 |
| 756 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 757 | Ga0207680_10048115 | 3300025903 | Bacteria | 2531 |
| 758 | Ga0207680_10050311 | 3300025903 | Bacteria | 2485 |
| 759 | Ga0207680_10051102 | 3300025903 | Bacteria | 2471 |
| 760 | Ga0207680_10207452 | 3300025903 | Bacteria | 1338 |
| 761 | Ga0207680_10498476 | 3300025903 | Bacteria | 867 |
| 762 | Ga0207680_10543220 | 3300025903 | Bacteria | 829 |
| 763 | Ga0207647_10000776 | 3300025904 | Bacteria | 24848 |
| 764 | Ga0207647_10000888 | 3300025904 | Bacteria | 23203 |
| 765 | Ga0207647_10002766 | 3300025904 | Bacteria | 13239 |
| 766 | Ga0207685_10055025 | 3300025905 | Bacteria | 1552 |
| 767 | Ga0207685_10097917 | 3300025905 | Bacteria | 1248 |
| 768 | Ga0207685_10425644 | 3300025905 | Bacteria | 685 |
| 769 | Ga0207699_10070352 | 3300025906 | Bacteria | 2136 |
| 770 | Ga0207699_10493910 | 3300025906 | Bacteria | 883 |
| 771 | Ga0207699_10855995 | 3300025906 | Bacteria | 670 |
| 772 | Ga0207645_10010112 | 3300025907 | Bacteria | 6493 |
| 773 | Ga0207645_10151559 | 3300025907 | Bacteria | 1513 |
| 774 | Ga0207645_10209376 | 3300025907 | Bacteria | 1284 |
| 775 | Ga0207645_10231059 | 3300025907 | Bacteria | 1221 |
| 776 | Ga0207645_10692571 | 3300025907 | Bacteria | 693 |
| 777 | Ga0207643_10000024 | 3300025908 | Bacteria | 103214 |
| 778 | Ga0207643_10007460 | 3300025908 | Bacteria | 5870 |
| 779 | Ga0207643_10083185 | 3300025908 | Bacteria | 1856 |
| 780 | Ga0207643_10299240 | 3300025908 | Bacteria | 1001 |
| 781 | Ga0207705_10045059 | 3300025909 | Bacteria | 3170 |
| 782 | Ga0207705_10061789 | 3300025909 | Bacteria | 2706 |
| 783 | Ga0207684_10030780 | 3300025910 | Bacteria | 4568 |
| 784 | Ga0207684_10043517 | 3300025910 | Unclassified | 3807 |
| 785 | Ga0207684_10217969 | 3300025910 | Bacteria | 1647 |
| 786 | Ga0207684_11291842 | 3300025910 | Bacteria | 601 |
| 787 | Ga0207654_10000444 | 3300025911 | Bacteria | 23592 |
| 788 | Ga0207654_10008850 | 3300025911 | Bacteria | 5108 |
| 789 | Ga0207654_10036982 | 3300025911 | Bacteria | 2731 |
| 790 | Ga0207654_10169170 | 3300025911 | Bacteria | 1418 |
| 791 | Ga0207654_10720171 | 3300025911 | Bacteria | 717 |
| 792 | Ga0207707_10000137 | 3300025912 | Bacteria | 75096 |
| 793 | Ga0207707_10002528 | 3300025912 | Bacteria | 16427 |
| 794 | Ga0207707_10029216 | 3300025912 | Bacteria | 4819 |
| 795 | Ga0207707_10091699 | 3300025912 | Unclassified | 2655 |
| 796 | Ga0207707_10096869 | 3300025912 | Bacteria | 2578 |
| 797 | Ga0207707_10212555 | 3300025912 | Bacteria | 1685 |
| 798 | Ga0207707_10592075 | 3300025912 | Bacteria | 939 |
| 799 | Ga0207707_10672067 | 3300025912 | Bacteria | 872 |
| 800 | Ga0207695_10000844 | 3300025913 | Bacteria | 56228 |
| 801 | Ga0207695_10002725 | 3300025913 | Bacteria | 25804 |
| 802 | Ga0207695_10029526 | 3300025913 | Bacteria | 6055 |
| 803 | Ga0207695_10041940 | 3300025913 | Bacteria | 4893 |
| 804 | Ga0207695_10042899 | 3300025913 | Bacteria | 4825 |
| 805 | Ga0207695_10175918 | 3300025913 | Bacteria | 2063 |
| 806 | Ga0207695_10210334 | 3300025913 | Bacteria | 1856 |
| 807 | Ga0207695_10300530 | 3300025913 | Bacteria | 1496 |
| 808 | Ga0207695_10396820 | 3300025913 | Bacteria | 1264 |
| 809 | Ga0207695_10859688 | 3300025913 | Bacteria | 787 |
| 810 | Ga0207695_10934150 | 3300025913 | Bacteria | 747 |
| 811 | Ga0207695_11338435 | 3300025913 | Bacteria | 596 |
| 812 | Ga0207695_11344858 | 3300025913 | Bacteria | 595 |
| 813 | Ga0207671_10003300 | 3300025914 | Bacteria | 16237 |
| 814 | Ga0207671_10003896 | 3300025914 | Bacteria | 14548 |
| 815 | Ga0207671_10011447 | 3300025914 | Bacteria | 7222 |
| 816 | Ga0207671_10213990 | 3300025914 | Bacteria | 1508 |
| 817 | Ga0207671_10570089 | 3300025914 | Bacteria | 902 |
| 818 | Ga0207671_10593396 | 3300025914 | Bacteria | 883 |
| 819 | Ga0207671_10709014 | 3300025914 | Bacteria | 800 |
| 820 | Ga0207671_10736084 | 3300025914 | Bacteria | 784 |
| 821 | Ga0207671_10992306 | 3300025914 | Bacteria | 662 |
| 822 | Ga0207693_10019331 | 3300025915 | Bacteria | 5420 |
| 823 | Ga0207663_10004609 | 3300025916 | Bacteria | 6870 |
| 824 | Ga0207660_10006522 | 3300025917 | Bacteria | 7571 |
| 825 | Ga0207660_10181303 | 3300025917 | Bacteria | 1636 |
| 826 | Ga0207660_10189663 | 3300025917 | Bacteria | 1600 |
| 827 | Ga0207660_10250269 | 3300025917 | Bacteria | 1398 |
| 828 | Ga0207660_10484556 | 3300025917 | Bacteria | 1002 |
| 829 | Ga0207660_10513944 | 3300025917 | Bacteria | 972 |
| 830 | Ga0207660_10580168 | 3300025917 | Bacteria | 913 |
| 831 | Ga0207660_10792511 | 3300025917 | Bacteria | 773 |
| 832 | Ga0207660_11317074 | 3300025917 | Bacteria | 586 |
| 833 | Ga0207660_11510492 | 3300025917 | Bacteria | 543 |
| 834 | Ga0207662_10000499 | 3300025918 | Bacteria | 17531 |
| 835 | Ga0207662_10001437 | 3300025918 | Bacteria | 11559 |
| 836 | Ga0207662_11275438 | 3300025918 | Bacteria | 522 |
| 837 | Ga0207657_10000115 | 3300025919 | Bacteria | 79117 |
| 838 | Ga0207657_10048721 | 3300025919 | Bacteria | 3698 |
| 839 | Ga0207657_10670345 | 3300025919 | Bacteria | 807 |
| 840 | Ga0207657_11042421 | 3300025919 | Bacteria | 626 |
| 841 | Ga0207649_10028267 | 3300025920 | Bacteria | 3301 |
| 842 | Ga0207649_10035081 | 3300025920 | Bacteria | 3011 |
| 843 | Ga0207649_10080895 | 3300025920 | Bacteria | 2102 |
| 844 | Ga0207649_10164667 | 3300025920 | Bacteria | 1539 |
| 845 | Ga0207652_10005039 | 3300025921 | Bacteria | 10706 |
| 846 | Ga0207652_10092469 | 3300025921 | Bacteria | 2661 |
| 847 | Ga0207652_10176514 | 3300025921 | Bacteria | 1919 |
| 848 | Ga0207652_10180872 | 3300025921 | Bacteria | 1895 |
| 849 | Ga0207652_10256183 | 3300025921 | Bacteria | 1578 |
| 850 | Ga0207646_10198791 | 3300025922 | Bacteria | 1810 |
| 851 | Ga0207646_10324278 | 3300025922 | Bacteria | 1392 |
| 852 | Ga0207681_10003152 | 3300025923 | Bacteria | 10367 |
| 853 | Ga0207681_10006516 | 3300025923 | Bacteria | 7166 |
| 854 | Ga0207681_10259621 | 3300025923 | Bacteria | 1360 |
| 855 | Ga0207681_11301738 | 3300025923 | Bacteria | 610 |
| 856 | Ga0207694_10000309 | 3300025924 | Bacteria | 45949 |
| 857 | Ga0207694_10005100 | 3300025924 | Bacteria | 10147 |
| 858 | Ga0207694_10010350 | 3300025924 | Bacteria | 7032 |
| 859 | Ga0207694_10010925 | 3300025924 | Bacteria | 6859 |
| 860 | Ga0207694_10116822 | 3300025924 | Bacteria | 2126 |
| 861 | Ga0207694_10193334 | 3300025924 | Bacteria | 1654 |
| 862 | Ga0207694_10864636 | 3300025924 | Bacteria | 764 |
| 863 | Ga0207694_11300043 | 3300025924 | Bacteria | 615 |
| 864 | Ga0207694_11500501 | 3300025924 | Bacteria | 569 |
| 865 | Ga0207694_11804724 | 3300025924 | Bacteria | 514 |
| 866 | Ga0207650_10007543 | 3300025925 | Bacteria | 7417 |
| 867 | Ga0207650_10034670 | 3300025925 | Bacteria | 3661 |
| 868 | Ga0207650_10035051 | 3300025925 | Bacteria | 3642 |
| 869 | Ga0207650_10116372 | 3300025925 | Bacteria | 2076 |
| 870 | Ga0207650_10292338 | 3300025925 | Bacteria | 1329 |
| 871 | Ga0207650_10382609 | 3300025925 | Bacteria | 1162 |
| 872 | Ga0207659_10003803 | 3300025926 | Bacteria | 9104 |
| 873 | Ga0207659_10022783 | 3300025926 | Bacteria | 4173 |
| 874 | Ga0207659_10694338 | 3300025926 | Bacteria | 871 |
| 875 | Ga0207659_10736444 | 3300025926 | Bacteria | 845 |
| 876 | Ga0207687_10037484 | 3300025927 | Bacteria | 3308 |
| 877 | Ga0207687_10106298 | 3300025927 | Bacteria | 2075 |
| 878 | Ga0207687_10636351 | 3300025927 | Bacteria | 901 |
| 879 | Ga0207700_10280646 | 3300025928 | Bacteria | 1433 |
| 880 | Ga0207700_10649946 | 3300025928 | Bacteria | 940 |
| 881 | Ga0207664_10311298 | 3300025929 | Bacteria | 1387 |
| 882 | Ga0207664_10402775 | 3300025929 | Bacteria | 1217 |
| 883 | Ga0207664_10581809 | 3300025929 | Bacteria | 1005 |
| 884 | Ga0207644_10009480 | 3300025931 | Bacteria | 6395 |
| 885 | Ga0207644_10068527 | 3300025931 | Bacteria | 2588 |
| 886 | Ga0207644_10085393 | 3300025931 | Bacteria | 2341 |
| 887 | Ga0207644_10164896 | 3300025931 | Bacteria | 1725 |
| 888 | Ga0207644_10221676 | 3300025931 | Bacteria | 1499 |
| 889 | Ga0207690_10006275 | 3300025932 | Bacteria | 7041 |
| 890 | Ga0207690_10132044 | 3300025932 | Bacteria | 1829 |
| 891 | Ga0207690_10436612 | 3300025932 | Bacteria | 1050 |
| 892 | Ga0207690_10690353 | 3300025932 | Bacteria | 839 |
| 893 | Ga0207690_11063437 | 3300025932 | Bacteria | 674 |
| 894 | Ga0207706_10003073 | 3300025933 | Bacteria | 16051 |
| 895 | Ga0207706_10044166 | 3300025933 | Bacteria | 3950 |
| 896 | Ga0207706_10050108 | 3300025933 | Bacteria | 3691 |
| 897 | Ga0207706_10173473 | 3300025933 | Bacteria | 1894 |
| 898 | Ga0207706_10563006 | 3300025933 | Bacteria | 981 |
| 899 | Ga0207706_11474131 | 3300025933 | Bacteria | 556 |
| 900 | Ga0207686_10000953 | 3300025934 | Bacteria | 17273 |
| 901 | Ga0207686_10011909 | 3300025934 | Bacteria | 4773 |
| 902 | Ga0207686_10030830 | 3300025934 | Bacteria | 3179 |
| 903 | Ga0207686_10360100 | 3300025934 | Bacteria | 1098 |
| 904 | Ga0207686_10428626 | 3300025934 | Bacteria | 1013 |
| 905 | Ga0207686_11573935 | 3300025934 | Bacteria | 542 |
| 906 | Ga0207709_10077554 | 3300025935 | Bacteria | 2130 |
| 907 | Ga0207709_10262049 | 3300025935 | Bacteria | 1268 |
| 908 | Ga0207670_10058925 | 3300025936 | Bacteria | 2610 |
| 909 | Ga0207670_10118338 | 3300025936 | Bacteria | 1921 |
| 910 | Ga0207670_11076908 | 3300025936 | Bacteria | 678 |
| 911 | Ga0207670_11283212 | 3300025936 | Bacteria | 621 |
| 912 | Ga0207669_10020686 | 3300025937 | Bacteria | 3456 |
| 913 | Ga0207669_10412686 | 3300025937 | Bacteria | 1060 |
| 914 | Ga0207669_10836192 | 3300025937 | Bacteria | 765 |
| 915 | Ga0207704_10001072 | 3300025938 | Bacteria | 12170 |
| 916 | Ga0207704_10011774 | 3300025938 | Bacteria | 4321 |
| 917 | Ga0207704_10012894 | 3300025938 | Bacteria | 4163 |
| 918 | Ga0207704_10051435 | 3300025938 | Bacteria | 2491 |
| 919 | Ga0207704_10167605 | 3300025938 | Bacteria | 1571 |
| 920 | Ga0207665_10022531 | 3300025939 | Bacteria | 4145 |
| 921 | Ga0207665_10165554 | 3300025939 | Bacteria | 1593 |
| 922 | Ga0207665_10818971 | 3300025939 | Bacteria | 736 |
| 923 | Ga0207665_11492122 | 3300025939 | Bacteria | 537 |
| 924 | Ga0207691_10014194 | 3300025940 | Bacteria | 7600 |
| 925 | Ga0207691_10021585 | 3300025940 | Bacteria | 6079 |
| 926 | Ga0207691_10021717 | 3300025940 | Bacteria | 6059 |
| 927 | Ga0207691_10029699 | 3300025940 | Bacteria | 5112 |
| 928 | Ga0207691_10289702 | 3300025940 | Bacteria | 1408 |
| 929 | Ga0207691_10416849 | 3300025940 | Bacteria | 1144 |
| 930 | Ga0207711_10001241 | 3300025941 | Bacteria | 24195 |
| 931 | Ga0207711_10063491 | 3300025941 | Bacteria | 3188 |
| 932 | Ga0207711_10102157 | 3300025941 | Bacteria | 2538 |
| 933 | Ga0207711_10113220 | 3300025941 | Bacteria | 2415 |
| 934 | Ga0207711_10189237 | 3300025941 | Bacteria | 1875 |
| 935 | Ga0207711_10202771 | 3300025941 | Bacteria | 1810 |
| 936 | Ga0207689_10000471 | 3300025942 | Bacteria | 37824 |
| 937 | Ga0207689_10015006 | 3300025942 | Bacteria | 6570 |
| 938 | Ga0207689_10335934 | 3300025942 | Bacteria | 1255 |
| 939 | Ga0207689_11828468 | 3300025942 | Bacteria | 501 |
| 940 | Ga0207661_10058882 | 3300025944 | Bacteria | 3093 |
| 941 | Ga0207661_10078706 | 3300025944 | Bacteria | 2715 |
| 942 | Ga0207661_10239636 | 3300025944 | Bacteria | 1609 |
| 943 | Ga0207661_12166587 | 3300025944 | Unclassified | 502 |
| 944 | Ga0207679_10002985 | 3300025945 | Bacteria | 10490 |
| 945 | Ga0207679_10049933 | 3300025945 | Bacteria | 3054 |
| 946 | Ga0207679_10137908 | 3300025945 | Bacteria | 1967 |
| 947 | Ga0207667_10007953 | 3300025949 | Bacteria | 12657 |
| 948 | Ga0207667_10058796 | 3300025949 | Bacteria | 4030 |
| 949 | Ga0207667_10069324 | 3300025949 | Bacteria | 3670 |
| 950 | Ga0207667_10119992 | 3300025949 | Bacteria | 2710 |
| 951 | Ga0207667_10305861 | 3300025949 | Bacteria | 1624 |
| 952 | Ga0207667_11878951 | 3300025949 | Bacteria | 561 |
| 953 | Ga0207651_10023742 | 3300025960 | Bacteria | 3779 |
| 954 | Ga0207651_10027738 | 3300025960 | Bacteria | 3562 |
| 955 | Ga0207651_10680913 | 3300025960 | Bacteria | 905 |
| 956 | Ga0207651_11967382 | 3300025960 | Bacteria | 525 |
| 957 | Ga0207712_10000605 | 3300025961 | Bacteria | 28454 |
| 958 | Ga0207712_10014305 | 3300025961 | Bacteria | 5101 |
| 959 | Ga0207712_10035911 | 3300025961 | Bacteria | 3372 |
| 960 | Ga0207712_10142312 | 3300025961 | Bacteria | 1842 |
| 961 | Ga0207712_10301983 | 3300025961 | Bacteria | 1314 |
| 962 | Ga0207712_10740006 | 3300025961 | Bacteria | 861 |
| 963 | Ga0207712_11427855 | 3300025961 | Bacteria | 619 |
| 964 | Ga0207712_11505479 | 3300025961 | Bacteria | 603 |
| 965 | Ga0207668_10008885 | 3300025972 | Bacteria | 6008 |
| 966 | Ga0207668_10026673 | 3300025972 | Bacteria | 3754 |
| 967 | Ga0207668_10063315 | 3300025972 | Bacteria | 2609 |
| 968 | Ga0207668_10252046 | 3300025972 | Bacteria | 1434 |
| 969 | Ga0207640_10006740 | 3300025981 | Bacteria | 6316 |
| 970 | Ga0207640_10307527 | 3300025981 | Bacteria | 1257 |
| 971 | Ga0207640_11241386 | 3300025981 | Unclassified | 664 |
| 972 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 973 | Ga0207658_10000126 | 3300025986 | Bacteria | 83451 |
| 974 | Ga0207658_10007587 | 3300025986 | Bacteria | 7391 |
| 975 | Ga0207658_10014907 | 3300025986 | Bacteria | 5327 |
| 976 | Ga0207658_10024572 | 3300025986 | Bacteria | 4216 |
| 977 | Ga0207658_10118358 | 3300025986 | Bacteria | 2107 |
| 978 | Ga0207658_10126657 | 3300025986 | Bacteria | 2045 |
| 979 | Ga0207658_10478751 | 3300025986 | Bacteria | 1106 |
| 980 | Ga0207658_10934227 | 3300025986 | Bacteria | 790 |
| 981 | Ga0207658_11007395 | 3300025986 | Bacteria | 760 |
| 982 | Ga0207658_11073824 | 3300025986 | Bacteria | 735 |
| 983 | Ga0207658_12010252 | 3300025986 | Bacteria | 526 |
| 984 | Ga0207677_10068327 | 3300026023 | Bacteria | 2493 |
| 985 | Ga0207677_10069624 | 3300026023 | Bacteria | 2475 |
| 986 | Ga0207677_10243057 | 3300026023 | Bacteria | 1457 |
| 987 | Ga0207677_10859541 | 3300026023 | Bacteria | 816 |
| 988 | Ga0207703_10007300 | 3300026035 | Bacteria | 8785 |
| 989 | Ga0207703_10024363 | 3300026035 | Bacteria | 4762 |
| 990 | Ga0207703_10954126 | 3300026035 | Bacteria | 822 |
| 991 | Ga0207703_11692618 | 3300026035 | Bacteria | 608 |
| 992 | Ga0207639_10007094 | 3300026041 | Bacteria | 7641 |
| 993 | Ga0207639_10080350 | 3300026041 | Bacteria | 2579 |
| 994 | Ga0207639_10115408 | 3300026041 | Bacteria | 2196 |
| 995 | Ga0207639_10119541 | 3300026041 | Bacteria | 2162 |
| 996 | Ga0207639_10152168 | 3300026041 | Bacteria | 1939 |
| 997 | Ga0207639_10186404 | 3300026041 | Bacteria | 1769 |
| 998 | Ga0207639_10227152 | 3300026041 | Bacteria | 1616 |
| 999 | Ga0207639_10479516 | 3300026041 | Bacteria | 1133 |
| 1000 | Ga0207639_10493442 | 3300026041 | Bacteria | 1118 |
| 1001 | Ga0207639_10651089 | 3300026041 | Bacteria | 975 |
| 1002 | Ga0207639_10703018 | 3300026041 | Bacteria | 938 |
| 1003 | Ga0207639_10829321 | 3300026041 | Bacteria | 862 |
| 1004 | Ga0207639_10903959 | 3300026041 | Bacteria | 825 |
| 1005 | Ga0207678_10000559 | 3300026067 | Bacteria | 33996 |
| 1006 | Ga0207678_10052062 | 3300026067 | Bacteria | 3533 |
| 1007 | Ga0207678_10126711 | 3300026067 | Bacteria | 2178 |
| 1008 | Ga0207678_10140143 | 3300026067 | Bacteria | 2064 |
| 1009 | Ga0207678_10420163 | 3300026067 | Bacteria | 1159 |
| 1010 | Ga0207708_10017324 | 3300026075 | Bacteria | 5423 |
| 1011 | Ga0207708_10033118 | 3300026075 | Bacteria | 3925 |
| 1012 | Ga0207708_10053869 | 3300026075 | Bacteria | 3066 |
| 1013 | Ga0207708_11804890 | 3300026075 | Bacteria | 537 |
| 1014 | Ga0207702_10054522 | 3300026078 | Bacteria | 3388 |
| 1015 | Ga0207702_10085922 | 3300026078 | Bacteria | 2742 |
| 1016 | Ga0207702_10132751 | 3300026078 | Bacteria | 2242 |
| 1017 | Ga0207702_10815088 | 3300026078 | Bacteria | 923 |
| 1018 | Ga0207641_10029640 | 3300026088 | Bacteria | 4526 |
| 1019 | Ga0207641_10038081 | 3300026088 | Bacteria | 4019 |
| 1020 | Ga0207641_10048946 | 3300026088 | Bacteria | 3570 |
| 1021 | Ga0207641_10123371 | 3300026088 | Bacteria | 2315 |
| 1022 | Ga0207641_10687368 | 3300026088 | Bacteria | 1007 |
| 1023 | Ga0207641_10889449 | 3300026088 | Bacteria | 884 |
| 1024 | Ga0207641_11075031 | 3300026088 | Bacteria | 803 |
| 1025 | Ga0207641_11081626 | 3300026088 | Bacteria | 800 |
| 1026 | Ga0207648_10000190 | 3300026089 | Bacteria | 64762 |
| 1027 | Ga0207648_10010947 | 3300026089 | Bacteria | 8570 |
| 1028 | Ga0207648_10014507 | 3300026089 | Bacteria | 7276 |
| 1029 | Ga0207648_10034096 | 3300026089 | Bacteria | 4489 |
| 1030 | Ga0207648_11188066 | 3300026089 | Bacteria | 716 |
| 1031 | Ga0207648_11366950 | 3300026089 | Bacteria | 666 |
| 1032 | Ga0207676_10002345 | 3300026095 | Bacteria | 13538 |
| 1033 | Ga0207676_10011240 | 3300026095 | Bacteria | 6395 |
| 1034 | Ga0207676_10017729 | 3300026095 | Bacteria | 5165 |
| 1035 | Ga0207676_10642783 | 3300026095 | Bacteria | 1023 |
| 1036 | Ga0207676_10790672 | 3300026095 | Bacteria | 925 |
| 1037 | Ga0207676_12329353 | 3300026095 | Bacteria | 533 |
| 1038 | Ga0207674_10001162 | 3300026116 | Bacteria | 34157 |
| 1039 | Ga0207674_10074425 | 3300026116 | Bacteria | 3408 |
| 1040 | Ga0207674_10081570 | 3300026116 | Bacteria | 3236 |
| 1041 | Ga0207674_10101285 | 3300026116 | Bacteria | 2861 |
| 1042 | Ga0207674_10149626 | 3300026116 | Bacteria | 2292 |
| 1043 | Ga0207674_10153642 | 3300026116 | Bacteria | 2257 |
| 1044 | Ga0207674_10238005 | 3300026116 | Bacteria | 1767 |
| 1045 | Ga0207675_100000193 | 3300026118 | Bacteria | 55695 |
| 1046 | Ga0207675_100001572 | 3300026118 | Bacteria | 22828 |
| 1047 | Ga0207675_100002043 | 3300026118 | Bacteria | 20132 |
| 1048 | Ga0207675_100006485 | 3300026118 | Bacteria | 11070 |
| 1049 | Ga0207675_100054555 | 3300026118 | Bacteria | 3729 |
| 1050 | Ga0207675_100098217 | 3300026118 | Bacteria | 2758 |
| 1051 | Ga0207675_100100972 | 3300026118 | Bacteria | 2718 |
| 1052 | Ga0207683_10003841 | 3300026121 | Bacteria | 13024 |
| 1053 | Ga0207683_10004611 | 3300026121 | Bacteria | 11875 |
| 1054 | Ga0207683_10017484 | 3300026121 | Bacteria | 6112 |
| 1055 | Ga0207683_10025958 | 3300026121 | Bacteria | 5057 |
| 1056 | Ga0207683_10045756 | 3300026121 | Bacteria | 3827 |
| 1057 | Ga0207683_10177776 | 3300026121 | Bacteria | 1929 |
| 1058 | Ga0207683_10314920 | 3300026121 | Bacteria | 1433 |
| 1059 | Ga0207698_10007753 | 3300026142 | Bacteria | 6742 |
| 1060 | Ga0207698_10206382 | 3300026142 | Bacteria | 1764 |
| 1061 | Ga0207698_10276096 | 3300026142 | Bacteria | 1552 |
| 1062 | Ga0207698_10453067 | 3300026142 | Bacteria | 1239 |
| 1063 | Ga0207698_10651990 | 3300026142 | Bacteria | 1043 |
| 1064 | Ga0207698_11564339 | 3300026142 | Bacteria | 675 |
| 1065 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 1066 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 1067 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 1068 | Ga0209982_1031442 | 3300027552 | Bacteria | 835 |
| 1069 | Ga0209971_1176112 | 3300027682 | Bacteria | 527 |
| 1070 | Ga0209813_10003044 | 3300027866 | Bacteria | 3895 |
| 1071 | Ga0207428_10036832 | 3300027907 | Bacteria | 3985 |
| 1072 | Ga0207428_10080356 | 3300027907 | Bacteria | 2547 |
| 1073 | Ga0207428_10173906 | 3300027907 | Bacteria | 1630 |
| 1074 | Ga0207428_10269933 | 3300027907 | Bacteria | 1265 |
| 1075 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 1076 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 1077 | Ga0268266_10003780 | 3300028379 | Bacteria | 14829 |
| 1078 | Ga0268266_10004583 | 3300028379 | Bacteria | 13200 |
| 1079 | Ga0268266_10022537 | 3300028379 | Bacteria | 5366 |
| 1080 | Ga0268266_10022738 | 3300028379 | Bacteria | 5336 |
| 1081 | Ga0268266_10126557 | 3300028379 | Bacteria | 2281 |
| 1082 | Ga0268266_10346841 | 3300028379 | Bacteria | 1395 |
| 1083 | Ga0268266_10444342 | 3300028379 | Bacteria | 1232 |
| 1084 | Ga0268266_10994329 | 3300028379 | Bacteria | 812 |
| 1085 | Ga0268266_11745028 | 3300028379 | Bacteria | 597 |
| 1086 | Ga0268266_11925803 | 3300028379 | Bacteria | 565 |
| 1087 | Ga0268265_10001621 | 3300028380 | Bacteria | 18541 |
| 1088 | Ga0268265_10019604 | 3300028380 | Bacteria | 4704 |
| 1089 | Ga0268265_10283200 | 3300028380 | Bacteria | 1484 |
| 1090 | Ga0268265_10350947 | 3300028380 | Bacteria | 1347 |
| 1091 | Ga0268265_10450796 | 3300028380 | Bacteria | 1202 |
| 1092 | Ga0268264_10010890 | 3300028381 | Bacteria | 7513 |
| 1093 | Ga0268264_10023850 | 3300028381 | Bacteria | 4990 |
| 1094 | Ga0268264_10123602 | 3300028381 | Bacteria | 2284 |
| 1095 | Ga0268264_10261546 | 3300028381 | Bacteria | 1612 |
| 1096 | Ga0268264_10319732 | 3300028381 | Bacteria | 1467 |
| 1097 | Ga0268264_10860190 | 3300028381 | Bacteria | 908 |
| 1098 | Ga0268264_11698531 | 3300028381 | Bacteria | 642 |
| 1099 | Ga0265337_1021972 | 3300028556 | Bacteria | 1982 |
| 1100 | Ga0265326_10031486 | 3300028558 | Bacteria | 1511 |
| 1101 | Ga0265319_1009046 | 3300028563 | Bacteria | 4293 |
| 1102 | Ga0265334_10011784 | 3300028573 | Bacteria | 3674 |
| 1103 | Ga0265323_10058859 | 3300028653 | Bacteria | 1341 |
| 1104 | Ga0265336_10005535 | 3300028666 | Bacteria | 4652 |
| 1105 | Ga0307517_10046637 | 3300028786 | Bacteria | 4514 |
| 1106 | Ga0307515_10156191 | 3300028794 | Bacteria | 2353 |
| 1107 | Ga0265338_10005770 | 3300028800 | Bacteria | 16007 |
| 1108 | Ga0265338_10031153 | 3300028800 | Bacteria | 5232 |
| 1109 | Ga0265338_10144576 | 3300028800 | Bacteria | 1857 |
| 1110 | Ga0265338_10385694 | 3300028800 | Bacteria | 1001 |
| 1111 | Ga0265338_10452043 | 3300028800 | Bacteria | 909 |
| 1112 | Ga0265324_10013743 | 3300029957 | Bacteria | 3012 |
| 1113 | Ga0265330_10013773 | 3300031235 | Bacteria | 3762 |
| 1114 | Ga0265330_10059727 | 3300031235 | Bacteria | 1660 |
| 1115 | Ga0265330_10073819 | 3300031235 | Bacteria | 1474 |
| 1116 | Ga0265330_10114893 | 3300031235 | Bacteria | 1148 |
| 1117 | Ga0265332_10021862 | 3300031238 | Bacteria | 2825 |
| 1118 | Ga0265332_10072533 | 3300031238 | Bacteria | 1466 |
| 1119 | Ga0265328_10036684 | 3300031239 | Bacteria | 1811 |
| 1120 | Ga0265320_10136680 | 3300031240 | Bacteria | 1111 |
| 1121 | Ga0265320_10145760 | 3300031240 | Bacteria | 1070 |
| 1122 | Ga0265320_10174743 | 3300031240 | Bacteria | 964 |
| 1123 | Ga0265325_10033483 | 3300031241 | Bacteria | 2739 |
| 1124 | Ga0265325_10093236 | 3300031241 | Bacteria | 1482 |
| 1125 | Ga0265339_10012788 | 3300031249 | Bacteria | 5103 |
| 1126 | Ga0265339_10170063 | 3300031249 | Bacteria | 1091 |
| 1127 | Ga0265331_10000129 | 3300031250 | Bacteria | 99170 |
| 1128 | Ga0265331_10018059 | 3300031250 | Bacteria | 3665 |
| 1129 | Ga0265331_10034446 | 3300031250 | Bacteria | 2498 |
| 1130 | Ga0265331_10042061 | 3300031250 | Bacteria | 2218 |
| 1131 | Ga0265327_10000044 | 3300031251 | Bacteria | 284808 |
| 1132 | Ga0265327_10278231 | 3300031251 | Bacteria | 740 |
| 1133 | Ga0265316_10006416 | 3300031344 | Bacteria | 11236 |
| 1134 | Ga0265316_10023501 | 3300031344 | Bacteria | 5176 |
| 1135 | Ga0265316_10059600 | 3300031344 | Bacteria | 2968 |
| 1136 | Ga0265316_10588686 | 3300031344 | Bacteria | 790 |
| 1137 | Ga0307513_10014455 | 3300031456 | Bacteria | 9631 |
| 1138 | Ga0307509_10000025 | 3300031507 | Bacteria | 235550 |
| 1139 | Ga0307509_10626380 | 3300031507 | Bacteria | 746 |
| 1140 | Ga0307408_100000325 | 3300031548 | Bacteria | 45762 |
| 1141 | Ga0307408_100486732 | 3300031548 | Bacteria | 1077 |
| 1142 | Ga0307408_100861379 | 3300031548 | Bacteria | 827 |
| 1143 | Ga0265313_10002621 | 3300031595 | Bacteria | 15299 |
| 1144 | Ga0265313_10076839 | 3300031595 | Bacteria | 1525 |
| 1145 | Ga0265313_10122971 | 3300031595 | Bacteria | 1130 |
| 1146 | Ga0265313_10130373 | 3300031595 | Bacteria | 1090 |
| 1147 | Ga0265313_10219654 | 3300031595 | Bacteria | 784 |
| 1148 | Ga0265313_10380869 | 3300031595 | Bacteria | 555 |
| 1149 | Ga0307508_10787789 | 3300031616 | Bacteria | 567 |
| 1150 | Ga0265314_10013382 | 3300031711 | Bacteria | 6629 |
| 1151 | Ga0265314_10017718 | 3300031711 | Bacteria | 5581 |
| 1152 | Ga0265314_10023967 | 3300031711 | Bacteria | 4638 |
| 1153 | Ga0265314_10151541 | 3300031711 | Bacteria | 1421 |
| 1154 | Ga0265314_10355323 | 3300031711 | Bacteria | 805 |
| 1155 | Ga0265314_10501382 | 3300031711 | Bacteria | 639 |
| 1156 | Ga0265342_10088063 | 3300031712 | Bacteria | 1783 |
| 1157 | Ga0307516_10650493 | 3300031730 | Bacteria | 709 |
| 1158 | Ga0307405_10380944 | 3300031731 | Bacteria | 1098 |
| 1159 | Ga0307410_11073703 | 3300031852 | Bacteria | 697 |
| 1160 | Ga0307410_11733477 | 3300031852 | Bacteria | 554 |
| 1161 | Ga0307406_11004938 | 3300031901 | Bacteria | 716 |
| 1162 | Ga0307407_10000325 | 3300031903 | Bacteria | 14209 |
| 1163 | Ga0307412_10009315 | 3300031911 | Bacteria | 5629 |
| 1164 | Ga0307416_100011206 | 3300032002 | Bacteria | 5960 |
| 1165 | Ga0307416_100470454 | 3300032002 | Bacteria | 1314 |
| 1166 | Ga0307414_10951395 | 3300032004 | Bacteria | 789 |
| 1167 | Ga0307411_10091173 | 3300032005 | Bacteria | 2128 |
| 1168 | Ga0307507_10421957 | 3300033179 | Bacteria | 749 |
| 1169 | Ga0307510_10143309 | 3300033180 | Bacteria | 2028 |
| 1170 | Ga0373958_0039048 | 3300034819 | Bacteria | 964 |
| 1171 | Ga0373926_0081791 | 3300035083 | Bacteria | 1195 |
| 1172 | Ga0373934_0006627 | 3300035086 | Bacteria | 4299 |
| 1173 | Ga0373934_0174175 | 3300035086 | Bacteria | 883 |
| 1174 | Ga0373944_0018240 | 3300035089 | Bacteria | 2002 |
| 1175 | Ga0373944_0128499 | 3300035089 | Bacteria | 879 |
| 1176 | Ga0373949_0124904 | 3300035090 | Bacteria | 726 |
| 1177 | Ga0373951_0157447 | 3300035091 | Bacteria | 641 |
| 1178 | Ga0373923_0009811 | 3300035111 | Bacteria | 3465 |
| 1179 | Ga0373923_0022007 | 3300035111 | Bacteria | 2495 |
| 1180 | Ga0373923_0246387 | 3300035111 | Bacteria | 836 |
| 1181 | Ga0373936_0004232 | 3300035113 | Bacteria | 5417 |
| 1182 | Ga0373936_0412631 | 3300035113 | Bacteria | 621 |
| 1183 | Ga0373936_0418425 | 3300035113 | Bacteria | 617 |
| 1184 | Ga0373941_0396091 | 3300035115 | Bacteria | 570 |
| 1185 | Ga0373945_0125292 | 3300035116 | Bacteria | 1024 |
| 1186 | Ga0373945_0572774 | 3300035116 | Bacteria | 508 |
| 1187 | Ga0373953_0010558 | 3300035117 | Bacteria | 3219 |
| 1188 | Ga0373954_0000055 | 3300035118 | Bacteria | 40229 |
| 1189 | Ga0373954_0000204 | 3300035118 | Bacteria | 21671 |
| 1190 | Ga0373954_0114438 | 3300035118 | Bacteria | 1306 |
| 1191 | Ga0373954_0232098 | 3300035118 | Bacteria | 908 |
| 1192 | Ga0373954_0456051 | 3300035118 | Bacteria | 633 |
| 1193 | Ga0373956_0002438 | 3300035119 | Bacteria | 7572 |
| 1194 | Ga0373956_0067902 | 3300035119 | Bacteria | 1623 |
| 1195 | Ga0373956_0437689 | 3300035119 | Bacteria | 624 |
| 1196 | Ga0373957_0035065 | 3300035120 | Bacteria | 1862 |
| 1197 | Ga0373943_0056140 | 3300035170 | Bacteria | 1953 |
| 1198 | Ga0373946_0001237 | 3300035171 | Bacteria | 8834 |
| 1199 | Ga0373946_0332051 | 3300035171 | Bacteria | 757 |
| 1200 | Ga0373955_0157064 | 3300035172 | Bacteria | 1340 |
| 1201 | Ga0373955_0194885 | 3300035172 | Bacteria | 1205 |
| 1202 | Ga0373955_0525412 | 3300035172 | Bacteria | 723 |
| 1203 | Ga0373955_0633595 | 3300035172 | Bacteria | 655 |
| 1204 | Ga0373955_0861737 | 3300035172 | Bacteria | 557 |
| 1205 | Ga0373955_0928148 | 3300035172 | Bacteria | 536 |
| 1206 | Ga0373961_0422914 | 3300035241 | Bacteria | 515 |
| 1207 | Ga0373962_0169095 | 3300035242 | Bacteria | 725 |
| 1208 | Ga0373924_0056499 | 3300035410 | Bacteria | 1635 |
| 1209 | Ga0373924_0187126 | 3300035410 | Bacteria | 912 |
| 1210 | Ga0373924_0227632 | 3300035410 | Bacteria | 824 |
| 1211 | Ga0373924_0308467 | 3300035410 | Bacteria | 703 |
| 1212 | Ga0373935_0071437 | 3300035692 | Bacteria | 2239 |
| 1213 | Ga0373935_0281370 | 3300035692 | Bacteria | 1171 |
| 1214 | Ga0373935_0413529 | 3300035692 | Bacteria | 970 |
| 1215 | Ga0373935_0518172 | 3300035692 | Bacteria | 867 |
| 1216 | Ga0373935_0548784 | 3300035692 | Bacteria | 842 |
| 1217 | Ga0373935_0899293 | 3300035692 | Bacteria | 656 |
| 1218 | Ga0373927_0025774 | 3300035695 | Bacteria | 3844 |
| 1219 | Ga0373927_0134686 | 3300035695 | Bacteria | 1614 |
| 1220 | Ga0373933_0000217 | 3300035724 | Bacteria | 37933 |
| 1221 | Ga0373933_0151831 | 3300035724 | Bacteria | 1467 |
| 1222 | Ga0373933_0182599 | 3300035724 | Bacteria | 1338 |
| 1223 | Ga0373933_0349704 | 3300035724 | Bacteria | 960 |
| 1224 | Ga0373933_1162530 | 3300035724 | Bacteria | 509 |
| 1225 | Ga0373947_0015951 | 3300035725 | Bacteria | 4315 |
| 1226 | Ga0373947_0080598 | 3300035725 | Bacteria | 2014 |
| 1227 | Ga0373947_0659745 | 3300035725 | Bacteria | 713 |
| 1228 | Ga0373937_0003434 | 3300036401 | Bacteria | 13300 |
| 1229 | Ga0373937_0009154 | 3300036401 | Bacteria | 8593 |
| 1230 | Ga0373937_0095899 | 3300036401 | Bacteria | 2750 |
| 1231 | Ga0373937_0288016 | 3300036401 | Bacteria | 1551 |
| 1232 | Ga0373937_0618780 | 3300036401 | Bacteria | 1028 |
| 1233 | Ga0373937_0680509 | 3300036401 | Bacteria | 975 |
| 1234 | Ga0373937_0787972 | 3300036401 | Bacteria | 898 |
| 1235 | Ga0373937_1481279 | 3300036401 | Bacteria | 626 |
| 1236 | Ga0373937_1789741 | 3300036401 | Bacteria | 561 |
| 1237 | Ga0373925_0007673 | 3300037068 | Bacteria | 7860 |
| 1238 | Ga0373925_0036931 | 3300037068 | Bacteria | 3605 |
| 1239 | Ga0373925_0075599 | 3300037068 | Bacteria | 2553 |
| 1240 | Ga0373925_0296554 | 3300037068 | Bacteria | 1305 |
| 1241 | Ga0373925_1092558 | 3300037068 | Bacteria | 656 |
| 1242 | Ga0395899_0015298 | 3300037312 | Bacteria | 5846 |
| 1243 | Ga0395899_0090344 | 3300037312 | Bacteria | 2220 |
| 1244 | Ga0395900_0029997 | 3300037418 | Bacteria | 5581 |
| 1245 | Ga0395900_0048114 | 3300037418 | Bacteria | 4392 |
| 1246 | Ga0395898_0005504 | 3300037466 | Bacteria | 13670 |
| 1247 | Ga0395898_0006215 | 3300037466 | Bacteria | 12792 |
| 1248 | Ga0395898_0649666 | 3300037466 | Bacteria | 997 |
| 1249 | Ga0395898_1891221 | 3300037466 | Bacteria | 517 |
| 1250 | Ga0395905_0088419 | 3300037471 | Bacteria | 2904 |
| 1251 | Ga0395905_0502047 | 3300037471 | Bacteria | 1113 |
| 1252 | Ga0395905_1290683 | 3300037471 | Bacteria | 634 |
| 1253 | Ga0395905_1316408 | 3300037471 | Bacteria | 626 |
| 1254 | Ga0436364_0188528 | 3300037853 | Bacteria | 2336 |
| 1255 | Ga0436364_0261445 | 3300037853 | Bacteria | 4008 |
| 1256 | Ga0436364_0424388 | 3300037853 | Bacteria | 1015 |
| 1257 | Ga0436364_0621490 | 3300037853 | Bacteria | 925 |
| 1258 | Ga0436364_0638380 | 3300037853 | Bacteria | 580 |
| 1259 | Ga0436364_1323035 | 3300037853 | Bacteria | 1529 |
| 1260 | Ga0395901_0043606 | 3300038443 | Bacteria | 4652 |
| 1261 | Ga0237816_00864 | 3300039145 | Bacteria | 2500 |
| 1262 | Ga0436365_0237040 | 3300039437 | Bacteria | 1230 |
| 1263 | Ga0436365_0347707 | 3300039437 | Bacteria | 2932 |
| 1264 | Ga0436365_0388218 | 3300039437 | Bacteria | 786 |
| 1265 | Ga0436365_0431361 | 3300039437 | Bacteria | 4618 |
| 1266 | Ga0436365_0545909 | 3300039437 | Bacteria | 3121 |
| 1267 | Ga0436365_0655612 | 3300039437 | Bacteria | 940 |
| 1268 | Ga0436365_1018828 | 3300039437 | Bacteria | 518 |
| 1269 | Ga0436365_1496770 | 3300039437 | Bacteria | 634 |
| 1270 | Ga0436360_0028296 | 3300039438 | Bacteria | 1047 |
| 1271 | Ga0436360_0042439 | 3300039438 | Bacteria | 4673 |
| 1272 | Ga0436360_0198558 | 3300039438 | Bacteria | 1500 |
| 1273 | Ga0436360_0318083 | 3300039438 | Bacteria | 668 |
| 1274 | Ga0436360_0420362 | 3300039438 | Bacteria | 550 |
| 1275 | Ga0436360_0460365 | 3300039438 | Bacteria | 649 |
| 1276 | Ga0436360_0693855 | 3300039438 | Bacteria | 590 |
| 1277 | Ga0436360_0775635 | 3300039438 | Bacteria | 3558 |
| 1278 | Ga0436361_0080522 | 3300039447 | Bacteria | 581 |
| 1279 | Ga0436361_0147964 | 3300039447 | Bacteria | 6359 |
| 1280 | Ga0436361_0249946 | 3300039447 | Bacteria | 698 |
| 1281 | Ga0436361_0298431 | 3300039447 | Bacteria | 7234 |
| 1282 | Ga0436361_0324977 | 3300039447 | Bacteria | 1806 |
| 1283 | Ga0436361_0574324 | 3300039447 | Bacteria | 669 |
| 1284 | Ga0436361_0582807 | 3300039447 | Bacteria | 681 |
| 1285 | Ga0436361_0688104 | 3300039447 | Bacteria | 58309 |
| 1286 | Ga0436361_0786290 | 3300039447 | Bacteria | 964 |
| 1287 | Ga0436361_0804603 | 3300039447 | Bacteria | 7354 |
| 1288 | Ga0436361_0925853 | 3300039447 | Bacteria | 1106 |
| 1289 | Ga0436361_1066058 | 3300039447 | Bacteria | 1081 |
| 1290 | Ga0436361_1073388 | 3300039447 | Bacteria | 1387 |
| 1291 | Ga0436363_0134352 | 3300039450 | Bacteria | 728 |
| 1292 | Ga0436363_0435549 | 3300039450 | Bacteria | 1180 |
| 1293 | Ga0436363_0534225 | 3300039450 | Bacteria | 609 |
| 1294 | Ga0436363_0924720 | 3300039450 | Bacteria | 557 |
| 1295 | Ga0436363_0952708 | 3300039450 | Bacteria | 1131 |
| 1296 | Ga0436363_1610909 | 3300039450 | Bacteria | 707 |
| 1297 | Ga0436362_0101641 | 3300039453 | Bacteria | 846 |
| 1298 | Ga0436362_0370145 | 3300039453 | Bacteria | 653 |
| 1299 | Ga0436362_0546087 | 3300039453 | Bacteria | 833 |
| 1300 | Ga0436362_0765821 | 3300039453 | Bacteria | 2223 |
| 1301 | Ga0436362_1083820 | 3300039453 | Bacteria | 1523 |
| 1302 | Ga0436362_1292496 | 3300039453 | Bacteria | 579 |
| 1303 | Ga0451789_1364666 | 3300041443 | Bacteria | 1200 |
| 1304 | Ga0451793_0876891 | 3300041452 | Bacteria | 661 |
| 1305 | Ga0451835_1133788 | 3300041492 | Bacteria | 759 |
| 1306 | Ga0451839_0325131 | 3300041496 | Bacteria | 1117 |
| 1307 | Ga0451839_0824064 | 3300041496 | Bacteria | 501 |
| 1308 | Ga0451839_1545218 | 3300041496 | Bacteria | 828 |
| 1309 | Ga0451845_0986483 | 3300041501 | Bacteria | 789 |
| 1310 | Ga0451843_1621180 | 3300041509 | Bacteria | 565 |
| 1311 | Ga0451853_2008343 | 3300041512 | Bacteria | 2257 |
| 1312 | Ga0451853_3762953 | 3300041512 | Bacteria | 525 |
| 1313 | Ga0439431_0199129 | 3300041997 | Bacteria | 583 |
| 1314 | Ga0439448_0037453 | 3300042005 | Bacteria | 1558 |
| 1315 | Ga0451577_1821555 | 3300042876 | Bacteria | 534 |
| 1316 | Ga0466969_0036637 | 3300044656 | Bacteria | 2477 |
| 1317 | Ga0466969_0040570 | 3300044656 | Bacteria | 2332 |
| 1318 | Ga0466969_0150888 | 3300044656 | Bacteria | 1071 |
| 1319 | Ga0466969_0291872 | 3300044656 | Bacteria | 738 |
| 1320 | Ga0466972_0001620 | 3300044658 | Bacteria | 10989 |
| 1321 | Ga0466972_0158522 | 3300044658 | Bacteria | 1063 |
| 1322 | Ga0466972_0335588 | 3300044658 | Bacteria | 707 |
| 1323 | Ga0466965_0280543 | 3300044683 | Bacteria | 900 |
| 1324 | Ga0466966_0000632 | 3300044684 | Bacteria | 22387 |
| 1325 | Ga0466966_0023836 | 3300044684 | Bacteria | 4005 |
| 1326 | Ga0466966_0027141 | 3300044684 | Bacteria | 3734 |
| 1327 | Ga0466961_0000897 | 3300044693 | Bacteria | 18504 |
| 1328 | Ga0466961_0001874 | 3300044693 | Bacteria | 13062 |
| 1329 | Ga0466961_0059644 | 3300044693 | Bacteria | 2426 |
| 1330 | Ga0466963_0120269 | 3300044694 | Bacteria | 1807 |
| 1331 | Ga0466963_0604047 | 3300044694 | Bacteria | 775 |
| 1332 | Ga0466963_1296588 | 3300044694 | Bacteria | 511 |
| 1333 | Ga0466964_0229245 | 3300044706 | Bacteria | 906 |
| 1334 | Ga0453684_0000497 | 3300044712 | Bacteria | 153728 |
| 1335 | Ga0466970_0059567 | 3300044765 | Bacteria | 2045 |
| 1336 | Ga0466970_0155617 | 3300044765 | Bacteria | 1263 |
| 1337 | Ga0466957_1379520 | 3300044842 | Bacteria | 513 |
| 1338 | Ga0466960_0817079 | 3300044901 | Bacteria | 565 |
| 1339 | Ga0466959_0004435 | 3300045049 | Bacteria | 9399 |
| 1340 | Ga0466959_0026954 | 3300045049 | Bacteria | 4262 |
| 1341 | Ga0466959_0149736 | 3300045049 | Bacteria | 1645 |
| 1342 | Ga0466959_1194577 | 3300045049 | Bacteria | 505 |
| 1343 | Ga0451576_0027185 | 3300045051 | Bacteria | 6146 |
| 1344 | Ga0451576_0921795 | 3300045051 | Bacteria | 916 |
| 1345 | Ga0451576_2124564 | 3300045051 | Unclassified | 577 |
| 1346 | Ga0466958_0611734 | 3300045836 | Bacteria | 709 |
| 1347 | Ga0466967_0033635 | 3300045976 | Bacteria | 4342 |
| 1348 | Ga0466967_0047012 | 3300045976 | Bacteria | 3760 |
| 1349 | Ga0466967_0095059 | 3300045976 | Bacteria | 2715 |
| 1350 | Ga0466967_0159258 | 3300045976 | Bacteria | 2118 |
| 1351 | Ga0495592_0566701 | 3300046454 | Bacteria | 696 |
| 1352 | Ga0495603_0193078 | 3300046455 | Bacteria | 1177 |
| 1353 | Ga0495629_0000008 | 3300046459 | Bacteria | 352138 |
| 1354 | Ga0495629_0048582 | 3300046459 | Bacteria | 2974 |
| 1355 | Ga0495629_0354921 | 3300046459 | Bacteria | 1000 |
| 1356 | Ga0495638_0252630 | 3300046460 | Bacteria | 971 |
| 1357 | Ga0495651_0038941 | 3300046462 | Bacteria | 3701 |
| 1358 | Ga0495653_0029611 | 3300046463 | Bacteria | 4368 |
| 1359 | Ga0495580_0184281 | 3300046472 | Bacteria | 1441 |
| 1360 | Ga0495582_0000674 | 3300046473 | Bacteria | 18786 |
| 1361 | Ga0495605_0201876 | 3300046474 | Bacteria | 866 |
| 1362 | Ga0495639_0000567 | 3300046475 | Bacteria | 17207 |
| 1363 | Ga0495639_0634673 | 3300046475 | Bacteria | 550 |
| 1364 | Ga0495662_0024433 | 3300046476 | Bacteria | 2916 |
| 1365 | Ga0495662_0255794 | 3300046476 | Bacteria | 862 |
| 1366 | Ga0495662_0261575 | 3300046476 | Bacteria | 852 |
| 1367 | Ga0495664_0506451 | 3300046477 | Bacteria | 721 |
| 1368 | Ga0495584_0637620 | 3300046491 | Bacteria | 543 |
| 1369 | Ga0495594_0134913 | 3300046499 | Bacteria | 1399 |
| 1370 | Ga0495608_0190739 | 3300046511 | Bacteria | 1294 |
| 1371 | Ga0495616_0031832 | 3300046513 | Bacteria | 2759 |
| 1372 | Ga0495628_0554772 | 3300046516 | Bacteria | 824 |
| 1373 | Ga0495628_0857846 | 3300046516 | Bacteria | 632 |
| 1374 | Ga0495628_1248318 | 3300046516 | Bacteria | 503 |
| 1375 | Ga0495630_0040767 | 3300046517 | Bacteria | 3470 |
| 1376 | Ga0495630_0296071 | 3300046517 | Bacteria | 1236 |
| 1377 | Ga0495630_0508701 | 3300046517 | Bacteria | 923 |
| 1378 | Ga0495643_0012071 | 3300046522 | Bacteria | 5225 |
| 1379 | Ga0495666_0000101 | 3300046526 | Bacteria | 34931 |
| 1380 | Ga0495642_0001940 | 3300046528 | Bacteria | 8745 |
| 1381 | Ga0495642_0263292 | 3300046528 | Bacteria | 754 |
| 1382 | Ga0495665_0000193 | 3300046531 | Bacteria | 31390 |
| 1383 | Ga0495640_0931474 | 3300046533 | Bacteria | 514 |
| 1384 | Ga0495586_0000818 | 3300046535 | Bacteria | 17884 |
| 1385 | Ga0495586_0162681 | 3300046535 | Bacteria | 1259 |
| 1386 | Ga0495586_0269614 | 3300046535 | Bacteria | 973 |
| 1387 | Ga0495586_0304802 | 3300046535 | Bacteria | 913 |
| 1388 | Ga0495598_0085544 | 3300046537 | Bacteria | 1019 |
| 1389 | Ga0495621_0267471 | 3300046539 | Bacteria | 702 |
| 1390 | Ga0495597_0044566 | 3300046542 | Bacteria | 1972 |
| 1391 | Ga0495667_0363901 | 3300046559 | Bacteria | 913 |
| 1392 | Ga0495656_0309272 | 3300046615 | Bacteria | 811 |
| 1393 | Ga0495668_0294683 | 3300046616 | Unclassified | 889 |
| 1394 | Ga0495668_0412140 | 3300046616 | Bacteria | 743 |
| 1395 | Ga0495634_0518424 | 3300046642 | Bacteria | 697 |
| 1396 | Ga0495625_0055245 | 3300046660 | Bacteria | 2832 |
| 1397 | Ga0495625_0091652 | 3300046660 | Bacteria | 2101 |
| 1398 | Ga0495635_0001435 | 3300046663 | Bacteria | 15925 |
| 1399 | Ga0495588_0493207 | 3300046674 | Bacteria | 642 |
| 1400 | Ga0495657_0413528 | 3300046675 | Bacteria | 792 |
| 1401 | Ga0495599_0608623 | 3300046678 | Unclassified | 636 |
| 1402 | Ga0495647_0000581 | 3300046681 | Bacteria | 10819 |
| 1403 | Ga0495658_0022836 | 3300046683 | Bacteria | 3313 |
| 1404 | Ga0495658_0049229 | 3300046683 | Bacteria | 2379 |
| 1405 | Ga0495669_0260034 | 3300046684 | Bacteria | 834 |
| 1406 | Ga0495613_0001075 | 3300046689 | Bacteria | 20823 |
| 1407 | Ga0495670_0525135 | 3300046691 | Bacteria | 643 |
| 1408 | Ga0495671_0233660 | 3300046692 | Bacteria | 889 |
| 1409 | Ga0495649_0291043 | 3300046694 | Bacteria | 833 |
| 1410 | Ga0495600_0003122 | 3300046809 | Bacteria | 9703 |
| 1411 | Ga0495581_0000277 | 3300047315 | Bacteria | 24872 |
| 1412 | Ga0495581_0024157 | 3300047315 | Bacteria | 3522 |
| 1413 | Ga0495636_0531685 | 3300047318 | Bacteria | 571 |
| 1414 | Ga0495676_0010268 | 3300047321 | Bacteria | 8497 |
| 1415 | Ga0495680_0060910 | 3300047322 | Bacteria | 2906 |
| 1416 | Ga0495680_0071991 | 3300047322 | Unclassified | 2630 |
| 1417 | Ga0495680_0351283 | 3300047322 | Bacteria | 1026 |
| 1418 | Ga0495683_0070881 | 3300047323 | Bacteria | 1711 |
| 1419 | Ga0495687_009164 | 3300047443 | Bacteria | 5568 |
| 1420 | Ga0495675_0854754 | 3300047444 | Bacteria | 501 |
| 1421 | Ga0495684_0001806 | 3300047471 | Bacteria | 17187 |
| 1422 | Ga0495684_0806778 | 3300047471 | Bacteria | 613 |
| 1423 | Ga0495686_0399255 | 3300047472 | Bacteria | 738 |
| 1424 | Ga0495614_0589883 | 3300048089 | Bacteria | 533 |
| 1425 | Ga0495626_0034476 | 3300048091 | Bacteria | 2421 |
| 1426 | Ga0496100_0334006 | 3300048903 | Bacteria | 1141 |
| 1427 | Ga0496100_0658885 | 3300048903 | Bacteria | 815 |
| 1428 | Ga0496101_0488016 | 3300048904 | Bacteria | 973 |
| 1429 | Ga0496101_0658182 | 3300048904 | Bacteria | 827 |
| 1430 | Ga0496102_0008058 | 3300048905 | Bacteria | 9012 |
| 1431 | Ga0496102_0021064 | 3300048905 | Bacteria | 5766 |
| 1432 | Ga0496102_0063640 | 3300048905 | Bacteria | 3378 |
| 1433 | Ga0496102_0064831 | 3300048905 | Bacteria | 3347 |
| 1434 | Ga0496102_0235871 | 3300048905 | Bacteria | 1725 |
| 1435 | Ga0496102_1211100 | 3300048905 | Bacteria | 675 |
| 1436 | Ga0496103_0002880 | 3300048906 | Bacteria | 10677 |
| 1437 | Ga0496103_0225619 | 3300048906 | Bacteria | 1205 |
| 1438 | Ga0496104_0000012 | 3300048907 | Bacteria | 438011 |
| 1439 | Ga0496104_0194686 | 3300048907 | Bacteria | 1939 |
| 1440 | Ga0496104_1801100 | 3300048907 | Bacteria | 514 |
| 1441 | Ga0496105_0000011 | 3300048908 | Bacteria | 302186 |
| 1442 | Ga0496105_0101553 | 3300048908 | Bacteria | 2375 |
| 1443 | Ga0496105_0933591 | 3300048908 | Bacteria | 652 |
| 1444 | Ga0496106_0078500 | 3300048909 | Bacteria | 2533 |
| 1445 | Ga0496106_0266847 | 3300048909 | Bacteria | 1370 |
| 1446 | Ga0496107_0524596 | 3300048910 | Bacteria | 878 |
| 1447 | Ga0496108_0071447 | 3300048911 | Bacteria | 2928 |
| 1448 | Ga0496109_0135553 | 3300048912 | Bacteria | 2300 |
| 1449 | Ga0496109_0195265 | 3300048912 | Bacteria | 1902 |
| 1450 | Ga0496109_0587405 | 3300048912 | Bacteria | 1050 |
| 1451 | Ga0496110_0088410 | 3300048913 | Bacteria | 2767 |
| 1452 | Ga0496110_0264036 | 3300048913 | Bacteria | 1567 |
| 1453 | Ga0496112_0013319 | 3300048915 | Bacteria | 7591 |
| 1454 | Ga0496112_0073457 | 3300048915 | Bacteria | 3381 |
| 1455 | Ga0496112_0158196 | 3300048915 | Bacteria | 2232 |
| 1456 | Ga0496112_0227710 | 3300048915 | Bacteria | 1819 |
| 1457 | Ga0496112_1794814 | 3300048915 | Bacteria | 525 |
| 1458 | Ga0496113_0210514 | 3300048916 | Bacteria | 1548 |
| 1459 | Ga0496113_0261612 | 3300048916 | Bacteria | 1382 |
| 1460 | Ga0496113_1029913 | 3300048916 | Bacteria | 647 |
| 1461 | Ga0496114_0196049 | 3300048917 | Bacteria | 1768 |
| 1462 | Ga0496114_0577640 | 3300048917 | Bacteria | 992 |
| 1463 | Ga0496115_0059226 | 3300048918 | Unclassified | 3084 |
| 1464 | Ga0496115_0371736 | 3300048918 | Bacteria | 1164 |
| 1465 | Ga0496115_0484488 | 3300048918 | Bacteria | 996 |
| 1466 | Ga0496117_0028747 | 3300048920 | Bacteria | 4300 |
| 1467 | Ga0496117_0045774 | 3300048920 | Bacteria | 3155 |
| 1468 | Ga0496118_0000880 | 3300048921 | Bacteria | 47321 |
| 1469 | Ga0496118_0004511 | 3300048921 | Bacteria | 16463 |
| 1470 | Ga0496118_0081937 | 3300048921 | Bacteria | 2263 |
| 1471 | Ga0496118_0085703 | 3300048921 | Bacteria | 2192 |
| 1472 | Ga0496118_0509970 | 3300048921 | Bacteria | 596 |
| 1473 | Ga0496119_0081422 | 3300048922 | Bacteria | 1865 |
| 1474 | Ga0496120_0257534 | 3300048923 | Bacteria | 816 |
| 1475 | Ga0496121_0076712 | 3300048924 | Bacteria | 2664 |
| 1476 | Ga0496121_0153477 | 3300048924 | Bacteria | 1692 |
| 1477 | Ga0496122_0000362 | 3300048925 | Bacteria | 97690 |
| 1478 | Ga0496122_0148530 | 3300048925 | Bacteria | 1452 |
| 1479 | Ga0496123_0007188 | 3300048926 | Bacteria | 10564 |
| 1480 | Ga0496124_0358717 | 3300048927 | Bacteria | 1028 |
| 1481 | Ga0496125_0185509 | 3300048928 | Bacteria | 1380 |
| 1482 | Ga0496125_0481905 | 3300048928 | Bacteria | 703 |
| 1483 | Ga0496125_0611136 | 3300048928 | Bacteria | 593 |
| 1484 | Ga0496126_0000925 | 3300048929 | Bacteria | 50764 |
| 1485 | Ga0496126_0002985 | 3300048929 | Bacteria | 21973 |
| 1486 | Ga0496126_0009713 | 3300048929 | Bacteria | 10192 |
| 1487 | Ga0496126_0298061 | 3300048929 | Bacteria | 1331 |
| 1488 | Ga0496126_0526082 | 3300048929 | Bacteria | 942 |
| 1489 | Ga0495682_0174201 | 3300049460 | Bacteria | 765 |
| 1490 | Ga0495682_0290169 | 3300049460 | Bacteria | 577 |
| 1491 | Ga0501299_006306 | 3300049522 | Bacteria | 1858 |
| 1492 | Ga0501300_011635 | 3300049523 | Bacteria | 1281 |
| 1493 | Ga0501031_0405268 | 3300049568 | Bacteria | 882 |
| 1494 | Ga0501032_0044990 | 3300049569 | Bacteria | 2987 |
| 1495 | Ga0501032_0625142 | 3300049569 | Bacteria | 684 |
| 1496 | Ga0501032_1080156 | 3300049569 | Bacteria | 503 |
| 1497 | Ga0501033_0074978 | 3300049570 | Bacteria | 2483 |
| 1498 | Ga0501033_0142321 | 3300049570 | Bacteria | 1733 |
| 1499 | Ga0501033_0662937 | 3300049570 | Bacteria | 712 |
| 1500 | Ga0501034_0015756 | 3300049571 | Bacteria | 7763 |
| 1501 | Ga0501034_0041700 | 3300049571 | Bacteria | 4644 |
| 1502 | Ga0501034_0090398 | 3300049571 | Bacteria | 3059 |
| 1503 | Ga0501034_0234996 | 3300049571 | Bacteria | 1781 |
| 1504 | Ga0501034_0335870 | 3300049571 | Bacteria | 1442 |
| 1505 | Ga0501034_0336393 | 3300049571 | Bacteria | 1440 |
| 1506 | Ga0501034_0874136 | 3300049571 | Bacteria | 788 |
| 1507 | Ga0501036_0228874 | 3300049572 | Bacteria | 1560 |
| 1508 | Ga0501036_1065820 | 3300049572 | Bacteria | 661 |
| 1509 | Ga0501037_0056565 | 3300049573 | Bacteria | 2864 |
| 1510 | Ga0501037_0209196 | 3300049573 | Bacteria | 1376 |
| 1511 | Ga0501037_0345967 | 3300049573 | Bacteria | 1026 |
| 1512 | Ga0501037_0466685 | 3300049573 | Bacteria | 860 |
| 1513 | Ga0501037_0802820 | 3300049573 | Bacteria | 621 |
| 1514 | Ga0501038_0008950 | 3300049574 | Bacteria | 9184 |
| 1515 | Ga0501038_0109654 | 3300049574 | Bacteria | 2287 |
| 1516 | Ga0501038_0483790 | 3300049574 | Bacteria | 948 |
| 1517 | Ga0501038_1123182 | 3300049574 | Bacteria | 573 |
| 1518 | Ga0501038_1243395 | 3300049574 | Bacteria | 539 |
| 1519 | Ga0501039_0038123 | 3300049575 | Bacteria | 3713 |
| 1520 | Ga0501039_0332661 | 3300049575 | Bacteria | 1194 |
| 1521 | Ga0501042_0341385 | 3300049578 | Bacteria | 1083 |
| 1522 | Ga0501043_0052365 | 3300049579 | Bacteria | 3206 |
| 1523 | Ga0501043_0541773 | 3300049579 | Bacteria | 865 |
| 1524 | Ga0501046_0056432 | 3300049580 | Bacteria | 3083 |
| 1525 | Ga0501046_1105322 | 3300049580 | Bacteria | 547 |
| 1526 | Ga0501046_1254847 | 3300049580 | Bacteria | 507 |
| 1527 | Ga0501047_0009209 | 3300049581 | Bacteria | 9320 |
| 1528 | Ga0501047_0020525 | 3300049581 | Bacteria | 6343 |
| 1529 | Ga0501047_0026810 | 3300049581 | Bacteria | 5546 |
| 1530 | Ga0501047_0044380 | 3300049581 | Bacteria | 4295 |
| 1531 | Ga0501047_0122539 | 3300049581 | Bacteria | 2481 |
| 1532 | Ga0501047_0167009 | 3300049581 | Bacteria | 2071 |
| 1533 | Ga0501047_0239052 | 3300049581 | Bacteria | 1667 |
| 1534 | Ga0501047_0406381 | 3300049581 | Bacteria | 1194 |
| 1535 | Ga0501047_0679303 | 3300049581 | Bacteria | 848 |
| 1536 | Ga0501047_0980542 | 3300049581 | Bacteria | 658 |
| 1537 | Ga0501047_1414123 | 3300049581 | Bacteria | 511 |
| 1538 | Ga0501048_0705526 | 3300049582 | Bacteria | 724 |
| 1539 | Ga0501067_0014186 | 3300049583 | Bacteria | 4413 |
| 1540 | Ga0501067_0136292 | 3300049583 | Bacteria | 1367 |
| 1541 | Ga0501068_0130993 | 3300049584 | Bacteria | 1568 |
| 1542 | Ga0501068_0386010 | 3300049584 | Bacteria | 902 |
| 1543 | Ga0501069_0042044 | 3300049585 | Bacteria | 2527 |
| 1544 | Ga0501069_0229257 | 3300049585 | Bacteria | 1081 |
| 1545 | Ga0501070_0008723 | 3300049586 | Bacteria | 8571 |
| 1546 | Ga0501070_0010789 | 3300049586 | Bacteria | 7719 |
| 1547 | Ga0501070_0028488 | 3300049586 | Bacteria | 4685 |
| 1548 | Ga0501070_0029122 | 3300049586 | Bacteria | 4631 |
| 1549 | Ga0501070_0118340 | 3300049586 | Bacteria | 2189 |
| 1550 | Ga0501070_0134361 | 3300049586 | Bacteria | 2043 |
| 1551 | Ga0501070_0152012 | 3300049586 | Bacteria | 1910 |
| 1552 | Ga0501070_0247021 | 3300049586 | Bacteria | 1460 |
| 1553 | Ga0501070_0380264 | 3300049586 | Bacteria | 1144 |
| 1554 | Ga0501070_0663760 | 3300049586 | Bacteria | 827 |
| 1555 | Ga0501073_0005196 | 3300049589 | Bacteria | 9758 |
| 1556 | Ga0501073_0022466 | 3300049589 | Bacteria | 4542 |
| 1557 | Ga0501073_0067293 | 3300049589 | Bacteria | 2497 |
| 1558 | Ga0501074_0010940 | 3300049590 | Bacteria | 6587 |
| 1559 | Ga0501074_0073799 | 3300049590 | Bacteria | 2450 |
| 1560 | Ga0501074_1287604 | 3300049590 | Bacteria | 512 |
| 1561 | Ga0501217_018049 | 3300049661 | Bacteria | 1634 |
| 1562 | Ga0501248_012099 | 3300049678 | Bacteria | 789 |
| 1563 | Ga0501249_033212 | 3300049679 | Bacteria | 1155 |
| 1564 | Ga0501249_172287 | 3300049679 | Bacteria | 555 |
| 1565 | Ga0501259_023039 | 3300049688 | Bacteria | 1124 |
| 1566 | Ga0501261_016995 | 3300049690 | Bacteria | 1014 |
| 1567 | Ga0501225_0063523 | 3300049705 | Bacteria | 1041 |
| 1568 | Ga0501079_0109309 | 3300049741 | Bacteria | 2147 |
| 1569 | Ga0501079_0614234 | 3300049741 | Bacteria | 856 |
| 1570 | Ga0501080_0002048 | 3300049742 | Bacteria | 17455 |
| 1571 | Ga0501080_0005634 | 3300049742 | Bacteria | 11190 |
| 1572 | Ga0501080_0015097 | 3300049742 | Bacteria | 7118 |
| 1573 | Ga0501080_0043668 | 3300049742 | Bacteria | 4174 |
| 1574 | Ga0501080_0076492 | 3300049742 | Bacteria | 3113 |
| 1575 | Ga0501080_0164295 | 3300049742 | Bacteria | 2049 |
| 1576 | Ga0501080_0226481 | 3300049742 | Bacteria | 1709 |
| 1577 | Ga0501080_0375644 | 3300049742 | Bacteria | 1281 |
| 1578 | Ga0501080_0494318 | 3300049742 | Bacteria | 1094 |
| 1579 | Ga0501080_0501904 | 3300049742 | Bacteria | 1084 |
| 1580 | Ga0501083_0019324 | 3300049744 | Bacteria | 4746 |
| 1581 | Ga0501083_0019536 | 3300049744 | Bacteria | 4719 |
| 1582 | Ga0501083_0026078 | 3300049744 | Bacteria | 4043 |
| 1583 | Ga0501083_0058230 | 3300049744 | Bacteria | 2586 |
| 1584 | Ga0501035_0022635 | 3300049822 | Bacteria | 5772 |
| 1585 | Ga0501035_0056896 | 3300049822 | Bacteria | 3488 |
| 1586 | Ga0501035_0057486 | 3300049822 | Bacteria | 3468 |
| 1587 | Ga0501035_0204139 | 3300049822 | Bacteria | 1694 |
| 1588 | Ga0501035_0325568 | 3300049822 | Bacteria | 1290 |
| 1589 | Ga0501044_0005549 | 3300049823 | Bacteria | 14009 |
| 1590 | Ga0501044_0046313 | 3300049823 | Bacteria | 4503 |
| 1591 | Ga0501044_0067893 | 3300049823 | Bacteria | 3632 |
| 1592 | Ga0501044_0068723 | 3300049823 | Bacteria | 3608 |
| 1593 | Ga0501044_0074192 | 3300049823 | Bacteria | 3457 |
| 1594 | Ga0501044_0096341 | 3300049823 | Bacteria | 2980 |
| 1595 | Ga0501044_0168202 | 3300049823 | Bacteria | 2165 |
| 1596 | Ga0501044_0287009 | 3300049823 | Bacteria | 1578 |
| 1597 | Ga0501044_0381800 | 3300049823 | Bacteria | 1324 |
| 1598 | Ga0501045_0838596 | 3300049824 | Bacteria | 676 |
| 1599 | nmdc:mga03683_614804_c1 | 3300050489 | Bacteria | 533 |
| 1600 | nmdc:mga03683_71801_c1 | 3300050489 | Bacteria | 1481 |
| 1601 | nmdc:mga03n38_239585_c1 | 3300050490 | Bacteria | 954 |
| 1602 | nmdc:mga03n38_38953_c1 | 3300050490 | Bacteria | 2059 |
| 1603 | nmdc:mga03n38_625374_c1 | 3300050490 | Bacteria | 615 |
| 1604 | nmdc:mga00v17_107719_c1 | 3300050491 | Bacteria | 1765 |
| 1605 | nmdc:mga00v17_15060_c1 | 3300050491 | Bacteria | 4334 |
| 1606 | nmdc:mga0yw44_50413_c1 | 3300050492 | Bacteria | 2517 |
| 1607 | nmdc:mga0yw44_75348_c1 | 3300050492 | Bacteria | 2104 |
| 1608 | nmdc:mga0k408_178216_c1 | 3300050493 | Bacteria | 1267 |
| 1609 | nmdc:mga0k408_20469_c1 | 3300050493 | Bacteria | 3707 |
| 1610 | nmdc:mga06z11_176425_c1 | 3300050494 | Bacteria | 1230 |
| 1611 | nmdc:mga06z11_19529_c1 | 3300050494 | Bacteria | 3118 |
| 1612 | nmdc:mga04h51_182307_c1 | 3300050495 | Bacteria | 818 |
| 1613 | nmdc:mga04h51_7586_c1 | 3300050495 | Bacteria | 2870 |
| 1614 | nmdc:mga07m45_116710_c1 | 3300050496 | Bacteria | 1540 |
| 1615 | nmdc:mga07m45_33430_c1 | 3300050496 | Bacteria | 2856 |
| 1616 | nmdc:mga05p37_807525_c1 | 3300050507 | Bacteria | 1025 |
| 1617 | nmdc:mga05p37_845169_c1 | 3300050507 | Bacteria | 995 |
| 1618 | nmdc:mga05p37_909833_c1 | 3300050507 | Bacteria | 947 |
| 1619 | nmdc:mga05p37_95097_c1 | 3300050507 | Bacteria | 3671 |
| 1620 | nmdc:mga09592_312311_c1 | 3300050508 | Bacteria | 1362 |
| 1621 | nmdc:mga09592_418227_c1 | 3300050508 | Bacteria | 1158 |
| 1622 | nmdc:mga09592_625262_c1 | 3300050508 | Bacteria | 921 |
| 1623 | nmdc:mga06r32_6533_c1 | 3300050510 | Bacteria | 10475 |
| 1624 | nmdc:mga06r32_691792_c1 | 3300050510 | Bacteria | 986 |
| 1625 | nmdc:mga08y16_1360663_c1 | 3300050511 | Bacteria | 674 |
| 1626 | nmdc:mga08y16_141932_c1 | 3300050511 | Bacteria | 2497 |
| 1627 | nmdc:mga08y16_294013_c1 | 3300050511 | Bacteria | 1675 |
| 1628 | nmdc:mga08y16_57347_c1 | 3300050511 | Bacteria | 4070 |
| 1629 | nmdc:mga08y16_648382_c1 | 3300050511 | Bacteria | 1060 |
| 1630 | nmdc:mga0n895_1176277_c1 | 3300050512 | Bacteria | 742 |
| 1631 | nmdc:mga0n895_182902_c1 | 3300050512 | Bacteria | 2128 |
| 1632 | nmdc:mga0n895_27801_c1 | 3300050512 | Bacteria | 5376 |
| 1633 | nmdc:mga0n895_5651_c1 | 3300050512 | Bacteria | 10481 |
| 1634 | nmdc:mga0n895_56967_c1 | 3300050512 | Bacteria | 3852 |
| 1635 | nmdc:mga0n895_574417_c1 | 3300050512 | Bacteria | 1132 |
| 1636 | nmdc:mga0rr50_10123_c1 | 3300050513 | Bacteria | 5968 |
| 1637 | nmdc:mga0rr50_160039_c1 | 3300050513 | Bacteria | 1827 |
| 1638 | nmdc:mga0rr50_610163_c1 | 3300050513 | Bacteria | 930 |
| 1639 | nmdc:mga0rr50_980580_c1 | 3300050513 | Unclassified | 720 |
| 1640 | nmdc:mga08x19_138789_c1 | 3300050514 | Bacteria | 1641 |
| 1641 | nmdc:mga08x19_689792_c1 | 3300050514 | Bacteria | 725 |
| 1642 | nmdc:mga0a205_17434_c1 | 3300050515 | Bacteria | 6733 |
| 1643 | nmdc:mga0a205_316383_c1 | 3300050515 | Bacteria | 1432 |
| 1644 | nmdc:mga0a205_49650_c1 | 3300050515 | Bacteria | 4051 |
| 1645 | nmdc:mga0sz30_17585_c1 | 3300050516 | Bacteria | 2853 |
| 1646 | nmdc:mga0sz30_33593_c1 | 3300050516 | Bacteria | 2133 |
| 1647 | nmdc:mga0sz30_487879_c1 | 3300050516 | Bacteria | 554 |
| 1648 | Ga0495601_0473726 | 3300053077 | Bacteria | 809 |
| 1649 | Ga0495595_0120686 | 3300053084 | Bacteria | 1277 |
| 1650 | Ga0495595_0472973 | 3300053084 | Bacteria | 638 |
| 1651 | Ga0495619_0002446 | 3300053085 | Bacteria | 12164 |
| 1652 | Ga0500578_0062105 | 3300053086 | Bacteria | 2385 |
| 1653 | Ga0500578_0142102 | 3300053086 | Bacteria | 1500 |
| 1654 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1655 | Ga0500643_025816 | 3300053087 | Bacteria | 1848 |
| 1656 | Ga0500643_189535 | 3300053087 | Bacteria | 551 |
| 1657 | Ga0500651_0163854 | 3300053093 | Bacteria | 1328 |
| 1658 | Ga0500650_0183400 | 3300053098 | Unclassified | 958 |
| 1659 | Ga0500554_098060 | 3300053102 | Bacteria | 979 |
| 1660 | Ga0500555_000025 | 3300053103 | Bacteria | 119960 |
| 1661 | Ga0500556_0005981 | 3300053104 | Bacteria | 3448 |
| 1662 | Ga0500572_027263 | 3300053111 | Bacteria | 1564 |
| 1663 | Ga0500592_012176 | 3300053116 | Bacteria | 1375 |
| 1664 | Ga0500595_086825 | 3300053119 | Bacteria | 910 |
| 1665 | Ga0500597_155413 | 3300053120 | Bacteria | 980 |
| 1666 | Ga0500614_165965 | 3300053123 | Bacteria | 671 |
| 1667 | Ga0500655_039097 | 3300053133 | Bacteria | 928 |
| 1668 | Ga0500658_0141013 | 3300053134 | Bacteria | 1081 |
| 1669 | Ga0500559_0003975 | 3300053136 | Bacteria | 7119 |
| 1670 | Ga0500564_017840 | 3300053138 | Bacteria | 3229 |
| 1671 | Ga0500616_0040971 | 3300053153 | Bacteria | 2488 |
| 1672 | Ga0500619_149021 | 3300053154 | Bacteria | 796 |
| 1673 | Ga0500637_0425958 | 3300053178 | Bacteria | 681 |
| 1674 | Ga0500645_011279 | 3300053730 | Bacteria | 2923 |
| 1675 | Ga0501084_0048326 | 3300054114 | Bacteria | 3562 |
| 1676 | Ga0587111_0194149 | 3300060346 | Bacteria | 572 |
| 1677 | Ga0501082_0000176 | 3300060353 | Bacteria | 55663 |
| 1678 | Ga0501082_0005084 | 3300060353 | Bacteria | 11459 |
| 1679 | Ga0501082_0112348 | 3300060353 | Bacteria | 2359 |
| 1680 | Ga0466962_0409353 | 3300061719 | Bacteria | 680 |
| 1681 | 2512351273 | 2512047030 | Bacteria | 9031815 |
| 1682 | 2515684689 | 2515154122 | Bacteria | 8609520 |
| 1683 | 2885280123 | 2885270888 | Bacteria | 9831543 |
| 1684 | 2888386441 | 2888378607 | Bacteria | 9652610 |
| 1685 | 2889036727 | 2889033259 | Bacteria | 9099371 |
| 1686 | 2902684507 | 2902682994 | Bacteria | 8951596 |
| 1687 | 2932791551 | 2932784394 | Bacteria | 9704911 |
| 1688 | 2932835454 | 2932828146 | Bacteria | 9745859 |
| 1689 | 2935613545 | 2935608549 | Bacteria | 8203142 |
| 1690 | 2935643484 | 2935638405 | Bacteria | 10015038 |
| 1691 | 2935710760 | 2935703347 | Bacteria | 10242284 |
| 1692 | 2935824602 | 2935819856 | Bacteria | 8261050 |
| 1693 | 2935833001 | 2935827899 | Bacteria | 10038562 |
| 1694 | 2935844327 | 2935837841 | Bacteria | 9454360 |
| 1695 | 2935851822 | 2935847175 | Bacteria | 8228321 |
| 1696 | 2935996710 | 2935992306 | Bacteria | 9802711 |
| 1697 | 3005724066 | 3005718088 | Bacteria | 8283608 |
| 1698 | 8017065969 | 8017057580 | Bacteria | 10023680 |
| 1699 | 8019578681 | 8019576017 | Bacteria | 10049540 |
| 1700 | 8019596718 | 8019586578 | Bacteria | 10212056 |
| 1701 | 8019604971 | 8019597564 | Bacteria | 10041141 |
| 1702 | 8019613562 | 8019608314 | Bacteria | 10042931 |
| 1703 | Ga0373930_0101847 | |||
| 1704 | JGI24736J21556_1015368 | |||
| 1705 | JGI24736J21556_1021579 | |||
| 1706 | JGI24739J22299_10073599 | |||
| 1707 | JGI24737J22298_10091082 | |||
| 1708 | JGI24748J21848_1001755 | |||
| 1709 | JGI24751J29686_10050174 | |||
| 1710 | JGI24751J29686_10130390 | |||
| 1711 | JGI25156J39149_1008617 | |||
| 1712 | JGI25162J39368_1003180 | |||
| 1713 | JGI25157J39369_1004429 | |||
| 1714 | JGI25164J39214_1001517 | |||
| 1715 | JGI25165J46597_1002740 | |||
| 1716 | JGI25153J46596_10006212 | |||
| 1717 | JGI25153J46596_10027181 | |||
| 1718 | rootH2_10080896 | |||
| 1719 | JGI25160J50197_1027724 | |||
| 1720 | JGI25404J52841_10005248 | |||
| 1721 | Ga0055525_1003849 | |||
| 1722 | Ga0055527_1001410 | |||
| 1723 | Ga0055535_1000762 | |||
| 1724 | Ga0055535_1001669 | |||
| 1725 | Ga0055542_1001204 | |||
| 1726 | Ga0055542_1001618 | |||
| 1727 | Ga0055542_1028182 | |||
| 1728 | Ga0055529_1000969 | |||
| 1729 | Ga0055529_1011211 | |||
| 1730 | Ga0055524_1032917 | |||
| 1731 | Ga0055540_1002653 | |||
| 1732 | Ga0055540_1089684 | |||
| 1733 | Ga0055531_10000002 | |||
| 1734 | Ga0055531_10000234 | |||
| 1735 | Ga0055531_10001156 | |||
| 1736 | Ga0055531_10054756 | |||
| 1737 | Ga0065165_1001827 | |||
| 1738 | Ga0065165_1004722 | |||
| 1739 | Ga0065714_10156014 | |||
| 1740 | Ga0065712_10004533 | |||
| 1741 | Ga0065712_10086972 | |||
| 1742 | Ga0065715_10032818 | |||
| 1743 | Ga0065715_10092414 | |||
| 1744 | Ga0065715_10100822 | |||
| 1745 | Ga0065715_10348883 | |||
| 1746 | Ga0065707_10088244 | |||
| 1747 | Ga0070658_10041393 | |||
| 1748 | Ga0070658_10047697 | |||
| 1749 | Ga0070676_10136820 | |||
| 1750 | Ga0070676_10654731 | |||
| 1751 | Ga0070683_100020285 | |||
| 1752 | Ga0070683_100049047 | |||
| 1753 | Ga0070683_100277955 | |||
| 1754 | Ga0070683_100290013 | |||
| 1755 | Ga0070683_100813273 | |||
| 1756 | Ga0070690_100000659 | |||
| 1757 | Ga0070690_100016640 | |||
| 1758 | Ga0070690_100050230 | |||
| 1759 | Ga0070690_100229506 | |||
| 1760 | Ga0070690_100520157 | |||
| 1761 | Ga0070670_100006270 | |||
| 1762 | Ga0070670_100130867 | |||
| 1763 | Ga0070670_100131109 | |||
| 1764 | Ga0070670_100143258 | |||
| 1765 | Ga0070670_100200923 | |||
| 1766 | Ga0070677_10014260 | |||
| 1767 | Ga0070677_10801587 | |||
| 1768 | Ga0068869_100015358 | |||
| 1769 | Ga0068869_100274307 | |||
| 1770 | Ga0068869_101044454 | |||
| 1771 | Ga0068869_101799850 | |||
| 1772 | Ga0070666_10000003 | |||
| 1773 | Ga0070666_10007556 | |||
| 1774 | Ga0070666_10009620 | |||
| 1775 | Ga0070666_10035307 | |||
| 1776 | Ga0070666_10787675 | |||
| 1777 | Ga0070666_11011814 | |||
| 1778 | Ga0070666_11095102 | |||
| 1779 | Ga0070680_100000638 | |||
| 1780 | Ga0070680_100031410 | |||
| 1781 | Ga0070680_100175521 | |||
| 1782 | Ga0070680_100711817 | |||
| 1783 | Ga0070680_100738049 | |||
| 1784 | Ga0070680_100791529 | |||
| 1785 | Ga0070680_100847624 | |||
| 1786 | Ga0070680_101074013 | |||
| 1787 | Ga0070682_100116774 | |||
| 1788 | Ga0070682_101015800 | |||
| 1789 | Ga0068868_100228042 | |||
| 1790 | Ga0068868_100248784 | |||
| 1791 | Ga0068868_101437998 | |||
| 1792 | Ga0068868_101569680 | |||
| 1793 | Ga0068868_102172133 | |||
| 1794 | Ga0070660_100140461 | |||
| 1795 | Ga0070660_101467951 | |||
| 1796 | Ga0070689_100055855 | |||
| 1797 | Ga0070689_101112229 | |||
| 1798 | Ga0070691_10046365 | |||
| 1799 | Ga0070691_10647447 | |||
| 1800 | Ga0070691_10869850 | |||
| 1801 | Ga0070687_100088033 | |||
| 1802 | Ga0070687_100099644 | |||
| 1803 | Ga0070687_100107919 | |||
| 1804 | Ga0070661_100034824 | |||
| 1805 | Ga0070661_100062488 | |||
| 1806 | Ga0070661_100153662 | |||
| 1807 | Ga0070661_101515868 | |||
| 1808 | Ga0070692_10000442 | |||
| 1809 | Ga0070692_11237327 | |||
| 1810 | Ga0070668_100016018 | |||
| 1811 | Ga0070668_100211729 | |||
| 1812 | Ga0070668_100283304 | |||
| 1813 | Ga0070668_101795866 | |||
| 1814 | Ga0070668_102059136 | |||
| 1815 | Ga0070669_100007961 | |||
| 1816 | Ga0070669_100008649 | |||
| 1817 | Ga0070669_100681976 | |||
| 1818 | Ga0070675_100001805 | |||
| 1819 | Ga0070675_100051449 | |||
| 1820 | Ga0070675_100119903 | |||
| 1821 | Ga0070675_100309809 | |||
| 1822 | Ga0070675_101082719 | |||
| 1823 | Ga0070671_100007395 | |||
| 1824 | Ga0070671_100024351 | |||
| 1825 | Ga0070671_100093484 | |||
| 1826 | Ga0070671_100289321 | |||
| 1827 | Ga0070671_100455641 | |||
| 1828 | Ga0070671_100491859 | |||
| 1829 | Ga0070674_100022583 | |||
| 1830 | Ga0070674_100042177 | |||
| 1831 | Ga0070674_100045473 | |||
| 1832 | Ga0070674_101501177 | |||
| 1833 | Ga0070673_100023355 | |||
| 1834 | Ga0070673_100123685 | |||
| 1835 | Ga0070673_100257426 | |||
| 1836 | Ga0070673_100415335 | |||
| 1837 | Ga0070673_100862872 | |||
| 1838 | Ga0070673_101726887 | |||
| 1839 | Ga0070688_100014662 | |||
| 1840 | Ga0070688_100031832 | |||
| 1841 | Ga0070688_100089508 | |||
| 1842 | Ga0070688_100590431 | |||
| 1843 | Ga0070688_100597938 | |||
| 1844 | Ga0070659_100015121 | |||
| 1845 | Ga0070659_100160980 | |||
| 1846 | Ga0070659_101317445 | |||
| 1847 | Ga0070667_100000049 | |||
| 1848 | Ga0070667_100000129 | |||
| 1849 | Ga0070667_100012603 | |||
| 1850 | Ga0070667_100026817 | |||
| 1851 | Ga0070667_100040730 | |||
| 1852 | Ga0070667_100247162 | |||
| 1853 | Ga0070667_100312819 | |||
| 1854 | Ga0070667_100342111 | |||
| 1855 | Ga0070667_100410628 | |||
| 1856 | Ga0070709_10014894 | |||
| 1857 | Ga0070709_10305038 | |||
| 1858 | Ga0070714_101106298 | |||
| 1859 | Ga0070714_102492986 | |||
| 1860 | Ga0070713_100041356 | |||
| 1861 | Ga0070713_100347421 | |||
| 1862 | Ga0070713_101044927 | |||
| 1863 | Ga0070710_10140852 | |||
| 1864 | Ga0070701_10021041 | |||
| 1865 | Ga0070711_100057363 | |||
| 1866 | Ga0070711_100576702 | |||
| 1867 | Ga0070711_100823062 | |||
| 1868 | Ga0070711_100954301 | |||
| 1869 | Ga0070711_101217193 | |||
| 1870 | Ga0070705_100015101 | |||
| 1871 | Ga0070705_100043853 | |||
| 1872 | Ga0070705_101119988 | |||
| 1873 | Ga0070700_100017632 | |||
| 1874 | Ga0070700_100032982 | |||
| 1875 | Ga0070700_101287421 | |||
| 1876 | Ga0070700_101445052 | |||
| 1877 | Ga0070694_100046149 | |||
| 1878 | Ga0070694_100238867 | |||
| 1879 | Ga0070708_100007506 | |||
| 1880 | Ga0070708_100104501 | |||
| 1881 | Ga0070708_100250706 | |||
| 1882 | Ga0070708_101612547 | |||
| 1883 | Ga0070663_100000996 | |||
| 1884 | Ga0070663_100056941 | |||
| 1885 | Ga0070663_100376719 | |||
| 1886 | Ga0070663_100771079 | |||
| 1887 | Ga0070678_100004888 | |||
| 1888 | Ga0070678_100009831 | |||
| 1889 | Ga0070678_100017870 | |||
| 1890 | Ga0070678_100239862 | |||
| 1891 | Ga0070678_100244482 | |||
| 1892 | Ga0070678_100522920 | |||
| 1893 | Ga0070678_100853711 | |||
| 1894 | Ga0070662_100009850 | |||
| 1895 | Ga0070662_100034756 | |||
| 1896 | Ga0070662_100131686 | |||
| 1897 | Ga0070662_100153920 | |||
| 1898 | Ga0070662_100680658 | |||
| 1899 | Ga0070662_101468429 | |||
| 1900 | Ga0070681_10007731 | |||
| 1901 | Ga0070681_10014089 | |||
| 1902 | Ga0070681_10030015 | |||
| 1903 | Ga0070681_10032470 | |||
| 1904 | Ga0070681_10033693 | |||
| 1905 | Ga0070681_10081128 | |||
| 1906 | Ga0068867_100006360 | |||
| 1907 | Ga0068867_100070879 | |||
| 1908 | Ga0068867_100113935 | |||
| 1909 | Ga0068867_100215995 | |||
| 1910 | Ga0068867_100696485 | |||
| 1911 | Ga0068867_100741118 | |||
| 1912 | Ga0070685_10007147 | |||
| 1913 | Ga0070685_10036196 | |||
| 1914 | Ga0070685_10120106 | |||
| 1915 | Ga0070685_10144937 | |||
| 1916 | Ga0070706_100027551 | |||
| 1917 | Ga0070706_100029141 | |||
| 1918 | Ga0070706_100081152 | |||
| 1919 | Ga0070706_100083087 | |||
| 1920 | Ga0070706_100342122 | |||
| 1921 | Ga0070707_100013711 | |||
| 1922 | Ga0070707_100318835 | |||
| 1923 | Ga0070707_100428217 | |||
| 1924 | Ga0070707_100630514 | |||
| 1925 | Ga0070698_100013139 | |||
| 1926 | Ga0070698_100080159 | |||
| 1927 | Ga0070698_101058083 | |||
| 1928 | Ga0070698_101499655 | |||
| 1929 | Ga0070699_100003254 | |||
| 1930 | Ga0070699_100035623 | |||
| 1931 | Ga0070699_101109535 | |||
| 1932 | Ga0070699_101776121 | |||
| 1933 | Ga0070679_100021255 | |||
| 1934 | Ga0070679_100123725 | |||
| 1935 | Ga0070679_100124837 | |||
| 1936 | Ga0070679_100213575 | |||
| 1937 | Ga0070679_100382984 | |||
| 1938 | Ga0070679_100967722 | |||
| 1939 | Ga0070684_100004144 | |||
| 1940 | Ga0070684_100028623 | |||
| 1941 | Ga0070684_100683871 | |||
| 1942 | Ga0070684_101069725 | |||
| 1943 | Ga0070697_100214933 | |||
| 1944 | Ga0068853_100036182 | |||
| 1945 | Ga0068853_100099539 | |||
| 1946 | Ga0068853_100151065 | |||
| 1947 | Ga0068853_100423338 | |||
| 1948 | Ga0068853_100487050 | |||
| 1949 | Ga0068853_100531181 | |||
| 1950 | Ga0068853_100864318 | |||
| 1951 | Ga0068853_101228614 | |||
| 1952 | Ga0068853_101428108 | |||
| 1953 | Ga0070672_100006524 | |||
| 1954 | Ga0070672_100015810 | |||
| 1955 | Ga0070672_100058961 | |||
| 1956 | Ga0070672_100080617 | |||
| 1957 | Ga0070672_100123772 | |||
| 1958 | Ga0070672_100760359 | |||
| 1959 | Ga0070686_100002162 | |||
| 1960 | Ga0070686_100023877 | |||
| 1961 | Ga0070686_100377933 | |||
| 1962 | Ga0070686_100860861 | |||
| 1963 | Ga0070695_100093500 | |||
| 1964 | Ga0070695_100466232 | |||
| 1965 | Ga0070695_100878395 | |||
| 1966 | Ga0070696_100010558 | |||
| 1967 | Ga0070696_100363884 | |||
| 1968 | Ga0070696_100579027 | |||
| 1969 | Ga0070696_100865066 | |||
| 1970 | Ga0070696_101490183 | |||
| 1971 | Ga0070693_100014679 | |||
| 1972 | Ga0070693_100040083 | |||
| 1973 | Ga0070693_100148259 | |||
| 1974 | Ga0070693_100335024 | |||
| 1975 | Ga0070693_100586110 | |||
| 1976 | Ga0070665_100000237 | |||
| 1977 | Ga0070665_100000467 | |||
| 1978 | Ga0070665_100003434 | |||
| 1979 | Ga0070665_100017979 | |||
| 1980 | Ga0070665_100088467 | |||
| 1981 | Ga0070665_100099051 | |||
| 1982 | Ga0070665_100250580 | |||
| 1983 | Ga0070665_101173373 | |||
| 1984 | Ga0070704_100045537 | |||
| 1985 | Ga0070704_100351708 | |||
| 1986 | Ga0068855_100002756 | |||
| 1987 | Ga0068855_100020476 | |||
| 1988 | Ga0068855_100030244 | |||
| 1989 | Ga0068855_100135511 | |||
| 1990 | Ga0068855_100339807 | |||
| 1991 | Ga0068855_100342971 | |||
| 1992 | Ga0068855_100982028 | |||
| 1993 | Ga0068855_101052532 | |||
| 1994 | Ga0068855_101125542 | |||
| 1995 | Ga0070664_100000362 | |||
| 1996 | Ga0070664_100041317 | |||
| 1997 | Ga0068857_100073578 | |||
| 1998 | Ga0068857_100079857 | |||
| 1999 | Ga0068857_100099565 | |||
| 2000 | Ga0068857_100110701 | |||
| 2001 | Ga0068857_100206056 | |||
| 2002 | Ga0068854_100011931 | |||
| 2003 | Ga0068854_100045286 | |||
| 2004 | Ga0068854_100791533 | |||
| 2005 | Ga0068854_102008009 | |||
| 2006 | Ga0068856_100044226 | |||
| 2007 | Ga0068856_100064653 | |||
| 2008 | Ga0068856_100094722 | |||
| 2009 | Ga0068856_100219676 | |||
| 2010 | Ga0068856_102496730 | |||
| 2011 | Ga0068856_102709913 | |||
| 2012 | Ga0070702_100026748 | |||
| 2013 | Ga0070702_100072830 | |||
| 2014 | Ga0068852_100231081 | |||
| 2015 | Ga0068852_100943426 | |||
| 2016 | Ga0068859_100005230 | |||
| 2017 | Ga0068859_100028400 | |||
| 2018 | Ga0068859_100037124 | |||
| 2019 | Ga0068859_100097986 | |||
| 2020 | Ga0068859_100311441 | |||
| 2021 | Ga0068859_100319350 | |||
| 2022 | Ga0068859_102100052 | |||
| 2023 | Ga0068864_100011349 | |||
| 2024 | Ga0068864_100319550 | |||
| 2025 | Ga0068866_10002285 | |||
| 2026 | Ga0068861_100003766 | |||
| 2027 | Ga0068861_100006557 | |||
| 2028 | Ga0068861_100007838 | |||
| 2029 | Ga0068861_100068962 | |||
| 2030 | Ga0068861_100268072 | |||
| 2031 | Ga0068861_100319549 | |||
| 2032 | Ga0068861_100641916 | |||
| 2033 | Ga0068861_101207406 | |||
| 2034 | Ga0068851_10014356 | |||
| 2035 | Ga0068870_10009855 | |||
| 2036 | Ga0068870_10370568 | |||
| 2037 | Ga0068863_100004078 | |||
| 2038 | Ga0068863_100033197 | |||
| 2039 | Ga0068863_100061050 | |||
| 2040 | Ga0068863_100074994 | |||
| 2041 | Ga0068863_100385673 | |||
| 2042 | Ga0068863_100838622 | |||
| 2043 | Ga0068863_101147526 | |||
| 2044 | Ga0068863_102385079 | |||
| 2045 | Ga0068858_100003914 | |||
| 2046 | Ga0068858_100990037 | |||
| 2047 | Ga0068858_101034605 | |||
| 2048 | Ga0068858_101151667 | |||
| 2049 | Ga0068858_101703257 | |||
| 2050 | Ga0068860_100014505 | |||
| 2051 | Ga0068860_100025718 | |||
| 2052 | Ga0068860_100242578 | |||
| 2053 | Ga0068860_100337738 | |||
| 2054 | Ga0068860_101127087 | |||
| 2055 | Ga0068862_100000710 | |||
| 2056 | Ga0068862_100000773 | |||
| 2057 | Ga0068862_100006742 | |||
| 2058 | Ga0068862_100082694 | |||
| 2059 | Ga0068862_101169141 | |||
| 2060 | Ga0081455_10003552 | |||
| 2061 | Ga0081455_10100711 | |||
| 2062 | Ga0081540_1000377 | |||
| 2063 | Ga0081540_1003811 | |||
| 2064 | Ga0081540_1027419 | |||
| 2065 | Ga0081539_10197392 | |||
| 2066 | Ga0081539_10240319 | |||
| 2067 | Ga0070717_10243931 | |||
| 2068 | Ga0070717_10285058 | |||
| 2069 | Ga0070717_10708318 | |||
| 2070 | Ga0070717_10713291 | |||
| 2071 | Ga0070717_10771724 | |||
| 2072 | Ga0070717_11162532 | |||
| 2073 | Ga0075365_10100758 | |||
| 2074 | Ga0075368_10003413 | |||
| 2075 | Ga0075364_10052682 | |||
| 2076 | Ga0075364_10124293 | |||
| 2077 | Ga0075364_10320818 | |||
| 2078 | Ga0075364_10613139 | |||
| 2079 | Ga0070715_10111121 | |||
| 2080 | Ga0070715_10121350 | |||
| 2081 | Ga0070715_10683742 | |||
| 2082 | Ga0070716_100019808 | |||
| 2083 | Ga0070716_100350564 | |||
| 2084 | Ga0070712_100000441 | |||
| 2085 | Ga0070712_100641030 | |||
| 2086 | Ga0070712_101444222 | |||
| 2087 | Ga0070712_102005083 | |||
| 2088 | Ga0075362_10112367 | |||
| 2089 | Ga0075367_10156006 | |||
| 2090 | Ga0075367_10822278 | |||
| 2091 | Ga0075369_10132280 | |||
| 2092 | Ga0075369_10340059 | |||
| 2093 | Ga0075366_10002121 | |||
| 2094 | Ga0075366_10128161 | |||
| 2095 | Ga0097621_100004137 | |||
| 2096 | Ga0097621_100004245 | |||
| 2097 | Ga0097621_100020255 | |||
| 2098 | Ga0097621_100034057 | |||
| 2099 | Ga0097621_100228862 | |||
| 2100 | Ga0097621_100567324 | |||
| 2101 | Ga0097621_100584820 | |||
| 2102 | Ga0097621_101765675 | |||
| 2103 | Ga0075370_10013002 | |||
| 2104 | Ga0068871_100009393 | |||
| 2105 | Ga0068871_100011257 | |||
| 2106 | Ga0068871_100023303 | |||
| 2107 | Ga0068871_100162194 | |||
| 2108 | Ga0068871_100220779 | |||
| 2109 | Ga0068871_100391849 | |||
| 2110 | Ga0068871_101575222 | |||
| 2111 | Ga0075428_100035750 | |||
| 2112 | Ga0075428_102684018 | |||
| 2113 | Ga0075430_100009406 | |||
| 2114 | Ga0075430_100363684 | |||
| 2115 | Ga0075430_101133096 | |||
| 2116 | Ga0075431_100050721 | |||
| 2117 | Ga0075431_100076297 | |||
| 2118 | Ga0075431_100594542 | |||
| 2119 | Ga0075433_10012601 | |||
| 2120 | Ga0075433_10054490 | |||
| 2121 | Ga0075433_10272924 | |||
| 2122 | Ga0075433_10492196 | |||
| 2123 | Ga0075433_10526698 | |||
| 2124 | Ga0075433_10630724 | |||
| 2125 | Ga0075434_100000002 | |||
| 2126 | Ga0075434_100005428 | |||
| 2127 | Ga0075434_100029901 | |||
| 2128 | Ga0075434_100134162 | |||
| 2129 | Ga0075434_100181741 | |||
| 2130 | Ga0075429_100318568 | |||
| 2131 | Ga0075429_100501227 | |||
| 2132 | Ga0075429_100669176 | |||
| 2133 | Ga0075429_100893225 | |||
| 2134 | Ga0068865_100002587 | |||
| 2135 | Ga0068865_100011373 | |||
| 2136 | Ga0068865_100016392 | |||
| 2137 | Ga0068865_100075379 | |||
| 2138 | Ga0068865_100351803 | |||
| 2139 | Ga0075436_100011488 | |||
| 2140 | Ga0075436_100202616 | |||
| 2141 | Ga0075436_100304506 | |||
| 2142 | Ga0075436_100355278 | |||
| 2143 | Ga0075436_100736622 | |||
| 2144 | Ga0075436_101019388 | |||
| 2145 | Ga0097620_100005230 | |||
| 2146 | Ga0097620_100028400 | |||
| 2147 | Ga0097620_100037124 | |||
| 2148 | Ga0097620_100097987 | |||
| 2149 | Ga0097620_100311405 | |||
| 2150 | Ga0097620_100319361 | |||
| 2151 | Ga0097620_102099982 | |||
| 2152 | Ga0099825_1035219 | |||
| 2153 | Ga0099823_1032609 | |||
| 2154 | Ga0075435_100018975 | |||
| 2155 | Ga0075435_100038058 | |||
| 2156 | Ga0075435_100630745 | |||
| 2157 | Ga0075435_100988209 | |||
| 2158 | Ga0075435_101410689 | |||
| 2159 | Ga0075435_102040561 | |||
| 2160 | Ga0099794_10092477 | |||
| 2161 | Ga0099795_10173993 | |||
| 2162 | Ga0105251_10231350 | |||
| 2163 | Ga0105250_10044625 | |||
| 2164 | Ga0105250_10097401 | |||
| 2165 | Ga0105240_10003909 | |||
| 2166 | Ga0105240_10013511 | |||
| 2167 | Ga0105240_10040761 | |||
| 2168 | Ga0105240_10048726 | |||
| 2169 | Ga0105240_10051298 | |||
| 2170 | Ga0105240_10086700 | |||
| 2171 | Ga0105240_10102240 | |||
| 2172 | Ga0105240_10117208 | |||
| 2173 | Ga0105240_10201237 | |||
| 2174 | Ga0105240_10415260 | |||
| 2175 | Ga0105240_10599914 | |||
| 2176 | Ga0105240_11396336 | |||
| 2177 | Ga0111539_10007838 | |||
| 2178 | Ga0111539_10026480 | |||
| 2179 | Ga0111539_10176275 | |||
| 2180 | Ga0111539_10629336 | |||
| 2181 | Ga0111539_10685271 | |||
| 2182 | Ga0111539_11458717 | |||
| 2183 | Ga0111539_11460512 | |||
| 2184 | Ga0111539_11720912 | |||
| 2185 | Ga0111539_12605516 | |||
| 2186 | Ga0111539_13040900 | |||
| 2187 | Ga0105245_10016953 | |||
| 2188 | Ga0105245_10038887 | |||
| 2189 | Ga0105245_10056008 | |||
| 2190 | Ga0105245_11095244 | |||
| 2191 | Ga0105245_11269450 | |||
| 2192 | Ga0105245_11719593 | |||
| 2193 | Ga0105247_10008282 | |||
| 2194 | Ga0105247_10080733 | |||
| 2195 | Ga0105247_10133923 | |||
| 2196 | Ga0105247_10595536 | |||
| 2197 | Ga0105247_10847183 | |||
| 2198 | Ga0105247_10887497 | |||
| 2199 | Ga0114129_10104235 | |||
| 2200 | Ga0114129_10440316 | |||
| 2201 | Ga0114129_10598538 | |||
| 2202 | Ga0114129_11194042 | |||
| 2203 | Ga0114129_12017311 | |||
| 2204 | Ga0105243_10005625 | |||
| 2205 | Ga0105243_10113365 | |||
| 2206 | Ga0105243_10257907 | |||
| 2207 | Ga0105243_10444720 | |||
| 2208 | Ga0105243_11733039 | |||
| 2209 | Ga0105243_12046080 | |||
| 2210 | Ga0105241_10003663 | |||
| 2211 | Ga0105241_10035647 | |||
| 2212 | Ga0105241_10073208 | |||
| 2213 | Ga0105241_10161064 | |||
| 2214 | Ga0105241_10377097 | |||
| 2215 | Ga0105241_10379407 | |||
| 2216 | Ga0105241_10477501 | |||
| 2217 | Ga0105241_11253685 | |||
| 2218 | Ga0105241_12014663 | |||
| 2219 | Ga0105241_12400940 | |||
| 2220 | Ga0105241_12577336 | |||
| 2221 | Ga0105241_12649383 | |||
| 2222 | Ga0105242_10007918 | |||
| 2223 | Ga0105242_10024897 | |||
| 2224 | Ga0105242_10042533 | |||
| 2225 | Ga0105242_10204361 | |||
| 2226 | Ga0105242_10307067 | |||
| 2227 | Ga0105242_10373877 | |||
| 2228 | Ga0105242_11033000 | |||
| 2229 | Ga0105242_11100353 | |||
| 2230 | Ga0105248_10000120 | |||
| 2231 | Ga0105248_10003190 | |||
| 2232 | Ga0105248_10125563 | |||
| 2233 | Ga0105248_10225214 | |||
| 2234 | Ga0105248_10426680 | |||
| 2235 | Ga0105248_10588588 | |||
| 2236 | Ga0105248_10706702 | |||
| 2237 | Ga0105248_11127324 | |||
| 2238 | Ga0105237_10000585 | |||
| 2239 | Ga0105237_10041317 | |||
| 2240 | Ga0105237_10060749 | |||
| 2241 | Ga0105237_10066556 | |||
| 2242 | Ga0105237_10067357 | |||
| 2243 | Ga0105237_10092757 | |||
| 2244 | Ga0105237_10227066 | |||
| 2245 | Ga0105237_10371359 | |||
| 2246 | Ga0105237_10415168 | |||
| 2247 | Ga0105237_10540869 | |||
| 2248 | Ga0105237_10557624 | |||
| 2249 | Ga0105237_10588664 | |||
| 2250 | Ga0105237_10661281 | |||
| 2251 | Ga0105237_11217536 | |||
| 2252 | Ga0105237_11268837 | |||
| 2253 | Ga0105237_11382107 | |||
| 2254 | Ga0105237_11949654 | |||
| 2255 | Ga0105238_10000686 | |||
| 2256 | Ga0105238_10000802 | |||
| 2257 | Ga0105238_10018812 | |||
| 2258 | Ga0105238_10029428 | |||
| 2259 | Ga0105238_10055256 | |||
| 2260 | Ga0105238_10087229 | |||
| 2261 | Ga0105238_10143999 | |||
| 2262 | Ga0105238_10218335 | |||
| 2263 | Ga0105238_10641169 | |||
| 2264 | Ga0105238_11020635 | |||
| 2265 | Ga0105238_11246987 | |||
| 2266 | Ga0105238_11294984 | |||
| 2267 | Ga0105238_11354002 | |||
| 2268 | Ga0105238_11670298 | |||
| 2269 | Ga0105238_11885083 | |||
| 2270 | Ga0105238_11929575 | |||
| 2271 | Ga0105249_10001381 | |||
| 2272 | Ga0105249_10007711 | |||
| 2273 | Ga0105249_10082416 | |||
| 2274 | Ga0105249_10292199 | |||
| 2275 | Ga0105249_10475176 | |||
| 2276 | Ga0105249_10539082 | |||
| 2277 | Ga0105249_10826291 | |||
| 2278 | Ga0105249_11050759 | |||
| 2279 | Ga0105249_11298262 | |||
| 2280 | Ga0099796_10438865 | |||
| 2281 | Ga0105239_10000598 | |||
| 2282 | Ga0105239_10024313 | |||
| 2283 | Ga0105239_10039543 | |||
| 2284 | Ga0105239_10055913 | |||
| 2285 | Ga0105239_10108698 | |||
| 2286 | Ga0105239_10153783 | |||
| 2287 | Ga0105239_10219536 | |||
| 2288 | Ga0105239_10565564 | |||
| 2289 | Ga0105239_10713489 | |||
| 2290 | Ga0105239_11914828 | |||
| 2291 | Ga0105246_10003169 | |||
| 2292 | Ga0105246_10056601 | |||
| 2293 | Ga0105246_10119130 | |||
| 2294 | Ga0105246_10376905 | |||
| 2295 | Ga0105246_10523567 | |||
| 2296 | Ga0105246_11197202 | |||
| 2297 | Ga0105246_12511814 | |||
| 2298 | Ga0157322_1036643 | |||
| 2299 | Ga0157314_1052243 | |||
| 2300 | Ga0157371_10011090 | |||
| 2301 | Ga0157370_10001505 | |||
| 2302 | Ga0157370_10422990 | |||
| 2303 | Ga0157370_10617434 | |||
| 2304 | Ga0157370_11060541 | |||
| 2305 | Ga0157369_10001137 | |||
| 2306 | Ga0157369_10007085 | |||
| 2307 | Ga0157369_10043435 | |||
| 2308 | Ga0157369_10120068 | |||
| 2309 | Ga0157374_10013680 | |||
| 2310 | Ga0157374_10033535 | |||
| 2311 | Ga0157374_10036715 | |||
| 2312 | Ga0157374_10354282 | |||
| 2313 | Ga0157374_10579161 | |||
| 2314 | Ga0157374_11292454 | |||
| 2315 | Ga0157378_10019633 | |||
| 2316 | Ga0157378_10028655 | |||
| 2317 | Ga0157378_10061729 | |||
| 2318 | Ga0157378_10407877 | |||
| 2319 | Ga0157378_10913935 | |||
| 2320 | Ga0157378_11228592 | |||
| 2321 | Ga0157378_12265422 | |||
| 2322 | Ga0163162_10001651 | |||
| 2323 | Ga0163162_10012697 | |||
| 2324 | Ga0163162_10017443 | |||
| 2325 | Ga0163162_10024940 | |||
| 2326 | Ga0163162_10051897 | |||
| 2327 | Ga0163162_10109029 | |||
| 2328 | Ga0163162_10126629 | |||
| 2329 | Ga0163162_10407075 | |||
| 2330 | Ga0163162_10436120 | |||
| 2331 | Ga0163162_10518344 | |||
| 2332 | Ga0163162_12065338 | |||
| 2333 | Ga0157372_10035411 | |||
| 2334 | Ga0157372_10049782 | |||
| 2335 | Ga0157372_10580609 | |||
| 2336 | Ga0157372_10616187 | |||
| 2337 | Ga0157372_10963796 | |||
| 2338 | Ga0157372_11564923 | |||
| 2339 | Ga0157372_12868801 | |||
| 2340 | Ga0157375_10001711 | |||
| 2341 | Ga0157375_10085834 | |||
| 2342 | Ga0157375_10087695 | |||
| 2343 | Ga0157375_10260540 | |||
| 2344 | Ga0157375_10371726 | |||
| 2345 | Ga0157375_10388667 | |||
| 2346 | Ga0157375_11086535 | |||
| 2347 | Ga0163163_10000639 | |||
| 2348 | Ga0163163_10009921 | |||
| 2349 | Ga0163163_10049124 | |||
| 2350 | Ga0163163_10237641 | |||
| 2351 | Ga0163163_10359865 | |||
| 2352 | Ga0157380_10264090 | |||
| 2353 | Ga0157380_10942054 | |||
| 2354 | Ga0157380_11517697 | |||
| 2355 | Ga0157380_12895059 | |||
| 2356 | Ga0157380_13215095 | |||
| 2357 | Ga0182008_10120559 | |||
| 2358 | Ga0182008_10220072 | |||
| 2359 | Ga0182008_10391064 | |||
| 2360 | Ga0157377_10001805 | |||
| 2361 | Ga0157377_10003066 | |||
| 2362 | Ga0157379_10016645 | |||
| 2363 | Ga0157379_10048305 | |||
| 2364 | Ga0157379_10066120 | |||
| 2365 | Ga0157379_10066986 | |||
| 2366 | Ga0157379_10219277 | |||
| 2367 | Ga0157379_10227584 | |||
| 2368 | Ga0157379_10463952 | |||
| 2369 | Ga0157379_10567712 | |||
| 2370 | Ga0157379_11580199 | |||
| 2371 | Ga0157379_12067041 | |||
| 2372 | Ga0157379_12101320 | |||
| 2373 | Ga0157376_10012122 | |||
| 2374 | Ga0157376_10013167 | |||
| 2375 | Ga0157376_10024072 | |||
| 2376 | Ga0157376_10430519 | |||
| 2377 | Ga0157376_10907787 | |||
| 2378 | Ga0157376_11242779 | |||
| 2379 | Ga0157376_13151042 | |||
| 2380 | Ga0182007_10004162 | |||
| 2381 | Ga0182007_10075671 | |||
| 2382 | Ga0163161_10010057 | |||
| 2383 | Ga0163161_10030360 | |||
| 2384 | Ga0163161_10088146 | |||
| 2385 | Ga0163161_11738495 | |||
| 2386 | Ga0213873_10279657 | |||
| 2387 | Ga0213872_10000304 | |||
| 2388 | Ga0213872_10008216 | |||
| 2389 | Ga0213872_10071172 | |||
| 2390 | Ga0213872_10251186 | |||
| 2391 | Ga0213872_10406076 | |||
| 2392 | Ga0213876_10026589 | |||
| 2393 | Ga0213876_10066199 | |||
| 2394 | Ga0213876_10175445 | |||
| 2395 | Ga0213875_10061108 | |||
| 2396 | Ga0213875_10118890 | |||
| 2397 | Ga0213875_10143471 | |||
| 2398 | Ga0213871_10028888 | |||
| 2399 | Ga0213871_10132264 | |||
| 2400 | Ga0228598_1012452 | |||
| 2401 | Ga0209672_100058 | |||
| 2402 | Ga0209672_101212 | |||
| 2403 | Ga0209563_101608 | |||
| 2404 | Ga0207427_101318 | |||
| 2405 | Ga0209437_101040 | |||
| 2406 | Ga0209258_100164 | |||
| 2407 | Ga0209258_101181 | |||
| 2408 | Ga0209258_109811 | |||
| 2409 | Ga0207425_1037931 | |||
| 2410 | Ga0209646_1001751 | |||
| 2411 | Ga0209026_1000280 | |||
| 2412 | Ga0209148_1000039 | |||
| 2413 | Ga0209148_1001605 | |||
| 2414 | Ga0209148_1002895 | |||
| 2415 | Ga0209759_1001011 | |||
| 2416 | Ga0209129_1024705 | |||
| 2417 | Ga0209233_1001383 | |||
| 2418 | Ga0209455_1000034 | |||
| 2419 | Ga0209455_1000450 | |||
| 2420 | Ga0209455_1000920 | |||
| 2421 | Ga0209673_1007773 | |||
| 2422 | Ga0207673_1016523 | |||
| 2423 | Ga0209564_1006041 | |||
| 2424 | Ga0209758_1000057 | |||
| 2425 | Ga0209758_1000109 | |||
| 2426 | Ga0209050_1002121 | |||
| 2427 | Ga0209256_1003201 | |||
| 2428 | Ga0209256_1018586 | |||
| 2429 | Ga0207426_1002293 | |||
| 2430 | Ga0207426_1048932 | |||
| 2431 | Ga0209051_1000025 | |||
| 2432 | Ga0209051_1005357 | |||
| 2433 | Ga0209051_1068084 | |||
| 2434 | Ga0209051_1074559 | |||
| 2435 | Ga0209257_1000039 | |||
| 2436 | Ga0209257_1000049 | |||
| 2437 | Ga0209257_1001604 | |||
| 2438 | Ga0209257_1012281 | |||
| 2439 | Ga0207697_10000498 | |||
| 2440 | Ga0207697_10076753 | |||
| 2441 | Ga0207656_10062321 | |||
| 2442 | Ga0207656_10239746 | |||
| 2443 | Ga0207682_10001642 | |||
| 2444 | Ga0207682_10001768 | |||
| 2445 | Ga0207692_10865573 | |||
| 2446 | Ga0207642_10001970 | |||
| 2447 | Ga0207642_10002638 | |||
| 2448 | Ga0207642_10604748 | |||
| 2449 | Ga0207642_10623380 | |||
| 2450 | Ga0207710_10008398 | |||
| 2451 | Ga0207710_10041401 | |||
| 2452 | Ga0207710_10077577 | |||
| 2453 | Ga0207688_10000572 | |||
| 2454 | Ga0207688_10020505 | |||
| 2455 | Ga0207688_10064630 | |||
| 2456 | Ga0207688_10326648 | |||
| 2457 | Ga0207688_10476554 | |||
| 2458 | Ga0207680_10000006 | |||
| 2459 | Ga0207680_10048115 | |||
| 2460 | Ga0207680_10050311 | |||
| 2461 | Ga0207680_10051102 | |||
| 2462 | Ga0207680_10207452 | |||
| 2463 | Ga0207680_10498476 | |||
| 2464 | Ga0207680_10543220 | |||
| 2465 | Ga0207647_10000776 | |||
| 2466 | Ga0207647_10000888 | |||
| 2467 | Ga0207647_10002766 | |||
| 2468 | Ga0207685_10055025 | |||
| 2469 | Ga0207685_10097917 | |||
| 2470 | Ga0207685_10425644 | |||
| 2471 | Ga0207699_10070352 | |||
| 2472 | Ga0207699_10493910 | |||
| 2473 | Ga0207699_10855995 | |||
| 2474 | Ga0207645_10010112 | |||
| 2475 | Ga0207645_10151559 | |||
| 2476 | Ga0207645_10209376 | |||
| 2477 | Ga0207645_10231059 | |||
| 2478 | Ga0207645_10692571 | |||
| 2479 | Ga0207643_10000024 | |||
| 2480 | Ga0207643_10007460 | |||
| 2481 | Ga0207643_10083185 | |||
| 2482 | Ga0207643_10299240 | |||
| 2483 | Ga0207705_10045059 | |||
| 2484 | Ga0207705_10061789 | |||
| 2485 | Ga0207684_10030780 | |||
| 2486 | Ga0207684_10043517 | |||
| 2487 | Ga0207684_10217969 | |||
| 2488 | Ga0207684_11291842 | |||
| 2489 | Ga0207654_10000444 | |||
| 2490 | Ga0207654_10008850 | |||
| 2491 | Ga0207654_10036982 | |||
| 2492 | Ga0207654_10169170 | |||
| 2493 | Ga0207654_10720171 | |||
| 2494 | Ga0207707_10000137 | |||
| 2495 | Ga0207707_10002528 | |||
| 2496 | Ga0207707_10029216 | |||
| 2497 | Ga0207707_10091699 | |||
| 2498 | Ga0207707_10096869 | |||
| 2499 | Ga0207707_10212555 | |||
| 2500 | Ga0207707_10592075 | |||
| 2501 | Ga0207707_10672067 | |||
| 2502 | Ga0207695_10000844 | |||
| 2503 | Ga0207695_10002725 | |||
| 2504 | Ga0207695_10029526 | |||
| 2505 | Ga0207695_10041940 | |||
| 2506 | Ga0207695_10042899 | |||
| 2507 | Ga0207695_10175918 | |||
| 2508 | Ga0207695_10210334 | |||
| 2509 | Ga0207695_10300530 | |||
| 2510 | Ga0207695_10396820 | |||
| 2511 | Ga0207695_10859688 | |||
| 2512 | Ga0207695_10934150 | |||
| 2513 | Ga0207695_11338435 | |||
| 2514 | Ga0207695_11344858 | |||
| 2515 | Ga0207671_10003300 | |||
| 2516 | Ga0207671_10003896 | |||
| 2517 | Ga0207671_10011447 | |||
| 2518 | Ga0207671_10213990 | |||
| 2519 | Ga0207671_10570089 | |||
| 2520 | Ga0207671_10593396 | |||
| 2521 | Ga0207671_10709014 | |||
| 2522 | Ga0207671_10736084 | |||
| 2523 | Ga0207671_10992306 | |||
| 2524 | Ga0207693_10019331 | |||
| 2525 | Ga0207663_10004609 | |||
| 2526 | Ga0207660_10006522 | |||
| 2527 | Ga0207660_10181303 | |||
| 2528 | Ga0207660_10189663 | |||
| 2529 | Ga0207660_10250269 | |||
| 2530 | Ga0207660_10484556 | |||
| 2531 | Ga0207660_10513944 | |||
| 2532 | Ga0207660_10580168 | |||
| 2533 | Ga0207660_10792511 | |||
| 2534 | Ga0207660_11317074 | |||
| 2535 | Ga0207660_11510492 | |||
| 2536 | Ga0207662_10000499 | |||
| 2537 | Ga0207662_10001437 | |||
| 2538 | Ga0207662_11275438 | |||
| 2539 | Ga0207657_10000115 | |||
| 2540 | Ga0207657_10048721 | |||
| 2541 | Ga0207657_10670345 | |||
| 2542 | Ga0207657_11042421 | |||
| 2543 | Ga0207649_10028267 | |||
| 2544 | Ga0207649_10035081 | |||
| 2545 | Ga0207649_10080895 | |||
| 2546 | Ga0207649_10164667 | |||
| 2547 | Ga0207652_10005039 | |||
| 2548 | Ga0207652_10092469 | |||
| 2549 | Ga0207652_10176514 | |||
| 2550 | Ga0207652_10180872 | |||
| 2551 | Ga0207652_10256183 | |||
| 2552 | Ga0207646_10198791 | |||
| 2553 | Ga0207646_10324278 | |||
| 2554 | Ga0207681_10003152 | |||
| 2555 | Ga0207681_10006516 | |||
| 2556 | Ga0207681_10259621 | |||
| 2557 | Ga0207681_11301738 | |||
| 2558 | Ga0207694_10000309 | |||
| 2559 | Ga0207694_10005100 | |||
| 2560 | Ga0207694_10010350 | |||
| 2561 | Ga0207694_10010925 | |||
| 2562 | Ga0207694_10116822 | |||
| 2563 | Ga0207694_10193334 | |||
| 2564 | Ga0207694_10864636 | |||
| 2565 | Ga0207694_11300043 | |||
| 2566 | Ga0207694_11500501 | |||
| 2567 | Ga0207694_11804724 | |||
| 2568 | Ga0207650_10007543 | |||
| 2569 | Ga0207650_10034670 | |||
| 2570 | Ga0207650_10035051 | |||
| 2571 | Ga0207650_10116372 | |||
| 2572 | Ga0207650_10292338 | |||
| 2573 | Ga0207650_10382609 | |||
| 2574 | Ga0207659_10003803 | |||
| 2575 | Ga0207659_10022783 | |||
| 2576 | Ga0207659_10694338 | |||
| 2577 | Ga0207659_10736444 | |||
| 2578 | Ga0207687_10037484 | |||
| 2579 | Ga0207687_10106298 | |||
| 2580 | Ga0207687_10636351 | |||
| 2581 | Ga0207700_10280646 | |||
| 2582 | Ga0207700_10649946 | |||
| 2583 | Ga0207664_10311298 | |||
| 2584 | Ga0207664_10402775 | |||
| 2585 | Ga0207664_10581809 | |||
| 2586 | Ga0207644_10009480 | |||
| 2587 | Ga0207644_10068527 | |||
| 2588 | Ga0207644_10085393 | |||
| 2589 | Ga0207644_10164896 | |||
| 2590 | Ga0207644_10221676 | |||
| 2591 | Ga0207690_10006275 | |||
| 2592 | Ga0207690_10132044 | |||
| 2593 | Ga0207690_10436612 | |||
| 2594 | Ga0207690_10690353 | |||
| 2595 | Ga0207690_11063437 | |||
| 2596 | Ga0207706_10003073 | |||
| 2597 | Ga0207706_10044166 | |||
| 2598 | Ga0207706_10050108 | |||
| 2599 | Ga0207706_10173473 | |||
| 2600 | Ga0207706_10563006 | |||
| 2601 | Ga0207706_11474131 | |||
| 2602 | Ga0207686_10000953 | |||
| 2603 | Ga0207686_10011909 | |||
| 2604 | Ga0207686_10030830 | |||
| 2605 | Ga0207686_10360100 | |||
| 2606 | Ga0207686_10428626 | |||
| 2607 | Ga0207686_11573935 | |||
| 2608 | Ga0207709_10077554 | |||
| 2609 | Ga0207709_10262049 | |||
| 2610 | Ga0207670_10058925 | |||
| 2611 | Ga0207670_10118338 | |||
| 2612 | Ga0207670_11076908 | |||
| 2613 | Ga0207670_11283212 | |||
| 2614 | Ga0207669_10020686 | |||
| 2615 | Ga0207669_10412686 | |||
| 2616 | Ga0207669_10836192 | |||
| 2617 | Ga0207704_10001072 | |||
| 2618 | Ga0207704_10011774 | |||
| 2619 | Ga0207704_10012894 | |||
| 2620 | Ga0207704_10051435 | |||
| 2621 | Ga0207704_10167605 | |||
| 2622 | Ga0207665_10022531 | |||
| 2623 | Ga0207665_10165554 | |||
| 2624 | Ga0207665_10818971 | |||
| 2625 | Ga0207665_11492122 | |||
| 2626 | Ga0207691_10014194 | |||
| 2627 | Ga0207691_10021585 | |||
| 2628 | Ga0207691_10021717 | |||
| 2629 | Ga0207691_10029699 | |||
| 2630 | Ga0207691_10289702 | |||
| 2631 | Ga0207691_10416849 | |||
| 2632 | Ga0207711_10001241 | |||
| 2633 | Ga0207711_10063491 | |||
| 2634 | Ga0207711_10102157 | |||
| 2635 | Ga0207711_10113220 | |||
| 2636 | Ga0207711_10189237 | |||
| 2637 | Ga0207711_10202771 | |||
| 2638 | Ga0207689_10000471 | |||
| 2639 | Ga0207689_10015006 | |||
| 2640 | Ga0207689_10335934 | |||
| 2641 | Ga0207689_11828468 | |||
| 2642 | Ga0207661_10058882 | |||
| 2643 | Ga0207661_10078706 | |||
| 2644 | Ga0207661_10239636 | |||
| 2645 | Ga0207661_12166587 | |||
| 2646 | Ga0207679_10002985 | |||
| 2647 | Ga0207679_10049933 | |||
| 2648 | Ga0207679_10137908 | |||
| 2649 | Ga0207667_10007953 | |||
| 2650 | Ga0207667_10058796 | |||
| 2651 | Ga0207667_10069324 | |||
| 2652 | Ga0207667_10119992 | |||
| 2653 | Ga0207667_10305861 | |||
| 2654 | Ga0207667_11878951 | |||
| 2655 | Ga0207651_10023742 | |||
| 2656 | Ga0207651_10027738 | |||
| 2657 | Ga0207651_10680913 | |||
| 2658 | Ga0207651_11967382 | |||
| 2659 | Ga0207712_10000605 | |||
| 2660 | Ga0207712_10014305 | |||
| 2661 | Ga0207712_10035911 | |||
| 2662 | Ga0207712_10142312 | |||
| 2663 | Ga0207712_10301983 | |||
| 2664 | Ga0207712_10740006 | |||
| 2665 | Ga0207712_11427855 | |||
| 2666 | Ga0207712_11505479 | |||
| 2667 | Ga0207668_10008885 | |||
| 2668 | Ga0207668_10026673 | |||
| 2669 | Ga0207668_10063315 | |||
| 2670 | Ga0207668_10252046 | |||
| 2671 | Ga0207640_10006740 | |||
| 2672 | Ga0207640_10307527 | |||
| 2673 | Ga0207640_11241386 | |||
| 2674 | Ga0207658_10000033 | |||
| 2675 | Ga0207658_10000126 | |||
| 2676 | Ga0207658_10007587 | |||
| 2677 | Ga0207658_10014907 | |||
| 2678 | Ga0207658_10024572 | |||
| 2679 | Ga0207658_10118358 | |||
| 2680 | Ga0207658_10126657 | |||
| 2681 | Ga0207658_10478751 | |||
| 2682 | Ga0207658_10934227 | |||
| 2683 | Ga0207658_11007395 | |||
| 2684 | Ga0207658_11073824 | |||
| 2685 | Ga0207658_12010252 | |||
| 2686 | Ga0207677_10068327 | |||
| 2687 | Ga0207677_10069624 | |||
| 2688 | Ga0207677_10243057 | |||
| 2689 | Ga0207677_10859541 | |||
| 2690 | Ga0207703_10007300 | |||
| 2691 | Ga0207703_10024363 | |||
| 2692 | Ga0207703_10954126 | |||
| 2693 | Ga0207703_11692618 | |||
| 2694 | Ga0207639_10007094 | |||
| 2695 | Ga0207639_10080350 | |||
| 2696 | Ga0207639_10115408 | |||
| 2697 | Ga0207639_10119541 | |||
| 2698 | Ga0207639_10152168 | |||
| 2699 | Ga0207639_10186404 | |||
| 2700 | Ga0207639_10227152 | |||
| 2701 | Ga0207639_10479516 | |||
| 2702 | Ga0207639_10493442 | |||
| 2703 | Ga0207639_10651089 | |||
| 2704 | Ga0207639_10703018 | |||
| 2705 | Ga0207639_10829321 | |||
| 2706 | Ga0207639_10903959 | |||
| 2707 | Ga0207678_10000559 | |||
| 2708 | Ga0207678_10052062 | |||
| 2709 | Ga0207678_10126711 | |||
| 2710 | Ga0207678_10140143 | |||
| 2711 | Ga0207678_10420163 | |||
| 2712 | Ga0207708_10017324 | |||
| 2713 | Ga0207708_10033118 | |||
| 2714 | Ga0207708_10053869 | |||
| 2715 | Ga0207708_11804890 | |||
| 2716 | Ga0207702_10054522 | |||
| 2717 | Ga0207702_10085922 | |||
| 2718 | Ga0207702_10132751 | |||
| 2719 | Ga0207702_10815088 | |||
| 2720 | Ga0207641_10029640 | |||
| 2721 | Ga0207641_10038081 | |||
| 2722 | Ga0207641_10048946 | |||
| 2723 | Ga0207641_10123371 | |||
| 2724 | Ga0207641_10687368 | |||
| 2725 | Ga0207641_10889449 | |||
| 2726 | Ga0207641_11075031 | |||
| 2727 | Ga0207641_11081626 | |||
| 2728 | Ga0207648_10000190 | |||
| 2729 | Ga0207648_10010947 | |||
| 2730 | Ga0207648_10014507 | |||
| 2731 | Ga0207648_10034096 | |||
| 2732 | Ga0207648_11188066 | |||
| 2733 | Ga0207648_11366950 | |||
| 2734 | Ga0207676_10002345 | |||
| 2735 | Ga0207676_10011240 | |||
| 2736 | Ga0207676_10017729 | |||
| 2737 | Ga0207676_10642783 | |||
| 2738 | Ga0207676_10790672 | |||
| 2739 | Ga0207676_12329353 | |||
| 2740 | Ga0207674_10001162 | |||
| 2741 | Ga0207674_10074425 | |||
| 2742 | Ga0207674_10081570 | |||
| 2743 | Ga0207674_10101285 | |||
| 2744 | Ga0207674_10149626 | |||
| 2745 | Ga0207674_10153642 | |||
| 2746 | Ga0207674_10238005 | |||
| 2747 | Ga0207675_100000193 | |||
| 2748 | Ga0207675_100001572 | |||
| 2749 | Ga0207675_100002043 | |||
| 2750 | Ga0207675_100006485 | |||
| 2751 | Ga0207675_100054555 | |||
| 2752 | Ga0207675_100098217 | |||
| 2753 | Ga0207675_100100972 | |||
| 2754 | Ga0207683_10003841 | |||
| 2755 | Ga0207683_10004611 | |||
| 2756 | Ga0207683_10017484 | |||
| 2757 | Ga0207683_10025958 | |||
| 2758 | Ga0207683_10045756 | |||
| 2759 | Ga0207683_10177776 | |||
| 2760 | Ga0207683_10314920 | |||
| 2761 | Ga0207698_10007753 | |||
| 2762 | Ga0207698_10206382 | |||
| 2763 | Ga0207698_10276096 | |||
| 2764 | Ga0207698_10453067 | |||
| 2765 | Ga0207698_10651990 | |||
| 2766 | Ga0207698_11564339 | |||
| 2767 | Ga0209389_1000019 | |||
| 2768 | Ga0209489_100033 | |||
| 2769 | Ga0209700_100012 | |||
| 2770 | Ga0209982_1031442 | |||
| 2771 | Ga0209971_1176112 | |||
| 2772 | Ga0209813_10003044 | |||
| 2773 | Ga0207428_10036832 | |||
| 2774 | Ga0207428_10080356 | |||
| 2775 | Ga0207428_10173906 | |||
| 2776 | Ga0207428_10269933 | |||
| 2777 | Ga0268266_10000001 | |||
| 2778 | Ga0268266_10000021 | |||
| 2779 | Ga0268266_10003780 | |||
| 2780 | Ga0268266_10004583 | |||
| 2781 | Ga0268266_10022537 | |||
| 2782 | Ga0268266_10022738 | |||
| 2783 | Ga0268266_10126557 | |||
| 2784 | Ga0268266_10346841 | |||
| 2785 | Ga0268266_10444342 | |||
| 2786 | Ga0268266_10994329 | |||
| 2787 | Ga0268266_11745028 | |||
| 2788 | Ga0268266_11925803 | |||
| 2789 | Ga0268265_10001621 | |||
| 2790 | Ga0268265_10019604 | |||
| 2791 | Ga0268265_10283200 | |||
| 2792 | Ga0268265_10350947 | |||
| 2793 | Ga0268265_10450796 | |||
| 2794 | Ga0268264_10010890 | |||
| 2795 | Ga0268264_10023850 | |||
| 2796 | Ga0268264_10123602 | |||
| 2797 | Ga0268264_10261546 | |||
| 2798 | Ga0268264_10319732 | |||
| 2799 | Ga0268264_10860190 | |||
| 2800 | Ga0268264_11698531 | |||
| 2801 | Ga0265337_1021972 | |||
| 2802 | Ga0265326_10031486 | |||
| 2803 | Ga0265319_1009046 | |||
| 2804 | Ga0265334_10011784 | |||
| 2805 | Ga0265323_10058859 | |||
| 2806 | Ga0265336_10005535 | |||
| 2807 | Ga0307517_10046637 | |||
| 2808 | Ga0307515_10156191 | |||
| 2809 | Ga0265338_10005770 | |||
| 2810 | Ga0265338_10031153 | |||
| 2811 | Ga0265338_10144576 | |||
| 2812 | Ga0265338_10385694 | |||
| 2813 | Ga0265338_10452043 | |||
| 2814 | Ga0265324_10013743 | |||
| 2815 | Ga0265330_10013773 | |||
| 2816 | Ga0265330_10059727 | |||
| 2817 | Ga0265330_10073819 | |||
| 2818 | Ga0265330_10114893 | |||
| 2819 | Ga0265332_10021862 | |||
| 2820 | Ga0265332_10072533 | |||
| 2821 | Ga0265328_10036684 | |||
| 2822 | Ga0265320_10136680 | |||
| 2823 | Ga0265320_10145760 | |||
| 2824 | Ga0265320_10174743 | |||
| 2825 | Ga0265325_10033483 | |||
| 2826 | Ga0265325_10093236 | |||
| 2827 | Ga0265339_10012788 | |||
| 2828 | Ga0265339_10170063 | |||
| 2829 | Ga0265331_10000129 | |||
| 2830 | Ga0265331_10018059 | |||
| 2831 | Ga0265331_10034446 | |||
| 2832 | Ga0265331_10042061 | |||
| 2833 | Ga0265327_10000044 | |||
| 2834 | Ga0265327_10278231 | |||
| 2835 | Ga0265316_10006416 | |||
| 2836 | Ga0265316_10023501 | |||
| 2837 | Ga0265316_10059600 | |||
| 2838 | Ga0265316_10588686 | |||
| 2839 | Ga0307513_10014455 | |||
| 2840 | Ga0307509_10000025 | |||
| 2841 | Ga0307509_10626380 | |||
| 2842 | Ga0307408_100000325 | |||
| 2843 | Ga0307408_100486732 | |||
| 2844 | Ga0307408_100861379 | |||
| 2845 | Ga0265313_10002621 | |||
| 2846 | Ga0265313_10076839 | |||
| 2847 | Ga0265313_10122971 | |||
| 2848 | Ga0265313_10130373 | |||
| 2849 | Ga0265313_10219654 | |||
| 2850 | Ga0265313_10380869 | |||
| 2851 | Ga0307508_10787789 | |||
| 2852 | Ga0265314_10013382 | |||
| 2853 | Ga0265314_10017718 | |||
| 2854 | Ga0265314_10023967 | |||
| 2855 | Ga0265314_10151541 | |||
| 2856 | Ga0265314_10355323 | |||
| 2857 | Ga0265314_10501382 | |||
| 2858 | Ga0265342_10088063 | |||
| 2859 | Ga0307516_10650493 | |||
| 2860 | Ga0307405_10380944 | |||
| 2861 | Ga0307410_11073703 | |||
| 2862 | Ga0307410_11733477 | |||
| 2863 | Ga0307406_11004938 | |||
| 2864 | Ga0307407_10000325 | |||
| 2865 | Ga0307412_10009315 | |||
| 2866 | Ga0307416_100011206 | |||
| 2867 | Ga0307416_100470454 | |||
| 2868 | Ga0307414_10951395 | |||
| 2869 | Ga0307411_10091173 | |||
| 2870 | Ga0307507_10421957 | |||
| 2871 | Ga0307510_10143309 | |||
| 2872 | Ga0373958_0039048 | |||
| 2873 | Ga0373926_0081791 | |||
| 2874 | Ga0373934_0006627 | |||
| 2875 | Ga0373934_0174175 | |||
| 2876 | Ga0373944_0018240 | |||
| 2877 | Ga0373944_0128499 | |||
| 2878 | Ga0373949_0124904 | |||
| 2879 | Ga0373951_0157447 | |||
| 2880 | Ga0373923_0009811 | |||
| 2881 | Ga0373923_0022007 | |||
| 2882 | Ga0373923_0246387 | |||
| 2883 | Ga0373936_0004232 | |||
| 2884 | Ga0373936_0412631 | |||
| 2885 | Ga0373936_0418425 | |||
| 2886 | Ga0373941_0396091 | |||
| 2887 | Ga0373945_0125292 | |||
| 2888 | Ga0373945_0572774 | |||
| 2889 | Ga0373953_0010558 | |||
| 2890 | Ga0373954_0000055 | |||
| 2891 | Ga0373954_0000204 | |||
| 2892 | Ga0373954_0114438 | |||
| 2893 | Ga0373954_0232098 | |||
| 2894 | Ga0373954_0456051 | |||
| 2895 | Ga0373956_0002438 | |||
| 2896 | Ga0373956_0067902 | |||
| 2897 | Ga0373956_0437689 | |||
| 2898 | Ga0373957_0035065 | |||
| 2899 | Ga0373943_0056140 | |||
| 2900 | Ga0373946_0001237 | |||
| 2901 | Ga0373946_0332051 | |||
| 2902 | Ga0373955_0157064 | |||
| 2903 | Ga0373955_0194885 | |||
| 2904 | Ga0373955_0525412 | |||
| 2905 | Ga0373955_0633595 | |||
| 2906 | Ga0373955_0861737 | |||
| 2907 | Ga0373955_0928148 | |||
| 2908 | Ga0373961_0422914 | |||
| 2909 | Ga0373962_0169095 | |||
| 2910 | Ga0373924_0056499 | |||
| 2911 | Ga0373924_0187126 | |||
| 2912 | Ga0373924_0227632 | |||
| 2913 | Ga0373924_0308467 | |||
| 2914 | Ga0373935_0071437 | |||
| 2915 | Ga0373935_0281370 | |||
| 2916 | Ga0373935_0413529 | |||
| 2917 | Ga0373935_0518172 | |||
| 2918 | Ga0373935_0548784 | |||
| 2919 | Ga0373935_0899293 | |||
| 2920 | Ga0373927_0025774 | |||
| 2921 | Ga0373927_0134686 | |||
| 2922 | Ga0373933_0000217 | |||
| 2923 | Ga0373933_0151831 | |||
| 2924 | Ga0373933_0182599 | |||
| 2925 | Ga0373933_0349704 | |||
| 2926 | Ga0373933_1162530 | |||
| 2927 | Ga0373947_0015951 | |||
| 2928 | Ga0373947_0080598 | |||
| 2929 | Ga0373947_0659745 | |||
| 2930 | Ga0373937_0003434 | |||
| 2931 | Ga0373937_0009154 | |||
| 2932 | Ga0373937_0095899 | |||
| 2933 | Ga0373937_0288016 | |||
| 2934 | Ga0373937_0618780 | |||
| 2935 | Ga0373937_0680509 | |||
| 2936 | Ga0373937_0787972 | |||
| 2937 | Ga0373937_1481279 | |||
| 2938 | Ga0373937_1789741 | |||
| 2939 | Ga0373925_0007673 | |||
| 2940 | Ga0373925_0036931 | |||
| 2941 | Ga0373925_0075599 | |||
| 2942 | Ga0373925_0296554 | |||
| 2943 | Ga0373925_1092558 | |||
| 2944 | Ga0395899_0015298 | |||
| 2945 | Ga0395899_0090344 | |||
| 2946 | Ga0395900_0029997 | |||
| 2947 | Ga0395900_0048114 | |||
| 2948 | Ga0395898_0005504 | |||
| 2949 | Ga0395898_0006215 | |||
| 2950 | Ga0395898_0649666 | |||
| 2951 | Ga0395898_1891221 | |||
| 2952 | Ga0395905_0088419 | |||
| 2953 | Ga0395905_0502047 | |||
| 2954 | Ga0395905_1290683 | |||
| 2955 | Ga0395905_1316408 | |||
| 2956 | Ga0436364_0188528 | |||
| 2957 | Ga0436364_0261445 | |||
| 2958 | Ga0436364_0424388 | |||
| 2959 | Ga0436364_0621490 | |||
| 2960 | Ga0436364_0638380 | |||
| 2961 | Ga0436364_1323035 | |||
| 2962 | Ga0395901_0043606 | |||
| 2963 | Ga0237816_00864 | |||
| 2964 | Ga0436365_0237040 | |||
| 2965 | Ga0436365_0347707 | |||
| 2966 | Ga0436365_0388218 | |||
| 2967 | Ga0436365_0431361 | |||
| 2968 | Ga0436365_0545909 | |||
| 2969 | Ga0436365_0655612 | |||
| 2970 | Ga0436365_1018828 | |||
| 2971 | Ga0436365_1496770 | |||
| 2972 | Ga0436360_0028296 | |||
| 2973 | Ga0436360_0042439 | |||
| 2974 | Ga0436360_0198558 | |||
| 2975 | Ga0436360_0318083 | |||
| 2976 | Ga0436360_0420362 | |||
| 2977 | Ga0436360_0460365 | |||
| 2978 | Ga0436360_0693855 | |||
| 2979 | Ga0436360_0775635 | |||
| 2980 | Ga0436361_0080522 | |||
| 2981 | Ga0436361_0147964 | |||
| 2982 | Ga0436361_0249946 | |||
| 2983 | Ga0436361_0298431 | |||
| 2984 | Ga0436361_0324977 | |||
| 2985 | Ga0436361_0574324 | |||
| 2986 | Ga0436361_0582807 | |||
| 2987 | Ga0436361_0688104 | |||
| 2988 | Ga0436361_0786290 | |||
| 2989 | Ga0436361_0804603 | |||
| 2990 | Ga0436361_0925853 | |||
| 2991 | Ga0436361_1066058 | |||
| 2992 | Ga0436361_1073388 | |||
| 2993 | Ga0436363_0134352 | |||
| 2994 | Ga0436363_0435549 | |||
| 2995 | Ga0436363_0534225 | |||
| 2996 | Ga0436363_0924720 | |||
| 2997 | Ga0436363_0952708 | |||
| 2998 | Ga0436363_1610909 | |||
| 2999 | Ga0436362_0101641 | |||
| 3000 | Ga0436362_0370145 | |||
| 3001 | Ga0436362_0546087 | |||
| 3002 | Ga0436362_0765821 | |||
| 3003 | Ga0436362_1083820 | |||
| 3004 | Ga0436362_1292496 | |||
| 3005 | Ga0451789_1364666 | |||
| 3006 | Ga0451793_0876891 | |||
| 3007 | Ga0451835_1133788 | |||
| 3008 | Ga0451839_0325131 | |||
| 3009 | Ga0451839_0824064 | |||
| 3010 | Ga0451839_1545218 | |||
| 3011 | Ga0451845_0986483 | |||
| 3012 | Ga0451843_1621180 | |||
| 3013 | Ga0451853_2008343 | |||
| 3014 | Ga0451853_3762953 | |||
| 3015 | Ga0439431_0199129 | |||
| 3016 | Ga0439448_0037453 | |||
| 3017 | Ga0451577_1821555 | |||
| 3018 | Ga0466969_0036637 | |||
| 3019 | Ga0466969_0040570 | |||
| 3020 | Ga0466969_0150888 | |||
| 3021 | Ga0466969_0291872 | |||
| 3022 | Ga0466972_0001620 | |||
| 3023 | Ga0466972_0158522 | |||
| 3024 | Ga0466972_0335588 | |||
| 3025 | Ga0466965_0280543 | |||
| 3026 | Ga0466966_0000632 | |||
| 3027 | Ga0466966_0023836 | |||
| 3028 | Ga0466966_0027141 | |||
| 3029 | Ga0466961_0000897 | |||
| 3030 | Ga0466961_0001874 | |||
| 3031 | Ga0466961_0059644 | |||
| 3032 | Ga0466963_0120269 | |||
| 3033 | Ga0466963_0604047 | |||
| 3034 | Ga0466963_1296588 | |||
| 3035 | Ga0466964_0229245 | |||
| 3036 | Ga0453684_0000497 | |||
| 3037 | Ga0466970_0059567 | |||
| 3038 | Ga0466970_0155617 | |||
| 3039 | Ga0466957_1379520 | |||
| 3040 | Ga0466960_0817079 | |||
| 3041 | Ga0466959_0004435 | |||
| 3042 | Ga0466959_0026954 | |||
| 3043 | Ga0466959_0149736 | |||
| 3044 | Ga0466959_1194577 | |||
| 3045 | Ga0451576_0027185 | |||
| 3046 | Ga0451576_0921795 | |||
| 3047 | Ga0451576_2124564 | |||
| 3048 | Ga0466958_0611734 | |||
| 3049 | Ga0466967_0033635 | |||
| 3050 | Ga0466967_0047012 | |||
| 3051 | Ga0466967_0095059 | |||
| 3052 | Ga0466967_0159258 | |||
| 3053 | Ga0495592_0566701 | |||
| 3054 | Ga0495603_0193078 | |||
| 3055 | Ga0495629_0000008 | |||
| 3056 | Ga0495629_0048582 | |||
| 3057 | Ga0495629_0354921 | |||
| 3058 | Ga0495638_0252630 | |||
| 3059 | Ga0495651_0038941 | |||
| 3060 | Ga0495653_0029611 | |||
| 3061 | Ga0495580_0184281 | |||
| 3062 | Ga0495582_0000674 | |||
| 3063 | Ga0495605_0201876 | |||
| 3064 | Ga0495639_0000567 | |||
| 3065 | Ga0495639_0634673 | |||
| 3066 | Ga0495662_0024433 | |||
| 3067 | Ga0495662_0255794 | |||
| 3068 | Ga0495662_0261575 | |||
| 3069 | Ga0495664_0506451 | |||
| 3070 | Ga0495584_0637620 | |||
| 3071 | Ga0495594_0134913 | |||
| 3072 | Ga0495608_0190739 | |||
| 3073 | Ga0495616_0031832 | |||
| 3074 | Ga0495628_0554772 | |||
| 3075 | Ga0495628_0857846 | |||
| 3076 | Ga0495628_1248318 | |||
| 3077 | Ga0495630_0040767 | |||
| 3078 | Ga0495630_0296071 | |||
| 3079 | Ga0495630_0508701 | |||
| 3080 | Ga0495643_0012071 | |||
| 3081 | Ga0495666_0000101 | |||
| 3082 | Ga0495642_0001940 | |||
| 3083 | Ga0495642_0263292 | |||
| 3084 | Ga0495665_0000193 | |||
| 3085 | Ga0495640_0931474 | |||
| 3086 | Ga0495586_0000818 | |||
| 3087 | Ga0495586_0162681 | |||
| 3088 | Ga0495586_0269614 | |||
| 3089 | Ga0495586_0304802 | |||
| 3090 | Ga0495598_0085544 | |||
| 3091 | Ga0495621_0267471 | |||
| 3092 | Ga0495597_0044566 | |||
| 3093 | Ga0495667_0363901 | |||
| 3094 | Ga0495656_0309272 | |||
| 3095 | Ga0495668_0294683 | |||
| 3096 | Ga0495668_0412140 | |||
| 3097 | Ga0495634_0518424 | |||
| 3098 | Ga0495625_0055245 | |||
| 3099 | Ga0495625_0091652 | |||
| 3100 | Ga0495635_0001435 | |||
| 3101 | Ga0495588_0493207 | |||
| 3102 | Ga0495657_0413528 | |||
| 3103 | Ga0495599_0608623 | |||
| 3104 | Ga0495647_0000581 | |||
| 3105 | Ga0495658_0022836 | |||
| 3106 | Ga0495658_0049229 | |||
| 3107 | Ga0495669_0260034 | |||
| 3108 | Ga0495613_0001075 | |||
| 3109 | Ga0495670_0525135 | |||
| 3110 | Ga0495671_0233660 | |||
| 3111 | Ga0495649_0291043 | |||
| 3112 | Ga0495600_0003122 | |||
| 3113 | Ga0495581_0000277 | |||
| 3114 | Ga0495581_0024157 | |||
| 3115 | Ga0495636_0531685 | |||
| 3116 | Ga0495676_0010268 | |||
| 3117 | Ga0495680_0060910 | |||
| 3118 | Ga0495680_0071991 | |||
| 3119 | Ga0495680_0351283 | |||
| 3120 | Ga0495683_0070881 | |||
| 3121 | Ga0495687_009164 | |||
| 3122 | Ga0495675_0854754 | |||
| 3123 | Ga0495684_0001806 | |||
| 3124 | Ga0495684_0806778 | |||
| 3125 | Ga0495686_0399255 | |||
| 3126 | Ga0495614_0589883 | |||
| 3127 | Ga0495626_0034476 | |||
| 3128 | Ga0496100_0334006 | |||
| 3129 | Ga0496100_0658885 | |||
| 3130 | Ga0496101_0488016 | |||
| 3131 | Ga0496101_0658182 | |||
| 3132 | Ga0496102_0008058 | |||
| 3133 | Ga0496102_0021064 | |||
| 3134 | Ga0496102_0063640 | |||
| 3135 | Ga0496102_0064831 | |||
| 3136 | Ga0496102_0235871 | |||
| 3137 | Ga0496102_1211100 | |||
| 3138 | Ga0496103_0002880 | |||
| 3139 | Ga0496103_0225619 | |||
| 3140 | Ga0496104_0000012 | |||
| 3141 | Ga0496104_0194686 | |||
| 3142 | Ga0496104_1801100 | |||
| 3143 | Ga0496105_0000011 | |||
| 3144 | Ga0496105_0101553 | |||
| 3145 | Ga0496105_0933591 | |||
| 3146 | Ga0496106_0078500 | |||
| 3147 | Ga0496106_0266847 | |||
| 3148 | Ga0496107_0524596 | |||
| 3149 | Ga0496108_0071447 | |||
| 3150 | Ga0496109_0135553 | |||
| 3151 | Ga0496109_0195265 | |||
| 3152 | Ga0496109_0587405 | |||
| 3153 | Ga0496110_0088410 | |||
| 3154 | Ga0496110_0264036 | |||
| 3155 | Ga0496112_0013319 | |||
| 3156 | Ga0496112_0073457 | |||
| 3157 | Ga0496112_0158196 | |||
| 3158 | Ga0496112_0227710 | |||
| 3159 | Ga0496112_1794814 | |||
| 3160 | Ga0496113_0210514 | |||
| 3161 | Ga0496113_0261612 | |||
| 3162 | Ga0496113_1029913 | |||
| 3163 | Ga0496114_0196049 | |||
| 3164 | Ga0496114_0577640 | |||
| 3165 | Ga0496115_0059226 | |||
| 3166 | Ga0496115_0371736 | |||
| 3167 | Ga0496115_0484488 | |||
| 3168 | Ga0496117_0028747 | |||
| 3169 | Ga0496117_0045774 | |||
| 3170 | Ga0496118_0000880 | |||
| 3171 | Ga0496118_0004511 | |||
| 3172 | Ga0496118_0081937 | |||
| 3173 | Ga0496118_0085703 | |||
| 3174 | Ga0496118_0509970 | |||
| 3175 | Ga0496119_0081422 | |||
| 3176 | Ga0496120_0257534 | |||
| 3177 | Ga0496121_0076712 | |||
| 3178 | Ga0496121_0153477 | |||
| 3179 | Ga0496122_0000362 | |||
| 3180 | Ga0496122_0148530 | |||
| 3181 | Ga0496123_0007188 | |||
| 3182 | Ga0496124_0358717 | |||
| 3183 | Ga0496125_0185509 | |||
| 3184 | Ga0496125_0481905 | |||
| 3185 | Ga0496125_0611136 | |||
| 3186 | Ga0496126_0000925 | |||
| 3187 | Ga0496126_0002985 | |||
| 3188 | Ga0496126_0009713 | |||
| 3189 | Ga0496126_0298061 | |||
| 3190 | Ga0496126_0526082 | |||
| 3191 | Ga0495682_0174201 | |||
| 3192 | Ga0495682_0290169 | |||
| 3193 | Ga0501299_006306 | |||
| 3194 | Ga0501300_011635 | |||
| 3195 | Ga0501031_0405268 | |||
| 3196 | Ga0501032_0044990 | |||
| 3197 | Ga0501032_0625142 | |||
| 3198 | Ga0501032_1080156 | |||
| 3199 | Ga0501033_0074978 | |||
| 3200 | Ga0501033_0142321 | |||
| 3201 | Ga0501033_0662937 | |||
| 3202 | Ga0501034_0015756 | |||
| 3203 | Ga0501034_0041700 | |||
| 3204 | Ga0501034_0090398 | |||
| 3205 | Ga0501034_0234996 | |||
| 3206 | Ga0501034_0335870 | |||
| 3207 | Ga0501034_0336393 | |||
| 3208 | Ga0501034_0874136 | |||
| 3209 | Ga0501036_0228874 | |||
| 3210 | Ga0501036_1065820 | |||
| 3211 | Ga0501037_0056565 | |||
| 3212 | Ga0501037_0209196 | |||
| 3213 | Ga0501037_0345967 | |||
| 3214 | Ga0501037_0466685 | |||
| 3215 | Ga0501037_0802820 | |||
| 3216 | Ga0501038_0008950 | |||
| 3217 | Ga0501038_0109654 | |||
| 3218 | Ga0501038_0483790 | |||
| 3219 | Ga0501038_1123182 | |||
| 3220 | Ga0501038_1243395 | |||
| 3221 | Ga0501039_0038123 | |||
| 3222 | Ga0501039_0332661 | |||
| 3223 | Ga0501042_0341385 | |||
| 3224 | Ga0501043_0052365 | |||
| 3225 | Ga0501043_0541773 | |||
| 3226 | Ga0501046_0056432 | |||
| 3227 | Ga0501046_1105322 | |||
| 3228 | Ga0501046_1254847 | |||
| 3229 | Ga0501047_0009209 | |||
| 3230 | Ga0501047_0020525 | |||
| 3231 | Ga0501047_0026810 | |||
| 3232 | Ga0501047_0044380 | |||
| 3233 | Ga0501047_0122539 | |||
| 3234 | Ga0501047_0167009 | |||
| 3235 | Ga0501047_0239052 | |||
| 3236 | Ga0501047_0406381 | |||
| 3237 | Ga0501047_0679303 | |||
| 3238 | Ga0501047_0980542 | |||
| 3239 | Ga0501047_1414123 | |||
| 3240 | Ga0501048_0705526 | |||
| 3241 | Ga0501067_0014186 | |||
| 3242 | Ga0501067_0136292 | |||
| 3243 | Ga0501068_0130993 | |||
| 3244 | Ga0501068_0386010 | |||
| 3245 | Ga0501069_0042044 | |||
| 3246 | Ga0501069_0229257 | |||
| 3247 | Ga0501070_0008723 | |||
| 3248 | Ga0501070_0010789 | |||
| 3249 | Ga0501070_0028488 | |||
| 3250 | Ga0501070_0029122 | |||
| 3251 | Ga0501070_0118340 | |||
| 3252 | Ga0501070_0134361 | |||
| 3253 | Ga0501070_0152012 | |||
| 3254 | Ga0501070_0247021 | |||
| 3255 | Ga0501070_0380264 | |||
| 3256 | Ga0501070_0663760 | |||
| 3257 | Ga0501073_0005196 | |||
| 3258 | Ga0501073_0022466 | |||
| 3259 | Ga0501073_0067293 | |||
| 3260 | Ga0501074_0010940 | |||
| 3261 | Ga0501074_0073799 | |||
| 3262 | Ga0501074_1287604 | |||
| 3263 | Ga0501217_018049 | |||
| 3264 | Ga0501248_012099 | |||
| 3265 | Ga0501249_033212 | |||
| 3266 | Ga0501249_172287 | |||
| 3267 | Ga0501259_023039 | |||
| 3268 | Ga0501261_016995 | |||
| 3269 | Ga0501225_0063523 | |||
| 3270 | Ga0501079_0109309 | |||
| 3271 | Ga0501079_0614234 | |||
| 3272 | Ga0501080_0002048 | |||
| 3273 | Ga0501080_0005634 | |||
| 3274 | Ga0501080_0015097 | |||
| 3275 | Ga0501080_0043668 | |||
| 3276 | Ga0501080_0076492 | |||
| 3277 | Ga0501080_0164295 | |||
| 3278 | Ga0501080_0226481 | |||
| 3279 | Ga0501080_0375644 | |||
| 3280 | Ga0501080_0494318 | |||
| 3281 | Ga0501080_0501904 | |||
| 3282 | Ga0501083_0019324 | |||
| 3283 | Ga0501083_0019536 | |||
| 3284 | Ga0501083_0026078 | |||
| 3285 | Ga0501083_0058230 | |||
| 3286 | Ga0501035_0022635 | |||
| 3287 | Ga0501035_0056896 | |||
| 3288 | Ga0501035_0057486 | |||
| 3289 | Ga0501035_0204139 | |||
| 3290 | Ga0501035_0325568 | |||
| 3291 | Ga0501044_0005549 | |||
| 3292 | Ga0501044_0046313 | |||
| 3293 | Ga0501044_0067893 | |||
| 3294 | Ga0501044_0068723 | |||
| 3295 | Ga0501044_0074192 | |||
| 3296 | Ga0501044_0096341 | |||
| 3297 | Ga0501044_0168202 | |||
| 3298 | Ga0501044_0287009 | |||
| 3299 | Ga0501044_0381800 | |||
| 3300 | Ga0501045_0838596 | |||
| 3301 | nmdc:mga03683_614804_c1 | |||
| 3302 | nmdc:mga03683_71801_c1 | |||
| 3303 | nmdc:mga03n38_239585_c1 | |||
| 3304 | nmdc:mga03n38_38953_c1 | |||
| 3305 | nmdc:mga03n38_625374_c1 | |||
| 3306 | nmdc:mga00v17_107719_c1 | |||
| 3307 | nmdc:mga00v17_15060_c1 | |||
| 3308 | nmdc:mga0yw44_50413_c1 | |||
| 3309 | nmdc:mga0yw44_75348_c1 | |||
| 3310 | nmdc:mga0k408_178216_c1 | |||
| 3311 | nmdc:mga0k408_20469_c1 | |||
| 3312 | nmdc:mga06z11_176425_c1 | |||
| 3313 | nmdc:mga06z11_19529_c1 | |||
| 3314 | nmdc:mga04h51_182307_c1 | |||
| 3315 | nmdc:mga04h51_7586_c1 | |||
| 3316 | nmdc:mga07m45_116710_c1 | |||
| 3317 | nmdc:mga07m45_33430_c1 | |||
| 3318 | nmdc:mga05p37_807525_c1 | |||
| 3319 | nmdc:mga05p37_845169_c1 | |||
| 3320 | nmdc:mga05p37_909833_c1 | |||
| 3321 | nmdc:mga05p37_95097_c1 | |||
| 3322 | nmdc:mga09592_312311_c1 | |||
| 3323 | nmdc:mga09592_418227_c1 | |||
| 3324 | nmdc:mga09592_625262_c1 | |||
| 3325 | nmdc:mga06r32_6533_c1 | |||
| 3326 | nmdc:mga06r32_691792_c1 | |||
| 3327 | nmdc:mga08y16_1360663_c1 | |||
| 3328 | nmdc:mga08y16_141932_c1 | |||
| 3329 | nmdc:mga08y16_294013_c1 | |||
| 3330 | nmdc:mga08y16_57347_c1 | |||
| 3331 | nmdc:mga08y16_648382_c1 | |||
| 3332 | nmdc:mga0n895_1176277_c1 | |||
| 3333 | nmdc:mga0n895_182902_c1 | |||
| 3334 | nmdc:mga0n895_27801_c1 | |||
| 3335 | nmdc:mga0n895_5651_c1 | |||
| 3336 | nmdc:mga0n895_56967_c1 | |||
| 3337 | nmdc:mga0n895_574417_c1 | |||
| 3338 | nmdc:mga0rr50_10123_c1 | |||
| 3339 | nmdc:mga0rr50_160039_c1 | |||
| 3340 | nmdc:mga0rr50_610163_c1 | |||
| 3341 | nmdc:mga0rr50_980580_c1 | |||
| 3342 | nmdc:mga08x19_138789_c1 | |||
| 3343 | nmdc:mga08x19_689792_c1 | |||
| 3344 | nmdc:mga0a205_17434_c1 | |||
| 3345 | nmdc:mga0a205_316383_c1 | |||
| 3346 | nmdc:mga0a205_49650_c1 | |||
| 3347 | nmdc:mga0sz30_17585_c1 | |||
| 3348 | nmdc:mga0sz30_33593_c1 | |||
| 3349 | nmdc:mga0sz30_487879_c1 | |||
| 3350 | Ga0495601_0473726 | |||
| 3351 | Ga0495595_0120686 | |||
| 3352 | Ga0495595_0472973 | |||
| 3353 | Ga0495619_0002446 | |||
| 3354 | Ga0500578_0062105 | |||
| 3355 | Ga0500578_0142102 | |||
| 3356 | Ga0500643_000013 | |||
| 3357 | Ga0500643_025816 | |||
| 3358 | Ga0500643_189535 | |||
| 3359 | Ga0500651_0163854 | |||
| 3360 | Ga0500650_0183400 | |||
| 3361 | Ga0500554_098060 | |||
| 3362 | Ga0500555_000025 | |||
| 3363 | Ga0500556_0005981 | |||
| 3364 | Ga0500572_027263 | |||
| 3365 | Ga0500592_012176 | |||
| 3366 | Ga0500595_086825 | |||
| 3367 | Ga0500597_155413 | |||
| 3368 | Ga0500614_165965 | |||
| 3369 | Ga0500655_039097 | |||
| 3370 | Ga0500658_0141013 | |||
| 3371 | Ga0500559_0003975 | |||
| 3372 | Ga0500564_017840 | |||
| 3373 | Ga0500616_0040971 | |||
| 3374 | Ga0500619_149021 | |||
| 3375 | Ga0500637_0425958 | |||
| 3376 | Ga0500645_011279 | |||
| 3377 | Ga0501084_0048326 | |||
| 3378 | Ga0587111_0194149 | |||
| 3379 | Ga0501082_0000176 | |||
| 3380 | Ga0501082_0005084 | |||
| 3381 | Ga0501082_0112348 | |||
| 3382 | Ga0466962_0409353 | |||
| 3383 | 2512351273 | |||
| 3384 | 2515684689 | |||
| 3385 | 2885280123 | |||
| 3386 | 2888386441 | |||
| 3387 | 2889036727 | |||
| 3388 | 2902684507 | |||
| 3389 | 2932791551 | |||
| 3390 | 2932835454 | |||
| 3391 | 2935613545 | |||
| 3392 | 2935643484 | |||
| 3393 | 2935710760 | |||
| 3394 | 2935824602 | |||
| 3395 | 2935833001 | |||
| 3396 | 2935844327 | |||
| 3397 | 2935851822 | |||
| 3398 | 2935996710 | |||
| 3399 | 3005724066 | |||
| 3400 | 8017065969 | |||
| 3401 | 8019578681 | |||
| 3402 | 8019596718 | |||
| 3403 | 8019604971 | |||
| 3404 | 8019613562 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9599 | 2 | 68 |
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.9403 | 12 | 69 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9217 | 13 | 69 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9193 | 2 | 76 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9144 | 11 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.956 | 10 | 67 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9419 | 6 | 71 | 1.10.10.10 |
| 4ijaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9403 | 12 | 69 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9403 | 10 | 69 | 1.10.10.10 |
| af_O94553_12_71_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9308 | 14 | 67 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526V880-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9943 | 2 | 70 |
GO:0003700
|
| AF-A0A2I0N826-F1-model_v4 | HTH arsR-type domain-containing protein | 0.982 | 2 | 68 |
GO:0003700
|
| AF-A0A659UVB0-F1-model_v4 | ArsR family transcriptional regulator | 0.9733 | 1 | 73 |
GO:0003700
|
| AF-A0A7M1Q0U5-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9661 | 2 | 69 |
GO:0003700
|
| AF-A0A2W2ATM0-F1-model_v4 | Transcriptional regulator | 0.9651 | 2 | 70 |
GO:0003700
GO:0005737 |