F495398

General Info

Members Datasets Scaffolds Average Seq Length
1702 553 3404 109

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0101847|Ga0373930_0101847_223_558
Length 105
Sequence MTERRRDTDLLFKALADPGRRKLLDLLHAHDGQTLNELCEHLDMTRQGLLQAANLVASVRRGREKLHFLNPVPLQEIYERWIAKFEKPRLKALGDLKRRLEKGNG

Samples

Sample ID Description Type Environment
1 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
130 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
152 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
174 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
175 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
265 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
266 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
267 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
270 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
275 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
276 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
277 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
278 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
279 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
280 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
281 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
282 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
283 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
284 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
285 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
286 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
287 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
288 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
289 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
290 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
291 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
292 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
295 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
296 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
297 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
298 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
299 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
300 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
301 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
302 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
305 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
306 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
307 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
308 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
309 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
310 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
311 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
312 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
313 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
314 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
315 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
316 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
317 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
318 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
320 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
321 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
322 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
323 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
324 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
325 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
326 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
327 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
328 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
329 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
332 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
333 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
334 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
335 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
338 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
339 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
340 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
341 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
342 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
343 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
344 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
345 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
349 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
350 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
351 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
352 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
353 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
354 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
355 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
356 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
357 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
358 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
359 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
360 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
361 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
362 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
363 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
364 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
365 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
366 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
367 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
368 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
369 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
370 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
371 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
372 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
373 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
374 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
375 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
376 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
377 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
378 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
379 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
380 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
381 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
382 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
383 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
384 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
385 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
386 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
387 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
388 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
389 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
390 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
391 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
392 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
399 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
400 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
403 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
404 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
405 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
406 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
409 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
410 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
415 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
416 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
417 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
418 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
421 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
422 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
425 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
426 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
427 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
448 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
449 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
450 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
456 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
457 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
472 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
473 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
474 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
475 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
476 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
477 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
478 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
479 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
480 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
481 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
482 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
485 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
488 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
489 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
490 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
491 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
492 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
493 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
494 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
495 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
496 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
497 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
498 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
499 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
500 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
501 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
502 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
503 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
504 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
505 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
506 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
507 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
508 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
509 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
510 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
511 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
512 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
513 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
514 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
515 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
516 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
517 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
518 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
519 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
520 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
521 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
522 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
523 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
524 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
525 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
526 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
527 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
528 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
529 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
532 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
533 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
534 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
535 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
536 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
537 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
538 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
539 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
540 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
541 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
542 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
543 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
544 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
545 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
546 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
547 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
548 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
549 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
550 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
551 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
552 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
553 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.06
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 1.35
Rhizoplane 2.47
Rhizosphere 84.84
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373930_0101847 3300034816 Bacteria 684
2 JGI24736J21556_1015368 3300001904 Bacteria 1226
3 JGI24736J21556_1021579 3300001904 Bacteria 1010
4 JGI24739J22299_10073599 3300001989 Bacteria 1060
5 JGI24737J22298_10091082 3300001990 Bacteria 904
6 JGI24748J21848_1001755 3300002074 Bacteria 2404
7 JGI24751J29686_10050174 3300002459 Bacteria 861
8 JGI24751J29686_10130390 3300002459 Bacteria 530
9 JGI25156J39149_1008617 3300002705 Bacteria 2550
10 JGI25162J39368_1003180 3300002737 Bacteria 5119
11 JGI25157J39369_1004429 3300002741 Bacteria 2547
12 JGI25164J39214_1001517 3300002772 Bacteria 5189
13 JGI25165J46597_1002740 3300003214 Bacteria 5189
14 JGI25153J46596_10006212 3300003215 Bacteria 6113
15 JGI25153J46596_10027181 3300003215 Bacteria 2010
16 rootH2_10080896 3300003320 Bacteria 2066
17 JGI25160J50197_1027724 3300003354 Bacteria 1535
18 JGI25404J52841_10005248 3300003659 Bacteria 2671
19 Ga0055525_1003849 3300003759 Bacteria 1309
20 Ga0055527_1001410 3300003760 Bacteria 5081
21 Ga0055535_1000762 3300003761 Bacteria 23888
22 Ga0055535_1001669 3300003761 Bacteria 10205
23 Ga0055542_1001204 3300003762 Bacteria 14617
24 Ga0055542_1001618 3300003762 Bacteria 10232
25 Ga0055542_1028182 3300003762 Bacteria 742
26 Ga0055529_1000969 3300003763 Bacteria 14617
27 Ga0055529_1011211 3300003763 Bacteria 1154
28 Ga0055524_1032917 3300003775 Bacteria 1460
29 Ga0055540_1002653 3300003792 Bacteria 9250
30 Ga0055540_1089684 3300003792 Bacteria 581
31 Ga0055531_10000002 3300003794 Bacteria 421971
32 Ga0055531_10000234 3300003794 Bacteria 60772
33 Ga0055531_10001156 3300003794 Bacteria 20372
34 Ga0055531_10054756 3300003794 Bacteria 1020
35 Ga0065165_1001827 3300005262 Bacteria 20819
36 Ga0065165_1004722 3300005262 Bacteria 8180
37 Ga0065714_10156014 3300005288 Bacteria 1078
38 Ga0065712_10004533 3300005290 Bacteria 3471
39 Ga0065712_10086972 3300005290 Bacteria 2605
40 Ga0065715_10032818 3300005293 Bacteria 2390
41 Ga0065715_10092414 3300005293 Bacteria 5131
42 Ga0065715_10100822 3300005293 Bacteria 3266
43 Ga0065715_10348883 3300005293 Bacteria 954
44 Ga0065707_10088244 3300005295 Bacteria 4726
45 Ga0070658_10041393 3300005327 Bacteria 3717
46 Ga0070658_10047697 3300005327 Bacteria 3466
47 Ga0070676_10136820 3300005328 Bacteria 1555
48 Ga0070676_10654731 3300005328 Bacteria 763
49 Ga0070683_100020285 3300005329 Bacteria 5914
50 Ga0070683_100049047 3300005329 Bacteria 3904
51 Ga0070683_100277955 3300005329 Bacteria 1593
52 Ga0070683_100290013 3300005329 Bacteria 1556
53 Ga0070683_100813273 3300005329 Bacteria 896
54 Ga0070690_100000659 3300005330 Bacteria 17618
55 Ga0070690_100016640 3300005330 Bacteria 4409
56 Ga0070690_100050230 3300005330 Bacteria 2660
57 Ga0070690_100229506 3300005330 Bacteria 1304
58 Ga0070690_100520157 3300005330 Bacteria 893
59 Ga0070670_100006270 3300005331 Bacteria 10067
60 Ga0070670_100130867 3300005331 Bacteria 2167
61 Ga0070670_100131109 3300005331 Bacteria 2164
62 Ga0070670_100143258 3300005331 Bacteria 2067
63 Ga0070670_100200923 3300005331 Bacteria 1732
64 Ga0070677_10014260 3300005333 Bacteria 2795
65 Ga0070677_10801587 3300005333 Bacteria 538
66 Ga0068869_100015358 3300005334 Bacteria 5135
67 Ga0068869_100274307 3300005334 Bacteria 1354
68 Ga0068869_101044454 3300005334 Bacteria 713
69 Ga0068869_101799850 3300005334 Bacteria 548
70 Ga0070666_10000003 3300005335 Bacteria 463666
71 Ga0070666_10007556 3300005335 Bacteria 6702
72 Ga0070666_10009620 3300005335 Bacteria 6033
73 Ga0070666_10035307 3300005335 Bacteria 3316
74 Ga0070666_10787675 3300005335 Bacteria 700
75 Ga0070666_11011814 3300005335 Bacteria 617
76 Ga0070666_11095102 3300005335 Bacteria 592
77 Ga0070680_100000638 3300005336 Bacteria 24374
78 Ga0070680_100031410 3300005336 Bacteria 4270
79 Ga0070680_100175521 3300005336 Bacteria 1804
80 Ga0070680_100711817 3300005336 Bacteria 864
81 Ga0070680_100738049 3300005336 Bacteria 848
82 Ga0070680_100791529 3300005336 Bacteria 817
83 Ga0070680_100847624 3300005336 Bacteria 788
84 Ga0070680_101074013 3300005336 Bacteria 696
85 Ga0070682_100116774 3300005337 Bacteria 1786
86 Ga0070682_101015800 3300005337 Bacteria 689
87 Ga0068868_100228042 3300005338 Bacteria 1562
88 Ga0068868_100248784 3300005338 Bacteria 1496
89 Ga0068868_101437998 3300005338 Bacteria 644
90 Ga0068868_101569680 3300005338 Bacteria 618
91 Ga0068868_102172133 3300005338 Bacteria 529
92 Ga0070660_100140461 3300005339 Bacteria 1937
93 Ga0070660_101467951 3300005339 Bacteria 580
94 Ga0070689_100055855 3300005340 Bacteria 3061
95 Ga0070689_101112229 3300005340 Bacteria 706
96 Ga0070691_10046365 3300005341 Bacteria 2064
97 Ga0070691_10647447 3300005341 Bacteria 629
98 Ga0070691_10869850 3300005341 Bacteria 554
99 Ga0070687_100088033 3300005343 Bacteria 1711
100 Ga0070687_100099644 3300005343 Bacteria 1624
101 Ga0070687_100107919 3300005343 Bacteria 1570
102 Ga0070661_100034824 3300005344 Bacteria 3654
103 Ga0070661_100062488 3300005344 Bacteria 2734
104 Ga0070661_100153662 3300005344 Bacteria 1741
105 Ga0070661_101515868 3300005344 Bacteria 566
106 Ga0070692_10000442 3300005345 Bacteria 12631
107 Ga0070692_11237327 3300005345 Bacteria 533
108 Ga0070668_100016018 3300005347 Bacteria 5609
109 Ga0070668_100211729 3300005347 Bacteria 1595
110 Ga0070668_100283304 3300005347 Bacteria 1385
111 Ga0070668_101795866 3300005347 Bacteria 564
112 Ga0070668_102059136 3300005347 Bacteria 527
113 Ga0070669_100007961 3300005353 Bacteria 7570
114 Ga0070669_100008649 3300005353 Bacteria 7263
115 Ga0070669_100681976 3300005353 Bacteria 866
116 Ga0070675_100001805 3300005354 Bacteria 15819
117 Ga0070675_100051449 3300005354 Bacteria 3385
118 Ga0070675_100119903 3300005354 Bacteria 2234
119 Ga0070675_100309809 3300005354 Bacteria 1393
120 Ga0070675_101082719 3300005354 Bacteria 737
121 Ga0070671_100007395 3300005355 Bacteria 8775
122 Ga0070671_100024351 3300005355 Bacteria 4955
123 Ga0070671_100093484 3300005355 Bacteria 2520
124 Ga0070671_100289321 3300005355 Bacteria 1394
125 Ga0070671_100455641 3300005355 Bacteria 1098
126 Ga0070671_100491859 3300005355 Bacteria 1055
127 Ga0070674_100022583 3300005356 Bacteria 4060
128 Ga0070674_100042177 3300005356 Bacteria 3098
129 Ga0070674_100045473 3300005356 Bacteria 3000
130 Ga0070674_101501177 3300005356 Bacteria 606
131 Ga0070673_100023355 3300005364 Bacteria 4518
132 Ga0070673_100123685 3300005364 Bacteria 2162
133 Ga0070673_100257426 3300005364 Bacteria 1523
134 Ga0070673_100415335 3300005364 Bacteria 1205
135 Ga0070673_100862872 3300005364 Bacteria 838
136 Ga0070673_101726887 3300005364 Bacteria 592
137 Ga0070688_100014662 3300005365 Bacteria 4445
138 Ga0070688_100031832 3300005365 Bacteria 3175
139 Ga0070688_100089508 3300005365 Bacteria 2009
140 Ga0070688_100590431 3300005365 Bacteria 849
141 Ga0070688_100597938 3300005365 Bacteria 844
142 Ga0070659_100015121 3300005366 Bacteria 5773
143 Ga0070659_100160980 3300005366 Bacteria 1835
144 Ga0070659_101317445 3300005366 Bacteria 641
145 Ga0070667_100000049 3300005367 Bacteria 158483
146 Ga0070667_100000129 3300005367 Bacteria 95291
147 Ga0070667_100012603 3300005367 Bacteria 6992
148 Ga0070667_100026817 3300005367 Bacteria 4795
149 Ga0070667_100040730 3300005367 Bacteria 3896
150 Ga0070667_100247162 3300005367 Bacteria 1594
151 Ga0070667_100312819 3300005367 Bacteria 1416
152 Ga0070667_100342111 3300005367 Bacteria 1353
153 Ga0070667_100410628 3300005367 Bacteria 1233
154 Ga0070709_10014894 3300005434 Bacteria 4412
155 Ga0070709_10305038 3300005434 Bacteria 1164
156 Ga0070714_101106298 3300005435 Bacteria 772
157 Ga0070714_102492986 3300005435 Bacteria 502
158 Ga0070713_100041356 3300005436 Bacteria 3755
159 Ga0070713_100347421 3300005436 Bacteria 1376
160 Ga0070713_101044927 3300005436 Bacteria 789
161 Ga0070710_10140852 3300005437 Bacteria 1479
162 Ga0070701_10021041 3300005438 Bacteria 3107
163 Ga0070711_100057363 3300005439 Bacteria 2696
164 Ga0070711_100576702 3300005439 Bacteria 936
165 Ga0070711_100823062 3300005439 Bacteria 789
166 Ga0070711_100954301 3300005439 Bacteria 734
167 Ga0070711_101217193 3300005439 Bacteria 652
168 Ga0070705_100015101 3300005440 Bacteria 3984
169 Ga0070705_100043853 3300005440 Bacteria 2566
170 Ga0070705_101119988 3300005440 Bacteria 645
171 Ga0070700_100017632 3300005441 Bacteria 4089
172 Ga0070700_100032982 3300005441 Bacteria 3117
173 Ga0070700_101287421 3300005441 Bacteria 614
174 Ga0070700_101445052 3300005441 Bacteria 583
175 Ga0070694_100046149 3300005444 Bacteria 2923
176 Ga0070694_100238867 3300005444 Bacteria 1370
177 Ga0070708_100007506 3300005445 Bacteria 8732
178 Ga0070708_100104501 3300005445 Bacteria 2597
179 Ga0070708_100250706 3300005445 Bacteria 1663
180 Ga0070708_101612547 3300005445 Bacteria 604
181 Ga0070663_100000996 3300005455 Bacteria 15418
182 Ga0070663_100056941 3300005455 Bacteria 2802
183 Ga0070663_100376719 3300005455 Bacteria 1155
184 Ga0070663_100771079 3300005455 Bacteria 823
185 Ga0070678_100004888 3300005456 Bacteria 7662
186 Ga0070678_100009831 3300005456 Bacteria 5815
187 Ga0070678_100017870 3300005456 Bacteria 4579
188 Ga0070678_100239862 3300005456 Bacteria 1515
189 Ga0070678_100244482 3300005456 Bacteria 1502
190 Ga0070678_100522920 3300005456 Bacteria 1050
191 Ga0070678_100853711 3300005456 Bacteria 830
192 Ga0070662_100009850 3300005457 Bacteria 6263
193 Ga0070662_100034756 3300005457 Bacteria 3556
194 Ga0070662_100131686 3300005457 Bacteria 1929
195 Ga0070662_100153920 3300005457 Bacteria 1793
196 Ga0070662_100680658 3300005457 Bacteria 869
197 Ga0070662_101468429 3300005457 Bacteria 588
198 Ga0070681_10007731 3300005458 Bacteria 10509
199 Ga0070681_10014089 3300005458 Bacteria 7958
200 Ga0070681_10030015 3300005458 Bacteria 5456
201 Ga0070681_10032470 3300005458 Bacteria 5239
202 Ga0070681_10033693 3300005458 Bacteria 5142
203 Ga0070681_10081128 3300005458 Bacteria 3199
204 Ga0068867_100006360 3300005459 Bacteria 8349
205 Ga0068867_100070879 3300005459 Bacteria 2606
206 Ga0068867_100113935 3300005459 Bacteria 2081
207 Ga0068867_100215995 3300005459 Bacteria 1543
208 Ga0068867_100696485 3300005459 Bacteria 896
209 Ga0068867_100741118 3300005459 Bacteria 871
210 Ga0070685_10007147 3300005466 Bacteria 5702
211 Ga0070685_10036196 3300005466 Bacteria 2789
212 Ga0070685_10120106 3300005466 Bacteria 1631
213 Ga0070685_10144937 3300005466 Bacteria 1499
214 Ga0070706_100027551 3300005467 Bacteria 5230
215 Ga0070706_100029141 3300005467 Bacteria 5086
216 Ga0070706_100081152 3300005467 Bacteria 3003
217 Ga0070706_100083087 3300005467 Bacteria 2967
218 Ga0070706_100342122 3300005467 Bacteria 1395
219 Ga0070707_100013711 3300005468 Bacteria 7589
220 Ga0070707_100318835 3300005468 Bacteria 1510
221 Ga0070707_100428217 3300005468 Unclassified 1284
222 Ga0070707_100630514 3300005468 Bacteria 1034
223 Ga0070698_100013139 3300005471 Bacteria 8761
224 Ga0070698_100080159 3300005471 Bacteria 3260
225 Ga0070698_101058083 3300005471 Bacteria 759
226 Ga0070698_101499655 3300005471 Bacteria 626
227 Ga0070699_100003254 3300005518 Bacteria 14368
228 Ga0070699_100035623 3300005518 Bacteria 4302
229 Ga0070699_101109535 3300005518 Bacteria 726
230 Ga0070699_101776121 3300005518 Bacteria 565
231 Ga0070679_100021255 3300005530 Bacteria 6332
232 Ga0070679_100123725 3300005530 Bacteria 2570
233 Ga0070679_100124837 3300005530 Bacteria 2557
234 Ga0070679_100213575 3300005530 Bacteria 1892
235 Ga0070679_100382984 3300005530 Unclassified 1353
236 Ga0070679_100967722 3300005530 Bacteria 795
237 Ga0070684_100004144 3300005535 Bacteria 10977
238 Ga0070684_100028623 3300005535 Bacteria 4714
239 Ga0070684_100683871 3300005535 Bacteria 956
240 Ga0070684_101069725 3300005535 Bacteria 758
241 Ga0070697_100214933 3300005536 Bacteria 1638
242 Ga0068853_100036182 3300005539 Bacteria 4196
243 Ga0068853_100099539 3300005539 Bacteria 2569
244 Ga0068853_100151065 3300005539 Bacteria 2091
245 Ga0068853_100423338 3300005539 Bacteria 1249
246 Ga0068853_100487050 3300005539 Bacteria 1163
247 Ga0068853_100531181 3300005539 Bacteria 1113
248 Ga0068853_100864318 3300005539 Bacteria 868
249 Ga0068853_101228614 3300005539 Bacteria 724
250 Ga0068853_101428108 3300005539 Bacteria 669
251 Ga0070672_100006524 3300005543 Bacteria 7845
252 Ga0070672_100015810 3300005543 Bacteria 5388
253 Ga0070672_100058961 3300005543 Bacteria 3019
254 Ga0070672_100080617 3300005543 Bacteria 2608
255 Ga0070672_100123772 3300005543 Bacteria 2119
256 Ga0070672_100760359 3300005543 Bacteria 851
257 Ga0070686_100002162 3300005544 Bacteria 10852
258 Ga0070686_100023877 3300005544 Bacteria 3660
259 Ga0070686_100377933 3300005544 Bacteria 1072
260 Ga0070686_100860861 3300005544 Bacteria 735
261 Ga0070695_100093500 3300005545 Bacteria 2012
262 Ga0070695_100466232 3300005545 Bacteria 971
263 Ga0070695_100878395 3300005545 Bacteria 723
264 Ga0070696_100010558 3300005546 Bacteria 6191
265 Ga0070696_100363884 3300005546 Bacteria 1123
266 Ga0070696_100579027 3300005546 Bacteria 903
267 Ga0070696_100865066 3300005546 Bacteria 748
268 Ga0070696_101490183 3300005546 Bacteria 579
269 Ga0070693_100014679 3300005547 Bacteria 4020
270 Ga0070693_100040083 3300005547 Bacteria 2628
271 Ga0070693_100148259 3300005547 Bacteria 1483
272 Ga0070693_100335024 3300005547 Bacteria 1031
273 Ga0070693_100586110 3300005547 Bacteria 803
274 Ga0070665_100000237 3300005548 Bacteria 91478
275 Ga0070665_100000467 3300005548 Bacteria 58613
276 Ga0070665_100003434 3300005548 Bacteria 16915
277 Ga0070665_100017979 3300005548 Bacteria 7098
278 Ga0070665_100088467 3300005548 Bacteria 3103
279 Ga0070665_100099051 3300005548 Bacteria 2919
280 Ga0070665_100250580 3300005548 Bacteria 1771
281 Ga0070665_101173373 3300005548 Bacteria 779
282 Ga0070704_100045537 3300005549 Bacteria 3053
283 Ga0070704_100351708 3300005549 Bacteria 1244
284 Ga0068855_100002756 3300005563 Bacteria 21628
285 Ga0068855_100020476 3300005563 Bacteria 7931
286 Ga0068855_100030244 3300005563 Bacteria 6478
287 Ga0068855_100135511 3300005563 Bacteria 2810
288 Ga0068855_100339807 3300005563 Bacteria 1656
289 Ga0068855_100342971 3300005563 Bacteria 1647
290 Ga0068855_100982028 3300005563 Bacteria 888
291 Ga0068855_101052532 3300005563 Bacteria 853
292 Ga0068855_101125542 3300005563 Unclassified 820
293 Ga0070664_100000362 3300005564 Bacteria 33490
294 Ga0070664_100041317 3300005564 Bacteria 3891
295 Ga0068857_100073578 3300005577 Bacteria 3045
296 Ga0068857_100079857 3300005577 Bacteria 2920
297 Ga0068857_100099565 3300005577 Bacteria 2608
298 Ga0068857_100110701 3300005577 Bacteria 2468
299 Ga0068857_100206056 3300005577 Bacteria 1794
300 Ga0068854_100011931 3300005578 Bacteria 5678
301 Ga0068854_100045286 3300005578 Bacteria 3127
302 Ga0068854_100791533 3300005578 Bacteria 826
303 Ga0068854_102008009 3300005578 Bacteria 533
304 Ga0068856_100044226 3300005614 Bacteria 4382
305 Ga0068856_100064653 3300005614 Bacteria 3615
306 Ga0068856_100094722 3300005614 Bacteria 2973
307 Ga0068856_100219676 3300005614 Bacteria 1916
308 Ga0068856_102496730 3300005614 Bacteria 523
309 Ga0068856_102709913 3300005614 Bacteria 501
310 Ga0070702_100026748 3300005615 Bacteria 3104
311 Ga0070702_100072830 3300005615 Bacteria 2034
312 Ga0068852_100231081 3300005616 Bacteria 1763
313 Ga0068852_100943426 3300005616 Bacteria 881
314 Ga0068859_100005230 3300005617 Bacteria 13184
315 Ga0068859_100028400 3300005617 Bacteria 5608
316 Ga0068859_100037124 3300005617 Bacteria 4890
317 Ga0068859_100097986 3300005617 Bacteria 2985
318 Ga0068859_100311441 3300005617 Bacteria 1668
319 Ga0068859_100319350 3300005617 Bacteria 1647
320 Ga0068859_102100052 3300005617 Bacteria 624
321 Ga0068864_100011349 3300005618 Bacteria 7362
322 Ga0068864_100319550 3300005618 Bacteria 1458
323 Ga0068866_10002285 3300005718 Bacteria 7933
324 Ga0068861_100003766 3300005719 Bacteria 10123
325 Ga0068861_100006557 3300005719 Bacteria 7940
326 Ga0068861_100007838 3300005719 Bacteria 7343
327 Ga0068861_100068962 3300005719 Bacteria 2734
328 Ga0068861_100268072 3300005719 Bacteria 1465
329 Ga0068861_100319549 3300005719 Bacteria 1351
330 Ga0068861_100641916 3300005719 Bacteria 980
331 Ga0068861_101207406 3300005719 Bacteria 732
332 Ga0068851_10014356 3300005834 Bacteria 3760
333 Ga0068870_10009855 3300005840 Bacteria 4362
334 Ga0068870_10370568 3300005840 Bacteria 924
335 Ga0068863_100004078 3300005841 Bacteria 14429
336 Ga0068863_100033197 3300005841 Bacteria 4917
337 Ga0068863_100061050 3300005841 Bacteria 3564
338 Ga0068863_100074994 3300005841 Bacteria 3201
339 Ga0068863_100385673 3300005841 Bacteria 1369
340 Ga0068863_100838622 3300005841 Bacteria 918
341 Ga0068863_101147526 3300005841 Bacteria 782
342 Ga0068863_102385079 3300005841 Bacteria 539
343 Ga0068858_100003914 3300005842 Bacteria 14709
344 Ga0068858_100990037 3300005842 Bacteria 824
345 Ga0068858_101034605 3300005842 Bacteria 805
346 Ga0068858_101151667 3300005842 Bacteria 762
347 Ga0068858_101703257 3300005842 Bacteria 623
348 Ga0068860_100014505 3300005843 Bacteria 7712
349 Ga0068860_100025718 3300005843 Bacteria 5677
350 Ga0068860_100242578 3300005843 Bacteria 1753
351 Ga0068860_100337738 3300005843 Bacteria 1481
352 Ga0068860_101127087 3300005843 Bacteria 804
353 Ga0068862_100000710 3300005844 Bacteria 33992
354 Ga0068862_100000773 3300005844 Bacteria 31853
355 Ga0068862_100006742 3300005844 Bacteria 9521
356 Ga0068862_100082694 3300005844 Bacteria 2787
357 Ga0068862_101169141 3300005844 Bacteria 767
358 Ga0081455_10003552 3300005937 Bacteria 17896
359 Ga0081455_10100711 3300005937 Bacteria 2320
360 Ga0081540_1000377 3300005983 Bacteria 44639
361 Ga0081540_1003811 3300005983 Bacteria 11795
362 Ga0081540_1027419 3300005983 Bacteria 3228
363 Ga0081539_10197392 3300005985 Bacteria 932
364 Ga0081539_10240319 3300005985 Bacteria 811
365 Ga0070717_10243931 3300006028 Bacteria 1585
366 Ga0070717_10285058 3300006028 Bacteria 1466
367 Ga0070717_10708318 3300006028 Bacteria 915
368 Ga0070717_10713291 3300006028 Bacteria 911
369 Ga0070717_10771724 3300006028 Bacteria 874
370 Ga0070717_11162532 3300006028 Bacteria 702
371 Ga0075365_10100758 3300006038 Bacteria 1977
372 Ga0075368_10003413 3300006042 Bacteria 5303
373 Ga0075364_10052682 3300006051 Bacteria 2660
374 Ga0075364_10124293 3300006051 Bacteria 1729
375 Ga0075364_10320818 3300006051 Bacteria 1055
376 Ga0075364_10613139 3300006051 Bacteria 743
377 Ga0070715_10111121 3300006163 Bacteria 1293
378 Ga0070715_10121350 3300006163 Bacteria 1246
379 Ga0070715_10683742 3300006163 Bacteria 611
380 Ga0070716_100019808 3300006173 Bacteria 3522
381 Ga0070716_100350564 3300006173 Bacteria 1045
382 Ga0070712_100000441 3300006175 Bacteria 23726
383 Ga0070712_100641030 3300006175 Bacteria 902
384 Ga0070712_101444222 3300006175 Bacteria 601
385 Ga0070712_102005083 3300006175 Bacteria 507
386 Ga0075362_10112367 3300006177 Bacteria 1283
387 Ga0075367_10156006 3300006178 Bacteria 1418
388 Ga0075367_10822278 3300006178 Bacteria 592
389 Ga0075369_10132280 3300006186 Bacteria 1134
390 Ga0075369_10340059 3300006186 Bacteria 703
391 Ga0075366_10002121 3300006195 Bacteria 10087
392 Ga0075366_10128161 3300006195 Bacteria 1531
393 Ga0097621_100004137 3300006237 Bacteria 10062
394 Ga0097621_100004245 3300006237 Bacteria 9958
395 Ga0097621_100020255 3300006237 Bacteria 5124
396 Ga0097621_100034057 3300006237 Bacteria 4060
397 Ga0097621_100228862 3300006237 Bacteria 1622
398 Ga0097621_100567324 3300006237 Bacteria 1034
399 Ga0097621_100584820 3300006237 Bacteria 1019
400 Ga0097621_101765675 3300006237 Bacteria 589
401 Ga0075370_10013002 3300006353 Bacteria 4415
402 Ga0068871_100009393 3300006358 Bacteria 7084
403 Ga0068871_100011257 3300006358 Bacteria 6558
404 Ga0068871_100023303 3300006358 Bacteria 4786
405 Ga0068871_100162194 3300006358 Bacteria 1912
406 Ga0068871_100220779 3300006358 Bacteria 1642
407 Ga0068871_100391849 3300006358 Bacteria 1236
408 Ga0068871_101575222 3300006358 Bacteria 622
409 Ga0075428_100035750 3300006844 Bacteria 5475
410 Ga0075428_102684018 3300006844 Bacteria 508
411 Ga0075430_100009406 3300006846 Bacteria 8261
412 Ga0075430_100363684 3300006846 Bacteria 1195
413 Ga0075430_101133096 3300006846 Bacteria 644
414 Ga0075431_100050721 3300006847 Bacteria 4278
415 Ga0075431_100076297 3300006847 Bacteria 3459
416 Ga0075431_100594542 3300006847 Bacteria 1091
417 Ga0075433_10012601 3300006852 Bacteria 6840
418 Ga0075433_10054490 3300006852 Bacteria 3489
419 Ga0075433_10272924 3300006852 Bacteria 1499
420 Ga0075433_10492196 3300006852 Bacteria 1080
421 Ga0075433_10526698 3300006852 Bacteria 1040
422 Ga0075433_10630724 3300006852 Bacteria 940
423 Ga0075434_100000002 3300006871 Bacteria 135661
424 Ga0075434_100005428 3300006871 Bacteria 11609
425 Ga0075434_100029901 3300006871 Bacteria 5362
426 Ga0075434_100134162 3300006871 Bacteria 2495
427 Ga0075434_100181741 3300006871 Bacteria 2123
428 Ga0075429_100318568 3300006880 Bacteria 1361
429 Ga0075429_100501227 3300006880 Bacteria 1064
430 Ga0075429_100669176 3300006880 Bacteria 909
431 Ga0075429_100893225 3300006880 Bacteria 778
432 Ga0068865_100002587 3300006881 Bacteria 10743
433 Ga0068865_100011373 3300006881 Bacteria 5566
434 Ga0068865_100016392 3300006881 Bacteria 4742
435 Ga0068865_100075379 3300006881 Bacteria 2405
436 Ga0068865_100351803 3300006881 Bacteria 1194
437 Ga0075436_100011488 3300006914 Bacteria 6077
438 Ga0075436_100202616 3300006914 Bacteria 1406
439 Ga0075436_100304506 3300006914 Bacteria 1143
440 Ga0075436_100355278 3300006914 Bacteria 1056
441 Ga0075436_100736622 3300006914 Bacteria 731
442 Ga0075436_101019388 3300006914 Bacteria 622
443 Ga0097620_100005230 3300006931 Bacteria 13184
444 Ga0097620_100028400 3300006931 Bacteria 5608
445 Ga0097620_100037124 3300006931 Bacteria 4890
446 Ga0097620_100097987 3300006931 Bacteria 2985
447 Ga0097620_100311405 3300006931 Bacteria 1668
448 Ga0097620_100319361 3300006931 Bacteria 1647
449 Ga0097620_102099982 3300006931 Bacteria 624
450 Ga0099825_1035219 3300006941 Bacteria 1804
451 Ga0099823_1032609 3300006944 Bacteria 4230
452 Ga0075435_100018975 3300007076 Bacteria 5241
453 Ga0075435_100038058 3300007076 Bacteria 3834
454 Ga0075435_100630745 3300007076 Bacteria 930
455 Ga0075435_100988209 3300007076 Bacteria 735
456 Ga0075435_101410689 3300007076 Unclassified 610
457 Ga0075435_102040561 3300007076 Bacteria 503
458 Ga0099794_10092477 3300007265 Bacteria 1502
459 Ga0099795_10173993 3300007788 Bacteria 896
460 Ga0105251_10231350 3300009011 Bacteria 832
461 Ga0105250_10044625 3300009092 Bacteria 1778
462 Ga0105250_10097401 3300009092 Bacteria 1199
463 Ga0105240_10003909 3300009093 Bacteria 23015
464 Ga0105240_10013511 3300009093 Bacteria 11208
465 Ga0105240_10040761 3300009093 Bacteria 5934
466 Ga0105240_10048726 3300009093 Bacteria 5352
467 Ga0105240_10051298 3300009093 Bacteria 5193
468 Ga0105240_10086700 3300009093 Bacteria 3835
469 Ga0105240_10102240 3300009093 Bacteria 3483
470 Ga0105240_10117208 3300009093 Bacteria 3211
471 Ga0105240_10201237 3300009093 Bacteria 2334
472 Ga0105240_10415260 3300009093 Bacteria 1513
473 Ga0105240_10599914 3300009093 Bacteria 1212
474 Ga0105240_11396336 3300009093 Bacteria 736
475 Ga0111539_10007838 3300009094 Bacteria 13639
476 Ga0111539_10026480 3300009094 Bacteria 7089
477 Ga0111539_10176275 3300009094 Bacteria 2497
478 Ga0111539_10629336 3300009094 Bacteria 1250
479 Ga0111539_10685271 3300009094 Bacteria 1193
480 Ga0111539_11458717 3300009094 Bacteria 794
481 Ga0111539_11460512 3300009094 Bacteria 793
482 Ga0111539_11720912 3300009094 Bacteria 727
483 Ga0111539_12605516 3300009094 Bacteria 586
484 Ga0111539_13040900 3300009094 Bacteria 542
485 Ga0105245_10016953 3300009098 Bacteria 6360
486 Ga0105245_10038887 3300009098 Bacteria 4233
487 Ga0105245_10056008 3300009098 Bacteria 3543
488 Ga0105245_11095244 3300009098 Bacteria 843
489 Ga0105245_11269450 3300009098 Bacteria 785
490 Ga0105245_11719593 3300009098 Bacteria 680
491 Ga0105247_10008282 3300009101 Bacteria 6342
492 Ga0105247_10080733 3300009101 Bacteria 2049
493 Ga0105247_10133923 3300009101 Bacteria 1617
494 Ga0105247_10595536 3300009101 Bacteria 819
495 Ga0105247_10847183 3300009101 Bacteria 701
496 Ga0105247_10887497 3300009101 Bacteria 687
497 Ga0114129_10104235 3300009147 Bacteria 3919
498 Ga0114129_10440316 3300009147 Bacteria 1711
499 Ga0114129_10598538 3300009147 Bacteria 1429
500 Ga0114129_11194042 3300009147 Bacteria 948
501 Ga0114129_12017311 3300009147 Bacteria 697
502 Ga0105243_10005625 3300009148 Bacteria 9759
503 Ga0105243_10113365 3300009148 Bacteria 2273
504 Ga0105243_10257907 3300009148 Bacteria 1560
505 Ga0105243_10444720 3300009148 Bacteria 1214
506 Ga0105243_11733039 3300009148 Bacteria 654
507 Ga0105243_12046080 3300009148 Bacteria 608
508 Ga0105241_10003663 3300009174 Bacteria 11413
509 Ga0105241_10035647 3300009174 Bacteria 3742
510 Ga0105241_10073208 3300009174 Bacteria 2664
511 Ga0105241_10161064 3300009174 Bacteria 1844
512 Ga0105241_10377097 3300009174 Bacteria 1238
513 Ga0105241_10379407 3300009174 Bacteria 1235
514 Ga0105241_10477501 3300009174 Bacteria 1107
515 Ga0105241_11253685 3300009174 Bacteria 704
516 Ga0105241_12014663 3300009174 Bacteria 569
517 Ga0105241_12400940 3300009174 Bacteria 526
518 Ga0105241_12577336 3300009174 Unclassified 510
519 Ga0105241_12649383 3300009174 Bacteria 504
520 Ga0105242_10007918 3300009176 Bacteria 8180
521 Ga0105242_10024897 3300009176 Bacteria 4730
522 Ga0105242_10042533 3300009176 Bacteria 3670
523 Ga0105242_10204361 3300009176 Bacteria 1756
524 Ga0105242_10307067 3300009176 Bacteria 1450
525 Ga0105242_10373877 3300009176 Bacteria 1323
526 Ga0105242_11033000 3300009176 Bacteria 832
527 Ga0105242_11100353 3300009176 Bacteria 808
528 Ga0105248_10000120 3300009177 Bacteria 89960
529 Ga0105248_10003190 3300009177 Bacteria 18173
530 Ga0105248_10125563 3300009177 Bacteria 2895
531 Ga0105248_10225214 3300009177 Bacteria 2111
532 Ga0105248_10426680 3300009177 Bacteria 1493
533 Ga0105248_10588588 3300009177 Bacteria 1255
534 Ga0105248_10706702 3300009177 Bacteria 1137
535 Ga0105248_11127324 3300009177 Bacteria 887
536 Ga0105237_10000585 3300009545 Bacteria 50881
537 Ga0105237_10041317 3300009545 Bacteria 4651
538 Ga0105237_10060749 3300009545 Bacteria 3779
539 Ga0105237_10066556 3300009545 Bacteria 3598
540 Ga0105237_10067357 3300009545 Bacteria 3574
541 Ga0105237_10092757 3300009545 Bacteria 3009
542 Ga0105237_10227066 3300009545 Bacteria 1867
543 Ga0105237_10371359 3300009545 Bacteria 1435
544 Ga0105237_10415168 3300009545 Unclassified 1351
545 Ga0105237_10540869 3300009545 Bacteria 1171
546 Ga0105237_10557624 3300009545 Bacteria 1152
547 Ga0105237_10588664 3300009545 Bacteria 1119
548 Ga0105237_10661281 3300009545 Bacteria 1051
549 Ga0105237_11217536 3300009545 Bacteria 759
550 Ga0105237_11268837 3300009545 Bacteria 743
551 Ga0105237_11382107 3300009545 Bacteria 710
552 Ga0105237_11949654 3300009545 Bacteria 596
553 Ga0105238_10000686 3300009551 Bacteria 35493
554 Ga0105238_10000802 3300009551 Bacteria 32599
555 Ga0105238_10018812 3300009551 Bacteria 7032
556 Ga0105238_10029428 3300009551 Bacteria 5595
557 Ga0105238_10055256 3300009551 Bacteria 3986
558 Ga0105238_10087229 3300009551 Bacteria 3107
559 Ga0105238_10143999 3300009551 Bacteria 2360
560 Ga0105238_10218335 3300009551 Bacteria 1882
561 Ga0105238_10641169 3300009551 Bacteria 1072
562 Ga0105238_11020635 3300009551 Bacteria 848
563 Ga0105238_11246987 3300009551 Bacteria 769
564 Ga0105238_11294984 3300009551 Bacteria 755
565 Ga0105238_11354002 3300009551 Bacteria 738
566 Ga0105238_11670298 3300009551 Bacteria 668
567 Ga0105238_11885083 3300009551 Bacteria 631
568 Ga0105238_11929575 3300009551 Bacteria 624
569 Ga0105249_10001381 3300009553 Bacteria 21241
570 Ga0105249_10007711 3300009553 Bacteria 9380
571 Ga0105249_10082416 3300009553 Bacteria 2993
572 Ga0105249_10292199 3300009553 Bacteria 1631
573 Ga0105249_10475176 3300009553 Bacteria 1292
574 Ga0105249_10539082 3300009553 Bacteria 1216
575 Ga0105249_10826291 3300009553 Bacteria 991
576 Ga0105249_11050759 3300009553 Bacteria 884
577 Ga0105249_11298262 3300009553 Bacteria 799
578 Ga0099796_10438865 3300010159 Bacteria 579
579 Ga0105239_10000598 3300010375 Bacteria 51483
580 Ga0105239_10024313 3300010375 Bacteria 6673
581 Ga0105239_10039543 3300010375 Bacteria 5167
582 Ga0105239_10055913 3300010375 Bacteria 4329
583 Ga0105239_10108698 3300010375 Bacteria 3072
584 Ga0105239_10153783 3300010375 Bacteria 2568
585 Ga0105239_10219536 3300010375 Bacteria 2132
586 Ga0105239_10565564 3300010375 Bacteria 1295
587 Ga0105239_10713489 3300010375 Bacteria 1147
588 Ga0105239_11914828 3300010375 Bacteria 688
589 Ga0105246_10003169 3300011119 Bacteria 9993
590 Ga0105246_10056601 3300011119 Bacteria 2711
591 Ga0105246_10119130 3300011119 Bacteria 1953
592 Ga0105246_10376905 3300011119 Bacteria 1171
593 Ga0105246_10523567 3300011119 Bacteria 1011
594 Ga0105246_11197202 3300011119 Bacteria 699
595 Ga0105246_12511814 3300011119 Bacteria 507
596 Ga0157322_1036643 3300012490 Bacteria 547
597 Ga0157314_1052243 3300012500 Bacteria 525
598 Ga0157371_10011090 3300013102 Bacteria 6978
599 Ga0157370_10001505 3300013104 Bacteria 28782
600 Ga0157370_10422990 3300013104 Bacteria 1225
601 Ga0157370_10617434 3300013104 Unclassified 992
602 Ga0157370_11060541 3300013104 Bacteria 733
603 Ga0157369_10001137 3300013105 Bacteria 33284
604 Ga0157369_10007085 3300013105 Bacteria 12932
605 Ga0157369_10043435 3300013105 Bacteria 4899
606 Ga0157369_10120068 3300013105 Bacteria 2789
607 Ga0157374_10013680 3300013296 Bacteria 7089
608 Ga0157374_10033535 3300013296 Bacteria 4684
609 Ga0157374_10036715 3300013296 Bacteria 4491
610 Ga0157374_10354282 3300013296 Unclassified 1459
611 Ga0157374_10579161 3300013296 Bacteria 1131
612 Ga0157374_11292454 3300013296 Bacteria 751
613 Ga0157378_10019633 3300013297 Bacteria 5940
614 Ga0157378_10028655 3300013297 Bacteria 4915
615 Ga0157378_10061729 3300013297 Bacteria 3346
616 Ga0157378_10407877 3300013297 Bacteria 1340
617 Ga0157378_10913935 3300013297 Bacteria 909
618 Ga0157378_11228592 3300013297 Bacteria 789
619 Ga0157378_12265422 3300013297 Bacteria 595
620 Ga0163162_10001651 3300013306 Bacteria 20905
621 Ga0163162_10012697 3300013306 Bacteria 8223
622 Ga0163162_10017443 3300013306 Bacteria 7025
623 Ga0163162_10024940 3300013306 Bacteria 5907
624 Ga0163162_10051897 3300013306 Bacteria 4116
625 Ga0163162_10109029 3300013306 Bacteria 2865
626 Ga0163162_10126629 3300013306 Bacteria 2661
627 Ga0163162_10407075 3300013306 Bacteria 1493
628 Ga0163162_10436120 3300013306 Bacteria 1442
629 Ga0163162_10518344 3300013306 Bacteria 1322
630 Ga0163162_12065338 3300013306 Bacteria 653
631 Ga0157372_10035411 3300013307 Bacteria 5496
632 Ga0157372_10049782 3300013307 Bacteria 4660
633 Ga0157372_10580609 3300013307 Bacteria 1306
634 Ga0157372_10616187 3300013307 Bacteria 1265
635 Ga0157372_10963796 3300013307 Bacteria 989
636 Ga0157372_11564923 3300013307 Bacteria 759
637 Ga0157372_12868801 3300013307 Bacteria 552
638 Ga0157375_10001711 3300013308 Bacteria 18837
639 Ga0157375_10085834 3300013308 Bacteria 3198
640 Ga0157375_10087695 3300013308 Bacteria 3164
641 Ga0157375_10260540 3300013308 Bacteria 1896
642 Ga0157375_10371726 3300013308 Bacteria 1596
643 Ga0157375_10388667 3300013308 Bacteria 1562
644 Ga0157375_11086535 3300013308 Bacteria 936
645 Ga0163163_10000639 3300014325 Bacteria 30088
646 Ga0163163_10009921 3300014325 Bacteria 8539
647 Ga0163163_10049124 3300014325 Bacteria 4150
648 Ga0163163_10237641 3300014325 Bacteria 1871
649 Ga0163163_10359865 3300014325 Bacteria 1512
650 Ga0157380_10264090 3300014326 Bacteria 1565
651 Ga0157380_10942054 3300014326 Bacteria 893
652 Ga0157380_11517697 3300014326 Bacteria 723
653 Ga0157380_12895059 3300014326 Bacteria 546
654 Ga0157380_13215095 3300014326 Bacteria 522
655 Ga0182008_10120559 3300014497 Bacteria 1303
656 Ga0182008_10220072 3300014497 Bacteria 971
657 Ga0182008_10391064 3300014497 Bacteria 745
658 Ga0157377_10001805 3300014745 Bacteria 9328
659 Ga0157377_10003066 3300014745 Bacteria 7496
660 Ga0157379_10016645 3300014968 Bacteria 6465
661 Ga0157379_10048305 3300014968 Bacteria 3798
662 Ga0157379_10066120 3300014968 Bacteria 3232
663 Ga0157379_10066986 3300014968 Bacteria 3210
664 Ga0157379_10219277 3300014968 Bacteria 1723
665 Ga0157379_10227584 3300014968 Bacteria 1690
666 Ga0157379_10463952 3300014968 Bacteria 1171
667 Ga0157379_10567712 3300014968 Bacteria 1057
668 Ga0157379_11580199 3300014968 Bacteria 640
669 Ga0157379_12067041 3300014968 Bacteria 564
670 Ga0157379_12101320 3300014968 Bacteria 560
671 Ga0157376_10012122 3300014969 Bacteria 6385
672 Ga0157376_10013167 3300014969 Bacteria 6164
673 Ga0157376_10024072 3300014969 Bacteria 4775
674 Ga0157376_10430519 3300014969 Bacteria 1282
675 Ga0157376_10907787 3300014969 Bacteria 899
676 Ga0157376_11242779 3300014969 Bacteria 774
677 Ga0157376_13151042 3300014969 Bacteria 500
678 Ga0182007_10004162 3300015262 Bacteria 6631
679 Ga0182007_10075671 3300015262 Bacteria 1104
680 Ga0163161_10010057 3300017792 Bacteria 6549
681 Ga0163161_10030360 3300017792 Bacteria 3846
682 Ga0163161_10088146 3300017792 Bacteria 2294
683 Ga0163161_11738495 3300017792 Bacteria 553
684 Ga0213873_10279657 3300021358 Bacteria 534
685 Ga0213872_10000304 3300021361 Bacteria 42020
686 Ga0213872_10008216 3300021361 Bacteria 5058
687 Ga0213872_10071172 3300021361 Bacteria 1568
688 Ga0213872_10251186 3300021361 Bacteria 745
689 Ga0213872_10406076 3300021361 Bacteria 552
690 Ga0213876_10026589 3300021384 Bacteria 3052
691 Ga0213876_10066199 3300021384 Bacteria 1907
692 Ga0213876_10175445 3300021384 Bacteria 1141
693 Ga0213875_10061108 3300021388 Bacteria 1761
694 Ga0213875_10118890 3300021388 Bacteria 1235
695 Ga0213875_10143471 3300021388 Bacteria 1118
696 Ga0213871_10028888 3300021441 Bacteria 1434
697 Ga0213871_10132264 3300021441 Bacteria 750
698 Ga0228598_1012452 3300024227 Bacteria 1690
699 Ga0209672_100058 3300025228 Bacteria 211992
700 Ga0209672_101212 3300025228 Bacteria 10412
701 Ga0209563_101608 3300025230 Bacteria 5843
702 Ga0207427_101318 3300025231 Bacteria 9320
703 Ga0209437_101040 3300025233 Bacteria 9320
704 Ga0209258_100164 3300025242 Bacteria 148838
705 Ga0209258_101181 3300025242 Bacteria 10543
706 Ga0209258_109811 3300025242 Bacteria 1270
707 Ga0207425_1037931 3300025245 Bacteria 928
708 Ga0209646_1001751 3300025246 Bacteria 5477
709 Ga0209026_1000280 3300025250 Bacteria 58823
710 Ga0209148_1000039 3300025254 Bacteria 482479
711 Ga0209148_1001605 3300025254 Bacteria 10543
712 Ga0209148_1002895 3300025254 Bacteria 5246
713 Ga0209759_1001011 3300025256 Bacteria 18928
714 Ga0209129_1024705 3300025258 Bacteria 1054
715 Ga0209233_1001383 3300025261 Bacteria 9625
716 Ga0209455_1000034 3300025272 Bacteria 483129
717 Ga0209455_1000450 3300025272 Bacteria 31556
718 Ga0209455_1000920 3300025272 Bacteria 15191
719 Ga0209673_1007773 3300025273 Bacteria 4872
720 Ga0207673_1016523 3300025290 Bacteria 981
721 Ga0209564_1006041 3300025295 Bacteria 6672
722 Ga0209758_1000057 3300025297 Bacteria 333111
723 Ga0209758_1000109 3300025297 Bacteria 214759
724 Ga0209050_1002121 3300025298 Bacteria 18068
725 Ga0209256_1003201 3300025299 Bacteria 11828
726 Ga0209256_1018586 3300025299 Bacteria 2249
727 Ga0207426_1002293 3300025302 Bacteria 12619
728 Ga0207426_1048932 3300025302 Bacteria 1267
729 Ga0209051_1000025 3300025303 Bacteria 415397
730 Ga0209051_1005357 3300025303 Bacteria 7533
731 Ga0209051_1068084 3300025303 Bacteria 1085
732 Ga0209051_1074559 3300025303 Bacteria 1005
733 Ga0209257_1000039 3300025304 Bacteria 591694
734 Ga0209257_1000049 3300025304 Bacteria 441224
735 Ga0209257_1001604 3300025304 Bacteria 25883
736 Ga0209257_1012281 3300025304 Bacteria 3983
737 Ga0207697_10000498 3300025315 Bacteria 22072
738 Ga0207697_10076753 3300025315 Bacteria 1404
739 Ga0207656_10062321 3300025321 Bacteria 1639
740 Ga0207656_10239746 3300025321 Unclassified 886
741 Ga0207682_10001642 3300025893 Bacteria 10254
742 Ga0207682_10001768 3300025893 Bacteria 9912
743 Ga0207692_10865573 3300025898 Bacteria 593
744 Ga0207642_10001970 3300025899 Bacteria 6342
745 Ga0207642_10002638 3300025899 Bacteria 5590
746 Ga0207642_10604748 3300025899 Bacteria 683
747 Ga0207642_10623380 3300025899 Bacteria 673
748 Ga0207710_10008398 3300025900 Bacteria 4355
749 Ga0207710_10041401 3300025900 Bacteria 2043
750 Ga0207710_10077577 3300025900 Bacteria 1535
751 Ga0207688_10000572 3300025901 Bacteria 18079
752 Ga0207688_10020505 3300025901 Bacteria 3610
753 Ga0207688_10064630 3300025901 Bacteria 2066
754 Ga0207688_10326648 3300025901 Bacteria 942
755 Ga0207688_10476554 3300025901 Bacteria 780
756 Ga0207680_10000006 3300025903 Bacteria 635950
757 Ga0207680_10048115 3300025903 Bacteria 2531
758 Ga0207680_10050311 3300025903 Bacteria 2485
759 Ga0207680_10051102 3300025903 Bacteria 2471
760 Ga0207680_10207452 3300025903 Bacteria 1338
761 Ga0207680_10498476 3300025903 Bacteria 867
762 Ga0207680_10543220 3300025903 Bacteria 829
763 Ga0207647_10000776 3300025904 Bacteria 24848
764 Ga0207647_10000888 3300025904 Bacteria 23203
765 Ga0207647_10002766 3300025904 Bacteria 13239
766 Ga0207685_10055025 3300025905 Bacteria 1552
767 Ga0207685_10097917 3300025905 Bacteria 1248
768 Ga0207685_10425644 3300025905 Bacteria 685
769 Ga0207699_10070352 3300025906 Bacteria 2136
770 Ga0207699_10493910 3300025906 Bacteria 883
771 Ga0207699_10855995 3300025906 Bacteria 670
772 Ga0207645_10010112 3300025907 Bacteria 6493
773 Ga0207645_10151559 3300025907 Bacteria 1513
774 Ga0207645_10209376 3300025907 Bacteria 1284
775 Ga0207645_10231059 3300025907 Bacteria 1221
776 Ga0207645_10692571 3300025907 Bacteria 693
777 Ga0207643_10000024 3300025908 Bacteria 103214
778 Ga0207643_10007460 3300025908 Bacteria 5870
779 Ga0207643_10083185 3300025908 Bacteria 1856
780 Ga0207643_10299240 3300025908 Bacteria 1001
781 Ga0207705_10045059 3300025909 Bacteria 3170
782 Ga0207705_10061789 3300025909 Bacteria 2706
783 Ga0207684_10030780 3300025910 Bacteria 4568
784 Ga0207684_10043517 3300025910 Unclassified 3807
785 Ga0207684_10217969 3300025910 Bacteria 1647
786 Ga0207684_11291842 3300025910 Bacteria 601
787 Ga0207654_10000444 3300025911 Bacteria 23592
788 Ga0207654_10008850 3300025911 Bacteria 5108
789 Ga0207654_10036982 3300025911 Bacteria 2731
790 Ga0207654_10169170 3300025911 Bacteria 1418
791 Ga0207654_10720171 3300025911 Bacteria 717
792 Ga0207707_10000137 3300025912 Bacteria 75096
793 Ga0207707_10002528 3300025912 Bacteria 16427
794 Ga0207707_10029216 3300025912 Bacteria 4819
795 Ga0207707_10091699 3300025912 Unclassified 2655
796 Ga0207707_10096869 3300025912 Bacteria 2578
797 Ga0207707_10212555 3300025912 Bacteria 1685
798 Ga0207707_10592075 3300025912 Bacteria 939
799 Ga0207707_10672067 3300025912 Bacteria 872
800 Ga0207695_10000844 3300025913 Bacteria 56228
801 Ga0207695_10002725 3300025913 Bacteria 25804
802 Ga0207695_10029526 3300025913 Bacteria 6055
803 Ga0207695_10041940 3300025913 Bacteria 4893
804 Ga0207695_10042899 3300025913 Bacteria 4825
805 Ga0207695_10175918 3300025913 Bacteria 2063
806 Ga0207695_10210334 3300025913 Bacteria 1856
807 Ga0207695_10300530 3300025913 Bacteria 1496
808 Ga0207695_10396820 3300025913 Bacteria 1264
809 Ga0207695_10859688 3300025913 Bacteria 787
810 Ga0207695_10934150 3300025913 Bacteria 747
811 Ga0207695_11338435 3300025913 Bacteria 596
812 Ga0207695_11344858 3300025913 Bacteria 595
813 Ga0207671_10003300 3300025914 Bacteria 16237
814 Ga0207671_10003896 3300025914 Bacteria 14548
815 Ga0207671_10011447 3300025914 Bacteria 7222
816 Ga0207671_10213990 3300025914 Bacteria 1508
817 Ga0207671_10570089 3300025914 Bacteria 902
818 Ga0207671_10593396 3300025914 Bacteria 883
819 Ga0207671_10709014 3300025914 Bacteria 800
820 Ga0207671_10736084 3300025914 Bacteria 784
821 Ga0207671_10992306 3300025914 Bacteria 662
822 Ga0207693_10019331 3300025915 Bacteria 5420
823 Ga0207663_10004609 3300025916 Bacteria 6870
824 Ga0207660_10006522 3300025917 Bacteria 7571
825 Ga0207660_10181303 3300025917 Bacteria 1636
826 Ga0207660_10189663 3300025917 Bacteria 1600
827 Ga0207660_10250269 3300025917 Bacteria 1398
828 Ga0207660_10484556 3300025917 Bacteria 1002
829 Ga0207660_10513944 3300025917 Bacteria 972
830 Ga0207660_10580168 3300025917 Bacteria 913
831 Ga0207660_10792511 3300025917 Bacteria 773
832 Ga0207660_11317074 3300025917 Bacteria 586
833 Ga0207660_11510492 3300025917 Bacteria 543
834 Ga0207662_10000499 3300025918 Bacteria 17531
835 Ga0207662_10001437 3300025918 Bacteria 11559
836 Ga0207662_11275438 3300025918 Bacteria 522
837 Ga0207657_10000115 3300025919 Bacteria 79117
838 Ga0207657_10048721 3300025919 Bacteria 3698
839 Ga0207657_10670345 3300025919 Bacteria 807
840 Ga0207657_11042421 3300025919 Bacteria 626
841 Ga0207649_10028267 3300025920 Bacteria 3301
842 Ga0207649_10035081 3300025920 Bacteria 3011
843 Ga0207649_10080895 3300025920 Bacteria 2102
844 Ga0207649_10164667 3300025920 Bacteria 1539
845 Ga0207652_10005039 3300025921 Bacteria 10706
846 Ga0207652_10092469 3300025921 Bacteria 2661
847 Ga0207652_10176514 3300025921 Bacteria 1919
848 Ga0207652_10180872 3300025921 Bacteria 1895
849 Ga0207652_10256183 3300025921 Bacteria 1578
850 Ga0207646_10198791 3300025922 Bacteria 1810
851 Ga0207646_10324278 3300025922 Bacteria 1392
852 Ga0207681_10003152 3300025923 Bacteria 10367
853 Ga0207681_10006516 3300025923 Bacteria 7166
854 Ga0207681_10259621 3300025923 Bacteria 1360
855 Ga0207681_11301738 3300025923 Bacteria 610
856 Ga0207694_10000309 3300025924 Bacteria 45949
857 Ga0207694_10005100 3300025924 Bacteria 10147
858 Ga0207694_10010350 3300025924 Bacteria 7032
859 Ga0207694_10010925 3300025924 Bacteria 6859
860 Ga0207694_10116822 3300025924 Bacteria 2126
861 Ga0207694_10193334 3300025924 Bacteria 1654
862 Ga0207694_10864636 3300025924 Bacteria 764
863 Ga0207694_11300043 3300025924 Bacteria 615
864 Ga0207694_11500501 3300025924 Bacteria 569
865 Ga0207694_11804724 3300025924 Bacteria 514
866 Ga0207650_10007543 3300025925 Bacteria 7417
867 Ga0207650_10034670 3300025925 Bacteria 3661
868 Ga0207650_10035051 3300025925 Bacteria 3642
869 Ga0207650_10116372 3300025925 Bacteria 2076
870 Ga0207650_10292338 3300025925 Bacteria 1329
871 Ga0207650_10382609 3300025925 Bacteria 1162
872 Ga0207659_10003803 3300025926 Bacteria 9104
873 Ga0207659_10022783 3300025926 Bacteria 4173
874 Ga0207659_10694338 3300025926 Bacteria 871
875 Ga0207659_10736444 3300025926 Bacteria 845
876 Ga0207687_10037484 3300025927 Bacteria 3308
877 Ga0207687_10106298 3300025927 Bacteria 2075
878 Ga0207687_10636351 3300025927 Bacteria 901
879 Ga0207700_10280646 3300025928 Bacteria 1433
880 Ga0207700_10649946 3300025928 Bacteria 940
881 Ga0207664_10311298 3300025929 Bacteria 1387
882 Ga0207664_10402775 3300025929 Bacteria 1217
883 Ga0207664_10581809 3300025929 Bacteria 1005
884 Ga0207644_10009480 3300025931 Bacteria 6395
885 Ga0207644_10068527 3300025931 Bacteria 2588
886 Ga0207644_10085393 3300025931 Bacteria 2341
887 Ga0207644_10164896 3300025931 Bacteria 1725
888 Ga0207644_10221676 3300025931 Bacteria 1499
889 Ga0207690_10006275 3300025932 Bacteria 7041
890 Ga0207690_10132044 3300025932 Bacteria 1829
891 Ga0207690_10436612 3300025932 Bacteria 1050
892 Ga0207690_10690353 3300025932 Bacteria 839
893 Ga0207690_11063437 3300025932 Bacteria 674
894 Ga0207706_10003073 3300025933 Bacteria 16051
895 Ga0207706_10044166 3300025933 Bacteria 3950
896 Ga0207706_10050108 3300025933 Bacteria 3691
897 Ga0207706_10173473 3300025933 Bacteria 1894
898 Ga0207706_10563006 3300025933 Bacteria 981
899 Ga0207706_11474131 3300025933 Bacteria 556
900 Ga0207686_10000953 3300025934 Bacteria 17273
901 Ga0207686_10011909 3300025934 Bacteria 4773
902 Ga0207686_10030830 3300025934 Bacteria 3179
903 Ga0207686_10360100 3300025934 Bacteria 1098
904 Ga0207686_10428626 3300025934 Bacteria 1013
905 Ga0207686_11573935 3300025934 Bacteria 542
906 Ga0207709_10077554 3300025935 Bacteria 2130
907 Ga0207709_10262049 3300025935 Bacteria 1268
908 Ga0207670_10058925 3300025936 Bacteria 2610
909 Ga0207670_10118338 3300025936 Bacteria 1921
910 Ga0207670_11076908 3300025936 Bacteria 678
911 Ga0207670_11283212 3300025936 Bacteria 621
912 Ga0207669_10020686 3300025937 Bacteria 3456
913 Ga0207669_10412686 3300025937 Bacteria 1060
914 Ga0207669_10836192 3300025937 Bacteria 765
915 Ga0207704_10001072 3300025938 Bacteria 12170
916 Ga0207704_10011774 3300025938 Bacteria 4321
917 Ga0207704_10012894 3300025938 Bacteria 4163
918 Ga0207704_10051435 3300025938 Bacteria 2491
919 Ga0207704_10167605 3300025938 Bacteria 1571
920 Ga0207665_10022531 3300025939 Bacteria 4145
921 Ga0207665_10165554 3300025939 Bacteria 1593
922 Ga0207665_10818971 3300025939 Bacteria 736
923 Ga0207665_11492122 3300025939 Bacteria 537
924 Ga0207691_10014194 3300025940 Bacteria 7600
925 Ga0207691_10021585 3300025940 Bacteria 6079
926 Ga0207691_10021717 3300025940 Bacteria 6059
927 Ga0207691_10029699 3300025940 Bacteria 5112
928 Ga0207691_10289702 3300025940 Bacteria 1408
929 Ga0207691_10416849 3300025940 Bacteria 1144
930 Ga0207711_10001241 3300025941 Bacteria 24195
931 Ga0207711_10063491 3300025941 Bacteria 3188
932 Ga0207711_10102157 3300025941 Bacteria 2538
933 Ga0207711_10113220 3300025941 Bacteria 2415
934 Ga0207711_10189237 3300025941 Bacteria 1875
935 Ga0207711_10202771 3300025941 Bacteria 1810
936 Ga0207689_10000471 3300025942 Bacteria 37824
937 Ga0207689_10015006 3300025942 Bacteria 6570
938 Ga0207689_10335934 3300025942 Bacteria 1255
939 Ga0207689_11828468 3300025942 Bacteria 501
940 Ga0207661_10058882 3300025944 Bacteria 3093
941 Ga0207661_10078706 3300025944 Bacteria 2715
942 Ga0207661_10239636 3300025944 Bacteria 1609
943 Ga0207661_12166587 3300025944 Unclassified 502
944 Ga0207679_10002985 3300025945 Bacteria 10490
945 Ga0207679_10049933 3300025945 Bacteria 3054
946 Ga0207679_10137908 3300025945 Bacteria 1967
947 Ga0207667_10007953 3300025949 Bacteria 12657
948 Ga0207667_10058796 3300025949 Bacteria 4030
949 Ga0207667_10069324 3300025949 Bacteria 3670
950 Ga0207667_10119992 3300025949 Bacteria 2710
951 Ga0207667_10305861 3300025949 Bacteria 1624
952 Ga0207667_11878951 3300025949 Bacteria 561
953 Ga0207651_10023742 3300025960 Bacteria 3779
954 Ga0207651_10027738 3300025960 Bacteria 3562
955 Ga0207651_10680913 3300025960 Bacteria 905
956 Ga0207651_11967382 3300025960 Bacteria 525
957 Ga0207712_10000605 3300025961 Bacteria 28454
958 Ga0207712_10014305 3300025961 Bacteria 5101
959 Ga0207712_10035911 3300025961 Bacteria 3372
960 Ga0207712_10142312 3300025961 Bacteria 1842
961 Ga0207712_10301983 3300025961 Bacteria 1314
962 Ga0207712_10740006 3300025961 Bacteria 861
963 Ga0207712_11427855 3300025961 Bacteria 619
964 Ga0207712_11505479 3300025961 Bacteria 603
965 Ga0207668_10008885 3300025972 Bacteria 6008
966 Ga0207668_10026673 3300025972 Bacteria 3754
967 Ga0207668_10063315 3300025972 Bacteria 2609
968 Ga0207668_10252046 3300025972 Bacteria 1434
969 Ga0207640_10006740 3300025981 Bacteria 6316
970 Ga0207640_10307527 3300025981 Bacteria 1257
971 Ga0207640_11241386 3300025981 Unclassified 664
972 Ga0207658_10000033 3300025986 Bacteria 158540
973 Ga0207658_10000126 3300025986 Bacteria 83451
974 Ga0207658_10007587 3300025986 Bacteria 7391
975 Ga0207658_10014907 3300025986 Bacteria 5327
976 Ga0207658_10024572 3300025986 Bacteria 4216
977 Ga0207658_10118358 3300025986 Bacteria 2107
978 Ga0207658_10126657 3300025986 Bacteria 2045
979 Ga0207658_10478751 3300025986 Bacteria 1106
980 Ga0207658_10934227 3300025986 Bacteria 790
981 Ga0207658_11007395 3300025986 Bacteria 760
982 Ga0207658_11073824 3300025986 Bacteria 735
983 Ga0207658_12010252 3300025986 Bacteria 526
984 Ga0207677_10068327 3300026023 Bacteria 2493
985 Ga0207677_10069624 3300026023 Bacteria 2475
986 Ga0207677_10243057 3300026023 Bacteria 1457
987 Ga0207677_10859541 3300026023 Bacteria 816
988 Ga0207703_10007300 3300026035 Bacteria 8785
989 Ga0207703_10024363 3300026035 Bacteria 4762
990 Ga0207703_10954126 3300026035 Bacteria 822
991 Ga0207703_11692618 3300026035 Bacteria 608
992 Ga0207639_10007094 3300026041 Bacteria 7641
993 Ga0207639_10080350 3300026041 Bacteria 2579
994 Ga0207639_10115408 3300026041 Bacteria 2196
995 Ga0207639_10119541 3300026041 Bacteria 2162
996 Ga0207639_10152168 3300026041 Bacteria 1939
997 Ga0207639_10186404 3300026041 Bacteria 1769
998 Ga0207639_10227152 3300026041 Bacteria 1616
999 Ga0207639_10479516 3300026041 Bacteria 1133
1000 Ga0207639_10493442 3300026041 Bacteria 1118
1001 Ga0207639_10651089 3300026041 Bacteria 975
1002 Ga0207639_10703018 3300026041 Bacteria 938
1003 Ga0207639_10829321 3300026041 Bacteria 862
1004 Ga0207639_10903959 3300026041 Bacteria 825
1005 Ga0207678_10000559 3300026067 Bacteria 33996
1006 Ga0207678_10052062 3300026067 Bacteria 3533
1007 Ga0207678_10126711 3300026067 Bacteria 2178
1008 Ga0207678_10140143 3300026067 Bacteria 2064
1009 Ga0207678_10420163 3300026067 Bacteria 1159
1010 Ga0207708_10017324 3300026075 Bacteria 5423
1011 Ga0207708_10033118 3300026075 Bacteria 3925
1012 Ga0207708_10053869 3300026075 Bacteria 3066
1013 Ga0207708_11804890 3300026075 Bacteria 537
1014 Ga0207702_10054522 3300026078 Bacteria 3388
1015 Ga0207702_10085922 3300026078 Bacteria 2742
1016 Ga0207702_10132751 3300026078 Bacteria 2242
1017 Ga0207702_10815088 3300026078 Bacteria 923
1018 Ga0207641_10029640 3300026088 Bacteria 4526
1019 Ga0207641_10038081 3300026088 Bacteria 4019
1020 Ga0207641_10048946 3300026088 Bacteria 3570
1021 Ga0207641_10123371 3300026088 Bacteria 2315
1022 Ga0207641_10687368 3300026088 Bacteria 1007
1023 Ga0207641_10889449 3300026088 Bacteria 884
1024 Ga0207641_11075031 3300026088 Bacteria 803
1025 Ga0207641_11081626 3300026088 Bacteria 800
1026 Ga0207648_10000190 3300026089 Bacteria 64762
1027 Ga0207648_10010947 3300026089 Bacteria 8570
1028 Ga0207648_10014507 3300026089 Bacteria 7276
1029 Ga0207648_10034096 3300026089 Bacteria 4489
1030 Ga0207648_11188066 3300026089 Bacteria 716
1031 Ga0207648_11366950 3300026089 Bacteria 666
1032 Ga0207676_10002345 3300026095 Bacteria 13538
1033 Ga0207676_10011240 3300026095 Bacteria 6395
1034 Ga0207676_10017729 3300026095 Bacteria 5165
1035 Ga0207676_10642783 3300026095 Bacteria 1023
1036 Ga0207676_10790672 3300026095 Bacteria 925
1037 Ga0207676_12329353 3300026095 Bacteria 533
1038 Ga0207674_10001162 3300026116 Bacteria 34157
1039 Ga0207674_10074425 3300026116 Bacteria 3408
1040 Ga0207674_10081570 3300026116 Bacteria 3236
1041 Ga0207674_10101285 3300026116 Bacteria 2861
1042 Ga0207674_10149626 3300026116 Bacteria 2292
1043 Ga0207674_10153642 3300026116 Bacteria 2257
1044 Ga0207674_10238005 3300026116 Bacteria 1767
1045 Ga0207675_100000193 3300026118 Bacteria 55695
1046 Ga0207675_100001572 3300026118 Bacteria 22828
1047 Ga0207675_100002043 3300026118 Bacteria 20132
1048 Ga0207675_100006485 3300026118 Bacteria 11070
1049 Ga0207675_100054555 3300026118 Bacteria 3729
1050 Ga0207675_100098217 3300026118 Bacteria 2758
1051 Ga0207675_100100972 3300026118 Bacteria 2718
1052 Ga0207683_10003841 3300026121 Bacteria 13024
1053 Ga0207683_10004611 3300026121 Bacteria 11875
1054 Ga0207683_10017484 3300026121 Bacteria 6112
1055 Ga0207683_10025958 3300026121 Bacteria 5057
1056 Ga0207683_10045756 3300026121 Bacteria 3827
1057 Ga0207683_10177776 3300026121 Bacteria 1929
1058 Ga0207683_10314920 3300026121 Bacteria 1433
1059 Ga0207698_10007753 3300026142 Bacteria 6742
1060 Ga0207698_10206382 3300026142 Bacteria 1764
1061 Ga0207698_10276096 3300026142 Bacteria 1552
1062 Ga0207698_10453067 3300026142 Bacteria 1239
1063 Ga0207698_10651990 3300026142 Bacteria 1043
1064 Ga0207698_11564339 3300026142 Bacteria 675
1065 Ga0209389_1000019 3300027296 Bacteria 172067
1066 Ga0209489_100033 3300027361 Bacteria 172166
1067 Ga0209700_100012 3300027363 Bacteria 357892
1068 Ga0209982_1031442 3300027552 Bacteria 835
1069 Ga0209971_1176112 3300027682 Bacteria 527
1070 Ga0209813_10003044 3300027866 Bacteria 3895
1071 Ga0207428_10036832 3300027907 Bacteria 3985
1072 Ga0207428_10080356 3300027907 Bacteria 2547
1073 Ga0207428_10173906 3300027907 Bacteria 1630
1074 Ga0207428_10269933 3300027907 Bacteria 1265
1075 Ga0268266_10000001 3300028379 Bacteria 4040580
1076 Ga0268266_10000021 3300028379 Bacteria 522453
1077 Ga0268266_10003780 3300028379 Bacteria 14829
1078 Ga0268266_10004583 3300028379 Bacteria 13200
1079 Ga0268266_10022537 3300028379 Bacteria 5366
1080 Ga0268266_10022738 3300028379 Bacteria 5336
1081 Ga0268266_10126557 3300028379 Bacteria 2281
1082 Ga0268266_10346841 3300028379 Bacteria 1395
1083 Ga0268266_10444342 3300028379 Bacteria 1232
1084 Ga0268266_10994329 3300028379 Bacteria 812
1085 Ga0268266_11745028 3300028379 Bacteria 597
1086 Ga0268266_11925803 3300028379 Bacteria 565
1087 Ga0268265_10001621 3300028380 Bacteria 18541
1088 Ga0268265_10019604 3300028380 Bacteria 4704
1089 Ga0268265_10283200 3300028380 Bacteria 1484
1090 Ga0268265_10350947 3300028380 Bacteria 1347
1091 Ga0268265_10450796 3300028380 Bacteria 1202
1092 Ga0268264_10010890 3300028381 Bacteria 7513
1093 Ga0268264_10023850 3300028381 Bacteria 4990
1094 Ga0268264_10123602 3300028381 Bacteria 2284
1095 Ga0268264_10261546 3300028381 Bacteria 1612
1096 Ga0268264_10319732 3300028381 Bacteria 1467
1097 Ga0268264_10860190 3300028381 Bacteria 908
1098 Ga0268264_11698531 3300028381 Bacteria 642
1099 Ga0265337_1021972 3300028556 Bacteria 1982
1100 Ga0265326_10031486 3300028558 Bacteria 1511
1101 Ga0265319_1009046 3300028563 Bacteria 4293
1102 Ga0265334_10011784 3300028573 Bacteria 3674
1103 Ga0265323_10058859 3300028653 Bacteria 1341
1104 Ga0265336_10005535 3300028666 Bacteria 4652
1105 Ga0307517_10046637 3300028786 Bacteria 4514
1106 Ga0307515_10156191 3300028794 Bacteria 2353
1107 Ga0265338_10005770 3300028800 Bacteria 16007
1108 Ga0265338_10031153 3300028800 Bacteria 5232
1109 Ga0265338_10144576 3300028800 Bacteria 1857
1110 Ga0265338_10385694 3300028800 Bacteria 1001
1111 Ga0265338_10452043 3300028800 Bacteria 909
1112 Ga0265324_10013743 3300029957 Bacteria 3012
1113 Ga0265330_10013773 3300031235 Bacteria 3762
1114 Ga0265330_10059727 3300031235 Bacteria 1660
1115 Ga0265330_10073819 3300031235 Bacteria 1474
1116 Ga0265330_10114893 3300031235 Bacteria 1148
1117 Ga0265332_10021862 3300031238 Bacteria 2825
1118 Ga0265332_10072533 3300031238 Bacteria 1466
1119 Ga0265328_10036684 3300031239 Bacteria 1811
1120 Ga0265320_10136680 3300031240 Bacteria 1111
1121 Ga0265320_10145760 3300031240 Bacteria 1070
1122 Ga0265320_10174743 3300031240 Bacteria 964
1123 Ga0265325_10033483 3300031241 Bacteria 2739
1124 Ga0265325_10093236 3300031241 Bacteria 1482
1125 Ga0265339_10012788 3300031249 Bacteria 5103
1126 Ga0265339_10170063 3300031249 Bacteria 1091
1127 Ga0265331_10000129 3300031250 Bacteria 99170
1128 Ga0265331_10018059 3300031250 Bacteria 3665
1129 Ga0265331_10034446 3300031250 Bacteria 2498
1130 Ga0265331_10042061 3300031250 Bacteria 2218
1131 Ga0265327_10000044 3300031251 Bacteria 284808
1132 Ga0265327_10278231 3300031251 Bacteria 740
1133 Ga0265316_10006416 3300031344 Bacteria 11236
1134 Ga0265316_10023501 3300031344 Bacteria 5176
1135 Ga0265316_10059600 3300031344 Bacteria 2968
1136 Ga0265316_10588686 3300031344 Bacteria 790
1137 Ga0307513_10014455 3300031456 Bacteria 9631
1138 Ga0307509_10000025 3300031507 Bacteria 235550
1139 Ga0307509_10626380 3300031507 Bacteria 746
1140 Ga0307408_100000325 3300031548 Bacteria 45762
1141 Ga0307408_100486732 3300031548 Bacteria 1077
1142 Ga0307408_100861379 3300031548 Bacteria 827
1143 Ga0265313_10002621 3300031595 Bacteria 15299
1144 Ga0265313_10076839 3300031595 Bacteria 1525
1145 Ga0265313_10122971 3300031595 Bacteria 1130
1146 Ga0265313_10130373 3300031595 Bacteria 1090
1147 Ga0265313_10219654 3300031595 Bacteria 784
1148 Ga0265313_10380869 3300031595 Bacteria 555
1149 Ga0307508_10787789 3300031616 Bacteria 567
1150 Ga0265314_10013382 3300031711 Bacteria 6629
1151 Ga0265314_10017718 3300031711 Bacteria 5581
1152 Ga0265314_10023967 3300031711 Bacteria 4638
1153 Ga0265314_10151541 3300031711 Bacteria 1421
1154 Ga0265314_10355323 3300031711 Bacteria 805
1155 Ga0265314_10501382 3300031711 Bacteria 639
1156 Ga0265342_10088063 3300031712 Bacteria 1783
1157 Ga0307516_10650493 3300031730 Bacteria 709
1158 Ga0307405_10380944 3300031731 Bacteria 1098
1159 Ga0307410_11073703 3300031852 Bacteria 697
1160 Ga0307410_11733477 3300031852 Bacteria 554
1161 Ga0307406_11004938 3300031901 Bacteria 716
1162 Ga0307407_10000325 3300031903 Bacteria 14209
1163 Ga0307412_10009315 3300031911 Bacteria 5629
1164 Ga0307416_100011206 3300032002 Bacteria 5960
1165 Ga0307416_100470454 3300032002 Bacteria 1314
1166 Ga0307414_10951395 3300032004 Bacteria 789
1167 Ga0307411_10091173 3300032005 Bacteria 2128
1168 Ga0307507_10421957 3300033179 Bacteria 749
1169 Ga0307510_10143309 3300033180 Bacteria 2028
1170 Ga0373958_0039048 3300034819 Bacteria 964
1171 Ga0373926_0081791 3300035083 Bacteria 1195
1172 Ga0373934_0006627 3300035086 Bacteria 4299
1173 Ga0373934_0174175 3300035086 Bacteria 883
1174 Ga0373944_0018240 3300035089 Bacteria 2002
1175 Ga0373944_0128499 3300035089 Bacteria 879
1176 Ga0373949_0124904 3300035090 Bacteria 726
1177 Ga0373951_0157447 3300035091 Bacteria 641
1178 Ga0373923_0009811 3300035111 Bacteria 3465
1179 Ga0373923_0022007 3300035111 Bacteria 2495
1180 Ga0373923_0246387 3300035111 Bacteria 836
1181 Ga0373936_0004232 3300035113 Bacteria 5417
1182 Ga0373936_0412631 3300035113 Bacteria 621
1183 Ga0373936_0418425 3300035113 Bacteria 617
1184 Ga0373941_0396091 3300035115 Bacteria 570
1185 Ga0373945_0125292 3300035116 Bacteria 1024
1186 Ga0373945_0572774 3300035116 Bacteria 508
1187 Ga0373953_0010558 3300035117 Bacteria 3219
1188 Ga0373954_0000055 3300035118 Bacteria 40229
1189 Ga0373954_0000204 3300035118 Bacteria 21671
1190 Ga0373954_0114438 3300035118 Bacteria 1306
1191 Ga0373954_0232098 3300035118 Bacteria 908
1192 Ga0373954_0456051 3300035118 Bacteria 633
1193 Ga0373956_0002438 3300035119 Bacteria 7572
1194 Ga0373956_0067902 3300035119 Bacteria 1623
1195 Ga0373956_0437689 3300035119 Bacteria 624
1196 Ga0373957_0035065 3300035120 Bacteria 1862
1197 Ga0373943_0056140 3300035170 Bacteria 1953
1198 Ga0373946_0001237 3300035171 Bacteria 8834
1199 Ga0373946_0332051 3300035171 Bacteria 757
1200 Ga0373955_0157064 3300035172 Bacteria 1340
1201 Ga0373955_0194885 3300035172 Bacteria 1205
1202 Ga0373955_0525412 3300035172 Bacteria 723
1203 Ga0373955_0633595 3300035172 Bacteria 655
1204 Ga0373955_0861737 3300035172 Bacteria 557
1205 Ga0373955_0928148 3300035172 Bacteria 536
1206 Ga0373961_0422914 3300035241 Bacteria 515
1207 Ga0373962_0169095 3300035242 Bacteria 725
1208 Ga0373924_0056499 3300035410 Bacteria 1635
1209 Ga0373924_0187126 3300035410 Bacteria 912
1210 Ga0373924_0227632 3300035410 Bacteria 824
1211 Ga0373924_0308467 3300035410 Bacteria 703
1212 Ga0373935_0071437 3300035692 Bacteria 2239
1213 Ga0373935_0281370 3300035692 Bacteria 1171
1214 Ga0373935_0413529 3300035692 Bacteria 970
1215 Ga0373935_0518172 3300035692 Bacteria 867
1216 Ga0373935_0548784 3300035692 Bacteria 842
1217 Ga0373935_0899293 3300035692 Bacteria 656
1218 Ga0373927_0025774 3300035695 Bacteria 3844
1219 Ga0373927_0134686 3300035695 Bacteria 1614
1220 Ga0373933_0000217 3300035724 Bacteria 37933
1221 Ga0373933_0151831 3300035724 Bacteria 1467
1222 Ga0373933_0182599 3300035724 Bacteria 1338
1223 Ga0373933_0349704 3300035724 Bacteria 960
1224 Ga0373933_1162530 3300035724 Bacteria 509
1225 Ga0373947_0015951 3300035725 Bacteria 4315
1226 Ga0373947_0080598 3300035725 Bacteria 2014
1227 Ga0373947_0659745 3300035725 Bacteria 713
1228 Ga0373937_0003434 3300036401 Bacteria 13300
1229 Ga0373937_0009154 3300036401 Bacteria 8593
1230 Ga0373937_0095899 3300036401 Bacteria 2750
1231 Ga0373937_0288016 3300036401 Bacteria 1551
1232 Ga0373937_0618780 3300036401 Bacteria 1028
1233 Ga0373937_0680509 3300036401 Bacteria 975
1234 Ga0373937_0787972 3300036401 Bacteria 898
1235 Ga0373937_1481279 3300036401 Bacteria 626
1236 Ga0373937_1789741 3300036401 Bacteria 561
1237 Ga0373925_0007673 3300037068 Bacteria 7860
1238 Ga0373925_0036931 3300037068 Bacteria 3605
1239 Ga0373925_0075599 3300037068 Bacteria 2553
1240 Ga0373925_0296554 3300037068 Bacteria 1305
1241 Ga0373925_1092558 3300037068 Bacteria 656
1242 Ga0395899_0015298 3300037312 Bacteria 5846
1243 Ga0395899_0090344 3300037312 Bacteria 2220
1244 Ga0395900_0029997 3300037418 Bacteria 5581
1245 Ga0395900_0048114 3300037418 Bacteria 4392
1246 Ga0395898_0005504 3300037466 Bacteria 13670
1247 Ga0395898_0006215 3300037466 Bacteria 12792
1248 Ga0395898_0649666 3300037466 Bacteria 997
1249 Ga0395898_1891221 3300037466 Bacteria 517
1250 Ga0395905_0088419 3300037471 Bacteria 2904
1251 Ga0395905_0502047 3300037471 Bacteria 1113
1252 Ga0395905_1290683 3300037471 Bacteria 634
1253 Ga0395905_1316408 3300037471 Bacteria 626
1254 Ga0436364_0188528 3300037853 Bacteria 2336
1255 Ga0436364_0261445 3300037853 Bacteria 4008
1256 Ga0436364_0424388 3300037853 Bacteria 1015
1257 Ga0436364_0621490 3300037853 Bacteria 925
1258 Ga0436364_0638380 3300037853 Bacteria 580
1259 Ga0436364_1323035 3300037853 Bacteria 1529
1260 Ga0395901_0043606 3300038443 Bacteria 4652
1261 Ga0237816_00864 3300039145 Bacteria 2500
1262 Ga0436365_0237040 3300039437 Bacteria 1230
1263 Ga0436365_0347707 3300039437 Bacteria 2932
1264 Ga0436365_0388218 3300039437 Bacteria 786
1265 Ga0436365_0431361 3300039437 Bacteria 4618
1266 Ga0436365_0545909 3300039437 Bacteria 3121
1267 Ga0436365_0655612 3300039437 Bacteria 940
1268 Ga0436365_1018828 3300039437 Bacteria 518
1269 Ga0436365_1496770 3300039437 Bacteria 634
1270 Ga0436360_0028296 3300039438 Bacteria 1047
1271 Ga0436360_0042439 3300039438 Bacteria 4673
1272 Ga0436360_0198558 3300039438 Bacteria 1500
1273 Ga0436360_0318083 3300039438 Bacteria 668
1274 Ga0436360_0420362 3300039438 Bacteria 550
1275 Ga0436360_0460365 3300039438 Bacteria 649
1276 Ga0436360_0693855 3300039438 Bacteria 590
1277 Ga0436360_0775635 3300039438 Bacteria 3558
1278 Ga0436361_0080522 3300039447 Bacteria 581
1279 Ga0436361_0147964 3300039447 Bacteria 6359
1280 Ga0436361_0249946 3300039447 Bacteria 698
1281 Ga0436361_0298431 3300039447 Bacteria 7234
1282 Ga0436361_0324977 3300039447 Bacteria 1806
1283 Ga0436361_0574324 3300039447 Bacteria 669
1284 Ga0436361_0582807 3300039447 Bacteria 681
1285 Ga0436361_0688104 3300039447 Bacteria 58309
1286 Ga0436361_0786290 3300039447 Bacteria 964
1287 Ga0436361_0804603 3300039447 Bacteria 7354
1288 Ga0436361_0925853 3300039447 Bacteria 1106
1289 Ga0436361_1066058 3300039447 Bacteria 1081
1290 Ga0436361_1073388 3300039447 Bacteria 1387
1291 Ga0436363_0134352 3300039450 Bacteria 728
1292 Ga0436363_0435549 3300039450 Bacteria 1180
1293 Ga0436363_0534225 3300039450 Bacteria 609
1294 Ga0436363_0924720 3300039450 Bacteria 557
1295 Ga0436363_0952708 3300039450 Bacteria 1131
1296 Ga0436363_1610909 3300039450 Bacteria 707
1297 Ga0436362_0101641 3300039453 Bacteria 846
1298 Ga0436362_0370145 3300039453 Bacteria 653
1299 Ga0436362_0546087 3300039453 Bacteria 833
1300 Ga0436362_0765821 3300039453 Bacteria 2223
1301 Ga0436362_1083820 3300039453 Bacteria 1523
1302 Ga0436362_1292496 3300039453 Bacteria 579
1303 Ga0451789_1364666 3300041443 Bacteria 1200
1304 Ga0451793_0876891 3300041452 Bacteria 661
1305 Ga0451835_1133788 3300041492 Bacteria 759
1306 Ga0451839_0325131 3300041496 Bacteria 1117
1307 Ga0451839_0824064 3300041496 Bacteria 501
1308 Ga0451839_1545218 3300041496 Bacteria 828
1309 Ga0451845_0986483 3300041501 Bacteria 789
1310 Ga0451843_1621180 3300041509 Bacteria 565
1311 Ga0451853_2008343 3300041512 Bacteria 2257
1312 Ga0451853_3762953 3300041512 Bacteria 525
1313 Ga0439431_0199129 3300041997 Bacteria 583
1314 Ga0439448_0037453 3300042005 Bacteria 1558
1315 Ga0451577_1821555 3300042876 Bacteria 534
1316 Ga0466969_0036637 3300044656 Bacteria 2477
1317 Ga0466969_0040570 3300044656 Bacteria 2332
1318 Ga0466969_0150888 3300044656 Bacteria 1071
1319 Ga0466969_0291872 3300044656 Bacteria 738
1320 Ga0466972_0001620 3300044658 Bacteria 10989
1321 Ga0466972_0158522 3300044658 Bacteria 1063
1322 Ga0466972_0335588 3300044658 Bacteria 707
1323 Ga0466965_0280543 3300044683 Bacteria 900
1324 Ga0466966_0000632 3300044684 Bacteria 22387
1325 Ga0466966_0023836 3300044684 Bacteria 4005
1326 Ga0466966_0027141 3300044684 Bacteria 3734
1327 Ga0466961_0000897 3300044693 Bacteria 18504
1328 Ga0466961_0001874 3300044693 Bacteria 13062
1329 Ga0466961_0059644 3300044693 Bacteria 2426
1330 Ga0466963_0120269 3300044694 Bacteria 1807
1331 Ga0466963_0604047 3300044694 Bacteria 775
1332 Ga0466963_1296588 3300044694 Bacteria 511
1333 Ga0466964_0229245 3300044706 Bacteria 906
1334 Ga0453684_0000497 3300044712 Bacteria 153728
1335 Ga0466970_0059567 3300044765 Bacteria 2045
1336 Ga0466970_0155617 3300044765 Bacteria 1263
1337 Ga0466957_1379520 3300044842 Bacteria 513
1338 Ga0466960_0817079 3300044901 Bacteria 565
1339 Ga0466959_0004435 3300045049 Bacteria 9399
1340 Ga0466959_0026954 3300045049 Bacteria 4262
1341 Ga0466959_0149736 3300045049 Bacteria 1645
1342 Ga0466959_1194577 3300045049 Bacteria 505
1343 Ga0451576_0027185 3300045051 Bacteria 6146
1344 Ga0451576_0921795 3300045051 Bacteria 916
1345 Ga0451576_2124564 3300045051 Unclassified 577
1346 Ga0466958_0611734 3300045836 Bacteria 709
1347 Ga0466967_0033635 3300045976 Bacteria 4342
1348 Ga0466967_0047012 3300045976 Bacteria 3760
1349 Ga0466967_0095059 3300045976 Bacteria 2715
1350 Ga0466967_0159258 3300045976 Bacteria 2118
1351 Ga0495592_0566701 3300046454 Bacteria 696
1352 Ga0495603_0193078 3300046455 Bacteria 1177
1353 Ga0495629_0000008 3300046459 Bacteria 352138
1354 Ga0495629_0048582 3300046459 Bacteria 2974
1355 Ga0495629_0354921 3300046459 Bacteria 1000
1356 Ga0495638_0252630 3300046460 Bacteria 971
1357 Ga0495651_0038941 3300046462 Bacteria 3701
1358 Ga0495653_0029611 3300046463 Bacteria 4368
1359 Ga0495580_0184281 3300046472 Bacteria 1441
1360 Ga0495582_0000674 3300046473 Bacteria 18786
1361 Ga0495605_0201876 3300046474 Bacteria 866
1362 Ga0495639_0000567 3300046475 Bacteria 17207
1363 Ga0495639_0634673 3300046475 Bacteria 550
1364 Ga0495662_0024433 3300046476 Bacteria 2916
1365 Ga0495662_0255794 3300046476 Bacteria 862
1366 Ga0495662_0261575 3300046476 Bacteria 852
1367 Ga0495664_0506451 3300046477 Bacteria 721
1368 Ga0495584_0637620 3300046491 Bacteria 543
1369 Ga0495594_0134913 3300046499 Bacteria 1399
1370 Ga0495608_0190739 3300046511 Bacteria 1294
1371 Ga0495616_0031832 3300046513 Bacteria 2759
1372 Ga0495628_0554772 3300046516 Bacteria 824
1373 Ga0495628_0857846 3300046516 Bacteria 632
1374 Ga0495628_1248318 3300046516 Bacteria 503
1375 Ga0495630_0040767 3300046517 Bacteria 3470
1376 Ga0495630_0296071 3300046517 Bacteria 1236
1377 Ga0495630_0508701 3300046517 Bacteria 923
1378 Ga0495643_0012071 3300046522 Bacteria 5225
1379 Ga0495666_0000101 3300046526 Bacteria 34931
1380 Ga0495642_0001940 3300046528 Bacteria 8745
1381 Ga0495642_0263292 3300046528 Bacteria 754
1382 Ga0495665_0000193 3300046531 Bacteria 31390
1383 Ga0495640_0931474 3300046533 Bacteria 514
1384 Ga0495586_0000818 3300046535 Bacteria 17884
1385 Ga0495586_0162681 3300046535 Bacteria 1259
1386 Ga0495586_0269614 3300046535 Bacteria 973
1387 Ga0495586_0304802 3300046535 Bacteria 913
1388 Ga0495598_0085544 3300046537 Bacteria 1019
1389 Ga0495621_0267471 3300046539 Bacteria 702
1390 Ga0495597_0044566 3300046542 Bacteria 1972
1391 Ga0495667_0363901 3300046559 Bacteria 913
1392 Ga0495656_0309272 3300046615 Bacteria 811
1393 Ga0495668_0294683 3300046616 Unclassified 889
1394 Ga0495668_0412140 3300046616 Bacteria 743
1395 Ga0495634_0518424 3300046642 Bacteria 697
1396 Ga0495625_0055245 3300046660 Bacteria 2832
1397 Ga0495625_0091652 3300046660 Bacteria 2101
1398 Ga0495635_0001435 3300046663 Bacteria 15925
1399 Ga0495588_0493207 3300046674 Bacteria 642
1400 Ga0495657_0413528 3300046675 Bacteria 792
1401 Ga0495599_0608623 3300046678 Unclassified 636
1402 Ga0495647_0000581 3300046681 Bacteria 10819
1403 Ga0495658_0022836 3300046683 Bacteria 3313
1404 Ga0495658_0049229 3300046683 Bacteria 2379
1405 Ga0495669_0260034 3300046684 Bacteria 834
1406 Ga0495613_0001075 3300046689 Bacteria 20823
1407 Ga0495670_0525135 3300046691 Bacteria 643
1408 Ga0495671_0233660 3300046692 Bacteria 889
1409 Ga0495649_0291043 3300046694 Bacteria 833
1410 Ga0495600_0003122 3300046809 Bacteria 9703
1411 Ga0495581_0000277 3300047315 Bacteria 24872
1412 Ga0495581_0024157 3300047315 Bacteria 3522
1413 Ga0495636_0531685 3300047318 Bacteria 571
1414 Ga0495676_0010268 3300047321 Bacteria 8497
1415 Ga0495680_0060910 3300047322 Bacteria 2906
1416 Ga0495680_0071991 3300047322 Unclassified 2630
1417 Ga0495680_0351283 3300047322 Bacteria 1026
1418 Ga0495683_0070881 3300047323 Bacteria 1711
1419 Ga0495687_009164 3300047443 Bacteria 5568
1420 Ga0495675_0854754 3300047444 Bacteria 501
1421 Ga0495684_0001806 3300047471 Bacteria 17187
1422 Ga0495684_0806778 3300047471 Bacteria 613
1423 Ga0495686_0399255 3300047472 Bacteria 738
1424 Ga0495614_0589883 3300048089 Bacteria 533
1425 Ga0495626_0034476 3300048091 Bacteria 2421
1426 Ga0496100_0334006 3300048903 Bacteria 1141
1427 Ga0496100_0658885 3300048903 Bacteria 815
1428 Ga0496101_0488016 3300048904 Bacteria 973
1429 Ga0496101_0658182 3300048904 Bacteria 827
1430 Ga0496102_0008058 3300048905 Bacteria 9012
1431 Ga0496102_0021064 3300048905 Bacteria 5766
1432 Ga0496102_0063640 3300048905 Bacteria 3378
1433 Ga0496102_0064831 3300048905 Bacteria 3347
1434 Ga0496102_0235871 3300048905 Bacteria 1725
1435 Ga0496102_1211100 3300048905 Bacteria 675
1436 Ga0496103_0002880 3300048906 Bacteria 10677
1437 Ga0496103_0225619 3300048906 Bacteria 1205
1438 Ga0496104_0000012 3300048907 Bacteria 438011
1439 Ga0496104_0194686 3300048907 Bacteria 1939
1440 Ga0496104_1801100 3300048907 Bacteria 514
1441 Ga0496105_0000011 3300048908 Bacteria 302186
1442 Ga0496105_0101553 3300048908 Bacteria 2375
1443 Ga0496105_0933591 3300048908 Bacteria 652
1444 Ga0496106_0078500 3300048909 Bacteria 2533
1445 Ga0496106_0266847 3300048909 Bacteria 1370
1446 Ga0496107_0524596 3300048910 Bacteria 878
1447 Ga0496108_0071447 3300048911 Bacteria 2928
1448 Ga0496109_0135553 3300048912 Bacteria 2300
1449 Ga0496109_0195265 3300048912 Bacteria 1902
1450 Ga0496109_0587405 3300048912 Bacteria 1050
1451 Ga0496110_0088410 3300048913 Bacteria 2767
1452 Ga0496110_0264036 3300048913 Bacteria 1567
1453 Ga0496112_0013319 3300048915 Bacteria 7591
1454 Ga0496112_0073457 3300048915 Bacteria 3381
1455 Ga0496112_0158196 3300048915 Bacteria 2232
1456 Ga0496112_0227710 3300048915 Bacteria 1819
1457 Ga0496112_1794814 3300048915 Bacteria 525
1458 Ga0496113_0210514 3300048916 Bacteria 1548
1459 Ga0496113_0261612 3300048916 Bacteria 1382
1460 Ga0496113_1029913 3300048916 Bacteria 647
1461 Ga0496114_0196049 3300048917 Bacteria 1768
1462 Ga0496114_0577640 3300048917 Bacteria 992
1463 Ga0496115_0059226 3300048918 Unclassified 3084
1464 Ga0496115_0371736 3300048918 Bacteria 1164
1465 Ga0496115_0484488 3300048918 Bacteria 996
1466 Ga0496117_0028747 3300048920 Bacteria 4300
1467 Ga0496117_0045774 3300048920 Bacteria 3155
1468 Ga0496118_0000880 3300048921 Bacteria 47321
1469 Ga0496118_0004511 3300048921 Bacteria 16463
1470 Ga0496118_0081937 3300048921 Bacteria 2263
1471 Ga0496118_0085703 3300048921 Bacteria 2192
1472 Ga0496118_0509970 3300048921 Bacteria 596
1473 Ga0496119_0081422 3300048922 Bacteria 1865
1474 Ga0496120_0257534 3300048923 Bacteria 816
1475 Ga0496121_0076712 3300048924 Bacteria 2664
1476 Ga0496121_0153477 3300048924 Bacteria 1692
1477 Ga0496122_0000362 3300048925 Bacteria 97690
1478 Ga0496122_0148530 3300048925 Bacteria 1452
1479 Ga0496123_0007188 3300048926 Bacteria 10564
1480 Ga0496124_0358717 3300048927 Bacteria 1028
1481 Ga0496125_0185509 3300048928 Bacteria 1380
1482 Ga0496125_0481905 3300048928 Bacteria 703
1483 Ga0496125_0611136 3300048928 Bacteria 593
1484 Ga0496126_0000925 3300048929 Bacteria 50764
1485 Ga0496126_0002985 3300048929 Bacteria 21973
1486 Ga0496126_0009713 3300048929 Bacteria 10192
1487 Ga0496126_0298061 3300048929 Bacteria 1331
1488 Ga0496126_0526082 3300048929 Bacteria 942
1489 Ga0495682_0174201 3300049460 Bacteria 765
1490 Ga0495682_0290169 3300049460 Bacteria 577
1491 Ga0501299_006306 3300049522 Bacteria 1858
1492 Ga0501300_011635 3300049523 Bacteria 1281
1493 Ga0501031_0405268 3300049568 Bacteria 882
1494 Ga0501032_0044990 3300049569 Bacteria 2987
1495 Ga0501032_0625142 3300049569 Bacteria 684
1496 Ga0501032_1080156 3300049569 Bacteria 503
1497 Ga0501033_0074978 3300049570 Bacteria 2483
1498 Ga0501033_0142321 3300049570 Bacteria 1733
1499 Ga0501033_0662937 3300049570 Bacteria 712
1500 Ga0501034_0015756 3300049571 Bacteria 7763
1501 Ga0501034_0041700 3300049571 Bacteria 4644
1502 Ga0501034_0090398 3300049571 Bacteria 3059
1503 Ga0501034_0234996 3300049571 Bacteria 1781
1504 Ga0501034_0335870 3300049571 Bacteria 1442
1505 Ga0501034_0336393 3300049571 Bacteria 1440
1506 Ga0501034_0874136 3300049571 Bacteria 788
1507 Ga0501036_0228874 3300049572 Bacteria 1560
1508 Ga0501036_1065820 3300049572 Bacteria 661
1509 Ga0501037_0056565 3300049573 Bacteria 2864
1510 Ga0501037_0209196 3300049573 Bacteria 1376
1511 Ga0501037_0345967 3300049573 Bacteria 1026
1512 Ga0501037_0466685 3300049573 Bacteria 860
1513 Ga0501037_0802820 3300049573 Bacteria 621
1514 Ga0501038_0008950 3300049574 Bacteria 9184
1515 Ga0501038_0109654 3300049574 Bacteria 2287
1516 Ga0501038_0483790 3300049574 Bacteria 948
1517 Ga0501038_1123182 3300049574 Bacteria 573
1518 Ga0501038_1243395 3300049574 Bacteria 539
1519 Ga0501039_0038123 3300049575 Bacteria 3713
1520 Ga0501039_0332661 3300049575 Bacteria 1194
1521 Ga0501042_0341385 3300049578 Bacteria 1083
1522 Ga0501043_0052365 3300049579 Bacteria 3206
1523 Ga0501043_0541773 3300049579 Bacteria 865
1524 Ga0501046_0056432 3300049580 Bacteria 3083
1525 Ga0501046_1105322 3300049580 Bacteria 547
1526 Ga0501046_1254847 3300049580 Bacteria 507
1527 Ga0501047_0009209 3300049581 Bacteria 9320
1528 Ga0501047_0020525 3300049581 Bacteria 6343
1529 Ga0501047_0026810 3300049581 Bacteria 5546
1530 Ga0501047_0044380 3300049581 Bacteria 4295
1531 Ga0501047_0122539 3300049581 Bacteria 2481
1532 Ga0501047_0167009 3300049581 Bacteria 2071
1533 Ga0501047_0239052 3300049581 Bacteria 1667
1534 Ga0501047_0406381 3300049581 Bacteria 1194
1535 Ga0501047_0679303 3300049581 Bacteria 848
1536 Ga0501047_0980542 3300049581 Bacteria 658
1537 Ga0501047_1414123 3300049581 Bacteria 511
1538 Ga0501048_0705526 3300049582 Bacteria 724
1539 Ga0501067_0014186 3300049583 Bacteria 4413
1540 Ga0501067_0136292 3300049583 Bacteria 1367
1541 Ga0501068_0130993 3300049584 Bacteria 1568
1542 Ga0501068_0386010 3300049584 Bacteria 902
1543 Ga0501069_0042044 3300049585 Bacteria 2527
1544 Ga0501069_0229257 3300049585 Bacteria 1081
1545 Ga0501070_0008723 3300049586 Bacteria 8571
1546 Ga0501070_0010789 3300049586 Bacteria 7719
1547 Ga0501070_0028488 3300049586 Bacteria 4685
1548 Ga0501070_0029122 3300049586 Bacteria 4631
1549 Ga0501070_0118340 3300049586 Bacteria 2189
1550 Ga0501070_0134361 3300049586 Bacteria 2043
1551 Ga0501070_0152012 3300049586 Bacteria 1910
1552 Ga0501070_0247021 3300049586 Bacteria 1460
1553 Ga0501070_0380264 3300049586 Bacteria 1144
1554 Ga0501070_0663760 3300049586 Bacteria 827
1555 Ga0501073_0005196 3300049589 Bacteria 9758
1556 Ga0501073_0022466 3300049589 Bacteria 4542
1557 Ga0501073_0067293 3300049589 Bacteria 2497
1558 Ga0501074_0010940 3300049590 Bacteria 6587
1559 Ga0501074_0073799 3300049590 Bacteria 2450
1560 Ga0501074_1287604 3300049590 Bacteria 512
1561 Ga0501217_018049 3300049661 Bacteria 1634
1562 Ga0501248_012099 3300049678 Bacteria 789
1563 Ga0501249_033212 3300049679 Bacteria 1155
1564 Ga0501249_172287 3300049679 Bacteria 555
1565 Ga0501259_023039 3300049688 Bacteria 1124
1566 Ga0501261_016995 3300049690 Bacteria 1014
1567 Ga0501225_0063523 3300049705 Bacteria 1041
1568 Ga0501079_0109309 3300049741 Bacteria 2147
1569 Ga0501079_0614234 3300049741 Bacteria 856
1570 Ga0501080_0002048 3300049742 Bacteria 17455
1571 Ga0501080_0005634 3300049742 Bacteria 11190
1572 Ga0501080_0015097 3300049742 Bacteria 7118
1573 Ga0501080_0043668 3300049742 Bacteria 4174
1574 Ga0501080_0076492 3300049742 Bacteria 3113
1575 Ga0501080_0164295 3300049742 Bacteria 2049
1576 Ga0501080_0226481 3300049742 Bacteria 1709
1577 Ga0501080_0375644 3300049742 Bacteria 1281
1578 Ga0501080_0494318 3300049742 Bacteria 1094
1579 Ga0501080_0501904 3300049742 Bacteria 1084
1580 Ga0501083_0019324 3300049744 Bacteria 4746
1581 Ga0501083_0019536 3300049744 Bacteria 4719
1582 Ga0501083_0026078 3300049744 Bacteria 4043
1583 Ga0501083_0058230 3300049744 Bacteria 2586
1584 Ga0501035_0022635 3300049822 Bacteria 5772
1585 Ga0501035_0056896 3300049822 Bacteria 3488
1586 Ga0501035_0057486 3300049822 Bacteria 3468
1587 Ga0501035_0204139 3300049822 Bacteria 1694
1588 Ga0501035_0325568 3300049822 Bacteria 1290
1589 Ga0501044_0005549 3300049823 Bacteria 14009
1590 Ga0501044_0046313 3300049823 Bacteria 4503
1591 Ga0501044_0067893 3300049823 Bacteria 3632
1592 Ga0501044_0068723 3300049823 Bacteria 3608
1593 Ga0501044_0074192 3300049823 Bacteria 3457
1594 Ga0501044_0096341 3300049823 Bacteria 2980
1595 Ga0501044_0168202 3300049823 Bacteria 2165
1596 Ga0501044_0287009 3300049823 Bacteria 1578
1597 Ga0501044_0381800 3300049823 Bacteria 1324
1598 Ga0501045_0838596 3300049824 Bacteria 676
1599 nmdc:mga03683_614804_c1 3300050489 Bacteria 533
1600 nmdc:mga03683_71801_c1 3300050489 Bacteria 1481
1601 nmdc:mga03n38_239585_c1 3300050490 Bacteria 954
1602 nmdc:mga03n38_38953_c1 3300050490 Bacteria 2059
1603 nmdc:mga03n38_625374_c1 3300050490 Bacteria 615
1604 nmdc:mga00v17_107719_c1 3300050491 Bacteria 1765
1605 nmdc:mga00v17_15060_c1 3300050491 Bacteria 4334
1606 nmdc:mga0yw44_50413_c1 3300050492 Bacteria 2517
1607 nmdc:mga0yw44_75348_c1 3300050492 Bacteria 2104
1608 nmdc:mga0k408_178216_c1 3300050493 Bacteria 1267
1609 nmdc:mga0k408_20469_c1 3300050493 Bacteria 3707
1610 nmdc:mga06z11_176425_c1 3300050494 Bacteria 1230
1611 nmdc:mga06z11_19529_c1 3300050494 Bacteria 3118
1612 nmdc:mga04h51_182307_c1 3300050495 Bacteria 818
1613 nmdc:mga04h51_7586_c1 3300050495 Bacteria 2870
1614 nmdc:mga07m45_116710_c1 3300050496 Bacteria 1540
1615 nmdc:mga07m45_33430_c1 3300050496 Bacteria 2856
1616 nmdc:mga05p37_807525_c1 3300050507 Bacteria 1025
1617 nmdc:mga05p37_845169_c1 3300050507 Bacteria 995
1618 nmdc:mga05p37_909833_c1 3300050507 Bacteria 947
1619 nmdc:mga05p37_95097_c1 3300050507 Bacteria 3671
1620 nmdc:mga09592_312311_c1 3300050508 Bacteria 1362
1621 nmdc:mga09592_418227_c1 3300050508 Bacteria 1158
1622 nmdc:mga09592_625262_c1 3300050508 Bacteria 921
1623 nmdc:mga06r32_6533_c1 3300050510 Bacteria 10475
1624 nmdc:mga06r32_691792_c1 3300050510 Bacteria 986
1625 nmdc:mga08y16_1360663_c1 3300050511 Bacteria 674
1626 nmdc:mga08y16_141932_c1 3300050511 Bacteria 2497
1627 nmdc:mga08y16_294013_c1 3300050511 Bacteria 1675
1628 nmdc:mga08y16_57347_c1 3300050511 Bacteria 4070
1629 nmdc:mga08y16_648382_c1 3300050511 Bacteria 1060
1630 nmdc:mga0n895_1176277_c1 3300050512 Bacteria 742
1631 nmdc:mga0n895_182902_c1 3300050512 Bacteria 2128
1632 nmdc:mga0n895_27801_c1 3300050512 Bacteria 5376
1633 nmdc:mga0n895_5651_c1 3300050512 Bacteria 10481
1634 nmdc:mga0n895_56967_c1 3300050512 Bacteria 3852
1635 nmdc:mga0n895_574417_c1 3300050512 Bacteria 1132
1636 nmdc:mga0rr50_10123_c1 3300050513 Bacteria 5968
1637 nmdc:mga0rr50_160039_c1 3300050513 Bacteria 1827
1638 nmdc:mga0rr50_610163_c1 3300050513 Bacteria 930
1639 nmdc:mga0rr50_980580_c1 3300050513 Unclassified 720
1640 nmdc:mga08x19_138789_c1 3300050514 Bacteria 1641
1641 nmdc:mga08x19_689792_c1 3300050514 Bacteria 725
1642 nmdc:mga0a205_17434_c1 3300050515 Bacteria 6733
1643 nmdc:mga0a205_316383_c1 3300050515 Bacteria 1432
1644 nmdc:mga0a205_49650_c1 3300050515 Bacteria 4051
1645 nmdc:mga0sz30_17585_c1 3300050516 Bacteria 2853
1646 nmdc:mga0sz30_33593_c1 3300050516 Bacteria 2133
1647 nmdc:mga0sz30_487879_c1 3300050516 Bacteria 554
1648 Ga0495601_0473726 3300053077 Bacteria 809
1649 Ga0495595_0120686 3300053084 Bacteria 1277
1650 Ga0495595_0472973 3300053084 Bacteria 638
1651 Ga0495619_0002446 3300053085 Bacteria 12164
1652 Ga0500578_0062105 3300053086 Bacteria 2385
1653 Ga0500578_0142102 3300053086 Bacteria 1500
1654 Ga0500643_000013 3300053087 Bacteria 324296
1655 Ga0500643_025816 3300053087 Bacteria 1848
1656 Ga0500643_189535 3300053087 Bacteria 551
1657 Ga0500651_0163854 3300053093 Bacteria 1328
1658 Ga0500650_0183400 3300053098 Unclassified 958
1659 Ga0500554_098060 3300053102 Bacteria 979
1660 Ga0500555_000025 3300053103 Bacteria 119960
1661 Ga0500556_0005981 3300053104 Bacteria 3448
1662 Ga0500572_027263 3300053111 Bacteria 1564
1663 Ga0500592_012176 3300053116 Bacteria 1375
1664 Ga0500595_086825 3300053119 Bacteria 910
1665 Ga0500597_155413 3300053120 Bacteria 980
1666 Ga0500614_165965 3300053123 Bacteria 671
1667 Ga0500655_039097 3300053133 Bacteria 928
1668 Ga0500658_0141013 3300053134 Bacteria 1081
1669 Ga0500559_0003975 3300053136 Bacteria 7119
1670 Ga0500564_017840 3300053138 Bacteria 3229
1671 Ga0500616_0040971 3300053153 Bacteria 2488
1672 Ga0500619_149021 3300053154 Bacteria 796
1673 Ga0500637_0425958 3300053178 Bacteria 681
1674 Ga0500645_011279 3300053730 Bacteria 2923
1675 Ga0501084_0048326 3300054114 Bacteria 3562
1676 Ga0587111_0194149 3300060346 Bacteria 572
1677 Ga0501082_0000176 3300060353 Bacteria 55663
1678 Ga0501082_0005084 3300060353 Bacteria 11459
1679 Ga0501082_0112348 3300060353 Bacteria 2359
1680 Ga0466962_0409353 3300061719 Bacteria 680
1681 2512351273 2512047030 Bacteria 9031815
1682 2515684689 2515154122 Bacteria 8609520
1683 2885280123 2885270888 Bacteria 9831543
1684 2888386441 2888378607 Bacteria 9652610
1685 2889036727 2889033259 Bacteria 9099371
1686 2902684507 2902682994 Bacteria 8951596
1687 2932791551 2932784394 Bacteria 9704911
1688 2932835454 2932828146 Bacteria 9745859
1689 2935613545 2935608549 Bacteria 8203142
1690 2935643484 2935638405 Bacteria 10015038
1691 2935710760 2935703347 Bacteria 10242284
1692 2935824602 2935819856 Bacteria 8261050
1693 2935833001 2935827899 Bacteria 10038562
1694 2935844327 2935837841 Bacteria 9454360
1695 2935851822 2935847175 Bacteria 8228321
1696 2935996710 2935992306 Bacteria 9802711
1697 3005724066 3005718088 Bacteria 8283608
1698 8017065969 8017057580 Bacteria 10023680
1699 8019578681 8019576017 Bacteria 10049540
1700 8019596718 8019586578 Bacteria 10212056
1701 8019604971 8019597564 Bacteria 10041141
1702 8019613562 8019608314 Bacteria 10042931
1703 Ga0373930_0101847
1704 JGI24736J21556_1015368
1705 JGI24736J21556_1021579
1706 JGI24739J22299_10073599
1707 JGI24737J22298_10091082
1708 JGI24748J21848_1001755
1709 JGI24751J29686_10050174
1710 JGI24751J29686_10130390
1711 JGI25156J39149_1008617
1712 JGI25162J39368_1003180
1713 JGI25157J39369_1004429
1714 JGI25164J39214_1001517
1715 JGI25165J46597_1002740
1716 JGI25153J46596_10006212
1717 JGI25153J46596_10027181
1718 rootH2_10080896
1719 JGI25160J50197_1027724
1720 JGI25404J52841_10005248
1721 Ga0055525_1003849
1722 Ga0055527_1001410
1723 Ga0055535_1000762
1724 Ga0055535_1001669
1725 Ga0055542_1001204
1726 Ga0055542_1001618
1727 Ga0055542_1028182
1728 Ga0055529_1000969
1729 Ga0055529_1011211
1730 Ga0055524_1032917
1731 Ga0055540_1002653
1732 Ga0055540_1089684
1733 Ga0055531_10000002
1734 Ga0055531_10000234
1735 Ga0055531_10001156
1736 Ga0055531_10054756
1737 Ga0065165_1001827
1738 Ga0065165_1004722
1739 Ga0065714_10156014
1740 Ga0065712_10004533
1741 Ga0065712_10086972
1742 Ga0065715_10032818
1743 Ga0065715_10092414
1744 Ga0065715_10100822
1745 Ga0065715_10348883
1746 Ga0065707_10088244
1747 Ga0070658_10041393
1748 Ga0070658_10047697
1749 Ga0070676_10136820
1750 Ga0070676_10654731
1751 Ga0070683_100020285
1752 Ga0070683_100049047
1753 Ga0070683_100277955
1754 Ga0070683_100290013
1755 Ga0070683_100813273
1756 Ga0070690_100000659
1757 Ga0070690_100016640
1758 Ga0070690_100050230
1759 Ga0070690_100229506
1760 Ga0070690_100520157
1761 Ga0070670_100006270
1762 Ga0070670_100130867
1763 Ga0070670_100131109
1764 Ga0070670_100143258
1765 Ga0070670_100200923
1766 Ga0070677_10014260
1767 Ga0070677_10801587
1768 Ga0068869_100015358
1769 Ga0068869_100274307
1770 Ga0068869_101044454
1771 Ga0068869_101799850
1772 Ga0070666_10000003
1773 Ga0070666_10007556
1774 Ga0070666_10009620
1775 Ga0070666_10035307
1776 Ga0070666_10787675
1777 Ga0070666_11011814
1778 Ga0070666_11095102
1779 Ga0070680_100000638
1780 Ga0070680_100031410
1781 Ga0070680_100175521
1782 Ga0070680_100711817
1783 Ga0070680_100738049
1784 Ga0070680_100791529
1785 Ga0070680_100847624
1786 Ga0070680_101074013
1787 Ga0070682_100116774
1788 Ga0070682_101015800
1789 Ga0068868_100228042
1790 Ga0068868_100248784
1791 Ga0068868_101437998
1792 Ga0068868_101569680
1793 Ga0068868_102172133
1794 Ga0070660_100140461
1795 Ga0070660_101467951
1796 Ga0070689_100055855
1797 Ga0070689_101112229
1798 Ga0070691_10046365
1799 Ga0070691_10647447
1800 Ga0070691_10869850
1801 Ga0070687_100088033
1802 Ga0070687_100099644
1803 Ga0070687_100107919
1804 Ga0070661_100034824
1805 Ga0070661_100062488
1806 Ga0070661_100153662
1807 Ga0070661_101515868
1808 Ga0070692_10000442
1809 Ga0070692_11237327
1810 Ga0070668_100016018
1811 Ga0070668_100211729
1812 Ga0070668_100283304
1813 Ga0070668_101795866
1814 Ga0070668_102059136
1815 Ga0070669_100007961
1816 Ga0070669_100008649
1817 Ga0070669_100681976
1818 Ga0070675_100001805
1819 Ga0070675_100051449
1820 Ga0070675_100119903
1821 Ga0070675_100309809
1822 Ga0070675_101082719
1823 Ga0070671_100007395
1824 Ga0070671_100024351
1825 Ga0070671_100093484
1826 Ga0070671_100289321
1827 Ga0070671_100455641
1828 Ga0070671_100491859
1829 Ga0070674_100022583
1830 Ga0070674_100042177
1831 Ga0070674_100045473
1832 Ga0070674_101501177
1833 Ga0070673_100023355
1834 Ga0070673_100123685
1835 Ga0070673_100257426
1836 Ga0070673_100415335
1837 Ga0070673_100862872
1838 Ga0070673_101726887
1839 Ga0070688_100014662
1840 Ga0070688_100031832
1841 Ga0070688_100089508
1842 Ga0070688_100590431
1843 Ga0070688_100597938
1844 Ga0070659_100015121
1845 Ga0070659_100160980
1846 Ga0070659_101317445
1847 Ga0070667_100000049
1848 Ga0070667_100000129
1849 Ga0070667_100012603
1850 Ga0070667_100026817
1851 Ga0070667_100040730
1852 Ga0070667_100247162
1853 Ga0070667_100312819
1854 Ga0070667_100342111
1855 Ga0070667_100410628
1856 Ga0070709_10014894
1857 Ga0070709_10305038
1858 Ga0070714_101106298
1859 Ga0070714_102492986
1860 Ga0070713_100041356
1861 Ga0070713_100347421
1862 Ga0070713_101044927
1863 Ga0070710_10140852
1864 Ga0070701_10021041
1865 Ga0070711_100057363
1866 Ga0070711_100576702
1867 Ga0070711_100823062
1868 Ga0070711_100954301
1869 Ga0070711_101217193
1870 Ga0070705_100015101
1871 Ga0070705_100043853
1872 Ga0070705_101119988
1873 Ga0070700_100017632
1874 Ga0070700_100032982
1875 Ga0070700_101287421
1876 Ga0070700_101445052
1877 Ga0070694_100046149
1878 Ga0070694_100238867
1879 Ga0070708_100007506
1880 Ga0070708_100104501
1881 Ga0070708_100250706
1882 Ga0070708_101612547
1883 Ga0070663_100000996
1884 Ga0070663_100056941
1885 Ga0070663_100376719
1886 Ga0070663_100771079
1887 Ga0070678_100004888
1888 Ga0070678_100009831
1889 Ga0070678_100017870
1890 Ga0070678_100239862
1891 Ga0070678_100244482
1892 Ga0070678_100522920
1893 Ga0070678_100853711
1894 Ga0070662_100009850
1895 Ga0070662_100034756
1896 Ga0070662_100131686
1897 Ga0070662_100153920
1898 Ga0070662_100680658
1899 Ga0070662_101468429
1900 Ga0070681_10007731
1901 Ga0070681_10014089
1902 Ga0070681_10030015
1903 Ga0070681_10032470
1904 Ga0070681_10033693
1905 Ga0070681_10081128
1906 Ga0068867_100006360
1907 Ga0068867_100070879
1908 Ga0068867_100113935
1909 Ga0068867_100215995
1910 Ga0068867_100696485
1911 Ga0068867_100741118
1912 Ga0070685_10007147
1913 Ga0070685_10036196
1914 Ga0070685_10120106
1915 Ga0070685_10144937
1916 Ga0070706_100027551
1917 Ga0070706_100029141
1918 Ga0070706_100081152
1919 Ga0070706_100083087
1920 Ga0070706_100342122
1921 Ga0070707_100013711
1922 Ga0070707_100318835
1923 Ga0070707_100428217
1924 Ga0070707_100630514
1925 Ga0070698_100013139
1926 Ga0070698_100080159
1927 Ga0070698_101058083
1928 Ga0070698_101499655
1929 Ga0070699_100003254
1930 Ga0070699_100035623
1931 Ga0070699_101109535
1932 Ga0070699_101776121
1933 Ga0070679_100021255
1934 Ga0070679_100123725
1935 Ga0070679_100124837
1936 Ga0070679_100213575
1937 Ga0070679_100382984
1938 Ga0070679_100967722
1939 Ga0070684_100004144
1940 Ga0070684_100028623
1941 Ga0070684_100683871
1942 Ga0070684_101069725
1943 Ga0070697_100214933
1944 Ga0068853_100036182
1945 Ga0068853_100099539
1946 Ga0068853_100151065
1947 Ga0068853_100423338
1948 Ga0068853_100487050
1949 Ga0068853_100531181
1950 Ga0068853_100864318
1951 Ga0068853_101228614
1952 Ga0068853_101428108
1953 Ga0070672_100006524
1954 Ga0070672_100015810
1955 Ga0070672_100058961
1956 Ga0070672_100080617
1957 Ga0070672_100123772
1958 Ga0070672_100760359
1959 Ga0070686_100002162
1960 Ga0070686_100023877
1961 Ga0070686_100377933
1962 Ga0070686_100860861
1963 Ga0070695_100093500
1964 Ga0070695_100466232
1965 Ga0070695_100878395
1966 Ga0070696_100010558
1967 Ga0070696_100363884
1968 Ga0070696_100579027
1969 Ga0070696_100865066
1970 Ga0070696_101490183
1971 Ga0070693_100014679
1972 Ga0070693_100040083
1973 Ga0070693_100148259
1974 Ga0070693_100335024
1975 Ga0070693_100586110
1976 Ga0070665_100000237
1977 Ga0070665_100000467
1978 Ga0070665_100003434
1979 Ga0070665_100017979
1980 Ga0070665_100088467
1981 Ga0070665_100099051
1982 Ga0070665_100250580
1983 Ga0070665_101173373
1984 Ga0070704_100045537
1985 Ga0070704_100351708
1986 Ga0068855_100002756
1987 Ga0068855_100020476
1988 Ga0068855_100030244
1989 Ga0068855_100135511
1990 Ga0068855_100339807
1991 Ga0068855_100342971
1992 Ga0068855_100982028
1993 Ga0068855_101052532
1994 Ga0068855_101125542
1995 Ga0070664_100000362
1996 Ga0070664_100041317
1997 Ga0068857_100073578
1998 Ga0068857_100079857
1999 Ga0068857_100099565
2000 Ga0068857_100110701
2001 Ga0068857_100206056
2002 Ga0068854_100011931
2003 Ga0068854_100045286
2004 Ga0068854_100791533
2005 Ga0068854_102008009
2006 Ga0068856_100044226
2007 Ga0068856_100064653
2008 Ga0068856_100094722
2009 Ga0068856_100219676
2010 Ga0068856_102496730
2011 Ga0068856_102709913
2012 Ga0070702_100026748
2013 Ga0070702_100072830
2014 Ga0068852_100231081
2015 Ga0068852_100943426
2016 Ga0068859_100005230
2017 Ga0068859_100028400
2018 Ga0068859_100037124
2019 Ga0068859_100097986
2020 Ga0068859_100311441
2021 Ga0068859_100319350
2022 Ga0068859_102100052
2023 Ga0068864_100011349
2024 Ga0068864_100319550
2025 Ga0068866_10002285
2026 Ga0068861_100003766
2027 Ga0068861_100006557
2028 Ga0068861_100007838
2029 Ga0068861_100068962
2030 Ga0068861_100268072
2031 Ga0068861_100319549
2032 Ga0068861_100641916
2033 Ga0068861_101207406
2034 Ga0068851_10014356
2035 Ga0068870_10009855
2036 Ga0068870_10370568
2037 Ga0068863_100004078
2038 Ga0068863_100033197
2039 Ga0068863_100061050
2040 Ga0068863_100074994
2041 Ga0068863_100385673
2042 Ga0068863_100838622
2043 Ga0068863_101147526
2044 Ga0068863_102385079
2045 Ga0068858_100003914
2046 Ga0068858_100990037
2047 Ga0068858_101034605
2048 Ga0068858_101151667
2049 Ga0068858_101703257
2050 Ga0068860_100014505
2051 Ga0068860_100025718
2052 Ga0068860_100242578
2053 Ga0068860_100337738
2054 Ga0068860_101127087
2055 Ga0068862_100000710
2056 Ga0068862_100000773
2057 Ga0068862_100006742
2058 Ga0068862_100082694
2059 Ga0068862_101169141
2060 Ga0081455_10003552
2061 Ga0081455_10100711
2062 Ga0081540_1000377
2063 Ga0081540_1003811
2064 Ga0081540_1027419
2065 Ga0081539_10197392
2066 Ga0081539_10240319
2067 Ga0070717_10243931
2068 Ga0070717_10285058
2069 Ga0070717_10708318
2070 Ga0070717_10713291
2071 Ga0070717_10771724
2072 Ga0070717_11162532
2073 Ga0075365_10100758
2074 Ga0075368_10003413
2075 Ga0075364_10052682
2076 Ga0075364_10124293
2077 Ga0075364_10320818
2078 Ga0075364_10613139
2079 Ga0070715_10111121
2080 Ga0070715_10121350
2081 Ga0070715_10683742
2082 Ga0070716_100019808
2083 Ga0070716_100350564
2084 Ga0070712_100000441
2085 Ga0070712_100641030
2086 Ga0070712_101444222
2087 Ga0070712_102005083
2088 Ga0075362_10112367
2089 Ga0075367_10156006
2090 Ga0075367_10822278
2091 Ga0075369_10132280
2092 Ga0075369_10340059
2093 Ga0075366_10002121
2094 Ga0075366_10128161
2095 Ga0097621_100004137
2096 Ga0097621_100004245
2097 Ga0097621_100020255
2098 Ga0097621_100034057
2099 Ga0097621_100228862
2100 Ga0097621_100567324
2101 Ga0097621_100584820
2102 Ga0097621_101765675
2103 Ga0075370_10013002
2104 Ga0068871_100009393
2105 Ga0068871_100011257
2106 Ga0068871_100023303
2107 Ga0068871_100162194
2108 Ga0068871_100220779
2109 Ga0068871_100391849
2110 Ga0068871_101575222
2111 Ga0075428_100035750
2112 Ga0075428_102684018
2113 Ga0075430_100009406
2114 Ga0075430_100363684
2115 Ga0075430_101133096
2116 Ga0075431_100050721
2117 Ga0075431_100076297
2118 Ga0075431_100594542
2119 Ga0075433_10012601
2120 Ga0075433_10054490
2121 Ga0075433_10272924
2122 Ga0075433_10492196
2123 Ga0075433_10526698
2124 Ga0075433_10630724
2125 Ga0075434_100000002
2126 Ga0075434_100005428
2127 Ga0075434_100029901
2128 Ga0075434_100134162
2129 Ga0075434_100181741
2130 Ga0075429_100318568
2131 Ga0075429_100501227
2132 Ga0075429_100669176
2133 Ga0075429_100893225
2134 Ga0068865_100002587
2135 Ga0068865_100011373
2136 Ga0068865_100016392
2137 Ga0068865_100075379
2138 Ga0068865_100351803
2139 Ga0075436_100011488
2140 Ga0075436_100202616
2141 Ga0075436_100304506
2142 Ga0075436_100355278
2143 Ga0075436_100736622
2144 Ga0075436_101019388
2145 Ga0097620_100005230
2146 Ga0097620_100028400
2147 Ga0097620_100037124
2148 Ga0097620_100097987
2149 Ga0097620_100311405
2150 Ga0097620_100319361
2151 Ga0097620_102099982
2152 Ga0099825_1035219
2153 Ga0099823_1032609
2154 Ga0075435_100018975
2155 Ga0075435_100038058
2156 Ga0075435_100630745
2157 Ga0075435_100988209
2158 Ga0075435_101410689
2159 Ga0075435_102040561
2160 Ga0099794_10092477
2161 Ga0099795_10173993
2162 Ga0105251_10231350
2163 Ga0105250_10044625
2164 Ga0105250_10097401
2165 Ga0105240_10003909
2166 Ga0105240_10013511
2167 Ga0105240_10040761
2168 Ga0105240_10048726
2169 Ga0105240_10051298
2170 Ga0105240_10086700
2171 Ga0105240_10102240
2172 Ga0105240_10117208
2173 Ga0105240_10201237
2174 Ga0105240_10415260
2175 Ga0105240_10599914
2176 Ga0105240_11396336
2177 Ga0111539_10007838
2178 Ga0111539_10026480
2179 Ga0111539_10176275
2180 Ga0111539_10629336
2181 Ga0111539_10685271
2182 Ga0111539_11458717
2183 Ga0111539_11460512
2184 Ga0111539_11720912
2185 Ga0111539_12605516
2186 Ga0111539_13040900
2187 Ga0105245_10016953
2188 Ga0105245_10038887
2189 Ga0105245_10056008
2190 Ga0105245_11095244
2191 Ga0105245_11269450
2192 Ga0105245_11719593
2193 Ga0105247_10008282
2194 Ga0105247_10080733
2195 Ga0105247_10133923
2196 Ga0105247_10595536
2197 Ga0105247_10847183
2198 Ga0105247_10887497
2199 Ga0114129_10104235
2200 Ga0114129_10440316
2201 Ga0114129_10598538
2202 Ga0114129_11194042
2203 Ga0114129_12017311
2204 Ga0105243_10005625
2205 Ga0105243_10113365
2206 Ga0105243_10257907
2207 Ga0105243_10444720
2208 Ga0105243_11733039
2209 Ga0105243_12046080
2210 Ga0105241_10003663
2211 Ga0105241_10035647
2212 Ga0105241_10073208
2213 Ga0105241_10161064
2214 Ga0105241_10377097
2215 Ga0105241_10379407
2216 Ga0105241_10477501
2217 Ga0105241_11253685
2218 Ga0105241_12014663
2219 Ga0105241_12400940
2220 Ga0105241_12577336
2221 Ga0105241_12649383
2222 Ga0105242_10007918
2223 Ga0105242_10024897
2224 Ga0105242_10042533
2225 Ga0105242_10204361
2226 Ga0105242_10307067
2227 Ga0105242_10373877
2228 Ga0105242_11033000
2229 Ga0105242_11100353
2230 Ga0105248_10000120
2231 Ga0105248_10003190
2232 Ga0105248_10125563
2233 Ga0105248_10225214
2234 Ga0105248_10426680
2235 Ga0105248_10588588
2236 Ga0105248_10706702
2237 Ga0105248_11127324
2238 Ga0105237_10000585
2239 Ga0105237_10041317
2240 Ga0105237_10060749
2241 Ga0105237_10066556
2242 Ga0105237_10067357
2243 Ga0105237_10092757
2244 Ga0105237_10227066
2245 Ga0105237_10371359
2246 Ga0105237_10415168
2247 Ga0105237_10540869
2248 Ga0105237_10557624
2249 Ga0105237_10588664
2250 Ga0105237_10661281
2251 Ga0105237_11217536
2252 Ga0105237_11268837
2253 Ga0105237_11382107
2254 Ga0105237_11949654
2255 Ga0105238_10000686
2256 Ga0105238_10000802
2257 Ga0105238_10018812
2258 Ga0105238_10029428
2259 Ga0105238_10055256
2260 Ga0105238_10087229
2261 Ga0105238_10143999
2262 Ga0105238_10218335
2263 Ga0105238_10641169
2264 Ga0105238_11020635
2265 Ga0105238_11246987
2266 Ga0105238_11294984
2267 Ga0105238_11354002
2268 Ga0105238_11670298
2269 Ga0105238_11885083
2270 Ga0105238_11929575
2271 Ga0105249_10001381
2272 Ga0105249_10007711
2273 Ga0105249_10082416
2274 Ga0105249_10292199
2275 Ga0105249_10475176
2276 Ga0105249_10539082
2277 Ga0105249_10826291
2278 Ga0105249_11050759
2279 Ga0105249_11298262
2280 Ga0099796_10438865
2281 Ga0105239_10000598
2282 Ga0105239_10024313
2283 Ga0105239_10039543
2284 Ga0105239_10055913
2285 Ga0105239_10108698
2286 Ga0105239_10153783
2287 Ga0105239_10219536
2288 Ga0105239_10565564
2289 Ga0105239_10713489
2290 Ga0105239_11914828
2291 Ga0105246_10003169
2292 Ga0105246_10056601
2293 Ga0105246_10119130
2294 Ga0105246_10376905
2295 Ga0105246_10523567
2296 Ga0105246_11197202
2297 Ga0105246_12511814
2298 Ga0157322_1036643
2299 Ga0157314_1052243
2300 Ga0157371_10011090
2301 Ga0157370_10001505
2302 Ga0157370_10422990
2303 Ga0157370_10617434
2304 Ga0157370_11060541
2305 Ga0157369_10001137
2306 Ga0157369_10007085
2307 Ga0157369_10043435
2308 Ga0157369_10120068
2309 Ga0157374_10013680
2310 Ga0157374_10033535
2311 Ga0157374_10036715
2312 Ga0157374_10354282
2313 Ga0157374_10579161
2314 Ga0157374_11292454
2315 Ga0157378_10019633
2316 Ga0157378_10028655
2317 Ga0157378_10061729
2318 Ga0157378_10407877
2319 Ga0157378_10913935
2320 Ga0157378_11228592
2321 Ga0157378_12265422
2322 Ga0163162_10001651
2323 Ga0163162_10012697
2324 Ga0163162_10017443
2325 Ga0163162_10024940
2326 Ga0163162_10051897
2327 Ga0163162_10109029
2328 Ga0163162_10126629
2329 Ga0163162_10407075
2330 Ga0163162_10436120
2331 Ga0163162_10518344
2332 Ga0163162_12065338
2333 Ga0157372_10035411
2334 Ga0157372_10049782
2335 Ga0157372_10580609
2336 Ga0157372_10616187
2337 Ga0157372_10963796
2338 Ga0157372_11564923
2339 Ga0157372_12868801
2340 Ga0157375_10001711
2341 Ga0157375_10085834
2342 Ga0157375_10087695
2343 Ga0157375_10260540
2344 Ga0157375_10371726
2345 Ga0157375_10388667
2346 Ga0157375_11086535
2347 Ga0163163_10000639
2348 Ga0163163_10009921
2349 Ga0163163_10049124
2350 Ga0163163_10237641
2351 Ga0163163_10359865
2352 Ga0157380_10264090
2353 Ga0157380_10942054
2354 Ga0157380_11517697
2355 Ga0157380_12895059
2356 Ga0157380_13215095
2357 Ga0182008_10120559
2358 Ga0182008_10220072
2359 Ga0182008_10391064
2360 Ga0157377_10001805
2361 Ga0157377_10003066
2362 Ga0157379_10016645
2363 Ga0157379_10048305
2364 Ga0157379_10066120
2365 Ga0157379_10066986
2366 Ga0157379_10219277
2367 Ga0157379_10227584
2368 Ga0157379_10463952
2369 Ga0157379_10567712
2370 Ga0157379_11580199
2371 Ga0157379_12067041
2372 Ga0157379_12101320
2373 Ga0157376_10012122
2374 Ga0157376_10013167
2375 Ga0157376_10024072
2376 Ga0157376_10430519
2377 Ga0157376_10907787
2378 Ga0157376_11242779
2379 Ga0157376_13151042
2380 Ga0182007_10004162
2381 Ga0182007_10075671
2382 Ga0163161_10010057
2383 Ga0163161_10030360
2384 Ga0163161_10088146
2385 Ga0163161_11738495
2386 Ga0213873_10279657
2387 Ga0213872_10000304
2388 Ga0213872_10008216
2389 Ga0213872_10071172
2390 Ga0213872_10251186
2391 Ga0213872_10406076
2392 Ga0213876_10026589
2393 Ga0213876_10066199
2394 Ga0213876_10175445
2395 Ga0213875_10061108
2396 Ga0213875_10118890
2397 Ga0213875_10143471
2398 Ga0213871_10028888
2399 Ga0213871_10132264
2400 Ga0228598_1012452
2401 Ga0209672_100058
2402 Ga0209672_101212
2403 Ga0209563_101608
2404 Ga0207427_101318
2405 Ga0209437_101040
2406 Ga0209258_100164
2407 Ga0209258_101181
2408 Ga0209258_109811
2409 Ga0207425_1037931
2410 Ga0209646_1001751
2411 Ga0209026_1000280
2412 Ga0209148_1000039
2413 Ga0209148_1001605
2414 Ga0209148_1002895
2415 Ga0209759_1001011
2416 Ga0209129_1024705
2417 Ga0209233_1001383
2418 Ga0209455_1000034
2419 Ga0209455_1000450
2420 Ga0209455_1000920
2421 Ga0209673_1007773
2422 Ga0207673_1016523
2423 Ga0209564_1006041
2424 Ga0209758_1000057
2425 Ga0209758_1000109
2426 Ga0209050_1002121
2427 Ga0209256_1003201
2428 Ga0209256_1018586
2429 Ga0207426_1002293
2430 Ga0207426_1048932
2431 Ga0209051_1000025
2432 Ga0209051_1005357
2433 Ga0209051_1068084
2434 Ga0209051_1074559
2435 Ga0209257_1000039
2436 Ga0209257_1000049
2437 Ga0209257_1001604
2438 Ga0209257_1012281
2439 Ga0207697_10000498
2440 Ga0207697_10076753
2441 Ga0207656_10062321
2442 Ga0207656_10239746
2443 Ga0207682_10001642
2444 Ga0207682_10001768
2445 Ga0207692_10865573
2446 Ga0207642_10001970
2447 Ga0207642_10002638
2448 Ga0207642_10604748
2449 Ga0207642_10623380
2450 Ga0207710_10008398
2451 Ga0207710_10041401
2452 Ga0207710_10077577
2453 Ga0207688_10000572
2454 Ga0207688_10020505
2455 Ga0207688_10064630
2456 Ga0207688_10326648
2457 Ga0207688_10476554
2458 Ga0207680_10000006
2459 Ga0207680_10048115
2460 Ga0207680_10050311
2461 Ga0207680_10051102
2462 Ga0207680_10207452
2463 Ga0207680_10498476
2464 Ga0207680_10543220
2465 Ga0207647_10000776
2466 Ga0207647_10000888
2467 Ga0207647_10002766
2468 Ga0207685_10055025
2469 Ga0207685_10097917
2470 Ga0207685_10425644
2471 Ga0207699_10070352
2472 Ga0207699_10493910
2473 Ga0207699_10855995
2474 Ga0207645_10010112
2475 Ga0207645_10151559
2476 Ga0207645_10209376
2477 Ga0207645_10231059
2478 Ga0207645_10692571
2479 Ga0207643_10000024
2480 Ga0207643_10007460
2481 Ga0207643_10083185
2482 Ga0207643_10299240
2483 Ga0207705_10045059
2484 Ga0207705_10061789
2485 Ga0207684_10030780
2486 Ga0207684_10043517
2487 Ga0207684_10217969
2488 Ga0207684_11291842
2489 Ga0207654_10000444
2490 Ga0207654_10008850
2491 Ga0207654_10036982
2492 Ga0207654_10169170
2493 Ga0207654_10720171
2494 Ga0207707_10000137
2495 Ga0207707_10002528
2496 Ga0207707_10029216
2497 Ga0207707_10091699
2498 Ga0207707_10096869
2499 Ga0207707_10212555
2500 Ga0207707_10592075
2501 Ga0207707_10672067
2502 Ga0207695_10000844
2503 Ga0207695_10002725
2504 Ga0207695_10029526
2505 Ga0207695_10041940
2506 Ga0207695_10042899
2507 Ga0207695_10175918
2508 Ga0207695_10210334
2509 Ga0207695_10300530
2510 Ga0207695_10396820
2511 Ga0207695_10859688
2512 Ga0207695_10934150
2513 Ga0207695_11338435
2514 Ga0207695_11344858
2515 Ga0207671_10003300
2516 Ga0207671_10003896
2517 Ga0207671_10011447
2518 Ga0207671_10213990
2519 Ga0207671_10570089
2520 Ga0207671_10593396
2521 Ga0207671_10709014
2522 Ga0207671_10736084
2523 Ga0207671_10992306
2524 Ga0207693_10019331
2525 Ga0207663_10004609
2526 Ga0207660_10006522
2527 Ga0207660_10181303
2528 Ga0207660_10189663
2529 Ga0207660_10250269
2530 Ga0207660_10484556
2531 Ga0207660_10513944
2532 Ga0207660_10580168
2533 Ga0207660_10792511
2534 Ga0207660_11317074
2535 Ga0207660_11510492
2536 Ga0207662_10000499
2537 Ga0207662_10001437
2538 Ga0207662_11275438
2539 Ga0207657_10000115
2540 Ga0207657_10048721
2541 Ga0207657_10670345
2542 Ga0207657_11042421
2543 Ga0207649_10028267
2544 Ga0207649_10035081
2545 Ga0207649_10080895
2546 Ga0207649_10164667
2547 Ga0207652_10005039
2548 Ga0207652_10092469
2549 Ga0207652_10176514
2550 Ga0207652_10180872
2551 Ga0207652_10256183
2552 Ga0207646_10198791
2553 Ga0207646_10324278
2554 Ga0207681_10003152
2555 Ga0207681_10006516
2556 Ga0207681_10259621
2557 Ga0207681_11301738
2558 Ga0207694_10000309
2559 Ga0207694_10005100
2560 Ga0207694_10010350
2561 Ga0207694_10010925
2562 Ga0207694_10116822
2563 Ga0207694_10193334
2564 Ga0207694_10864636
2565 Ga0207694_11300043
2566 Ga0207694_11500501
2567 Ga0207694_11804724
2568 Ga0207650_10007543
2569 Ga0207650_10034670
2570 Ga0207650_10035051
2571 Ga0207650_10116372
2572 Ga0207650_10292338
2573 Ga0207650_10382609
2574 Ga0207659_10003803
2575 Ga0207659_10022783
2576 Ga0207659_10694338
2577 Ga0207659_10736444
2578 Ga0207687_10037484
2579 Ga0207687_10106298
2580 Ga0207687_10636351
2581 Ga0207700_10280646
2582 Ga0207700_10649946
2583 Ga0207664_10311298
2584 Ga0207664_10402775
2585 Ga0207664_10581809
2586 Ga0207644_10009480
2587 Ga0207644_10068527
2588 Ga0207644_10085393
2589 Ga0207644_10164896
2590 Ga0207644_10221676
2591 Ga0207690_10006275
2592 Ga0207690_10132044
2593 Ga0207690_10436612
2594 Ga0207690_10690353
2595 Ga0207690_11063437
2596 Ga0207706_10003073
2597 Ga0207706_10044166
2598 Ga0207706_10050108
2599 Ga0207706_10173473
2600 Ga0207706_10563006
2601 Ga0207706_11474131
2602 Ga0207686_10000953
2603 Ga0207686_10011909
2604 Ga0207686_10030830
2605 Ga0207686_10360100
2606 Ga0207686_10428626
2607 Ga0207686_11573935
2608 Ga0207709_10077554
2609 Ga0207709_10262049
2610 Ga0207670_10058925
2611 Ga0207670_10118338
2612 Ga0207670_11076908
2613 Ga0207670_11283212
2614 Ga0207669_10020686
2615 Ga0207669_10412686
2616 Ga0207669_10836192
2617 Ga0207704_10001072
2618 Ga0207704_10011774
2619 Ga0207704_10012894
2620 Ga0207704_10051435
2621 Ga0207704_10167605
2622 Ga0207665_10022531
2623 Ga0207665_10165554
2624 Ga0207665_10818971
2625 Ga0207665_11492122
2626 Ga0207691_10014194
2627 Ga0207691_10021585
2628 Ga0207691_10021717
2629 Ga0207691_10029699
2630 Ga0207691_10289702
2631 Ga0207691_10416849
2632 Ga0207711_10001241
2633 Ga0207711_10063491
2634 Ga0207711_10102157
2635 Ga0207711_10113220
2636 Ga0207711_10189237
2637 Ga0207711_10202771
2638 Ga0207689_10000471
2639 Ga0207689_10015006
2640 Ga0207689_10335934
2641 Ga0207689_11828468
2642 Ga0207661_10058882
2643 Ga0207661_10078706
2644 Ga0207661_10239636
2645 Ga0207661_12166587
2646 Ga0207679_10002985
2647 Ga0207679_10049933
2648 Ga0207679_10137908
2649 Ga0207667_10007953
2650 Ga0207667_10058796
2651 Ga0207667_10069324
2652 Ga0207667_10119992
2653 Ga0207667_10305861
2654 Ga0207667_11878951
2655 Ga0207651_10023742
2656 Ga0207651_10027738
2657 Ga0207651_10680913
2658 Ga0207651_11967382
2659 Ga0207712_10000605
2660 Ga0207712_10014305
2661 Ga0207712_10035911
2662 Ga0207712_10142312
2663 Ga0207712_10301983
2664 Ga0207712_10740006
2665 Ga0207712_11427855
2666 Ga0207712_11505479
2667 Ga0207668_10008885
2668 Ga0207668_10026673
2669 Ga0207668_10063315
2670 Ga0207668_10252046
2671 Ga0207640_10006740
2672 Ga0207640_10307527
2673 Ga0207640_11241386
2674 Ga0207658_10000033
2675 Ga0207658_10000126
2676 Ga0207658_10007587
2677 Ga0207658_10014907
2678 Ga0207658_10024572
2679 Ga0207658_10118358
2680 Ga0207658_10126657
2681 Ga0207658_10478751
2682 Ga0207658_10934227
2683 Ga0207658_11007395
2684 Ga0207658_11073824
2685 Ga0207658_12010252
2686 Ga0207677_10068327
2687 Ga0207677_10069624
2688 Ga0207677_10243057
2689 Ga0207677_10859541
2690 Ga0207703_10007300
2691 Ga0207703_10024363
2692 Ga0207703_10954126
2693 Ga0207703_11692618
2694 Ga0207639_10007094
2695 Ga0207639_10080350
2696 Ga0207639_10115408
2697 Ga0207639_10119541
2698 Ga0207639_10152168
2699 Ga0207639_10186404
2700 Ga0207639_10227152
2701 Ga0207639_10479516
2702 Ga0207639_10493442
2703 Ga0207639_10651089
2704 Ga0207639_10703018
2705 Ga0207639_10829321
2706 Ga0207639_10903959
2707 Ga0207678_10000559
2708 Ga0207678_10052062
2709 Ga0207678_10126711
2710 Ga0207678_10140143
2711 Ga0207678_10420163
2712 Ga0207708_10017324
2713 Ga0207708_10033118
2714 Ga0207708_10053869
2715 Ga0207708_11804890
2716 Ga0207702_10054522
2717 Ga0207702_10085922
2718 Ga0207702_10132751
2719 Ga0207702_10815088
2720 Ga0207641_10029640
2721 Ga0207641_10038081
2722 Ga0207641_10048946
2723 Ga0207641_10123371
2724 Ga0207641_10687368
2725 Ga0207641_10889449
2726 Ga0207641_11075031
2727 Ga0207641_11081626
2728 Ga0207648_10000190
2729 Ga0207648_10010947
2730 Ga0207648_10014507
2731 Ga0207648_10034096
2732 Ga0207648_11188066
2733 Ga0207648_11366950
2734 Ga0207676_10002345
2735 Ga0207676_10011240
2736 Ga0207676_10017729
2737 Ga0207676_10642783
2738 Ga0207676_10790672
2739 Ga0207676_12329353
2740 Ga0207674_10001162
2741 Ga0207674_10074425
2742 Ga0207674_10081570
2743 Ga0207674_10101285
2744 Ga0207674_10149626
2745 Ga0207674_10153642
2746 Ga0207674_10238005
2747 Ga0207675_100000193
2748 Ga0207675_100001572
2749 Ga0207675_100002043
2750 Ga0207675_100006485
2751 Ga0207675_100054555
2752 Ga0207675_100098217
2753 Ga0207675_100100972
2754 Ga0207683_10003841
2755 Ga0207683_10004611
2756 Ga0207683_10017484
2757 Ga0207683_10025958
2758 Ga0207683_10045756
2759 Ga0207683_10177776
2760 Ga0207683_10314920
2761 Ga0207698_10007753
2762 Ga0207698_10206382
2763 Ga0207698_10276096
2764 Ga0207698_10453067
2765 Ga0207698_10651990
2766 Ga0207698_11564339
2767 Ga0209389_1000019
2768 Ga0209489_100033
2769 Ga0209700_100012
2770 Ga0209982_1031442
2771 Ga0209971_1176112
2772 Ga0209813_10003044
2773 Ga0207428_10036832
2774 Ga0207428_10080356
2775 Ga0207428_10173906
2776 Ga0207428_10269933
2777 Ga0268266_10000001
2778 Ga0268266_10000021
2779 Ga0268266_10003780
2780 Ga0268266_10004583
2781 Ga0268266_10022537
2782 Ga0268266_10022738
2783 Ga0268266_10126557
2784 Ga0268266_10346841
2785 Ga0268266_10444342
2786 Ga0268266_10994329
2787 Ga0268266_11745028
2788 Ga0268266_11925803
2789 Ga0268265_10001621
2790 Ga0268265_10019604
2791 Ga0268265_10283200
2792 Ga0268265_10350947
2793 Ga0268265_10450796
2794 Ga0268264_10010890
2795 Ga0268264_10023850
2796 Ga0268264_10123602
2797 Ga0268264_10261546
2798 Ga0268264_10319732
2799 Ga0268264_10860190
2800 Ga0268264_11698531
2801 Ga0265337_1021972
2802 Ga0265326_10031486
2803 Ga0265319_1009046
2804 Ga0265334_10011784
2805 Ga0265323_10058859
2806 Ga0265336_10005535
2807 Ga0307517_10046637
2808 Ga0307515_10156191
2809 Ga0265338_10005770
2810 Ga0265338_10031153
2811 Ga0265338_10144576
2812 Ga0265338_10385694
2813 Ga0265338_10452043
2814 Ga0265324_10013743
2815 Ga0265330_10013773
2816 Ga0265330_10059727
2817 Ga0265330_10073819
2818 Ga0265330_10114893
2819 Ga0265332_10021862
2820 Ga0265332_10072533
2821 Ga0265328_10036684
2822 Ga0265320_10136680
2823 Ga0265320_10145760
2824 Ga0265320_10174743
2825 Ga0265325_10033483
2826 Ga0265325_10093236
2827 Ga0265339_10012788
2828 Ga0265339_10170063
2829 Ga0265331_10000129
2830 Ga0265331_10018059
2831 Ga0265331_10034446
2832 Ga0265331_10042061
2833 Ga0265327_10000044
2834 Ga0265327_10278231
2835 Ga0265316_10006416
2836 Ga0265316_10023501
2837 Ga0265316_10059600
2838 Ga0265316_10588686
2839 Ga0307513_10014455
2840 Ga0307509_10000025
2841 Ga0307509_10626380
2842 Ga0307408_100000325
2843 Ga0307408_100486732
2844 Ga0307408_100861379
2845 Ga0265313_10002621
2846 Ga0265313_10076839
2847 Ga0265313_10122971
2848 Ga0265313_10130373
2849 Ga0265313_10219654
2850 Ga0265313_10380869
2851 Ga0307508_10787789
2852 Ga0265314_10013382
2853 Ga0265314_10017718
2854 Ga0265314_10023967
2855 Ga0265314_10151541
2856 Ga0265314_10355323
2857 Ga0265314_10501382
2858 Ga0265342_10088063
2859 Ga0307516_10650493
2860 Ga0307405_10380944
2861 Ga0307410_11073703
2862 Ga0307410_11733477
2863 Ga0307406_11004938
2864 Ga0307407_10000325
2865 Ga0307412_10009315
2866 Ga0307416_100011206
2867 Ga0307416_100470454
2868 Ga0307414_10951395
2869 Ga0307411_10091173
2870 Ga0307507_10421957
2871 Ga0307510_10143309
2872 Ga0373958_0039048
2873 Ga0373926_0081791
2874 Ga0373934_0006627
2875 Ga0373934_0174175
2876 Ga0373944_0018240
2877 Ga0373944_0128499
2878 Ga0373949_0124904
2879 Ga0373951_0157447
2880 Ga0373923_0009811
2881 Ga0373923_0022007
2882 Ga0373923_0246387
2883 Ga0373936_0004232
2884 Ga0373936_0412631
2885 Ga0373936_0418425
2886 Ga0373941_0396091
2887 Ga0373945_0125292
2888 Ga0373945_0572774
2889 Ga0373953_0010558
2890 Ga0373954_0000055
2891 Ga0373954_0000204
2892 Ga0373954_0114438
2893 Ga0373954_0232098
2894 Ga0373954_0456051
2895 Ga0373956_0002438
2896 Ga0373956_0067902
2897 Ga0373956_0437689
2898 Ga0373957_0035065
2899 Ga0373943_0056140
2900 Ga0373946_0001237
2901 Ga0373946_0332051
2902 Ga0373955_0157064
2903 Ga0373955_0194885
2904 Ga0373955_0525412
2905 Ga0373955_0633595
2906 Ga0373955_0861737
2907 Ga0373955_0928148
2908 Ga0373961_0422914
2909 Ga0373962_0169095
2910 Ga0373924_0056499
2911 Ga0373924_0187126
2912 Ga0373924_0227632
2913 Ga0373924_0308467
2914 Ga0373935_0071437
2915 Ga0373935_0281370
2916 Ga0373935_0413529
2917 Ga0373935_0518172
2918 Ga0373935_0548784
2919 Ga0373935_0899293
2920 Ga0373927_0025774
2921 Ga0373927_0134686
2922 Ga0373933_0000217
2923 Ga0373933_0151831
2924 Ga0373933_0182599
2925 Ga0373933_0349704
2926 Ga0373933_1162530
2927 Ga0373947_0015951
2928 Ga0373947_0080598
2929 Ga0373947_0659745
2930 Ga0373937_0003434
2931 Ga0373937_0009154
2932 Ga0373937_0095899
2933 Ga0373937_0288016
2934 Ga0373937_0618780
2935 Ga0373937_0680509
2936 Ga0373937_0787972
2937 Ga0373937_1481279
2938 Ga0373937_1789741
2939 Ga0373925_0007673
2940 Ga0373925_0036931
2941 Ga0373925_0075599
2942 Ga0373925_0296554
2943 Ga0373925_1092558
2944 Ga0395899_0015298
2945 Ga0395899_0090344
2946 Ga0395900_0029997
2947 Ga0395900_0048114
2948 Ga0395898_0005504
2949 Ga0395898_0006215
2950 Ga0395898_0649666
2951 Ga0395898_1891221
2952 Ga0395905_0088419
2953 Ga0395905_0502047
2954 Ga0395905_1290683
2955 Ga0395905_1316408
2956 Ga0436364_0188528
2957 Ga0436364_0261445
2958 Ga0436364_0424388
2959 Ga0436364_0621490
2960 Ga0436364_0638380
2961 Ga0436364_1323035
2962 Ga0395901_0043606
2963 Ga0237816_00864
2964 Ga0436365_0237040
2965 Ga0436365_0347707
2966 Ga0436365_0388218
2967 Ga0436365_0431361
2968 Ga0436365_0545909
2969 Ga0436365_0655612
2970 Ga0436365_1018828
2971 Ga0436365_1496770
2972 Ga0436360_0028296
2973 Ga0436360_0042439
2974 Ga0436360_0198558
2975 Ga0436360_0318083
2976 Ga0436360_0420362
2977 Ga0436360_0460365
2978 Ga0436360_0693855
2979 Ga0436360_0775635
2980 Ga0436361_0080522
2981 Ga0436361_0147964
2982 Ga0436361_0249946
2983 Ga0436361_0298431
2984 Ga0436361_0324977
2985 Ga0436361_0574324
2986 Ga0436361_0582807
2987 Ga0436361_0688104
2988 Ga0436361_0786290
2989 Ga0436361_0804603
2990 Ga0436361_0925853
2991 Ga0436361_1066058
2992 Ga0436361_1073388
2993 Ga0436363_0134352
2994 Ga0436363_0435549
2995 Ga0436363_0534225
2996 Ga0436363_0924720
2997 Ga0436363_0952708
2998 Ga0436363_1610909
2999 Ga0436362_0101641
3000 Ga0436362_0370145
3001 Ga0436362_0546087
3002 Ga0436362_0765821
3003 Ga0436362_1083820
3004 Ga0436362_1292496
3005 Ga0451789_1364666
3006 Ga0451793_0876891
3007 Ga0451835_1133788
3008 Ga0451839_0325131
3009 Ga0451839_0824064
3010 Ga0451839_1545218
3011 Ga0451845_0986483
3012 Ga0451843_1621180
3013 Ga0451853_2008343
3014 Ga0451853_3762953
3015 Ga0439431_0199129
3016 Ga0439448_0037453
3017 Ga0451577_1821555
3018 Ga0466969_0036637
3019 Ga0466969_0040570
3020 Ga0466969_0150888
3021 Ga0466969_0291872
3022 Ga0466972_0001620
3023 Ga0466972_0158522
3024 Ga0466972_0335588
3025 Ga0466965_0280543
3026 Ga0466966_0000632
3027 Ga0466966_0023836
3028 Ga0466966_0027141
3029 Ga0466961_0000897
3030 Ga0466961_0001874
3031 Ga0466961_0059644
3032 Ga0466963_0120269
3033 Ga0466963_0604047
3034 Ga0466963_1296588
3035 Ga0466964_0229245
3036 Ga0453684_0000497
3037 Ga0466970_0059567
3038 Ga0466970_0155617
3039 Ga0466957_1379520
3040 Ga0466960_0817079
3041 Ga0466959_0004435
3042 Ga0466959_0026954
3043 Ga0466959_0149736
3044 Ga0466959_1194577
3045 Ga0451576_0027185
3046 Ga0451576_0921795
3047 Ga0451576_2124564
3048 Ga0466958_0611734
3049 Ga0466967_0033635
3050 Ga0466967_0047012
3051 Ga0466967_0095059
3052 Ga0466967_0159258
3053 Ga0495592_0566701
3054 Ga0495603_0193078
3055 Ga0495629_0000008
3056 Ga0495629_0048582
3057 Ga0495629_0354921
3058 Ga0495638_0252630
3059 Ga0495651_0038941
3060 Ga0495653_0029611
3061 Ga0495580_0184281
3062 Ga0495582_0000674
3063 Ga0495605_0201876
3064 Ga0495639_0000567
3065 Ga0495639_0634673
3066 Ga0495662_0024433
3067 Ga0495662_0255794
3068 Ga0495662_0261575
3069 Ga0495664_0506451
3070 Ga0495584_0637620
3071 Ga0495594_0134913
3072 Ga0495608_0190739
3073 Ga0495616_0031832
3074 Ga0495628_0554772
3075 Ga0495628_0857846
3076 Ga0495628_1248318
3077 Ga0495630_0040767
3078 Ga0495630_0296071
3079 Ga0495630_0508701
3080 Ga0495643_0012071
3081 Ga0495666_0000101
3082 Ga0495642_0001940
3083 Ga0495642_0263292
3084 Ga0495665_0000193
3085 Ga0495640_0931474
3086 Ga0495586_0000818
3087 Ga0495586_0162681
3088 Ga0495586_0269614
3089 Ga0495586_0304802
3090 Ga0495598_0085544
3091 Ga0495621_0267471
3092 Ga0495597_0044566
3093 Ga0495667_0363901
3094 Ga0495656_0309272
3095 Ga0495668_0294683
3096 Ga0495668_0412140
3097 Ga0495634_0518424
3098 Ga0495625_0055245
3099 Ga0495625_0091652
3100 Ga0495635_0001435
3101 Ga0495588_0493207
3102 Ga0495657_0413528
3103 Ga0495599_0608623
3104 Ga0495647_0000581
3105 Ga0495658_0022836
3106 Ga0495658_0049229
3107 Ga0495669_0260034
3108 Ga0495613_0001075
3109 Ga0495670_0525135
3110 Ga0495671_0233660
3111 Ga0495649_0291043
3112 Ga0495600_0003122
3113 Ga0495581_0000277
3114 Ga0495581_0024157
3115 Ga0495636_0531685
3116 Ga0495676_0010268
3117 Ga0495680_0060910
3118 Ga0495680_0071991
3119 Ga0495680_0351283
3120 Ga0495683_0070881
3121 Ga0495687_009164
3122 Ga0495675_0854754
3123 Ga0495684_0001806
3124 Ga0495684_0806778
3125 Ga0495686_0399255
3126 Ga0495614_0589883
3127 Ga0495626_0034476
3128 Ga0496100_0334006
3129 Ga0496100_0658885
3130 Ga0496101_0488016
3131 Ga0496101_0658182
3132 Ga0496102_0008058
3133 Ga0496102_0021064
3134 Ga0496102_0063640
3135 Ga0496102_0064831
3136 Ga0496102_0235871
3137 Ga0496102_1211100
3138 Ga0496103_0002880
3139 Ga0496103_0225619
3140 Ga0496104_0000012
3141 Ga0496104_0194686
3142 Ga0496104_1801100
3143 Ga0496105_0000011
3144 Ga0496105_0101553
3145 Ga0496105_0933591
3146 Ga0496106_0078500
3147 Ga0496106_0266847
3148 Ga0496107_0524596
3149 Ga0496108_0071447
3150 Ga0496109_0135553
3151 Ga0496109_0195265
3152 Ga0496109_0587405
3153 Ga0496110_0088410
3154 Ga0496110_0264036
3155 Ga0496112_0013319
3156 Ga0496112_0073457
3157 Ga0496112_0158196
3158 Ga0496112_0227710
3159 Ga0496112_1794814
3160 Ga0496113_0210514
3161 Ga0496113_0261612
3162 Ga0496113_1029913
3163 Ga0496114_0196049
3164 Ga0496114_0577640
3165 Ga0496115_0059226
3166 Ga0496115_0371736
3167 Ga0496115_0484488
3168 Ga0496117_0028747
3169 Ga0496117_0045774
3170 Ga0496118_0000880
3171 Ga0496118_0004511
3172 Ga0496118_0081937
3173 Ga0496118_0085703
3174 Ga0496118_0509970
3175 Ga0496119_0081422
3176 Ga0496120_0257534
3177 Ga0496121_0076712
3178 Ga0496121_0153477
3179 Ga0496122_0000362
3180 Ga0496122_0148530
3181 Ga0496123_0007188
3182 Ga0496124_0358717
3183 Ga0496125_0185509
3184 Ga0496125_0481905
3185 Ga0496125_0611136
3186 Ga0496126_0000925
3187 Ga0496126_0002985
3188 Ga0496126_0009713
3189 Ga0496126_0298061
3190 Ga0496126_0526082
3191 Ga0495682_0174201
3192 Ga0495682_0290169
3193 Ga0501299_006306
3194 Ga0501300_011635
3195 Ga0501031_0405268
3196 Ga0501032_0044990
3197 Ga0501032_0625142
3198 Ga0501032_1080156
3199 Ga0501033_0074978
3200 Ga0501033_0142321
3201 Ga0501033_0662937
3202 Ga0501034_0015756
3203 Ga0501034_0041700
3204 Ga0501034_0090398
3205 Ga0501034_0234996
3206 Ga0501034_0335870
3207 Ga0501034_0336393
3208 Ga0501034_0874136
3209 Ga0501036_0228874
3210 Ga0501036_1065820
3211 Ga0501037_0056565
3212 Ga0501037_0209196
3213 Ga0501037_0345967
3214 Ga0501037_0466685
3215 Ga0501037_0802820
3216 Ga0501038_0008950
3217 Ga0501038_0109654
3218 Ga0501038_0483790
3219 Ga0501038_1123182
3220 Ga0501038_1243395
3221 Ga0501039_0038123
3222 Ga0501039_0332661
3223 Ga0501042_0341385
3224 Ga0501043_0052365
3225 Ga0501043_0541773
3226 Ga0501046_0056432
3227 Ga0501046_1105322
3228 Ga0501046_1254847
3229 Ga0501047_0009209
3230 Ga0501047_0020525
3231 Ga0501047_0026810
3232 Ga0501047_0044380
3233 Ga0501047_0122539
3234 Ga0501047_0167009
3235 Ga0501047_0239052
3236 Ga0501047_0406381
3237 Ga0501047_0679303
3238 Ga0501047_0980542
3239 Ga0501047_1414123
3240 Ga0501048_0705526
3241 Ga0501067_0014186
3242 Ga0501067_0136292
3243 Ga0501068_0130993
3244 Ga0501068_0386010
3245 Ga0501069_0042044
3246 Ga0501069_0229257
3247 Ga0501070_0008723
3248 Ga0501070_0010789
3249 Ga0501070_0028488
3250 Ga0501070_0029122
3251 Ga0501070_0118340
3252 Ga0501070_0134361
3253 Ga0501070_0152012
3254 Ga0501070_0247021
3255 Ga0501070_0380264
3256 Ga0501070_0663760
3257 Ga0501073_0005196
3258 Ga0501073_0022466
3259 Ga0501073_0067293
3260 Ga0501074_0010940
3261 Ga0501074_0073799
3262 Ga0501074_1287604
3263 Ga0501217_018049
3264 Ga0501248_012099
3265 Ga0501249_033212
3266 Ga0501249_172287
3267 Ga0501259_023039
3268 Ga0501261_016995
3269 Ga0501225_0063523
3270 Ga0501079_0109309
3271 Ga0501079_0614234
3272 Ga0501080_0002048
3273 Ga0501080_0005634
3274 Ga0501080_0015097
3275 Ga0501080_0043668
3276 Ga0501080_0076492
3277 Ga0501080_0164295
3278 Ga0501080_0226481
3279 Ga0501080_0375644
3280 Ga0501080_0494318
3281 Ga0501080_0501904
3282 Ga0501083_0019324
3283 Ga0501083_0019536
3284 Ga0501083_0026078
3285 Ga0501083_0058230
3286 Ga0501035_0022635
3287 Ga0501035_0056896
3288 Ga0501035_0057486
3289 Ga0501035_0204139
3290 Ga0501035_0325568
3291 Ga0501044_0005549
3292 Ga0501044_0046313
3293 Ga0501044_0067893
3294 Ga0501044_0068723
3295 Ga0501044_0074192
3296 Ga0501044_0096341
3297 Ga0501044_0168202
3298 Ga0501044_0287009
3299 Ga0501044_0381800
3300 Ga0501045_0838596
3301 nmdc:mga03683_614804_c1
3302 nmdc:mga03683_71801_c1
3303 nmdc:mga03n38_239585_c1
3304 nmdc:mga03n38_38953_c1
3305 nmdc:mga03n38_625374_c1
3306 nmdc:mga00v17_107719_c1
3307 nmdc:mga00v17_15060_c1
3308 nmdc:mga0yw44_50413_c1
3309 nmdc:mga0yw44_75348_c1
3310 nmdc:mga0k408_178216_c1
3311 nmdc:mga0k408_20469_c1
3312 nmdc:mga06z11_176425_c1
3313 nmdc:mga06z11_19529_c1
3314 nmdc:mga04h51_182307_c1
3315 nmdc:mga04h51_7586_c1
3316 nmdc:mga07m45_116710_c1
3317 nmdc:mga07m45_33430_c1
3318 nmdc:mga05p37_807525_c1
3319 nmdc:mga05p37_845169_c1
3320 nmdc:mga05p37_909833_c1
3321 nmdc:mga05p37_95097_c1
3322 nmdc:mga09592_312311_c1
3323 nmdc:mga09592_418227_c1
3324 nmdc:mga09592_625262_c1
3325 nmdc:mga06r32_6533_c1
3326 nmdc:mga06r32_691792_c1
3327 nmdc:mga08y16_1360663_c1
3328 nmdc:mga08y16_141932_c1
3329 nmdc:mga08y16_294013_c1
3330 nmdc:mga08y16_57347_c1
3331 nmdc:mga08y16_648382_c1
3332 nmdc:mga0n895_1176277_c1
3333 nmdc:mga0n895_182902_c1
3334 nmdc:mga0n895_27801_c1
3335 nmdc:mga0n895_5651_c1
3336 nmdc:mga0n895_56967_c1
3337 nmdc:mga0n895_574417_c1
3338 nmdc:mga0rr50_10123_c1
3339 nmdc:mga0rr50_160039_c1
3340 nmdc:mga0rr50_610163_c1
3341 nmdc:mga0rr50_980580_c1
3342 nmdc:mga08x19_138789_c1
3343 nmdc:mga08x19_689792_c1
3344 nmdc:mga0a205_17434_c1
3345 nmdc:mga0a205_316383_c1
3346 nmdc:mga0a205_49650_c1
3347 nmdc:mga0sz30_17585_c1
3348 nmdc:mga0sz30_33593_c1
3349 nmdc:mga0sz30_487879_c1
3350 Ga0495601_0473726
3351 Ga0495595_0120686
3352 Ga0495595_0472973
3353 Ga0495619_0002446
3354 Ga0500578_0062105
3355 Ga0500578_0142102
3356 Ga0500643_000013
3357 Ga0500643_025816
3358 Ga0500643_189535
3359 Ga0500651_0163854
3360 Ga0500650_0183400
3361 Ga0500554_098060
3362 Ga0500555_000025
3363 Ga0500556_0005981
3364 Ga0500572_027263
3365 Ga0500592_012176
3366 Ga0500595_086825
3367 Ga0500597_155413
3368 Ga0500614_165965
3369 Ga0500655_039097
3370 Ga0500658_0141013
3371 Ga0500559_0003975
3372 Ga0500564_017840
3373 Ga0500616_0040971
3374 Ga0500619_149021
3375 Ga0500637_0425958
3376 Ga0500645_011279
3377 Ga0501084_0048326
3378 Ga0587111_0194149
3379 Ga0501082_0000176
3380 Ga0501082_0005084
3381 Ga0501082_0112348
3382 Ga0466962_0409353
3383 2512351273
3384 2515684689
3385 2885280123
3386 2888386441
3387 2889036727
3388 2902684507
3389 2932791551
3390 2932835454
3391 2935613545
3392 2935643484
3393 2935710760
3394 2935824602
3395 2935833001
3396 2935844327
3397 2935851822
3398 2935996710
3399 3005724066
3400 8017065969
3401 8019578681
3402 8019596718
3403 8019604971
3404 8019613562

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9599 2 68
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9403 12 69
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9217 13 69
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9193 2 76
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9144 11 69
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.956 10 67 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9419 6 71 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 12 69 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 10 69 1.10.10.10
af_O94553_12_71_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9308 14 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A526V880-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9943 2 70 GO:0003700
AF-A0A2I0N826-F1-model_v4 HTH arsR-type domain-containing protein 0.982 2 68 GO:0003700
AF-A0A659UVB0-F1-model_v4 ArsR family transcriptional regulator 0.9733 1 73 GO:0003700
AF-A0A7M1Q0U5-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9661 2 69 GO:0003700
AF-A0A2W2ATM0-F1-model_v4 Transcriptional regulator 0.9651 2 70 GO:0003700
GO:0005737

Map