F495294

General Info

Members Datasets Scaffolds Average Seq Length
1676 714 1534 382

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0011332|Ga0466969_0011332_2736_4004
Length 422
Sequence MTNGEPAAALPPGSGPRSPEVSSAQAAVSAGASAPVNLLDFDLDGLAAFCERLGEKRFRATQLYRWIHQKGAADFAQMSDLAKSLRQKLAGTAEVRGLPVISEQASADGTIKWLFDVGGGNAVESVFIPEDDRGTLCVSSQAGCAVGCRFCSTGHQGFSRNLSTGEIVAQLWFAEHHLRQRLNLKEGERAVTNVVMMGMGEPLQNYGALVPALRTMLDDHGYGLSRRRVTVSTSGVVPMMDRLREDCPVALAVSLHAPNDALRDVLVPLNRKYPLRELMAACRRYLDAAPRDFITFEYCMLDGVNDTPELAQELIARVRGEHPDARGVGAVACKFNLIPFNPFPESGLKRSPRDRVLAFAKLLQDAGVVTTVRKTRGDDIDAACGQLAGEVQDRTRAAERMTRAPIRVHRTPPAGGTGRMRE

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
5 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
6 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
7 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
8 2547132374 Acidovorax radicis N35 Isolate Unclassified
9 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
10 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
11 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
12 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
13 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
14 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
15 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
16 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
17 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
18 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
19 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
20 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
21 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
22 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
23 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
24 2643221556 Massilia sp. Root1485 Isolate Unclassified
25 2643221570 Acidovorax sp. Root568 Isolate Unclassified
26 2643221585 Pelomonas sp. Root662 Isolate Unclassified
27 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
28 2643221596 Acidovorax sp. Root70 Isolate Unclassified
29 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
30 2643221611 Acidovorax sp. Root219 Isolate Unclassified
31 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
32 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
33 2643221638 Duganella sp. Root336D2 Isolate Unclassified
34 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
35 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
36 2643221645 Massilia sp. Root351 Isolate Unclassified
37 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
38 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
39 2643221652 Acidovorax sp. Root402 Isolate Unclassified
40 2643221656 Pelomonas sp. Root405 Isolate Unclassified
41 2643221658 Variovorax sp. Root411 Isolate Unclassified
42 2643221664 Massilia sp. Root418 Isolate Unclassified
43 2643221672 Variovorax sp. Root434 Isolate Unclassified
44 2643221683 Variovorax sp. Root473 Isolate Unclassified
45 2643221684 Massilia sp. Root133 Isolate Unclassified
46 2643221717 Acidovorax sp. Root267 Isolate Unclassified
47 2738541277 Variovorax sp. GV051 Isolate Unclassified
48 2738541280 Massilia sp. GV090 Isolate Unclassified
49 2738541297 Duganella sp. GV083 Isolate Unclassified
50 2738541300 Massilia sp. GV016 Isolate Unclassified
51 2738541307 Variovorax sp. GV008 Isolate Unclassified
52 2738541337 Pelomonas sp. BT06 Isolate Unclassified
53 2738541357 Duganella sp. GV053 Isolate Unclassified
54 2738543003 Duganella sp. GV066 Isolate Unclassified
55 2738543013 Variovorax sp. BT01 Isolate Unclassified
56 2738543018 Massilia sp. GV045 Isolate Unclassified
57 2738543019 Variovorax sp. GV040 Isolate Unclassified
58 2738543026 Duganella sp. GV089 Isolate Unclassified
59 2738543029 Duganella sp. GV039 Isolate Unclassified
60 2738543030 Massilia sp. GV097 Isolate Unclassified
61 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
62 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
63 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
64 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
65 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
66 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
67 2816332133 Acidovorax radicis 2721A Isolate Unclassified
68 2818991436 Collimonas arenae 515 Isolate Unclassified
69 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
70 2818991446 Variovorax sp. 1180 Isolate Unclassified
71 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
72 2821131069 Duganella sp. 1224 Isolate Unclassified
73 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
74 2831864461 Roseateles noduli HZ7 Isolate Nodule
75 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
76 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
77 2842677519 Variovorax sp. R-72495 Isolate Unclassified
78 2842711865 Duganella sp. R-73148 Isolate Unclassified
79 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
80 2842733646 Variovorax sp. R-72446 Isolate Unclassified
81 2842747753 Variovorax sp. R-72060 Isolate Unclassified
82 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
83 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
84 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
85 2857553236 Duganella sp. R-74557 Isolate Unclassified
86 2857558681 Duganella sp. R-74565 Isolate Unclassified
87 2857564685 Duganella sp. R-74599 Isolate Unclassified
88 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
89 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
90 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
91 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
92 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
93 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
94 2885198086 Variovorax sp. 679 Isolate Unclassified
95 2885211737 Variovorax sp. 553 Isolate Unclassified
96 2885266251 Ralstonia sp. SET104 Isolate Nodule
97 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
98 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
99 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
100 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
101 2899924645 Variovorax sp. 369 Isolate Unclassified
102 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
103 2904424332 Duganella sp. 1411 Isolate Rhizosphere
104 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
105 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
106 2904456579 Variovorax sp. 2002 Isolate Unclassified
107 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
108 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
109 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
110 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
111 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
112 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
113 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
114 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
115 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
116 2919476304 Duganella sp. 3397 Isolate Unclassified
117 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
118 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
119 2928037797 Variovorax sp. 1126 Isolate Unclassified
120 2928044640 Variovorax sp. 1128 Isolate Unclassified
121 2928051484 Variovorax sp. 1133 Isolate Unclassified
122 2928058823 Ralstonia sp. 1138 Isolate Unclassified
123 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
124 2928070936 Variovorax gossypii 1167 Isolate Unclassified
125 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
126 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
127 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
128 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
129 2929520902 Variovorax beijingensis 502 Isolate Unclassified
130 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
131 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
132 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
133 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
134 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
135 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
136 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
137 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
138 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
139 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
140 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
141 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
142 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
143 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
146 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
147 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
148 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
149 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
150 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
151 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
152 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
153 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
154 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
155 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
156 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
157 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
158 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
159 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
160 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
161 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
162 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
163 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
164 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
165 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
166 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
167 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
168 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
170 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
171 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
172 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
173 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
174 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
175 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
176 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
177 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
178 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
179 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
180 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
181 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
182 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
183 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
184 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
185 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
186 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
187 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
188 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
189 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
190 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
191 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
192 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
193 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
194 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
195 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
196 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
197 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
198 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
199 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
200 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
201 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
202 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
203 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
204 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
205 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
206 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
207 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
208 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
209 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
210 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
211 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
212 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
213 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
214 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
215 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
216 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
217 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
218 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
219 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
220 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
221 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
222 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
223 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
224 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
227 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
228 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
229 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
230 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
231 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
232 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
233 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
234 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
235 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
236 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
237 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
238 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
239 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
240 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
246 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
247 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
248 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
249 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
250 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
251 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
252 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
253 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
254 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
255 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
256 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
257 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
258 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
261 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
262 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
263 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
264 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
265 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
271 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
272 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
273 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
277 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
278 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
279 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
280 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
281 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
282 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
283 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
284 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
285 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
286 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
287 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
288 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
289 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
290 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
291 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
292 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
293 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
294 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
295 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
296 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
297 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
298 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
300 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
301 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
302 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
304 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
305 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
306 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
307 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
308 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
315 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
316 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
318 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
319 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
320 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
323 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
324 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
325 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
332 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
334 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
337 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
392 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
393 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
398 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
401 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
403 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
404 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
406 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
410 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
411 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
412 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
413 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
414 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
415 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
416 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
417 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
418 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
419 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
420 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
421 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
422 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
423 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
424 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
425 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
426 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
427 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
428 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
429 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
430 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
431 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
432 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
433 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
434 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
435 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
436 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
437 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
438 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
439 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
440 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
441 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
442 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
443 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
444 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
445 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
446 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
447 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
448 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
449 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
450 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
451 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
452 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
453 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
454 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
455 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
456 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
457 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
458 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
459 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
460 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
461 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
462 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
463 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
464 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
465 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
466 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
467 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
468 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
469 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
470 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
471 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
472 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
473 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
474 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
475 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
476 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
477 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
478 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
479 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
480 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
481 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
482 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
483 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
484 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
485 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
486 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
487 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
488 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
489 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
490 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
491 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
492 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
493 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
494 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
495 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
496 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
497 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
498 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
499 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
500 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
501 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
502 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
503 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
504 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
505 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
506 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
507 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
508 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
509 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
510 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
511 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
512 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
513 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
514 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
515 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
516 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
517 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
518 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
519 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
520 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
521 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
522 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
523 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
524 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
525 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
526 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
527 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
528 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
529 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
530 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
531 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
532 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
533 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
534 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
535 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
536 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
537 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
538 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
539 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
540 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
541 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
542 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
543 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
544 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
545 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
546 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
547 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
548 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
549 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
550 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
551 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
552 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
553 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
554 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
555 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
556 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
557 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
558 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
559 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
560 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
561 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
562 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
563 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
564 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
565 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
566 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
567 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
568 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
569 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
570 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
571 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
572 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
573 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
574 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
575 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
576 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
577 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
578 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
579 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
580 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
581 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
582 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
583 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
584 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
585 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
586 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
587 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
588 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
589 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
590 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
591 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
592 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
593 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
594 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
595 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
596 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
597 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
598 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
599 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
600 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
601 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
602 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
603 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
604 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
605 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
606 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
607 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
608 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
609 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
610 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
611 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
612 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
613 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
614 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
615 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
616 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
617 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
618 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
619 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
621 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
622 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
623 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
624 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
625 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
628 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
631 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
633 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
634 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
635 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
636 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
637 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
638 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
639 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
640 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
641 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
642 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
643 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
644 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
645 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
646 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
648 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
649 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
650 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
651 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
652 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
653 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
654 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
655 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
656 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
657 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
658 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
659 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
660 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
661 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
662 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
663 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
664 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
665 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
666 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
667 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
668 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
669 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
670 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
671 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
672 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
673 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
674 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
675 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
676 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
677 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
678 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
679 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
680 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
681 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
682 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
683 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
684 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
685 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
686 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
687 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
688 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
689 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
690 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
691 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
713 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
714 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.42
Metatranscriptomes 3.1
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.61
Nodule 1.07
Rhizoplane 1.91
Rhizosphere 62.95
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000199 3300001915 Bacteria 17754
2 JGI24740J21852_10000895 3300001979 Bacteria 13189
3 JGI24740J21852_10001585 3300001979 Bacteria 10460
4 JGI24740J21852_10004992 3300001979 Bacteria 5638
5 JGI25155J39150_1000002 3300002704 Bacteria 292156
6 JGI25155J39150_1001127 3300002704 Bacteria 2553
7 JGI25155J39150_1001208 3300002704 Bacteria 2211
8 JGI25156J39149_1000003 3300002705 Bacteria 305434
9 JGI25156J39149_1000581 3300002705 Bacteria 20815
10 JGI25156J39149_1001438 3300002705 Bacteria 10105
11 JGI25156J39149_1001520 3300002705 Bacteria 9631
12 JGI25156J39149_1003958 3300002705 Bacteria 4680
13 JGI25156J39149_1005219 3300002705 Bacteria 3801
14 JGI25162J39368_1000015 3300002737 Bacteria 316381
15 JGI25162J39368_1007808 3300002737 Bacteria 1613
16 JGI25154J39366_1000009 3300002738 Bacteria 305408
17 JGI25154J39366_1000235 3300002738 Bacteria 36388
18 JGI25154J39366_1001232 3300002738 Bacteria 9642
19 JGI25154J39366_1001235 3300002738 Bacteria 9631
20 JGI25154J39366_1001307 3300002738 Bacteria 9249
21 JGI25154J39366_1001714 3300002738 Bacteria 7165
22 JGI25158J39367_1005220 3300002739 Bacteria 1911
23 JGI25157J39369_1000002 3300002741 Bacteria 305434
24 JGI25157J39369_1000163 3300002741 Bacteria 55914
25 JGI25157J39369_1000420 3300002741 Bacteria 28199
26 JGI25157J39369_1001343 3300002741 Bacteria 9712
27 JGI25152J39213_1000550 3300002773 Bacteria 20595
28 JGI25150J39212_1001844 3300002774 Bacteria 5603
29 JGI25150J39212_1002871 3300002774 Bacteria 4172
30 JGI25159J45721_1000800 3300002987 Bacteria 13705
31 JGI25159J45721_1004502 3300002987 Bacteria 4610
32 JGI25159J45721_1005712 3300002987 Bacteria 3856
33 JGI25159J45721_1009490 3300002987 Bacteria 2561
34 JGI25159J45721_1012145 3300002987 Bacteria 2070
35 Ga0006759J45824_1003446 3300003163 Bacteria 2823
36 JGI25151J46595_10005733 3300003187 Bacteria 6368
37 JGI25151J46595_10012448 3300003187 Bacteria 3868
38 JGI25151J46595_10022540 3300003187 Bacteria 2612
39 JGI25165J46597_1000001 3300003214 Bacteria 1111887
40 JGI25153J46596_10003458 3300003215 Bacteria 8844
41 JGI25153J46596_10008695 3300003215 Bacteria 4820
42 JGI25153J46596_10012758 3300003215 Bacteria 3600
43 JGI25153J46596_10021011 3300003215 Bacteria 2446
44 Ga0006777J48905_1005637 3300003308 Bacteria 1428
45 rootH1_10015076 3300003316 Bacteria 5286
46 rootL2_10000199 3300003322 Bacteria 15762
47 rootH1_10066204 3300003323 Bacteria 3979
48 JGI26128J50194_1000545 3300003347 Bacteria 2109
49 JGI25160J50197_1000257 3300003354 Bacteria 39928
50 JGI25160J50197_1000586 3300003354 Bacteria 20466
51 JGI26145J50221_1002406 3300003371 Bacteria 1473
52 JGI25161J50226_1000018 3300003374 Bacteria 172599
53 Ga0007417J51691_1021004 3300003544 Bacteria 1857
54 Ga0007410J51695_1007930 3300003574 Bacteria 3108
55 Ga0007410J51695_1013383 3300003574 Bacteria 1886
56 Ga0007410J51695_1013461 3300003574 Bacteria 1995
57 Ga0007409J51694_1007957 3300003575 Bacteria 2503
58 Ga0007409J51694_1014187 3300003575 Bacteria 16595
59 Ga0007416J51690_1015392 3300003577 Bacteria 16759
60 Ga0007416J51690_1017208 3300003577 Bacteria 3640
61 Ga0006562J51391_1019774 3300003578 Bacteria 2031
62 Ga0032354_1010901 3300003693 Bacteria 3273
63 Ga0032354_1037686 3300003693 Bacteria 6660
64 Ga0055538_1000001 3300003751 Bacteria 1111887
65 Ga0055539_1000001 3300003752 Bacteria 1111887
66 Ga0055539_1000021 3300003752 Bacteria 305460
67 Ga0055539_1000172 3300003752 Bacteria 56105
68 Ga0055539_1003113 3300003752 Bacteria 2375
69 Ga0055533_1000003 3300003756 Bacteria 1111887
70 Ga0055533_1000006 3300003756 Bacteria 635559
71 Ga0055533_1000029 3300003756 Bacteria 305460
72 Ga0055532_1000002 3300003758 Bacteria 576000
73 Ga0055532_1000029 3300003758 Bacteria 232900
74 Ga0055532_1000050 3300003758 Bacteria 169240
75 Ga0055525_1000001 3300003759 Bacteria 1016948
76 Ga0055525_1000026 3300003759 Bacteria 345798
77 Ga0055525_1000033 3300003759 Bacteria 305460
78 Ga0055525_1000087 3300003759 Bacteria 149803
79 Ga0055525_1000662 3300003759 Bacteria 13279
80 Ga0055535_1000270 3300003761 Bacteria 54462
81 Ga0055535_1000881 3300003761 Bacteria 20958
82 Ga0055542_1000027 3300003762 Bacteria 254819
83 Ga0055542_1001549 3300003762 Bacteria 10899
84 Ga0055542_1007204 3300003762 Bacteria 2287
85 Ga0055529_1000062 3300003763 Bacteria 183782
86 Ga0055529_1000095 3300003763 Bacteria 134030
87 Ga0055529_1000175 3300003763 Bacteria 87829
88 Ga0055526_1000256 3300003771 Bacteria 44998
89 Ga0055526_1000412 3300003771 Bacteria 34667
90 Ga0055526_1003759 3300003771 Bacteria 9471
91 Ga0055526_1011228 3300003771 Bacteria 4063
92 Ga0055526_1019259 3300003771 Bacteria 2494
93 Ga0055526_1019561 3300003771 Bacteria 2462
94 Ga0055537_1000008 3300003773 Bacteria 142572
95 Ga0055537_1000143 3300003773 Bacteria 53762
96 Ga0055537_1000638 3300003773 Bacteria 18639
97 Ga0055537_1003491 3300003773 Bacteria 4820
98 Ga0055524_1000083 3300003775 Bacteria 119259
99 Ga0055524_1000161 3300003775 Bacteria 77623
100 Ga0055536_1011405 3300003781 Bacteria 3414
101 Ga0055534_1000226 3300003784 Bacteria 40702
102 Ga0055534_1000304 3300003784 Bacteria 32991
103 Ga0055534_1000742 3300003784 Bacteria 15697
104 Ga0055534_1002938 3300003784 Bacteria 5648
105 Ga0055534_1009543 3300003784 Bacteria 2101
106 Ga0055528_1002845 3300003790 Bacteria 9031
107 Ga0055528_1006547 3300003790 Bacteria 5277
108 Ga0055530_10000211 3300003791 Bacteria 52600
109 Ga0055530_10002691 3300003791 Bacteria 11067
110 Ga0055530_10009042 3300003791 Bacteria 3884
111 Ga0055530_10009823 3300003791 Bacteria 3617
112 Ga0055540_1000012 3300003792 Bacteria 262667
113 Ga0055540_1000062 3300003792 Bacteria 128474
114 Ga0055540_1002597 3300003792 Bacteria 9408
115 Ga0055540_1006225 3300003792 Bacteria 4790
116 Ga0055540_1007759 3300003792 Bacteria 3984
117 Ga0055540_1018181 3300003792 Bacteria 1933
118 Ga0055531_10000481 3300003794 Bacteria 36889
119 Ga0055531_10000823 3300003794 Bacteria 25703
120 Ga0055531_10002967 3300003794 Bacteria 11029
121 Ga0055531_10008585 3300003794 Bacteria 5360
122 Ga0055531_10009809 3300003794 Bacteria 4853
123 Ga0055531_10018344 3300003794 Bacteria 2894
124 Ga0055541_1000001 3300003841 Bacteria 1111887
125 Ga0055541_1000029 3300003841 Bacteria 199874
126 Ga0055541_1000045 3300003841 Bacteria 148620
127 Ga0055541_1000370 3300003841 Bacteria 13833
128 Ga0055541_1000532 3300003841 Bacteria 10465
129 Ga0055543_1000993 3300004625 Bacteria 12770
130 Ga0055543_1001717 3300004625 Bacteria 8242
131 Ga0055543_1002038 3300004625 Bacteria 7097
132 Ga0055543_1002844 3300004625 Bacteria 5456
133 Ga0055543_1002954 3300004625 Bacteria 5295
134 Ga0055543_1005341 3300004625 Bacteria 3296
135 Ga0065165_1000006 3300005262 Bacteria 352298
136 Ga0065165_1000268 3300005262 Bacteria 89520
137 Ga0065165_1001911 3300005262 Bacteria 19919
138 Ga0065165_1005783 3300005262 Bacteria 6760
139 Ga0065165_1016274 3300005262 Bacteria 2792
140 Ga0065165_1042039 3300005262 Bacteria 1352
141 Ga0065704_10087556 3300005289 Bacteria 3016
142 Ga0065715_10137524 3300005293 Bacteria 1905
143 Ga0070658_10099644 3300005327 Bacteria 2401
144 Ga0070658_10166852 3300005327 Bacteria 1848
145 Ga0070676_10058257 3300005328 Bacteria 2288
146 Ga0070676_10060174 3300005328 Bacteria 2255
147 Ga0070676_10065730 3300005328 Bacteria 2166
148 Ga0070690_100030769 3300005330 Bacteria 3340
149 Ga0070690_100152895 3300005330 Bacteria 1576
150 Ga0070670_100000334 3300005331 Bacteria 39594
151 Ga0070677_10002685 3300005333 Bacteria 5693
152 Ga0068869_100052976 3300005334 Bacteria 2948
153 Ga0070666_10003592 3300005335 Bacteria 9401
154 Ga0070666_10041629 3300005335 Bacteria 3071
155 Ga0070682_100031262 3300005337 Bacteria 3219
156 Ga0070682_100060240 3300005337 Bacteria 2400
157 Ga0068868_100024313 3300005338 Bacteria 4596
158 Ga0070660_100000913 3300005339 Bacteria 19741
159 Ga0070660_100001317 3300005339 Bacteria 16907
160 Ga0070660_100066074 3300005339 Bacteria 2815
161 Ga0070660_100200320 3300005339 Bacteria 1619
162 Ga0070689_100042926 3300005340 Bacteria 3473
163 Ga0070689_100075030 3300005340 Bacteria 2647
164 Ga0070661_100000139 3300005344 Bacteria 60942
165 Ga0070661_100000264 3300005344 Bacteria 43037
166 Ga0070661_100071413 3300005344 Bacteria 2555
167 Ga0070668_100018633 3300005347 Bacteria 5212
168 Ga0070668_100153912 3300005347 Bacteria 1862
169 Ga0070669_100142037 3300005353 Bacteria 1852
170 Ga0070669_100165624 3300005353 Bacteria 1720
171 Ga0070675_100010734 3300005354 Bacteria 7165
172 Ga0070675_100045668 3300005354 Bacteria 3585
173 Ga0070675_100175651 3300005354 Bacteria 1849
174 Ga0070671_100018737 3300005355 Bacteria 5625
175 Ga0070671_100020806 3300005355 Bacteria 5352
176 Ga0070674_100000872 3300005356 Bacteria 15687
177 Ga0070673_100010297 3300005364 Bacteria 6325
178 Ga0070673_100115192 3300005364 Bacteria 2235
179 Ga0070659_100000798 3300005366 Bacteria 22978
180 Ga0070659_100001509 3300005366 Bacteria 16775
181 Ga0070659_100001576 3300005366 Bacteria 16422
182 Ga0070659_100064529 3300005366 Bacteria 2898
183 Ga0070659_100121600 3300005366 Bacteria 2115
184 Ga0070659_100203703 3300005366 Bacteria 1629
185 Ga0070667_100002781 3300005367 Bacteria 15106
186 Ga0070667_100027186 3300005367 Bacteria 4761
187 Ga0070667_100281596 3300005367 Bacteria 1493
188 Ga0070705_100018240 3300005440 Bacteria 3675
189 Ga0070705_100217251 3300005440 Bacteria 1321
190 Ga0070694_100028514 3300005444 Bacteria 3634
191 Ga0070708_100036779 3300005445 Bacteria 4271
192 Ga0070663_100000006 3300005455 Bacteria 208068
193 Ga0070663_100002931 3300005455 Bacteria 9711
194 Ga0070678_100006899 3300005456 Bacteria 6697
195 Ga0070678_100022537 3300005456 Bacteria 4176
196 Ga0070678_100041594 3300005456 Bacteria 3259
197 Ga0070678_100060133 3300005456 Bacteria 2795
198 Ga0070678_100194060 3300005456 Bacteria 1671
199 Ga0070681_10006689 3300005458 Bacteria 11214
200 Ga0070681_10087560 3300005458 Bacteria 3067
201 Ga0070681_10169046 3300005458 Bacteria 2108
202 Ga0068867_100000820 3300005459 Bacteria 20957
203 Ga0068867_100016759 3300005459 Bacteria 5206
204 Ga0068867_100018872 3300005459 Bacteria 4907
205 Ga0068867_100121514 3300005459 Bacteria 2019
206 Ga0068867_100171657 3300005459 Bacteria 1718
207 Ga0070685_10178037 3300005466 Bacteria 1367
208 Ga0070706_100028142 3300005467 Bacteria 5173
209 Ga0070699_100017265 3300005518 Bacteria 6197
210 Ga0070697_100001109 3300005536 Bacteria 20376
211 Ga0068853_100208762 3300005539 Bacteria 1779
212 Ga0068853_100219304 3300005539 Bacteria 1737
213 Ga0068853_100222964 3300005539 Bacteria 1723
214 Ga0068853_100281253 3300005539 Bacteria 1534
215 Ga0070672_100003864 3300005543 Bacteria 9751
216 Ga0070672_100018119 3300005543 Bacteria 5084
217 Ga0070672_100123127 3300005543 Bacteria 2125
218 Ga0070695_100027965 3300005545 Bacteria 3496
219 Ga0070665_100011739 3300005548 Bacteria 8846
220 Ga0070665_100234756 3300005548 Bacteria 1834
221 Ga0070665_100293540 3300005548 Bacteria 1628
222 Ga0070704_100014555 3300005549 Bacteria 4916
223 Ga0070704_100083446 3300005549 Bacteria 2359
224 Ga0068855_100002429 3300005563 Bacteria 23003
225 Ga0068855_100011038 3300005563 Bacteria 10902
226 Ga0068855_100040371 3300005563 Bacteria 5540
227 Ga0068855_100048665 3300005563 Bacteria 5003
228 Ga0068855_100107915 3300005563 Bacteria 3198
229 Ga0068855_100353836 3300005563 Bacteria 1617
230 Ga0070664_100000002 3300005564 Bacteria 458815
231 Ga0070664_100003853 3300005564 Bacteria 12108
232 Ga0070664_100024728 3300005564 Bacteria 4972
233 Ga0070664_100047466 3300005564 Bacteria 3627
234 Ga0070664_100160054 3300005564 Bacteria 1992
235 Ga0068857_100027590 3300005577 Bacteria 5009
236 Ga0068857_100031841 3300005577 Bacteria 4660
237 Ga0068857_100239237 3300005577 Bacteria 1662
238 Ga0068854_100000043 3300005578 Bacteria 92551
239 Ga0068854_100016517 3300005578 Bacteria 4922
240 Ga0068854_100075386 3300005578 Bacteria 2477
241 Ga0068856_100000028 3300005614 Bacteria 131498
242 Ga0068856_100001213 3300005614 Bacteria 27067
243 Ga0068856_100017575 3300005614 Bacteria 6930
244 Ga0068852_100018364 3300005616 Bacteria 5509
245 Ga0068852_100040581 3300005616 Bacteria 3928
246 Ga0068852_100143431 3300005616 Bacteria 2213
247 Ga0068852_100231748 3300005616 Bacteria 1760
248 Ga0068859_100030477 3300005617 Bacteria 5413
249 Ga0068859_100101618 3300005617 Bacteria 2932
250 Ga0068859_100159038 3300005617 Bacteria 2338
251 Ga0068864_100002247 3300005618 Bacteria 15969
252 Ga0068864_100039151 3300005618 Bacteria 4051
253 Ga0068861_100000343 3300005719 Bacteria 26498
254 Ga0068851_10074103 3300005834 Bacteria 1766
255 Ga0068863_100007447 3300005841 Bacteria 10712
256 Ga0068863_100016536 3300005841 Bacteria 7078
257 Ga0068863_100079825 3300005841 Bacteria 3099
258 Ga0068858_100012025 3300005842 Bacteria 8159
259 Ga0068860_100039691 3300005843 Bacteria 4503
260 Ga0068862_100012976 3300005844 Bacteria 6891
261 Ga0068862_100051442 3300005844 Bacteria 3524
262 Ga0075365_10020443 3300006038 Bacteria 4105
263 Ga0075365_10122504 3300006038 Bacteria 1795
264 Ga0075368_10076344 3300006042 Bacteria 1360
265 Ga0075363_100049093 3300006048 Bacteria 2246
266 Ga0075364_10000361 3300006051 Bacteria 22465
267 Ga0075364_10004201 3300006051 Bacteria 8263
268 Ga0075364_10015913 3300006051 Bacteria 4670
269 Ga0075364_10021230 3300006051 Bacteria 4092
270 Ga0075364_10096949 3300006051 Bacteria 1961
271 Ga0075432_10000339 3300006058 Bacteria 13374
272 Ga0075432_10023832 3300006058 Bacteria 2097
273 Ga0070716_100198077 3300006173 Bacteria 1332
274 Ga0075362_10001523 3300006177 Bacteria 7462
275 Ga0075362_10003993 3300006177 Bacteria 5247
276 Ga0075362_10007315 3300006177 Bacteria 4174
277 Ga0075362_10028935 3300006177 Bacteria 2384
278 Ga0075362_10033589 3300006177 Bacteria 2232
279 Ga0075367_10133290 3300006178 Bacteria 1536
280 Ga0075369_10101287 3300006186 Bacteria 1292
281 Ga0075366_10005443 3300006195 Bacteria 6899
282 Ga0075366_10006029 3300006195 Bacteria 6604
283 Ga0075366_10008662 3300006195 Bacteria 5664
284 Ga0075366_10014706 3300006195 Bacteria 4473
285 Ga0075366_10027449 3300006195 Bacteria 3339
286 Ga0075366_10030434 3300006195 Bacteria 3173
287 Ga0075366_10044456 3300006195 Bacteria 2632
288 Ga0075366_10046494 3300006195 Bacteria 2572
289 Ga0075366_10047353 3300006195 Bacteria 2549
290 Ga0075366_10049372 3300006195 Bacteria 2497
291 Ga0075366_10081180 3300006195 Bacteria 1937
292 Ga0075370_10000245 3300006353 Bacteria 19479
293 Ga0075370_10001414 3300006353 Bacteria 10381
294 Ga0075370_10001496 3300006353 Bacteria 10196
295 Ga0075370_10005283 3300006353 Bacteria 6397
296 Ga0075370_10007796 3300006353 Bacteria 5472
297 Ga0075370_10009707 3300006353 Bacteria 5011
298 Ga0075370_10011251 3300006353 Bacteria 4697
299 Ga0075370_10015818 3300006353 Bacteria 4047
300 Ga0075370_10096614 3300006353 Bacteria 1707
301 Ga0068871_100028781 3300006358 Bacteria 4360
302 Ga0075428_100000521 3300006844 Bacteria 39098
303 Ga0075430_100023615 3300006846 Bacteria 5236
304 Ga0075430_100035659 3300006846 Bacteria 4219
305 Ga0075433_10171730 3300006852 Bacteria 1929
306 Ga0075434_100053000 3300006871 Bacteria 4031
307 Ga0075429_100003825 3300006880 Bacteria 12856
308 Ga0075429_100020657 3300006880 Bacteria 5716
309 Ga0075436_100000353 3300006914 Bacteria 29366
310 Ga0075436_100006510 3300006914 Bacteria 8001
311 Ga0075436_100072438 3300006914 Bacteria 2384
312 Ga0097620_100030476 3300006931 Bacteria 5413
313 Ga0097620_100101621 3300006931 Bacteria 2932
314 Ga0097620_100159052 3300006931 Bacteria 2338
315 Ga0099823_1003573 3300006944 Bacteria 14802
316 Ga0079104_1000186 3300006946 Bacteria 87104
317 Ga0079104_1007818 3300006946 Bacteria 3817
318 Ga0079104_1010697 3300006946 Bacteria 2998
319 Ga0099826_10000001 3300006948 Bacteria 1155201
320 Ga0099826_10001313 3300006948 Bacteria 14690
321 Ga0075435_100247971 3300007076 Bacteria 1516
322 Ga0099794_10029708 3300007265 Bacteria 2547
323 Ga0099794_10043832 3300007265 Bacteria 2137
324 Ga0105244_10003650 3300009036 Bacteria 10894
325 Ga0105244_10030420 3300009036 Bacteria 2873
326 Ga0105244_10072715 3300009036 Bacteria 1713
327 Ga0105240_10005173 3300009093 Bacteria 19510
328 Ga0105240_10017343 3300009093 Bacteria 9709
329 Ga0105240_10018846 3300009093 Bacteria 9241
330 Ga0105240_10020541 3300009093 Bacteria 8804
331 Ga0105240_10058094 3300009093 Bacteria 4830
332 Ga0105240_10088709 3300009093 Bacteria 3784
333 Ga0111539_10001172 3300009094 Bacteria 34757
334 Ga0105245_10206027 3300009098 Bacteria 1891
335 Ga0105243_10003626 3300009148 Bacteria 12435
336 Ga0105243_10012597 3300009148 Bacteria 6390
337 Ga0105243_10015371 3300009148 Bacteria 5789
338 Ga0105243_10046565 3300009148 Bacteria 3412
339 Ga0105242_10000970 3300009176 Bacteria 22398
340 Ga0105242_10016812 3300009176 Bacteria 5694
341 Ga0105248_10051958 3300009177 Bacteria 4599
342 Ga0105248_10054325 3300009177 Bacteria 4491
343 Ga0105237_10000367 3300009545 Bacteria 63983
344 Ga0105237_10007511 3300009545 Bacteria 11921
345 Ga0105237_10009389 3300009545 Bacteria 10477
346 Ga0105237_10046093 3300009545 Bacteria 4386
347 Ga0105237_10091314 3300009545 Bacteria 3035
348 Ga0105238_10000367 3300009551 Bacteria 48504
349 Ga0105239_10000150 3300010375 Bacteria 100349
350 Ga0105239_10048392 3300010375 Bacteria 4663
351 Ga0105239_10126300 3300010375 Bacteria 2843
352 Ga0105239_10258439 3300010375 Bacteria 1957
353 Ga0105246_10048906 3300011119 Bacteria 2893
354 Ga0157319_1000009 3300012497 Bacteria 227971
355 Ga0157373_10002505 3300013100 Bacteria 13979
356 Ga0157373_10024986 3300013100 Bacteria 4325
357 Ga0157373_10036278 3300013100 Bacteria 3540
358 Ga0157373_10069956 3300013100 Bacteria 2480
359 Ga0157371_10000001 3300013102 Bacteria 1162285
360 Ga0157371_10000204 3300013102 Bacteria 86751
361 Ga0157371_10143951 3300013102 Bacteria 1698
362 Ga0157370_10000013 3300013104 Bacteria 198861
363 Ga0157370_10002966 3300013104 Bacteria 20185
364 Ga0157370_10198943 3300013104 Bacteria 1859
365 Ga0157369_10000724 3300013105 Bacteria 42487
366 Ga0157369_10002173 3300013105 Bacteria 23616
367 Ga0157369_10006099 3300013105 Bacteria 13993
368 Ga0157369_10126414 3300013105 Bacteria 2710
369 Ga0157374_10000067 3300013296 Bacteria 107173
370 Ga0157374_10000895 3300013296 Bacteria 25972
371 Ga0157374_10140959 3300013296 Bacteria 2340
372 Ga0157378_10012903 3300013297 Bacteria 7315
373 Ga0157378_10041290 3300013297 Bacteria 4092
374 Ga0157378_10052732 3300013297 Bacteria 3619
375 Ga0157378_10059389 3300013297 Bacteria 3412
376 Ga0157378_10074224 3300013297 Bacteria 3060
377 Ga0163162_10003353 3300013306 Bacteria 15319
378 Ga0163162_10129458 3300013306 Bacteria 2632
379 Ga0163162_10166104 3300013306 Bacteria 2331
380 Ga0163162_10176279 3300013306 Bacteria 2263
381 Ga0157372_10006459 3300013307 Bacteria 12484
382 Ga0157372_10129142 3300013307 Bacteria 2907
383 Ga0157375_10027704 3300013308 Bacteria 5301
384 Ga0157375_10030363 3300013308 Bacteria 5095
385 Ga0163163_10006006 3300014325 Bacteria 10564
386 Ga0157380_10047265 3300014326 Bacteria 3384
387 Ga0157380_10083953 3300014326 Bacteria 2610
388 Ga0182008_10000317 3300014497 Bacteria 37953
389 Ga0182008_10001784 3300014497 Bacteria 14086
390 Ga0182008_10008860 3300014497 Bacteria 5460
391 Ga0182008_10016908 3300014497 Bacteria 3784
392 Ga0182008_10019892 3300014497 Bacteria 3460
393 Ga0182008_10039546 3300014497 Bacteria 2356
394 Ga0182008_10069701 3300014497 Bacteria 1730
395 Ga0157377_10000014 3300014745 Bacteria 213961
396 Ga0157379_10023602 3300014968 Bacteria 5459
397 Ga0157379_10030186 3300014968 Bacteria 4823
398 Ga0157379_10061146 3300014968 Bacteria 3368
399 Ga0157376_10098455 3300014969 Bacteria 2550
400 Ga0157376_10327014 3300014969 Bacteria 1459
401 Ga0182006_1000002 3300015261 Bacteria 887990
402 Ga0182006_1000117 3300015261 Bacteria 85963
403 Ga0182006_1001371 3300015261 Bacteria 14825
404 Ga0182006_1002284 3300015261 Bacteria 10590
405 Ga0182006_1010814 3300015261 Bacteria 4042
406 Ga0182006_1014280 3300015261 Bacteria 3426
407 Ga0182006_1060176 3300015261 Bacteria 1436
408 Ga0182007_10000045 3300015262 Bacteria 106028
409 Ga0182007_10001215 3300015262 Bacteria 13977
410 Ga0182007_10002141 3300015262 Bacteria 10070
411 Ga0182007_10003073 3300015262 Bacteria 8035
412 Ga0182007_10006337 3300015262 Bacteria 5087
413 Ga0182007_10035831 3300015262 Bacteria 1672
414 Ga0182005_1000002 3300015265 Bacteria 908499
415 Ga0182005_1000007 3300015265 Bacteria 490994
416 Ga0182005_1000431 3300015265 Bacteria 22295
417 Ga0182005_1008518 3300015265 Bacteria 3021
418 Ga0183362_10001 3300015683 Bacteria 2046624
419 Ga0163161_10000943 3300017792 Bacteria 22389
420 Ga0163161_10033889 3300017792 Bacteria 3650
421 Ga0163161_10054079 3300017792 Bacteria 2913
422 Ga0197907_11358827 3300020069 Bacteria 6030
423 Ga0206349_1321444 3300020075 Bacteria 3053
424 Ga0206355_1123131 3300020076 Bacteria 9882
425 Ga0206351_10143154 3300020077 Bacteria 33246
426 Ga0206350_10286196 3300020080 Bacteria 3863
427 Ga0154015_1106824 3300020610 Bacteria 15314
428 Ga0213872_10000003 3300021361 Bacteria 366948
429 Ga0213872_10000004 3300021361 Bacteria 306230
430 Ga0213872_10000016 3300021361 Bacteria 180524
431 Ga0213872_10000026 3300021361 Bacteria 149852
432 Ga0213872_10000199 3300021361 Bacteria 53150
433 Ga0213872_10000552 3300021361 Bacteria 29038
434 Ga0213872_10004172 3300021361 Bacteria 7773
435 Ga0213872_10050593 3300021361 Bacteria 1886
436 Ga0213876_10047440 3300021384 Bacteria 2271
437 Ga0224712_10003779 3300022467 Bacteria 3989
438 Ga0209435_100001 3300025206 Bacteria 1424171
439 Ga0209435_100029 3300025206 Bacteria 176358
440 Ga0209435_100531 3300025206 Bacteria 7324
441 Ga0209436_100074 3300025208 Bacteria 50572
442 Ga0209436_107406 3300025208 Bacteria 2296
443 Ga0209436_107658 3300025208 Bacteria 2230
444 Ga0209784_100003 3300025224 Bacteria 1379451
445 Ga0209784_100004 3300025224 Bacteria 1378156
446 Ga0209784_100033 3300025224 Bacteria 305649
447 Ga0209784_100522 3300025224 Bacteria 14485
448 Ga0209566_100002 3300025225 Bacteria 2614868
449 Ga0209566_100004 3300025225 Bacteria 1531866
450 Ga0209566_100037 3300025225 Bacteria 305649
451 Ga0209566_100731 3300025225 Bacteria 18455
452 Ga0209566_101006 3300025225 Bacteria 12012
453 Ga0209674_100003 3300025226 Bacteria 2196646
454 Ga0209674_100006 3300025226 Bacteria 1531866
455 Ga0209674_100008 3300025226 Bacteria 1076909
456 Ga0209674_100055 3300025226 Bacteria 305649
457 Ga0209674_100217 3300025226 Bacteria 55436
458 Ga0209672_100052 3300025228 Bacteria 231179
459 Ga0209672_100190 3300025228 Bacteria 49762
460 Ga0209672_101060 3300025228 Bacteria 11768
461 Ga0209672_101759 3300025228 Bacteria 6810
462 Ga0209672_105771 3300025228 Bacteria 2087
463 Ga0209147_100002 3300025229 Bacteria 2158988
464 Ga0209147_100004 3300025229 Bacteria 1371850
465 Ga0209563_100004 3300025230 Bacteria 1814108
466 Ga0209563_100005 3300025230 Bacteria 1774893
467 Ga0209563_100007 3300025230 Bacteria 1579402
468 Ga0209563_100009 3300025230 Bacteria 1378156
469 Ga0209563_100010 3300025230 Bacteria 1337457
470 Ga0209563_100056 3300025230 Bacteria 305649
471 Ga0209563_102380 3300025230 Bacteria 4283
472 Ga0207427_101216 3300025231 Bacteria 9960
473 Ga0209437_100004 3300025233 Bacteria 1378156
474 Ga0209437_100053 3300025233 Bacteria 375580
475 Ga0209258_100002 3300025242 Bacteria 2158988
476 Ga0209258_100048 3300025242 Bacteria 365881
477 Ga0209258_100060 3300025242 Bacteria 319881
478 Ga0209258_100463 3300025242 Bacteria 44224
479 Ga0209258_100482 3300025242 Bacteria 41643
480 Ga0207425_1000001 3300025245 Bacteria 2525432
481 Ga0207425_1000089 3300025245 Bacteria 91267
482 Ga0207425_1000275 3300025245 Bacteria 37897
483 Ga0207425_1000596 3300025245 Bacteria 20990
484 Ga0207425_1003163 3300025245 Bacteria 5387
485 Ga0207425_1003233 3300025245 Bacteria 5316
486 Ga0209646_1000001 3300025246 Bacteria 3092932
487 Ga0209646_1000010 3300025246 Bacteria 573803
488 Ga0209646_1000022 3300025246 Bacteria 446621
489 Ga0209646_1000073 3300025246 Bacteria 224301
490 Ga0209646_1000109 3300025246 Bacteria 158348
491 Ga0209646_1000242 3300025246 Bacteria 56037
492 Ga0209026_1000003 3300025250 Bacteria 1060571
493 Ga0209026_1000124 3300025250 Bacteria 125673
494 Ga0209026_1000311 3300025250 Bacteria 52155
495 Ga0209026_1004281 3300025250 Bacteria 4309
496 Ga0209677_100005 3300025253 Bacteria 1378156
497 Ga0209677_100009 3300025253 Bacteria 749530
498 Ga0209677_100034 3300025253 Bacteria 305649
499 Ga0209677_100274 3300025253 Bacteria 34497
500 Ga0209677_100396 3300025253 Bacteria 26411
501 Ga0209677_103662 3300025253 Bacteria 4837
502 Ga0209677_111576 3300025253 Bacteria 1366
503 Ga0209148_1000021 3300025254 Bacteria 714645
504 Ga0209148_1000040 3300025254 Bacteria 473531
505 Ga0209148_1000241 3300025254 Bacteria 87665
506 Ga0209148_1002487 3300025254 Bacteria 6262
507 Ga0209759_1000001 3300025256 Bacteria 2799452
508 Ga0209759_1000108 3300025256 Bacteria 146393
509 Ga0209759_1000373 3300025256 Bacteria 56051
510 Ga0209759_1000412 3300025256 Bacteria 52804
511 Ga0209759_1001241 3300025256 Bacteria 15482
512 Ga0209759_1001285 3300025256 Bacteria 14981
513 Ga0209759_1001792 3300025256 Bacteria 10886
514 Ga0209759_1006296 3300025256 Bacteria 4011
515 Ga0209759_1008599 3300025256 Bacteria 3165
516 Ga0209129_1000001 3300025258 Bacteria 1452436
517 Ga0209129_1000007 3300025258 Bacteria 771325
518 Ga0209129_1000148 3300025258 Bacteria 114559
519 Ga0209129_1004204 3300025258 Bacteria 5774
520 Ga0209129_1007373 3300025258 Bacteria 3293
521 Ga0209129_1013173 3300025258 Bacteria 1839
522 Ga0209233_1000005 3300025261 Bacteria 1531866
523 Ga0209565_1000004 3300025263 Bacteria 983150
524 Ga0209565_1000009 3300025263 Bacteria 751701
525 Ga0209565_1000153 3300025263 Bacteria 92909
526 Ga0209565_1000292 3300025263 Bacteria 48172
527 Ga0209565_1000311 3300025263 Bacteria 45199
528 Ga0209565_1000606 3300025263 Bacteria 23901
529 Ga0209565_1001694 3300025263 Bacteria 9100
530 Ga0209565_1003078 3300025263 Bacteria 5601
531 Ga0209455_1000021 3300025272 Bacteria 699993
532 Ga0209455_1000093 3300025272 Bacteria 220487
533 Ga0209455_1000121 3300025272 Bacteria 173350
534 Ga0209455_1002583 3300025272 Bacteria 6904
535 Ga0209673_1000019 3300025273 Bacteria 449094
536 Ga0209673_1000074 3300025273 Bacteria 233552
537 Ga0209673_1000423 3300025273 Bacteria 73682
538 Ga0209673_1000794 3300025273 Bacteria 42072
539 Ga0209673_1003547 3300025273 Bacteria 9103
540 Ga0209673_1003649 3300025273 Bacteria 8901
541 Ga0209673_1011832 3300025273 Bacteria 3565
542 Ga0209673_1012266 3300025273 Bacteria 3464
543 Ga0209130_1000050 3300025284 Bacteria 222092
544 Ga0209130_1000143 3300025284 Bacteria 114072
545 Ga0209130_1000172 3300025284 Bacteria 93199
546 Ga0209130_1000329 3300025284 Bacteria 54511
547 Ga0209130_1000460 3300025284 Bacteria 42703
548 Ga0209130_1002121 3300025284 Bacteria 10547
549 Ga0209130_1004145 3300025284 Bacteria 5683
550 Ga0209130_1005713 3300025284 Bacteria 4226
551 Ga0209675_1000028 3300025291 Bacteria 281253
552 Ga0209675_1000044 3300025291 Bacteria 230392
553 Ga0209675_1000150 3300025291 Bacteria 92909
554 Ga0209675_1001581 3300025291 Bacteria 12882
555 Ga0209675_1001931 3300025291 Bacteria 11201
556 Ga0209675_1002255 3300025291 Bacteria 10065
557 Ga0209675_1007563 3300025291 Bacteria 4141
558 Ga0209676_1000004 3300025292 Bacteria 1138360
559 Ga0209676_1000029 3300025292 Bacteria 520536
560 Ga0209676_1002870 3300025292 Bacteria 11363
561 Ga0209676_1003529 3300025292 Bacteria 9532
562 Ga0209676_1003660 3300025292 Bacteria 9218
563 Ga0209676_1016751 3300025292 Bacteria 2629
564 Ga0209025_1000111 3300025294 Bacteria 218982
565 Ga0209025_1000624 3300025294 Bacteria 62814
566 Ga0209025_1002339 3300025294 Bacteria 20439
567 Ga0209025_1003371 3300025294 Bacteria 15273
568 Ga0209025_1005225 3300025294 Bacteria 10707
569 Ga0209025_1007741 3300025294 Bacteria 7919
570 Ga0209025_1008867 3300025294 Bacteria 7124
571 Ga0209564_1000003 3300025295 Bacteria 1585848
572 Ga0209564_1000009 3300025295 Bacteria 950196
573 Ga0209564_1000033 3300025295 Bacteria 446200
574 Ga0209564_1000058 3300025295 Bacteria 332955
575 Ga0209564_1000153 3300025295 Bacteria 166910
576 Ga0209564_1000178 3300025295 Bacteria 151982
577 Ga0209564_1000251 3300025295 Bacteria 114511
578 Ga0209564_1000470 3300025295 Bacteria 67507
579 Ga0209564_1001234 3300025295 Bacteria 28811
580 Ga0209564_1001907 3300025295 Bacteria 18654
581 Ga0209564_1005307 3300025295 Bacteria 7424
582 Ga0209564_1008824 3300025295 Bacteria 4906
583 Ga0209758_1000025 3300025297 Bacteria 586687
584 Ga0209758_1000116 3300025297 Bacteria 198356
585 Ga0209758_1000387 3300025297 Bacteria 76099
586 Ga0209758_1000439 3300025297 Bacteria 69980
587 Ga0209758_1002669 3300025297 Bacteria 17617
588 Ga0209758_1005897 3300025297 Bacteria 9126
589 Ga0209758_1012598 3300025297 Bacteria 4714
590 Ga0209050_1000002 3300025298 Bacteria 1792849
591 Ga0209050_1000003 3300025298 Bacteria 1609245
592 Ga0209050_1000412 3300025298 Bacteria 79647
593 Ga0209050_1001086 3300025298 Bacteria 33175
594 Ga0209050_1001892 3300025298 Bacteria 20072
595 Ga0209050_1005811 3300025298 Bacteria 7577
596 Ga0209050_1010897 3300025298 Bacteria 4402
597 Ga0209050_1020874 3300025298 Bacteria 2415
598 Ga0209050_1021056 3300025298 Bacteria 2396
599 Ga0209256_1000001 3300025299 Bacteria 2166974
600 Ga0209256_1000005 3300025299 Bacteria 1315082
601 Ga0209256_1000024 3300025299 Bacteria 448909
602 Ga0209256_1000093 3300025299 Bacteria 209318
603 Ga0209256_1000488 3300025299 Bacteria 58638
604 Ga0209256_1003497 3300025299 Bacteria 10949
605 Ga0207426_1000001 3300025302 Bacteria 1341301
606 Ga0207426_1000028 3300025302 Bacteria 483955
607 Ga0207426_1000071 3300025302 Bacteria 329539
608 Ga0207426_1000692 3300025302 Bacteria 40473
609 Ga0207426_1001345 3300025302 Bacteria 20882
610 Ga0209051_1000002 3300025303 Bacteria 1631846
611 Ga0209051_1000003 3300025303 Bacteria 1609245
612 Ga0209051_1000063 3300025303 Bacteria 249739
613 Ga0209051_1000268 3300025303 Bacteria 87155
614 Ga0209051_1001146 3300025303 Bacteria 24136
615 Ga0209051_1001878 3300025303 Bacteria 16472
616 Ga0209051_1003892 3300025303 Bacteria 9535
617 Ga0209051_1005038 3300025303 Bacteria 7868
618 Ga0209051_1014865 3300025303 Bacteria 3612
619 Ga0209051_1053509 3300025303 Bacteria 1325
620 Ga0209257_1000002 3300025304 Bacteria 1767052
621 Ga0209257_1000018 3300025304 Bacteria 836016
622 Ga0209257_1000275 3300025304 Bacteria 116952
623 Ga0209257_1000354 3300025304 Bacteria 93718
624 Ga0209257_1001690 3300025304 Bacteria 24813
625 Ga0209257_1002262 3300025304 Bacteria 19671
626 Ga0209257_1002313 3300025304 Bacteria 19265
627 Ga0209257_1002999 3300025304 Bacteria 15302
628 Ga0209257_1004776 3300025304 Bacteria 10103
629 Ga0209257_1019761 3300025304 Bacteria 2521
630 Ga0207697_10004138 3300025315 Bacteria 6997
631 Ga0207697_10011975 3300025315 Bacteria 3651
632 Ga0207655_1003482 3300025728 Bacteria 11692
633 Ga0207655_1006002 3300025728 Bacteria 8126
634 Ga0207682_10003292 3300025893 Bacteria 7058
635 Ga0207682_10013079 3300025893 Bacteria 3234
636 Ga0207680_10003056 3300025903 Bacteria 7852
637 Ga0207647_10000176 3300025904 Bacteria 51278
638 Ga0207645_10006398 3300025907 Bacteria 8458
639 Ga0207645_10009991 3300025907 Bacteria 6536
640 Ga0207643_10035733 3300025908 Bacteria 2787
641 Ga0207643_10067634 3300025908 Bacteria 2051
642 Ga0207643_10102057 3300025908 Bacteria 1683
643 Ga0207705_10000768 3300025909 Bacteria 26407
644 Ga0207705_10112464 3300025909 Bacteria 2013
645 Ga0207684_10104042 3300025910 Bacteria 2427
646 Ga0207654_10005978 3300025911 Bacteria 6125
647 Ga0207707_10012991 3300025912 Bacteria 7250
648 Ga0207707_10070211 3300025912 Bacteria 3053
649 Ga0207695_10001614 3300025913 Bacteria 36581
650 Ga0207695_10002501 3300025913 Bacteria 27018
651 Ga0207695_10004682 3300025913 Bacteria 18530
652 Ga0207695_10005439 3300025913 Bacteria 16890
653 Ga0207695_10036213 3300025913 Bacteria 5338
654 Ga0207695_10292937 3300025913 Bacteria 1519
655 Ga0207671_10000808 3300025914 Bacteria 39539
656 Ga0207671_10026808 3300025914 Bacteria 4312
657 Ga0207671_10050814 3300025914 Bacteria 3070
658 Ga0207657_10000843 3300025919 Bacteria 32461
659 Ga0207657_10002514 3300025919 Bacteria 19834
660 Ga0207657_10044157 3300025919 Bacteria 3920
661 Ga0207649_10000193 3300025920 Bacteria 50158
662 Ga0207649_10002218 3300025920 Bacteria 10971
663 Ga0207649_10116089 3300025920 Bacteria 1797
664 Ga0207646_10351787 3300025922 Bacteria 1331
665 Ga0207681_10004604 3300025923 Bacteria 8484
666 Ga0207681_10102846 3300025923 Bacteria 2063
667 Ga0207650_10000913 3300025925 Bacteria 22271
668 Ga0207659_10000189 3300025926 Bacteria 36771
669 Ga0207659_10004058 3300025926 Bacteria 8834
670 Ga0207659_10004477 3300025926 Bacteria 8457
671 Ga0207687_10070281 3300025927 Bacteria 2499
672 Ga0207687_10274339 3300025927 Bacteria 1349
673 Ga0207644_10029379 3300025931 Bacteria 3813
674 Ga0207690_10000541 3300025932 Bacteria 24643
675 Ga0207690_10005319 3300025932 Bacteria 7587
676 Ga0207690_10007244 3300025932 Bacteria 6586
677 Ga0207690_10007619 3300025932 Bacteria 6422
678 Ga0207690_10153749 3300025932 Bacteria 1708
679 Ga0207706_10034951 3300025933 Bacteria 4471
680 Ga0207706_10049695 3300025933 Bacteria 3706
681 Ga0207706_10061811 3300025933 Bacteria 3299
682 Ga0207706_10128454 3300025933 Bacteria 2229
683 Ga0207686_10000809 3300025934 Bacteria 19195
684 Ga0207709_10001797 3300025935 Bacteria 14374
685 Ga0207709_10004048 3300025935 Bacteria 8536
686 Ga0207709_10009473 3300025935 Bacteria 5357
687 Ga0207670_10186134 3300025936 Bacteria 1567
688 Ga0207669_10001570 3300025937 Bacteria 9743
689 Ga0207669_10005261 3300025937 Bacteria 5784
690 Ga0207669_10094735 3300025937 Bacteria 1955
691 Ga0207669_10105297 3300025937 Bacteria 1876
692 Ga0207704_10072874 3300025938 Bacteria 2185
693 Ga0207704_10087309 3300025938 Bacteria 2037
694 Ga0207665_10007367 3300025939 Bacteria 7272
695 Ga0207665_10104367 3300025939 Bacteria 1983
696 Ga0207691_10002491 3300025940 Bacteria 18008
697 Ga0207691_10013616 3300025940 Bacteria 7773
698 Ga0207691_10017166 3300025940 Bacteria 6866
699 Ga0207691_10019152 3300025940 Bacteria 6480
700 Ga0207711_10030824 3300025941 Bacteria 4524
701 Ga0207711_10041281 3300025941 Bacteria 3929
702 Ga0207689_10069464 3300025942 Bacteria 2894
703 Ga0207689_10099680 3300025942 Bacteria 2387
704 Ga0207679_10000001 3300025945 Bacteria 777444
705 Ga0207679_10001861 3300025945 Bacteria 13115
706 Ga0207679_10027731 3300025945 Bacteria 3921
707 Ga0207667_10000034 3300025949 Bacteria 304569
708 Ga0207667_10037117 3300025949 Bacteria 5212
709 Ga0207667_10054097 3300025949 Bacteria 4222
710 Ga0207667_10072367 3300025949 Bacteria 3583
711 Ga0207667_10126610 3300025949 Bacteria 2631
712 Ga0207667_10284418 3300025949 Bacteria 1690
713 Ga0207651_10007212 3300025960 Bacteria 5909
714 Ga0207651_10037955 3300025960 Bacteria 3160
715 Ga0207651_10124579 3300025960 Bacteria 1961
716 Ga0207712_10035285 3300025961 Bacteria 3396
717 Ga0207668_10139821 3300025972 Bacteria 1860
718 Ga0207640_10000098 3300025981 Bacteria 66901
719 Ga0207640_10018472 3300025981 Bacteria 4099
720 Ga0207658_10006468 3300025986 Bacteria 7996
721 Ga0207658_10009255 3300025986 Bacteria 6682
722 Ga0207658_10053784 3300025986 Bacteria 2976
723 Ga0207658_10109335 3300025986 Bacteria 2182
724 Ga0207677_10006156 3300026023 Bacteria 6555
725 Ga0207703_10003102 3300026035 Bacteria 14039
726 Ga0207703_10080568 3300026035 Bacteria 2711
727 Ga0207639_10205305 3300026041 Bacteria 1693
728 Ga0207639_10219849 3300026041 Bacteria 1640
729 Ga0207678_10000001 3300026067 Bacteria 433184
730 Ga0207678_10002552 3300026067 Bacteria 16593
731 Ga0207678_10093712 3300026067 Bacteria 2566
732 Ga0207708_10077055 3300026075 Bacteria 2558
733 Ga0207702_10000009 3300026078 Bacteria 305906
734 Ga0207702_10002147 3300026078 Bacteria 18951
735 Ga0207702_10094379 3300026078 Bacteria 2626
736 Ga0207641_10003303 3300026088 Bacteria 14346
737 Ga0207641_10036723 3300026088 Bacteria 4090
738 Ga0207641_10043576 3300026088 Bacteria 3769
739 Ga0207648_10000142 3300026089 Bacteria 71593
740 Ga0207648_10001133 3300026089 Bacteria 29959
741 Ga0207648_10021300 3300026089 Bacteria 5827
742 Ga0207648_10175045 3300026089 Bacteria 1898
743 Ga0207648_10196930 3300026089 Bacteria 1786
744 Ga0207648_10318847 3300026089 Bacteria 1397
745 Ga0207676_10005300 3300026095 Bacteria 9134
746 Ga0207676_10138952 3300026095 Bacteria 2077
747 Ga0207674_10001006 3300026116 Bacteria 36821
748 Ga0207674_10014389 3300026116 Bacteria 8740
749 Ga0207674_10046656 3300026116 Bacteria 4447
750 Ga0207675_100001246 3300026118 Bacteria 25396
751 Ga0207675_100025406 3300026118 Bacteria 5514
752 Ga0207683_10022902 3300026121 Bacteria 5368
753 Ga0207683_10026909 3300026121 Bacteria 4969
754 Ga0207683_10061741 3300026121 Bacteria 3299
755 Ga0207683_10089363 3300026121 Bacteria 2741
756 Ga0207683_10113081 3300026121 Bacteria 2432
757 Ga0207683_10142555 3300026121 Bacteria 2160
758 Ga0207698_10018066 3300026142 Bacteria 4798
759 Ga0207698_10074454 3300026142 Bacteria 2709
760 Ga0207698_10118215 3300026142 Bacteria 2238
761 Ga0207698_10331714 3300026142 Bacteria 1429
762 Ga0209281_1000442 3300027111 Bacteria 59796
763 Ga0209281_1004821 3300027111 Bacteria 3923
764 Ga0209389_1009757 3300027296 Bacteria 8616
765 Ga0209371_1007787 3300027312 Bacteria 3664
766 Ga0209967_1002266 3300027364 Bacteria 2498
767 Ga0209967_1006672 3300027364 Bacteria 1571
768 Ga0209981_1002288 3300027378 Bacteria 2435
769 Ga0209995_1004707 3300027471 Bacteria 2191
770 Ga0209968_1001087 3300027526 Bacteria 4149
771 Ga0209999_1004774 3300027543 Bacteria 2436
772 Ga0209999_1013436 3300027543 Bacteria 1485
773 Ga0209999_1017424 3300027543 Bacteria 1310
774 Ga0209970_1000814 3300027614 Bacteria 5470
775 Ga0209282_1000001 3300027666 Bacteria 2450367
776 Ga0209588_1046569 3300027671 Bacteria 1403
777 Ga0209971_1019615 3300027682 Bacteria 1606
778 Ga0209966_1000004 3300027695 Bacteria 108133
779 Ga0209974_10002324 3300027876 Bacteria 6898
780 Ga0209974_10002377 3300027876 Bacteria 6822
781 Ga0207428_10000830 3300027907 Bacteria 34841
782 Ga0268266_10145296 3300028379 Bacteria 2132
783 Ga0268265_10040740 3300028380 Bacteria 3432
784 Ga0268264_10039604 3300028381 Bacteria 3894
785 Ga0268264_10096750 3300028381 Bacteria 2558
786 Ga0265336_10000062 3300028666 Bacteria 101023
787 Ga0307515_10000022 3300028794 Bacteria 404064
788 Ga0307515_10000191 3300028794 Bacteria 149201
789 Ga0307515_10000208 3300028794 Bacteria 144484
790 Ga0307515_10003517 3300028794 Bacteria 32929
791 Ga0307515_10003519 3300028794 Bacteria 32915
792 Ga0307515_10011870 3300028794 Bacteria 16472
793 Ga0307515_10015490 3300028794 Bacteria 14042
794 Ga0307515_10036876 3300028794 Bacteria 7888
795 Ga0307515_10174390 3300028794 Bacteria 2127
796 Ga0265338_10077449 3300028800 Bacteria 2811
797 Ga0265324_10000928 3300029957 Bacteria 18416
798 Ga0268256_1008034 3300030500 Bacteria 3664
799 Ga0316180_1024577 3300030736 Bacteria 6853
800 Ga0316181_1063388 3300030744 Bacteria 3265
801 Ga0316182_1344291 3300030745 Bacteria 6659
802 Ga0265330_10000032 3300031235 Bacteria 130592
803 Ga0265332_10000001 3300031238 Bacteria 863783
804 Ga0265332_10000003 3300031238 Bacteria 482849
805 Ga0265328_10000004 3300031239 Bacteria 242356
806 Ga0265328_10001293 3300031239 Bacteria 11554
807 Ga0265325_10006034 3300031241 Bacteria 7411
808 Ga0265340_10011616 3300031247 Bacteria 4675
809 Ga0265331_10008102 3300031250 Bacteria 6001
810 Ga0265331_10060231 3300031250 Bacteria 1794
811 Ga0265327_10000043 3300031251 Bacteria 285108
812 Ga0265327_10000184 3300031251 Bacteria 133023
813 Ga0265327_10000261 3300031251 Bacteria 104627
814 Ga0265327_10000956 3300031251 Bacteria 41506
815 Ga0265327_10014403 3300031251 Bacteria 5175
816 Ga0265327_10025250 3300031251 Bacteria 3469
817 Ga0265327_10050447 3300031251 Bacteria 2177
818 Ga0265316_10231625 3300031344 Bacteria 1360
819 Ga0307513_10000014 3300031456 Bacteria 303157
820 Ga0307513_10000019 3300031456 Bacteria 231194
821 Ga0307513_10011299 3300031456 Bacteria 11111
822 Ga0307513_10089327 3300031456 Bacteria 3146
823 Ga0307509_10022521 3300031507 Bacteria 7100
824 Ga0307509_10041706 3300031507 Bacteria 4978
825 Ga0307408_100000008 3300031548 Bacteria 456355
826 Ga0307408_100000513 3300031548 Bacteria 33428
827 Ga0307408_100001235 3300031548 Bacteria 19185
828 Ga0307408_100010270 3300031548 Bacteria 6176
829 Ga0307408_100014180 3300031548 Bacteria 5295
830 Ga0307408_100028168 3300031548 Bacteria 3879
831 Ga0307408_100034061 3300031548 Bacteria 3564
832 Ga0307508_10000017 3300031616 Bacteria 203567
833 Ga0307514_10001461 3300031649 Bacteria 28839
834 Ga0307514_10004466 3300031649 Bacteria 12861
835 Ga0307514_10007672 3300031649 Bacteria 9285
836 Ga0316575_10030592 3300031665 Bacteria 2105
837 Ga0265314_10000022 3300031711 Bacteria 297299
838 Ga0265314_10002666 3300031711 Bacteria 17890
839 Ga0265314_10055744 3300031711 Bacteria 2725
840 Ga0307516_10000254 3300031730 Bacteria 68771
841 Ga0307516_10003632 3300031730 Bacteria 19615
842 Ga0307516_10004780 3300031730 Bacteria 16517
843 Ga0307516_10006776 3300031730 Bacteria 13382
844 Ga0307405_10048866 3300031731 Bacteria 2611
845 Ga0307413_10037276 3300031824 Bacteria 2807
846 Ga0307406_10000279 3300031901 Bacteria 30071
847 Ga0307406_10001221 3300031901 Bacteria 14382
848 Ga0307406_10010426 3300031901 Bacteria 5240
849 Ga0307406_10042774 3300031901 Bacteria 2830
850 Ga0307407_10002597 3300031903 Bacteria 7130
851 Ga0307412_10021521 3300031911 Bacteria 3940
852 Ga0307412_10073409 3300031911 Bacteria 2340
853 Ga0307409_100125018 3300031995 Bacteria 2186
854 Ga0307416_100013315 3300032002 Bacteria 5586
855 Ga0307416_100092334 3300032002 Bacteria 2603
856 Ga0307416_100107319 3300032002 Bacteria 2450
857 Ga0307416_100140365 3300032002 Bacteria 2195
858 Ga0307416_100162230 3300032002 Bacteria 2068
859 Ga0307414_10022373 3300032004 Bacteria 3985
860 Ga0307414_10078226 3300032004 Bacteria 2410
861 Ga0307411_10002201 3300032005 Bacteria 8479
862 Ga0307411_10015220 3300032005 Bacteria 4313
863 Ga0307411_10170435 3300032005 Bacteria 1641
864 Ga0307415_100028737 3300032126 Bacteria 3543
865 Ga0307507_10064219 3300033179 Bacteria 3390
866 Ga0373951_0015022 3300035091 Bacteria 1742
867 Ga0373932_0018160 3300035112 Bacteria 1815
868 Ga0373939_0000164 3300035114 Bacteria 18449
869 Ga0373960_0015650 3300035121 Bacteria 1939
870 Ga0373960_0018371 3300035121 Bacteria 1822
871 Ga0373942_0047325 3300035207 Bacteria 1195
872 Ga0316574_0002074 3300035398 Bacteria 9911
873 Ga0373931_0000346 3300035691 Bacteria 19115
874 Ga0373931_0183747 3300035691 Bacteria 1240
875 Ga0373937_0147098 3300036401 Bacteria 2206
876 Ga0373937_0209036 3300036401 Bacteria 1836
877 Ga0373937_0267318 3300036401 Bacteria 1613
878 Ga0395899_0000028 3300037312 Bacteria 334378
879 Ga0395899_0001707 3300037312 Bacteria 18303
880 Ga0395899_0001829 3300037312 Bacteria 17620
881 Ga0395899_0002713 3300037312 Bacteria 14270
882 Ga0395899_0002722 3300037312 Bacteria 14257
883 Ga0395899_0089861 3300037312 Bacteria 2227
884 Ga0395899_0129776 3300037312 Bacteria 1800
885 Ga0395899_0190098 3300037312 Bacteria 1437
886 Ga0395900_0000188 3300037418 Bacteria 99195
887 Ga0395900_0000404 3300037418 Bacteria 62102
888 Ga0395900_0006862 3300037418 Bacteria 11810
889 Ga0395900_0007487 3300037418 Bacteria 11275
890 Ga0395900_0019397 3300037418 Bacteria 6935
891 Ga0395900_0030419 3300037418 Bacteria 5545
892 Ga0395900_0047771 3300037418 Bacteria 4409
893 Ga0395900_0061956 3300037418 Bacteria 3845
894 Ga0395900_0071579 3300037418 Bacteria 3564
895 Ga0395900_0145451 3300037418 Bacteria 2424
896 Ga0395898_0002535 3300037466 Bacteria 21422
897 Ga0395898_0021367 3300037466 Bacteria 6563
898 Ga0395898_0056071 3300037466 Bacteria 3842
899 Ga0395898_0075075 3300037466 Bacteria 3265
900 Ga0395898_0130013 3300037466 Bacteria 2412
901 Ga0395898_0173483 3300037466 Bacteria 2061
902 Ga0395898_0193475 3300037466 Bacteria 1943
903 Ga0395905_0000373 3300037471 Bacteria 63927
904 Ga0395905_0001392 3300037471 Bacteria 29351
905 Ga0395905_0002403 3300037471 Bacteria 20823
906 Ga0395905_0002964 3300037471 Bacteria 18450
907 Ga0395905_0019259 3300037471 Bacteria 6470
908 Ga0395905_0019945 3300037471 Bacteria 6353
909 Ga0395905_0022852 3300037471 Bacteria 5912
910 Ga0395905_0044762 3300037471 Bacteria 4152
911 Ga0395905_0051956 3300037471 Bacteria 3838
912 Ga0395905_0052375 3300037471 Bacteria 3821
913 Ga0395905_0055716 3300037471 Bacteria 3700
914 Ga0395905_0082668 3300037471 Bacteria 3009
915 Ga0395901_0000217 3300038443 Bacteria 72615
916 Ga0395901_0002151 3300038443 Bacteria 20134
917 Ga0395901_0019360 3300038443 Bacteria 6958
918 Ga0395901_0034202 3300038443 Bacteria 5248
919 Ga0395901_0041955 3300038443 Bacteria 4742
920 Ga0395901_0136007 3300038443 Bacteria 2583
921 Ga0395901_0271617 3300038443 Bacteria 1763
922 Ga0400483_219566 3300039062 Bacteria 1608
923 Ga0436365_0325012 3300039437 Bacteria 6680
924 Ga0436361_0052780 3300039447 Bacteria 22118
925 Ga0436361_0089504 3300039447 Bacteria 11531
926 Ga0436361_0136744 3300039447 Bacteria 34867
927 Ga0436361_0376061 3300039447 Bacteria 200571
928 Ga0436361_0583521 3300039447 Bacteria 71514
929 Ga0436361_0681193 3300039447 Bacteria 39405
930 Ga0436361_0974268 3300039447 Bacteria 66829
931 Ga0436361_1205067 3300039447 Bacteria 1717
932 Ga0439436_0000600 3300041404 Bacteria 9558
933 Ga0439436_0002999 3300041404 Bacteria 5121
934 Ga0439439_0030834 3300041406 Bacteria 1364
935 Ga0439439_0045999 3300041406 Bacteria 1139
936 Ga0439461_0008822 3300041410 Bacteria 1817
937 Ga0439465_0001850 3300041413 Bacteria 6925
938 Ga0439465_0022298 3300041413 Bacteria 1989
939 Ga0451789_0718700 3300041443 Bacteria 2927
940 Ga0451793_1814855 3300041452 Bacteria 2046
941 Ga0451849_0021782 3300041505 Bacteria 1626
942 Ga0439431_0001330 3300041997 Bacteria 5441
943 Ga0439431_0006327 3300041997 Bacteria 2616
944 Ga0439433_0000095 3300041999 Bacteria 12239
945 Ga0439442_009072 3300042002 Bacteria 2011
946 Ga0439445_0002081 3300042004 Bacteria 4428
947 Ga0439448_0000095 3300042005 Bacteria 15826
948 Ga0439432_001088 3300042006 Bacteria 10324
949 Ga0439449_0000064 3300042007 Bacteria 33150
950 Ga0439449_0000770 3300042007 Bacteria 12325
951 Ga0439449_0009218 3300042007 Bacteria 3740
952 Ga0439450_010822 3300042008 Bacteria 1770
953 Ga0439452_002075 3300042010 Bacteria 7604
954 Ga0439455_0001605 3300042012 Bacteria 3852
955 Ga0439455_0021277 3300042012 Bacteria 1545
956 Ga0439462_0002409 3300042015 Bacteria 4341
957 Ga0450920_003022 3300042122 Bacteria 2902
958 Ga0450923_010893 3300042125 Bacteria 1625
959 Ga0450888_001438 3300042126 Bacteria 2284
960 Ga0450890_004653 3300042127 Bacteria 1788
961 Ga0450896_003283 3300042133 Bacteria 2141
962 Ga0450889_000167 3300042144 Bacteria 6955
963 Ga0439446_0013167 3300042156 Bacteria 2268
964 Ga0439458_0013844 3300042157 Bacteria 1817
965 Ga0450908_005451 3300042184 Bacteria 2438
966 Ga0439434_0013333 3300042435 Bacteria 2440
967 Ga0439434_0026727 3300042435 Bacteria 1743
968 Ga0439464_0003043 3300042439 Bacteria 4192
969 Ga0439460_0029524 3300042461 Bacteria 1553
970 Ga0450918_000566 3300042531 Bacteria 7868
971 Ga0450893_0001807 3300042532 Bacteria 3292
972 Ga0451577_0000457 3300042876 Bacteria 71078
973 Ga0451577_0001608 3300042876 Bacteria 29360
974 Ga0451577_0005822 3300042876 Bacteria 12479
975 Ga0451577_0015192 3300042876 Bacteria 7163
976 Ga0451577_0054386 3300042876 Bacteria 3573
977 Ga0466969_0000002 3300044656 Bacteria 178693
978 Ga0466969_0009674 3300044656 Bacteria 5110
979 Ga0466969_0011332 3300044656 Bacteria 4721
980 Ga0466972_0000041 3300044658 Bacteria 132242
981 Ga0466972_0010214 3300044658 Bacteria 4715
982 Ga0466972_0016157 3300044658 Bacteria 3730
983 Ga0466972_0050698 3300044658 Bacteria 2003
984 Ga0453683_0016829 3300044673 Bacteria 4714
985 Ga0453683_0026293 3300044673 Bacteria 3696
986 Ga0466965_0003357 3300044683 Bacteria 7018
987 Ga0466965_0013125 3300044683 Bacteria 3904
988 Ga0466965_0014917 3300044683 Bacteria 3683
989 Ga0466965_0017774 3300044683 Bacteria 3401
990 Ga0466965_0024321 3300044683 Bacteria 2929
991 Ga0466965_0030808 3300044683 Bacteria 2614
992 Ga0466965_0076770 3300044683 Bacteria 1686
993 Ga0466965_0112273 3300044683 Bacteria 1401
994 Ga0466966_0009856 3300044684 Bacteria 6333
995 Ga0466966_0014323 3300044684 Bacteria 5250
996 Ga0466966_0048125 3300044684 Bacteria 2716
997 Ga0466961_0000197 3300044693 Bacteria 40589
998 Ga0466961_0008940 3300044693 Bacteria 6392
999 Ga0466961_0030032 3300044693 Bacteria 3492
1000 Ga0466963_0066792 3300044694 Bacteria 2413
1001 Ga0466963_0095559 3300044694 Bacteria 2028
1002 Ga0466964_0004825 3300044706 Bacteria 4984
1003 Ga0466964_0007990 3300044706 Bacteria 3962
1004 Ga0466964_0009532 3300044706 Bacteria 3659
1005 Ga0453684_0000005 3300044712 Bacteria 1431632
1006 Ga0453684_0011680 3300044712 Bacteria 14651
1007 Ga0453684_0022088 3300044712 Bacteria 9464
1008 Ga0453684_0051481 3300044712 Bacteria 5397
1009 Ga0453684_0054587 3300044712 Bacteria 5203
1010 Ga0453684_0146319 3300044712 Bacteria 2814
1011 Ga0453684_0150699 3300044712 Bacteria 2764
1012 Ga0453684_0296104 3300044712 Bacteria 1840
1013 Ga0453684_0342818 3300044712 Bacteria 1687
1014 Ga0453684_0488559 3300044712 Bacteria 1365
1015 Ga0466971_0005732 3300044719 Bacteria 5400
1016 Ga0466971_0032905 3300044719 Bacteria 2322
1017 Ga0466968_0000328 3300044735 Bacteria 15269
1018 Ga0466968_0003733 3300044735 Bacteria 5646
1019 Ga0466968_0020319 3300044735 Bacteria 2680
1020 Ga0466970_0001953 3300044765 Bacteria 9971
1021 Ga0466970_0017427 3300044765 Bacteria 3711
1022 Ga0466970_0020495 3300044765 Bacteria 3436
1023 Ga0466970_0085316 3300044765 Bacteria 1710
1024 Ga0466957_0000791 3300044842 Bacteria 16187
1025 Ga0466957_0015722 3300044842 Bacteria 4421
1026 Ga0466957_0039113 3300044842 Bacteria 2860
1027 Ga0466960_0127746 3300044901 Bacteria 1338
1028 Ga0466959_0001562 3300045049 Bacteria 14096
1029 Ga0466959_0004663 3300045049 Bacteria 9223
1030 Ga0466959_0019040 3300045049 Bacteria 5046
1031 Ga0466959_0035280 3300045049 Bacteria 3700
1032 Ga0466959_0090620 3300045049 Bacteria 2196
1033 Ga0451576_0001449 3300045051 Bacteria 40328
1034 Ga0451576_0009855 3300045051 Bacteria 11039
1035 Ga0451576_0015538 3300045051 Bacteria 8427
1036 Ga0451576_0034054 3300045051 Bacteria 5411
1037 Ga0451576_0090482 3300045051 Bacteria 3183
1038 Ga0451576_0202995 3300045051 Bacteria 2070
1039 Ga0451576_0304663 3300045051 Bacteria 1667
1040 Ga0451576_0639959 3300045051 Bacteria 1117
1041 Ga0466967_0027465 3300045976 Bacteria 4735
1042 Ga0466967_0132584 3300045976 Bacteria 2314
1043 Ga0495617_000029 3300046452 Bacteria 153239
1044 Ga0495617_000050 3300046452 Bacteria 109761
1045 Ga0495617_001265 3300046452 Bacteria 11311
1046 Ga0495627_000055 3300046453 Bacteria 149482
1047 Ga0495627_006898 3300046453 Bacteria 4414
1048 Ga0495592_0000656 3300046454 Bacteria 24042
1049 Ga0495592_0022299 3300046454 Bacteria 4818
1050 Ga0495603_0047614 3300046455 Bacteria 2552
1051 Ga0495590_0000032 3300046457 Bacteria 139575
1052 Ga0495590_0000060 3300046457 Bacteria 89639
1053 Ga0495591_000596 3300046458 Bacteria 27314
1054 Ga0495629_0025793 3300046459 Bacteria 4177
1055 Ga0495629_0031756 3300046459 Bacteria 3738
1056 Ga0495629_0044071 3300046459 Bacteria 3131
1057 Ga0495638_0000562 3300046460 Bacteria 42310
1058 Ga0495638_0019435 3300046460 Bacteria 4496
1059 Ga0495638_0045974 3300046460 Bacteria 2744
1060 Ga0495651_0002000 3300046462 Bacteria 15759
1061 Ga0495653_0000081 3300046463 Bacteria 80385
1062 Ga0495653_0081582 3300046463 Bacteria 2390
1063 Ga0495650_0000048 3300046471 Bacteria 334427
1064 Ga0495650_0000161 3300046471 Bacteria 149996
1065 Ga0495650_0000890 3300046471 Bacteria 35207
1066 Ga0495650_0002372 3300046471 Bacteria 15460
1067 Ga0495650_0003041 3300046471 Bacteria 12656
1068 Ga0495650_0009337 3300046471 Bacteria 5589
1069 Ga0495582_0017401 3300046473 Bacteria 3933
1070 Ga0495605_0000044 3300046474 Bacteria 182513
1071 Ga0495605_0000180 3300046474 Bacteria 78538
1072 Ga0495605_0000494 3300046474 Bacteria 33913
1073 Ga0495605_0002894 3300046474 Bacteria 10420
1074 Ga0495605_0087919 3300046474 Bacteria 1444
1075 Ga0495639_0002696 3300046475 Bacteria 7719
1076 Ga0495662_0027003 3300046476 Bacteria 2773
1077 Ga0495584_0000613 3300046491 Bacteria 23870
1078 Ga0495584_0009159 3300046491 Bacteria 5107
1079 Ga0495584_0010710 3300046491 Bacteria 4709
1080 Ga0495584_0012788 3300046491 Bacteria 4282
1081 Ga0495584_0024369 3300046491 Bacteria 3068
1082 Ga0495585_0001109 3300046492 Bacteria 22188
1083 Ga0495585_0004398 3300046492 Bacteria 9142
1084 Ga0495585_0021342 3300046492 Bacteria 3718
1085 Ga0495585_0038591 3300046492 Bacteria 2687
1086 Ga0495585_0044172 3300046492 Bacteria 2490
1087 Ga0495594_0022012 3300046499 Bacteria 3407
1088 Ga0495596_0000481 3300046500 Bacteria 25324
1089 Ga0495596_0001056 3300046500 Bacteria 16369
1090 Ga0495596_0009863 3300046500 Bacteria 4184
1091 Ga0495607_0002872 3300046501 Bacteria 13617
1092 Ga0495607_0012437 3300046501 Bacteria 5618
1093 Ga0495607_0017013 3300046501 Bacteria 4680
1094 Ga0495607_0022647 3300046501 Bacteria 3941
1095 Ga0495607_0039947 3300046501 Bacteria 2797
1096 Ga0495607_0064366 3300046501 Bacteria 2071
1097 Ga0495607_0094293 3300046501 Bacteria 1615
1098 Ga0495583_0000145 3300046506 Bacteria 119890
1099 Ga0495583_0000153 3300046506 Bacteria 115755
1100 Ga0495583_0000155 3300046506 Bacteria 114870
1101 Ga0495583_0000622 3300046506 Bacteria 47571
1102 Ga0495583_0014837 3300046506 Bacteria 4269
1103 Ga0495583_0014978 3300046506 Bacteria 4244
1104 Ga0495606_0000232 3300046507 Bacteria 98402
1105 Ga0495606_0000510 3300046507 Bacteria 63022
1106 Ga0495606_0000904 3300046507 Bacteria 44069
1107 Ga0495606_0001037 3300046507 Bacteria 40238
1108 Ga0495606_0002667 3300046507 Bacteria 20265
1109 Ga0495606_0025667 3300046507 Bacteria 4215
1110 Ga0495606_0133542 3300046507 Bacteria 1473
1111 Ga0495608_0002698 3300046511 Bacteria 12749
1112 Ga0495610_0000003 3300046512 Bacteria 1203910
1113 Ga0495610_0000683 3300046512 Bacteria 32754
1114 Ga0495610_0001267 3300046512 Bacteria 22640
1115 Ga0495610_0005108 3300046512 Bacteria 9439
1116 Ga0495610_0012154 3300046512 Bacteria 5204
1117 Ga0495610_0044864 3300046512 Bacteria 2191
1118 Ga0495616_0000368 3300046513 Bacteria 35195
1119 Ga0495616_0002113 3300046513 Bacteria 13325
1120 Ga0495616_0002290 3300046513 Bacteria 12809
1121 Ga0495616_0008854 3300046513 Bacteria 5921
1122 Ga0495616_0009537 3300046513 Bacteria 5668
1123 Ga0495616_0012032 3300046513 Bacteria 4926
1124 Ga0495616_0052526 3300046513 Bacteria 2029
1125 Ga0495616_0055107 3300046513 Bacteria 1969
1126 Ga0495628_0001041 3300046516 Bacteria 25381
1127 Ga0495628_0002970 3300046516 Bacteria 15210
1128 Ga0495628_0011231 3300046516 Bacteria 7578
1129 Ga0495630_0078444 3300046517 Bacteria 2490
1130 Ga0495631_0006567 3300046518 Bacteria 5992
1131 Ga0495631_0010855 3300046518 Bacteria 4500
1132 Ga0495631_0012627 3300046518 Bacteria 4120
1133 Ga0495632_0000675 3300046519 Bacteria 31125
1134 Ga0495632_0000792 3300046519 Bacteria 28132
1135 Ga0495632_0015558 3300046519 Bacteria 4259
1136 Ga0495632_0019623 3300046519 Bacteria 3678
1137 Ga0495632_0028407 3300046519 Bacteria 2919
1138 Ga0495632_0040734 3300046519 Bacteria 2337
1139 Ga0495637_0000004 3300046520 Bacteria 589740
1140 Ga0495637_0000656 3300046520 Bacteria 24104
1141 Ga0495637_0009348 3300046520 Bacteria 4784
1142 Ga0495643_0000228 3300046522 Bacteria 84885
1143 Ga0495643_0001906 3300046522 Bacteria 17615
1144 Ga0495643_0013184 3300046522 Bacteria 4958
1145 Ga0495643_0017990 3300046522 Bacteria 4117
1146 Ga0495644_0005754 3300046523 Bacteria 4840
1147 Ga0495648_0000125 3300046524 Bacteria 90565
1148 Ga0495648_0001315 3300046524 Bacteria 24611
1149 Ga0495648_0035276 3300046524 Bacteria 3243
1150 Ga0495648_0042665 3300046524 Bacteria 2851
1151 Ga0495648_0078035 3300046524 Bacteria 1895
1152 Ga0495663_0008647 3300046525 Bacteria 2824
1153 Ga0495666_0017689 3300046526 Bacteria 3549
1154 Ga0495666_0047683 3300046526 Bacteria 2063
1155 Ga0495642_0019418 3300046528 Bacteria 2664
1156 Ga0495642_0023200 3300046528 Bacteria 2448
1157 Ga0495642_0029751 3300046528 Bacteria 2182
1158 Ga0495642_0053184 3300046528 Bacteria 1668
1159 Ga0495652_0038674 3300046529 Bacteria 4131
1160 Ga0495652_0039001 3300046529 Bacteria 4110
1161 Ga0495654_0000161 3300046530 Bacteria 66649
1162 Ga0495654_0025295 3300046530 Bacteria 3059
1163 Ga0495665_0009055 3300046531 Bacteria 5398
1164 Ga0495665_0011262 3300046531 Bacteria 4842
1165 Ga0495665_0070394 3300046531 Bacteria 1843
1166 Ga0495640_0002796 3300046533 Bacteria 14038
1167 Ga0495586_0000700 3300046535 Bacteria 19011
1168 Ga0495586_0001459 3300046535 Bacteria 13035
1169 Ga0495587_0043411 3300046536 Bacteria 2677
1170 Ga0495587_0153173 3300046536 Bacteria 1314
1171 Ga0495609_0000059 3300046538 Bacteria 142403
1172 Ga0495609_0006386 3300046538 Bacteria 6017
1173 Ga0495609_0062901 3300046538 Bacteria 1638
1174 Ga0495621_0000945 3300046539 Bacteria 7400
1175 Ga0495597_0000507 3300046542 Bacteria 32361
1176 Ga0495597_0001639 3300046542 Bacteria 15655
1177 Ga0495597_0003206 3300046542 Bacteria 9738
1178 Ga0495597_0018497 3300046542 Bacteria 3270
1179 Ga0495597_0051766 3300046542 Bacteria 1809
1180 Ga0495597_0054921 3300046542 Bacteria 1747
1181 Ga0495597_0056798 3300046542 Bacteria 1713
1182 Ga0495645_0016673 3300046543 Bacteria 5252
1183 Ga0495622_0000078 3300046557 Bacteria 86309
1184 Ga0495633_0000797 3300046558 Bacteria 28130
1185 Ga0495633_0010563 3300046558 Bacteria 5030
1186 Ga0495633_0013087 3300046558 Bacteria 4386
1187 Ga0495633_0020919 3300046558 Bacteria 3280
1188 Ga0495633_0021646 3300046558 Bacteria 3213
1189 Ga0495633_0022848 3300046558 Bacteria 3104
1190 Ga0495667_0001556 3300046559 Bacteria 15231
1191 Ga0495656_0000076 3300046615 Bacteria 44185
1192 Ga0495668_0000368 3300046616 Bacteria 59517
1193 Ga0495668_0000657 3300046616 Bacteria 41502
1194 Ga0495668_0002551 3300046616 Bacteria 14810
1195 Ga0495668_0006775 3300046616 Bacteria 7445
1196 Ga0495668_0012859 3300046616 Bacteria 4955
1197 Ga0495668_0024425 3300046616 Bacteria 3437
1198 Ga0495634_0002308 3300046642 Bacteria 15958
1199 Ga0495634_0011874 3300046642 Bacteria 6329
1200 Ga0495634_0150923 3300046642 Bacteria 1469
1201 Ga0495611_0020391 3300046648 Bacteria 2852
1202 Ga0495611_0034656 3300046648 Bacteria 2232
1203 Ga0495625_0000436 3300046660 Bacteria 62756
1204 Ga0495625_0004994 3300046660 Bacteria 12316
1205 Ga0495625_0006820 3300046660 Bacteria 10092
1206 Ga0495625_0007896 3300046660 Bacteria 9161
1207 Ga0495625_0012120 3300046660 Bacteria 6994
1208 Ga0495625_0016825 3300046660 Bacteria 5741
1209 Ga0495625_0028305 3300046660 Bacteria 4204
1210 Ga0495625_0042342 3300046660 Bacteria 3311
1211 Ga0495625_0048793 3300046660 Bacteria 3046
1212 Ga0495635_0155289 3300046663 Bacteria 1558
1213 Ga0495659_0000122 3300046664 Bacteria 34041
1214 Ga0495659_0002747 3300046664 Bacteria 5659
1215 Ga0495661_0002354 3300046665 Bacteria 14588
1216 Ga0495661_0006604 3300046665 Bacteria 8147
1217 Ga0495661_0015281 3300046665 Bacteria 5125
1218 Ga0495661_0015765 3300046665 Bacteria 5033
1219 Ga0495661_0034833 3300046665 Bacteria 3164
1220 Ga0495661_0055909 3300046665 Bacteria 2363
1221 Ga0495661_0134382 3300046665 Bacteria 1352
1222 Ga0495588_0000189 3300046674 Bacteria 66785
1223 Ga0495588_0023206 3300046674 Bacteria 3070
1224 Ga0495588_0053574 3300046674 Bacteria 2080
1225 Ga0495588_0088646 3300046674 Bacteria 1619
1226 Ga0495599_0000399 3300046678 Bacteria 24819
1227 Ga0495599_0009316 3300046678 Bacteria 5997
1228 Ga0495623_0006506 3300046679 Bacteria 7606
1229 Ga0495623_0048215 3300046679 Bacteria 2702
1230 Ga0495646_0001572 3300046680 Bacteria 13606
1231 Ga0495646_0069395 3300046680 Bacteria 2079
1232 Ga0495647_0008788 3300046681 Bacteria 3402
1233 Ga0495658_0006586 3300046683 Bacteria 5705
1234 Ga0495658_0006812 3300046683 Bacteria 5626
1235 Ga0495669_0000508 3300046684 Bacteria 17675
1236 Ga0495669_0008827 3300046684 Bacteria 4246
1237 Ga0495613_0009379 3300046689 Bacteria 7262
1238 Ga0495613_0014523 3300046689 Bacteria 5843
1239 Ga0495670_0002575 3300046691 Bacteria 8956
1240 Ga0495670_0032566 3300046691 Bacteria 2592
1241 Ga0495670_0052998 3300046691 Bacteria 2031
1242 Ga0495671_0000001 3300046692 Bacteria 1169494
1243 Ga0495671_0000430 3300046692 Bacteria 33279
1244 Ga0495649_0001263 3300046694 Bacteria 19477
1245 Ga0495649_0013899 3300046694 Bacteria 4629
1246 Ga0495589_0000052 3300046794 Bacteria 111467
1247 Ga0495589_0000317 3300046794 Bacteria 38407
1248 Ga0495589_0008909 3300046794 Bacteria 5221
1249 Ga0495589_0023095 3300046794 Bacteria 3170
1250 Ga0495589_0026040 3300046794 Bacteria 2965
1251 Ga0495600_0000629 3300046809 Bacteria 18215
1252 Ga0495600_0029278 3300046809 Bacteria 3565
1253 Ga0495600_0100965 3300046809 Bacteria 1881
1254 Ga0495660_0002980 3300046810 Bacteria 10569
1255 Ga0495660_0004826 3300046810 Bacteria 8133
1256 Ga0495660_0013093 3300046810 Bacteria 4807
1257 Ga0495581_0041096 3300047315 Bacteria 2675
1258 Ga0495581_0052322 3300047315 Bacteria 2358
1259 Ga0495604_0008571 3300047317 Bacteria 8077
1260 Ga0495604_0020547 3300047317 Bacteria 5273
1261 Ga0495604_0025805 3300047317 Bacteria 4679
1262 Ga0495636_0000336 3300047318 Bacteria 18003
1263 Ga0495636_0000461 3300047318 Bacteria 15077
1264 Ga0495636_0002901 3300047318 Bacteria 6629
1265 Ga0495636_0022513 3300047318 Bacteria 2548
1266 Ga0495672_0000093 3300047320 Bacteria 145111
1267 Ga0495672_0000176 3300047320 Bacteria 92728
1268 Ga0495672_0000342 3300047320 Bacteria 59691
1269 Ga0495672_0001378 3300047320 Bacteria 23962
1270 Ga0495672_0030482 3300047320 Bacteria 3382
1271 Ga0495676_0019249 3300047321 Bacteria 6006
1272 Ga0495676_0037983 3300047321 Bacteria 4003
1273 Ga0495680_0002481 3300047322 Bacteria 18867
1274 Ga0495683_0000248 3300047323 Bacteria 48653
1275 Ga0495683_0000343 3300047323 Bacteria 38546
1276 Ga0495683_0002649 3300047323 Bacteria 10686
1277 Ga0495687_000087 3300047443 Bacteria 142540
1278 Ga0495687_000395 3300047443 Bacteria 54190
1279 Ga0495687_000598 3300047443 Bacteria 42075
1280 Ga0495687_000913 3300047443 Bacteria 30782
1281 Ga0495687_001142 3300047443 Bacteria 25716
1282 Ga0495687_002075 3300047443 Bacteria 16835
1283 Ga0495687_002391 3300047443 Bacteria 15136
1284 Ga0495687_007698 3300047443 Bacteria 6289
1285 Ga0495675_0028624 3300047444 Bacteria 3552
1286 Ga0495677_0000070 3300047445 Bacteria 52431
1287 Ga0495677_0018251 3300047445 Bacteria 2542
1288 Ga0495677_0020382 3300047445 Bacteria 2403
1289 Ga0495679_009305 3300047446 Bacteria 3942
1290 Ga0495679_009792 3300047446 Bacteria 3807
1291 Ga0495685_000323 3300047447 Bacteria 15390
1292 Ga0495685_018588 3300047447 Bacteria 2386
1293 Ga0495673_0000006 3300047469 Bacteria 908691
1294 Ga0495673_0000024 3300047469 Bacteria 521349
1295 Ga0495673_0000049 3300047469 Bacteria 265878
1296 Ga0495681_0002290 3300047470 Bacteria 13763
1297 Ga0495681_0002823 3300047470 Bacteria 12290
1298 Ga0495681_0006653 3300047470 Bacteria 7549
1299 Ga0495686_0001319 3300047472 Bacteria 27837
1300 Ga0495686_0002420 3300047472 Bacteria 17652
1301 Ga0495686_0009713 3300047472 Bacteria 6907
1302 Ga0495686_0071230 3300047472 Bacteria 2140
1303 Ga0495593_0003834 3300047673 Bacteria 8977
1304 Ga0495593_0022003 3300047673 Bacteria 3557
1305 Ga0495602_0054070 3300048088 Bacteria 3548
1306 Ga0495614_0000563 3300048089 Bacteria 15425
1307 Ga0495626_0000085 3300048091 Bacteria 125255
1308 Ga0495626_0000178 3300048091 Bacteria 77592
1309 Ga0495626_0001048 3300048091 Bacteria 23645
1310 Ga0495626_0005716 3300048091 Bacteria 7190
1311 Ga0495626_0016181 3300048091 Bacteria 3796
1312 Ga0495626_0016736 3300048091 Bacteria 3717
1313 Ga0496100_0011298 3300048903 Bacteria 5081
1314 Ga0496101_0021767 3300048904 Bacteria 4406
1315 Ga0496101_0042206 3300048904 Bacteria 3256
1316 Ga0496101_0051336 3300048904 Bacteria 2971
1317 Ga0496102_0011990 3300048905 Bacteria 7488
1318 Ga0496102_0029346 3300048905 Bacteria 4922
1319 Ga0496102_0037961 3300048905 Bacteria 4345
1320 Ga0496102_0078090 3300048905 Bacteria 3047
1321 Ga0496102_0086355 3300048905 Bacteria 2897
1322 Ga0496104_0261480 3300048907 Bacteria 1643
1323 Ga0496104_0382512 3300048907 Bacteria 1320
1324 Ga0496105_0001580 3300048908 Bacteria 16149
1325 Ga0496105_0188494 3300048908 Bacteria 1687
1326 Ga0496106_0047710 3300048909 Bacteria 3224
1327 Ga0496109_0038419 3300048912 Bacteria 4328
1328 Ga0496110_0028201 3300048913 Bacteria 4819
1329 Ga0496110_0035522 3300048913 Bacteria 4324
1330 Ga0496110_0105558 3300048913 Bacteria 2527
1331 Ga0496110_0270295 3300048913 Bacteria 1548
1332 Ga0496111_0069687 3300048914 Bacteria 2557
1333 Ga0496114_0048729 3300048917 Bacteria 3524
1334 Ga0496114_0055953 3300048917 Bacteria 3290
1335 Ga0496114_0218225 3300048917 Bacteria 1674
1336 Ga0496115_0007765 3300048918 Bacteria 7910
1337 Ga0496115_0058190 3300048918 Bacteria 3110
1338 Ga0496116_0005336 3300048919 Bacteria 11978
1339 Ga0496116_0109107 3300048919 Bacteria 1632
1340 Ga0496117_0000001 3300048920 Bacteria 2526244
1341 Ga0496117_0014655 3300048920 Bacteria 6739
1342 Ga0496118_0000078 3300048921 Bacteria 190946
1343 Ga0496118_0030575 3300048921 Bacteria 4491
1344 Ga0496118_0061288 3300048921 Bacteria 2786
1345 Ga0496118_0149690 3300048921 Bacteria 1463
1346 Ga0496118_0155114 3300048921 Bacteria 1426
1347 Ga0496121_0036731 3300048924 Bacteria 4361
1348 Ga0496121_0041851 3300048924 Bacteria 3996
1349 Ga0496121_0062576 3300048924 Bacteria 3047
1350 Ga0496121_0092447 3300048924 Bacteria 2358
1351 Ga0496121_0255477 3300048924 Bacteria 1213
1352 Ga0496122_0000103 3300048925 Bacteria 196819
1353 Ga0496122_0000472 3300048925 Bacteria 83803
1354 Ga0496122_0002104 3300048925 Bacteria 29499
1355 Ga0496122_0040011 3300048925 Bacteria 3732
1356 Ga0496123_0000261 3300048926 Bacteria 106547
1357 Ga0496123_0000361 3300048926 Bacteria 85609
1358 Ga0496123_0001654 3300048926 Bacteria 29944
1359 Ga0496123_0026803 3300048926 Bacteria 4308
1360 Ga0496123_0054174 3300048926 Bacteria 2643
1361 Ga0496123_0096880 3300048926 Bacteria 1730
1362 Ga0496123_0107743 3300048926 Bacteria 1602
1363 Ga0496124_0000151 3300048927 Bacteria 142761
1364 Ga0496124_0000155 3300048927 Bacteria 138529
1365 Ga0496124_0004832 3300048927 Bacteria 15496
1366 Ga0496124_0045923 3300048927 Bacteria 3743
1367 Ga0496125_0005102 3300048928 Bacteria 14777
1368 Ga0496125_0005971 3300048928 Bacteria 13330
1369 Ga0496125_0009461 3300048928 Bacteria 10006
1370 Ga0496125_0029672 3300048928 Bacteria 4910
1371 Ga0496125_0035455 3300048928 Bacteria 4374
1372 Ga0496125_0161292 3300048928 Bacteria 1522
1373 Ga0501310_000578 3300049130 Bacteria 3214
1374 Ga0495678_000223 3300049459 Bacteria 65751
1375 Ga0495678_000439 3300049459 Bacteria 41538
1376 Ga0495678_000771 3300049459 Bacteria 28941
1377 Ga0495678_002291 3300049459 Bacteria 13267
1378 Ga0495678_003472 3300049459 Bacteria 9743
1379 Ga0495678_039382 3300049459 Bacteria 1907
1380 Ga0495682_0001584 3300049460 Bacteria 11830
1381 Ga0495682_0029415 3300049460 Bacteria 2034
1382 Ga0501295_002376 3300049518 Bacteria 2138
1383 Ga0501298_013028 3300049521 Bacteria 1466
1384 Ga0501300_000967 3300049523 Bacteria 4392
1385 Ga0501031_0001583 3300049568 Bacteria 14189
1386 Ga0501031_0138779 3300049568 Bacteria 1588
1387 Ga0501038_0101445 3300049574 Bacteria 2396
1388 Ga0501039_0006011 3300049575 Bacteria 9208
1389 Ga0501039_0165594 3300049575 Bacteria 1738
1390 Ga0501043_0000141 3300049579 Bacteria 67326
1391 Ga0501043_0070134 3300049579 Bacteria 2753
1392 Ga0501046_0000047 3300049580 Bacteria 140344
1393 Ga0501046_0029614 3300049580 Bacteria 4450
1394 Ga0501047_0000058 3300049581 Bacteria 139202
1395 Ga0501047_0066255 3300049581 Bacteria 3481
1396 Ga0501048_0002761 3300049582 Bacteria 13396
1397 Ga0501070_0001800 3300049586 Bacteria 18908
1398 Ga0501070_0077838 3300049586 Bacteria 2744
1399 Ga0501074_0005316 3300049590 Bacteria 9267
1400 Ga0501074_0249547 3300049590 Bacteria 1262
1401 Ga0501075_0022681 3300049591 Bacteria 4588
1402 Ga0501198_000002 3300049649 Bacteria 197356
1403 Ga0501222_000002 3300049662 Bacteria 169093
1404 Ga0501223_003895 3300049663 Bacteria 3224
1405 Ga0501253_006016 3300049683 Bacteria 1623
1406 Ga0501258_001545 3300049687 Bacteria 1904
1407 Ga0501229_000963 3300049706 Bacteria 3265
1408 Ga0501262_000587 3300049759 Bacteria 4323
1409 Ga0501262_003280 3300049759 Bacteria 1849
1410 Ga0501266_000061 3300049763 Bacteria 16407
1411 Ga0501279_014401 3300049775 Bacteria 1089
1412 Ga0501280_000779 3300049776 Bacteria 6936
1413 Ga0501282_003594 3300049778 Bacteria 1672
1414 Ga0501035_0006524 3300049822 Bacteria 10950
1415 Ga0501044_0000070 3300049823 Bacteria 124889
1416 Ga0501044_0000379 3300049823 Bacteria 55288
1417 Ga0501044_0239282 3300049823 Bacteria 1759
1418 nmdc:mga03683_1058_c1 3300050489 Bacteria 8058
1419 nmdc:mga03683_1137_c1 3300050489 Bacteria 7817
1420 nmdc:mga03n38_22459_c1 3300050490 Bacteria 2554
1421 nmdc:mga00v17_19444_c1 3300050491 Bacteria 3877
1422 nmdc:mga00v17_30066_c1 3300050491 Bacteria 3193
1423 nmdc:mga00v17_31656_c1 3300050491 Bacteria 3121
1424 nmdc:mga00v17_3261_c1 3300050491 Bacteria 8362
1425 nmdc:mga00v17_59130_c1 3300050491 Bacteria 2350
1426 nmdc:mga0yw44_149906_c1 3300050492 Bacteria 1520
1427 nmdc:mga0yw44_18828_c1 3300050492 Bacteria 3792
1428 nmdc:mga0yw44_4617_c1 3300050492 Bacteria 6354
1429 nmdc:mga0k408_123753_c1 3300050493 Bacteria 1533
1430 nmdc:mga0k408_129286_c1 3300050493 Bacteria 1499
1431 nmdc:mga0k408_15735_c1 3300050493 Bacteria 4187
1432 nmdc:mga0k408_21431_c2 3300050493 Bacteria 3437
1433 nmdc:mga0k408_28418_c1 3300050493 Bacteria 3180
1434 nmdc:mga0k408_4539_c1 3300050493 Bacteria 4229
1435 nmdc:mga0k408_84428_c1 3300050493 Bacteria 1863
1436 nmdc:mga0k408_8464_c1 3300050493 Bacteria 5525
1437 nmdc:mga06z11_12650_c1 3300050494 Bacteria 3676
1438 nmdc:mga06z11_28742_c1 3300050494 Bacteria 2671
1439 nmdc:mga06z11_60760_c1 3300050494 Bacteria 1968
1440 nmdc:mga04h51_11267_c1 3300050495 Bacteria 2478
1441 nmdc:mga07m45_110521_c1 3300050496 Bacteria 1583
1442 nmdc:mga07m45_11535_c1 3300050496 Bacteria 4647
1443 nmdc:mga07m45_12754_c1 3300050496 Bacteria 4444
1444 nmdc:mga07m45_182_c1 3300050496 Bacteria 25233
1445 nmdc:mga07m45_19387_c1 3300050496 Bacteria 3685
1446 nmdc:mga07m45_21169_c1 3300050496 Bacteria 3538
1447 nmdc:mga07m45_23333_c1 3300050496 Bacteria 3382
1448 nmdc:mga07m45_35932_c1 3300050496 Bacteria 2757
1449 nmdc:mga07m45_51285_c1 3300050496 Bacteria 2327
1450 nmdc:mga07m45_831_c1 3300050496 Bacteria 13365
1451 nmdc:mga09592_17028_c1 3300050508 Bacteria 5949
1452 nmdc:mga09592_3371_c1 3300050508 Bacteria 12912
1453 nmdc:mga0qj67_13392_c1 3300050509 Bacteria 6186
1454 nmdc:mga08y16_34516_c1 3300050511 Bacteria 5313
1455 nmdc:mga08y16_4675_c1 3300050511 Bacteria 14265
1456 nmdc:mga0n895_202668_c1 3300050512 Bacteria 2015
1457 nmdc:mga0n895_286054_c1 3300050512 Bacteria 1671
1458 nmdc:mga0rr50_240967_c1 3300050513 Bacteria 1499
1459 nmdc:mga0rr50_45174_c1 3300050513 Bacteria 3236
1460 nmdc:mga08x19_144_c1 3300050514 Bacteria 61986
1461 nmdc:mga08x19_20211_c1 3300050514 Bacteria 4100
1462 nmdc:mga08x19_5478_c1 3300050514 Bacteria 7507
1463 nmdc:mga0sz30_20039_c1 3300050516 Bacteria 2695
1464 nmdc:mga0sz30_30537_c1 3300050516 Bacteria 2226
1465 Ga0500610_0020964 3300053079 Bacteria 3199
1466 Ga0500635_0000033 3300053080 Bacteria 97175
1467 Ga0500578_0000002 3300053086 Bacteria 293507
1468 Ga0500644_0001013 3300053088 Bacteria 8603
1469 Ga0500646_0004257 3300053090 Bacteria 3627
1470 Ga0500646_0004453 3300053090 Bacteria 3550
1471 Ga0500651_0000042 3300053093 Bacteria 87895
1472 Ga0500651_0027361 3300053093 Bacteria 3586
1473 Ga0500650_0021345 3300053098 Bacteria 2852
1474 Ga0500569_035869 3300053109 Bacteria 1424
1475 Ga0500571_000096 3300053110 Bacteria 28934
1476 Ga0500593_000815 3300053117 Bacteria 11655
1477 Ga0500593_007672 3300053117 Bacteria 4404
1478 Ga0500607_002839 3300053121 Bacteria 13391
1479 Ga0500618_000469 3300053125 Bacteria 26219
1480 Ga0500618_001201 3300053125 Bacteria 12380
1481 Ga0500652_000102 3300053131 Bacteria 33562
1482 Ga0500658_0000966 3300053134 Bacteria 11734
1483 Ga0500658_0001050 3300053134 Bacteria 11300
1484 Ga0500559_0004514 3300053136 Bacteria 6584
1485 Ga0500574_000611 3300053141 Bacteria 4610
1486 Ga0500577_0007624 3300053142 Bacteria 3044
1487 Ga0500604_0004883 3300053151 Bacteria 3556
1488 Ga0500616_0017939 3300053153 Bacteria 4007
1489 Ga0500619_000015 3300053154 Bacteria 54620
1490 Ga0500619_001041 3300053154 Bacteria 4799
1491 Ga0500622_0000001 3300053156 Bacteria 657715
1492 Ga0500622_0000236 3300053156 Bacteria 57393
1493 Ga0500622_0003109 3300053156 Bacteria 11424
1494 Ga0500624_001676 3300053157 Bacteria 3303
1495 Ga0500636_0000870 3300053177 Bacteria 16194
1496 Ga0500636_0009640 3300053177 Bacteria 5619
1497 Ga0500637_0062352 3300053178 Bacteria 2136
1498 Ga0500570_060536 3300053724 Bacteria 1836
1499 Ga0500625_008812 3300053729 Bacteria 4478
1500 Ga0500645_002026 3300053730 Bacteria 9465
1501 Ga0500645_002056 3300053730 Bacteria 9358
1502 Ga0500645_009453 3300053730 Bacteria 3274
1503 Ga0590071_005391 3300059421 Bacteria 3075
1504 Ga0587084_000476 3300059477 Bacteria 3181
1505 Ga0587084_002643 3300059477 Bacteria 1885
1506 Ga0587070_000720 3300059491 Bacteria 2999
1507 Ga0587070_007438 3300059491 Bacteria 1519
1508 Ga0587073_0004837 3300059492 Bacteria 1963
1509 Ga0587077_008527 3300059493 Bacteria 1529
1510 Ga0587082_000566 3300059504 Bacteria 3212
1511 Ga0587083_0002910 3300059505 Bacteria 2199
1512 Ga0587083_0004811 3300059505 Bacteria 1907
1513 Ga0587086_000607 3300059507 Bacteria 2714
1514 Ga0587088_001141 3300059508 Bacteria 2643
1515 Ga0587090_000296 3300059510 Bacteria 3850
1516 Ga0587090_003114 3300059510 Bacteria 1894
1517 Ga0587098_002515 3300059604 Bacteria 1557
1518 Ga0587106_002524 3300059605 Bacteria 1810
1519 Ga0587101_000694 3300059623 Bacteria 2546
1520 Ga0587101_000876 3300059623 Bacteria 2391
1521 Ga0587101_003309 3300059623 Bacteria 1626
1522 Ga0587128_005367 3300059630 Bacteria 1528
1523 Ga0587067_000005 3300059640 Bacteria 10011
1524 Ga0587068_000631 3300059641 Bacteria 3388
1525 Ga0587072_000020 3300059643 Bacteria 9919
1526 Ga0587075_002891 3300059644 Bacteria 1865
1527 Ga0587075_005763 3300059644 Bacteria 1495
1528 Ga0587076_000849 3300059645 Bacteria 2829
1529 Ga0587076_005786 3300059645 Bacteria 1617
1530 Ga0587079_000879 3300059647 Bacteria 3063
1531 Ga0587104_000148 3300059650 Bacteria 2334
1532 Ga0587111_0001500 3300060346 Bacteria 2829
1533 Ga0587111_0006959 3300060346 Bacteria 1817
1534 Ga0587111_0007265 3300060346 Bacteria 1794

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_123753_c1 nmdc:mga0k408_123753_c1_32_982 302
2 3300041406 Ga0439439_0045999 Ga0439439_0045999_61_1128 305
3 3300035691 Ga0373931_0183747 Ga0373931_0183747_257_1213 314
4 3300049775 Ga0501279_014401 Ga0501279_014401_49_1038 319
5 3300046558 Ga0495633_0021646 Ga0495633_0021646_2178_3194 320
6 3300044901 Ga0466960_0127746 Ga0466960_0127746_87_1115 321
7 3300041410 Ga0439461_0008822 Ga0439461_0008822_35_1048 322
8 3300048917 Ga0496114_0218225 Ga0496114_0218225_54_1067 322
9 3300048907 Ga0496104_0382512 Ga0496104_0382512_277_1308 325
10 3300050492 nmdc:mga0yw44_18828_c1 nmdc:mga0yw44_18828_c1_2762_3778 326
11 3300050494 nmdc:mga06z11_60760_c1 nmdc:mga06z11_60760_c1_917_1933 326
12 3300049590 Ga0501074_0249547 Ga0501074_0249547_249_1247 329
13 3300050490 nmdc:mga03n38_22459_c1 nmdc:mga03n38_22459_c1_1488_2543 332
14 3300028800 Ga0265338_10077449 Ga0265338_100774493 338
15 3300029957 Ga0265324_10000928 Ga0265324_1000092815 338
16 3300031241 Ga0265325_10006034 Ga0265325_100060345 338
17 3300031711 Ga0265314_10002666 Ga0265314_1000266617 338
18 3300050489 nmdc:mga03683_1058_c1 nmdc:mga03683_1058_c1_6993_8042 338
19 3300046663 Ga0495635_0155289 Ga0495635_0155289_194_1303 340
20 3300048913 Ga0496110_0270295 Ga0496110_0270295_432_1526 341
21 3300031344 Ga0265316_10231625 Ga0265316_102316252 342
22 3300007265 Ga0099794_10029708 Ga0099794_100297083 346
23 3300044673 Ga0453683_0026293 Ga0453683_0026293_594_1676 346
24 3300044712 Ga0453684_0488559 Ga0453684_0488559_259_1341 346
25 3300045051 Ga0451576_0202995 Ga0451576_0202995_765_1847 346
26 3300025908 Ga0207643_10035733 Ga0207643_100357332 348
27 3300005578 Ga0068854_100075386 Ga0068854_1000753863 349
28 3300036401 Ga0373937_0209036 Ga0373937_0209036_480_1658 349
29 3300053177 Ga0500636_0000870 Ga0500636_0000870_2919_4031 349
30 3300053178 Ga0500637_0062352 Ga0500637_0062352_753_1865 349
31 3300053729 Ga0500625_008812 Ga0500625_008812_445_1557 349
32 3300005456 Ga0070678_100060133 Ga0070678_1000601332 350
33 3300005841 Ga0068863_100079825 Ga0068863_1000798253 350
34 3300009177 Ga0105248_10054325 Ga0105248_100543253 350
35 3300013308 Ga0157375_10027704 Ga0157375_100277043 350
36 3300014969 Ga0157376_10098455 Ga0157376_100984553 350
37 3300021384 Ga0213876_10047440 Ga0213876_100474402 350
38 3300025941 Ga0207711_10030824 Ga0207711_100308244 350
39 3300026088 Ga0207641_10043576 Ga0207641_100435763 350
40 3300026095 Ga0207676_10138952 Ga0207676_101389522 350
41 3300027364 Ga0209967_1002266 Ga0209967_10022663 350
42 3300027378 Ga0209981_1002288 Ga0209981_10022882 350
43 3300027471 Ga0209995_1004707 Ga0209995_10047072 350
44 3300027543 Ga0209999_1004774 Ga0209999_10047742 350
45 3300027682 Ga0209971_1019615 Ga0209971_10196152 350
46 3300032002 Ga0307416_100140365 Ga0307416_1001403653 350
47 3300036401 Ga0373937_0147098 Ga0373937_0147098_613_1779 350
48 3300039437 Ga0436365_0325012 Ga0436365_0325012_5009_6187 350
49 3300046459 Ga0495629_0025793 Ga0495629_0025793_897_2063 350
50 3300046681 Ga0495647_0008788 Ga0495647_0008788_698_1864 350
51 3300046683 Ga0495658_0006812 Ga0495658_0006812_4169_5335 350
52 3300049575 Ga0501039_0006011 Ga0501039_0006011_3518_4582 351
53 3300049591 Ga0501075_0022681 Ga0501075_0022681_1648_2712 351
54 3300005456 Ga0070678_100194060 Ga0070678_1001940602 352
55 3300005834 Ga0068851_10074103 Ga0068851_100741032 352
56 3300006844 Ga0075428_100000521 Ga0075428_10000052120 352
57 3300006880 Ga0075429_100020657 Ga0075429_1000206574 352
58 3300009094 Ga0111539_10001172 Ga0111539_1000117220 352
59 3300025961 Ga0207712_10035285 Ga0207712_100352853 352
60 3300027907 Ga0207428_10000830 Ga0207428_1000083019 352
61 3300050508 nmdc:mga09592_17028_c1 nmdc:mga09592_17028_c1_3625_4710 352
62 3300050511 nmdc:mga08y16_4675_c1 nmdc:mga08y16_4675_c1_473_1558 352
63 3300005458 Ga0070681_10169046 Ga0070681_101690462 353
64 3300005518 Ga0070699_100017265 Ga0070699_1000172655 353
65 3300005564 Ga0070664_100047466 Ga0070664_1000474662 353
66 3300006871 Ga0075434_100053000 Ga0075434_1000530004 353
67 3300006914 Ga0075436_100000353 Ga0075436_10000035321 353
68 3300046454 Ga0495592_0000656 Ga0495592_0000656_12567_13637 353
69 3300046463 Ga0495653_0081582 Ga0495653_0081582_822_1892 353
70 3300046476 Ga0495662_0027003 Ga0495662_0027003_1653_2723 353
71 3300046511 Ga0495608_0002698 Ga0495608_0002698_2101_3171 353
72 3300046516 Ga0495628_0011231 Ga0495628_0011231_3264_4334 353
73 3300046517 Ga0495630_0078444 Ga0495630_0078444_1160_2230 353
74 3300046529 Ga0495652_0039001 Ga0495652_0039001_1677_2747 353
75 3300046533 Ga0495640_0002796 Ga0495640_0002796_5359_6429 353
76 3300046535 Ga0495586_0000700 Ga0495586_0000700_14220_15290 353
77 3300046559 Ga0495667_0001556 Ga0495667_0001556_5315_6385 353
78 3300046642 Ga0495634_0011874 Ga0495634_0011874_4155_5225 353
79 3300046678 Ga0495599_0009316 Ga0495599_0009316_4014_5084 353
80 3300046683 Ga0495658_0006586 Ga0495658_0006586_3231_4301 353
81 3300046689 Ga0495613_0009379 Ga0495613_0009379_184_1254 353
82 3300047322 Ga0495680_0002481 Ga0495680_0002481_7794_8864 353
83 3300050512 nmdc:mga0n895_202668_c1 nmdc:mga0n895_202668_c1_57_1127 353
84 3300050513 nmdc:mga0rr50_45174_c1 nmdc:mga0rr50_45174_c1_591_1661 353
85 3300050514 nmdc:mga08x19_144_c1 nmdc:mga08x19_144_c1_42440_43510 353
86 3300005339 Ga0070660_100000913 Ga0070660_10000091316 354
87 3300005366 Ga0070659_100001509 Ga0070659_10000150913 354
88 3300005578 Ga0068854_100016517 Ga0068854_1000165172 354
89 3300009093 Ga0105240_10017343 Ga0105240_1001734310 354
90 3300009545 Ga0105237_10007511 Ga0105237_100075114 354
91 3300009551 Ga0105238_10000367 Ga0105238_1000036710 354
92 3300010375 Ga0105239_10048392 Ga0105239_100483924 354
93 3300025913 Ga0207695_10001614 Ga0207695_1000161415 354
94 3300025914 Ga0207671_10050814 Ga0207671_100508143 354
95 3300025919 Ga0207657_10002514 Ga0207657_100025145 354
96 3300025932 Ga0207690_10007244 Ga0207690_100072445 354
97 3300025949 Ga0207667_10126610 Ga0207667_101266102 354
98 3300037471 Ga0395905_0002403 Ga0395905_0002403_7636_8805 354
99 3300044658 Ga0466972_0000041 Ga0466972_0000041_114334_115503 354
100 3300044683 Ga0466965_0003357 Ga0466965_0003357_4844_6013 354
101 3300044735 Ga0466968_0020319 Ga0466968_0020319_995_2164 354
102 3300048904 Ga0496101_0042206 Ga0496101_0042206_1309_2478 354
103 3300048908 Ga0496105_0188494 Ga0496105_0188494_400_1569 354
104 3300048913 Ga0496110_0028201 Ga0496110_0028201_1210_2379 354
105 3300006846 Ga0075430_100035659 Ga0075430_1000356594 355
106 3300006946 Ga0079104_1007818 Ga0079104_10078184 355
107 3300021361 Ga0213872_10000552 Ga0213872_1000055220 355
108 3300039447 Ga0436361_0974268 Ga0436361_0974268_27866_29041 355
109 3300046528 Ga0495642_0053184 Ga0495642_0053184_125_1207 355
110 3300049575 Ga0501039_0165594 Ga0501039_0165594_498_1580 355
111 3300050512 nmdc:mga0n895_286054_c1 nmdc:mga0n895_286054_c1_297_1373 355
112 3300060346 Ga0587111_0001500 Ga0587111_0001500_512_1681 355
113 iso_pu_bacteria 2526164512 2526213701 355
114 3300005330 Ga0070690_100152895 Ga0070690_1001528952 356
115 3300005340 Ga0070689_100042926 Ga0070689_1000429264 356
116 3300005440 Ga0070705_100217251 Ga0070705_1002172512 356
117 3300005536 Ga0070697_100001109 Ga0070697_1000011094 356
118 3300005539 Ga0068853_100219304 Ga0068853_1002193042 356
119 3300007265 Ga0099794_10043832 Ga0099794_100438322 356
120 3300025936 Ga0207670_10186134 Ga0207670_101861342 356
121 3300036401 Ga0373937_0267318 Ga0373937_0267318_92_1177 356
122 3300044712 Ga0453684_0022088 Ga0453684_0022088_2657_3751 356
123 3300045976 Ga0466967_0027465 Ga0466967_0027465_3572_4657 356
124 3300005444 Ga0070694_100028514 Ga0070694_1000285143 357
125 3300005458 Ga0070681_10087560 Ga0070681_100875602 357
126 3300005545 Ga0070695_100027965 Ga0070695_1000279654 357
127 3300005549 Ga0070704_100014555 Ga0070704_1000145555 357
128 3300005549 Ga0070704_100083446 Ga0070704_1000834462 357
129 3300006173 Ga0070716_100198077 Ga0070716_1001980772 357
130 3300006852 Ga0075433_10171730 Ga0075433_101717302 357
131 3300006914 Ga0075436_100006510 Ga0075436_1000065104 357
132 3300006914 Ga0075436_100072438 Ga0075436_1000724381 357
133 3300007076 Ga0075435_100247971 Ga0075435_1002479712 357
134 3300009176 Ga0105242_10016812 Ga0105242_100168126 357
135 3300025912 Ga0207707_10070211 Ga0207707_100702112 357
136 3300025939 Ga0207665_10007367 Ga0207665_100073676 357
137 3300027671 Ga0209588_1046569 Ga0209588_10465692 357
138 3300035112 Ga0373932_0018160 Ga0373932_0018160_476_1564 357
139 3300042435 Ga0439434_0026727 Ga0439434_0026727_615_1733 357
140 3300045051 Ga0451576_0639959 Ga0451576_0639959_13_1095 357
141 3300050514 nmdc:mga08x19_20211_c1 nmdc:mga08x19_20211_c1_957_2039 357
142 3300050514 nmdc:mga08x19_5478_c1 nmdc:mga08x19_5478_c1_3606_4688 357
143 3300005327 Ga0070658_10099644 Ga0070658_100996441 358
144 3300005543 Ga0070672_100018119 Ga0070672_1000181192 358
145 3300013306 Ga0163162_10176279 Ga0163162_101762792 358
146 3300031251 Ga0265327_10014403 Ga0265327_100144033 358
147 3300048914 Ga0496111_0069687 Ga0496111_0069687_34_1113 358
148 3300005440 Ga0070705_100018240 Ga0070705_1000182402 359
149 3300005445 Ga0070708_100036779 Ga0070708_1000367793 359
150 3300005458 Ga0070681_10006689 Ga0070681_100066898 359
151 3300005467 Ga0070706_100028142 Ga0070706_1000281423 359
152 3300025910 Ga0207684_10104042 Ga0207684_101040423 359
153 3300025912 Ga0207707_10012991 Ga0207707_100129914 359
154 3300025939 Ga0207665_10104367 Ga0207665_101043671 359
155 3300027364 Ga0209967_1006672 Ga0209967_10066722 359
156 3300027543 Ga0209999_1017424 Ga0209999_10174242 359
157 3300027876 Ga0209974_10002377 Ga0209974_100023776 359
158 3300031239 Ga0265328_10001293 Ga0265328_1000129310 359
159 3300035121 Ga0373960_0018371 Ga0373960_0018371_537_1640 359
160 3300035207 Ga0373942_0047325 Ga0373942_0047325_38_1132 359
161 3300049586 Ga0501070_0001800 Ga0501070_0001800_6013_7098 359
162 3300049586 Ga0501070_0077838 Ga0501070_0077838_1182_2267 359
163 3300049590 Ga0501074_0005316 Ga0501074_0005316_4397_5482 359
164 3300050513 nmdc:mga0rr50_240967_c1 nmdc:mga0rr50_240967_c1_69_1154 359
165 iso_pu_bacteria 2643221544 2643742687 359
166 iso_pu_bacteria 2643221570 2643864739 359
167 iso_pu_bacteria 2643221585 2643936207 359
168 iso_pu_bacteria 2643221596 2643991115 359
169 iso_pu_bacteria 2643221639 2644217706 359
170 iso_pu_bacteria 2643221646 2644258556 359
171 iso_pu_bacteria 2643221652 2644294030 359
172 iso_pu_bacteria 2643221656 2644316852 359
173 iso_pu_bacteria 2842718218 2842721251 359
174 iso_pu_bacteria 2894023352 2894026786 359
175 iso_pu_bacteria 2932422444 2932426490 359
176 iso_pu_bacteria 2974320154 2974322656 359
177 iso_pu_bacteria 2990710928 2990711802 359
178 3300005328 Ga0070676_10060174 Ga0070676_100601742 360
179 3300005340 Ga0070689_100075030 Ga0070689_1000750303 360
180 3300005617 Ga0068859_100101618 Ga0068859_1001016182 360
181 3300005842 Ga0068858_100012025 Ga0068858_1000120254 360
182 3300006931 Ga0097620_100101621 Ga0097620_1001016212 360
183 3300013296 Ga0157374_10000895 Ga0157374_1000089517 360
184 3300013297 Ga0157378_10012903 Ga0157378_100129033 360
185 3300013297 Ga0157378_10074224 Ga0157378_100742242 360
186 3300014325 Ga0163163_10006006 Ga0163163_100060064 360
187 3300026035 Ga0207703_10080568 Ga0207703_100805682 360
188 3300026075 Ga0207708_10077055 Ga0207708_100770552 360
189 3300028794 Ga0307515_10000191 Ga0307515_1000019110 360
190 3300031649 Ga0307514_10007672 Ga0307514_100076723 360
191 3300031665 Ga0316575_10030592 Ga0316575_100305922 360
192 3300035398 Ga0316574_0002074 Ga0316574_0002074_604_1722 360
193 3300048924 Ga0496121_0255477 Ga0496121_0255477_17_1150 360
194 3300050511 nmdc:mga08y16_34516_c1 nmdc:mga08y16_34516_c1_679_1776 360
195 iso_pu_bacteria 2547132374 2548500236 360
196 iso_pu_bacteria 2643221717 2644644447 360
197 iso_pu_bacteria 2904479285 2904480237 360
198 3300003792 Ga0055540_1018181 Ga0055540_10181812 361
199 3300006038 Ga0075365_10122504 Ga0075365_101225042 361
200 3300006195 Ga0075366_10030434 Ga0075366_100304343 361
201 3300017792 Ga0163161_10033889 Ga0163161_100338894 361
202 3300025303 Ga0209051_1014865 Ga0209051_10148652 361
203 3300028794 Ga0307515_10000022 Ga0307515_10000022235 361
204 3300031456 Ga0307513_10011299 Ga0307513_100112993 361
205 3300045051 Ga0451576_0034054 Ga0451576_0034054_2025_3149 361
206 3300049568 Ga0501031_0001583 Ga0501031_0001583_12721_13833 361
207 3300050492 nmdc:mga0yw44_149906_c1 nmdc:mga0yw44_149906_c1_207_1352 361
208 iso_pu_bacteria 2738541337 2739056739 361
209 3300002704 JGI25155J39150_1001127 JGI25155J39150_10011272 362
210 3300002704 JGI25155J39150_1001208 JGI25155J39150_10012082 362
211 3300002705 JGI25156J39149_1001520 JGI25156J39149_10015208 362
212 3300002705 JGI25156J39149_1003958 JGI25156J39149_10039584 362
213 3300002737 JGI25162J39368_1000015 JGI25162J39368_1000015271 362
214 3300002737 JGI25162J39368_1007808 JGI25162J39368_10078081 362
215 3300002738 JGI25154J39366_1001232 JGI25154J39366_10012322 362
216 3300002738 JGI25154J39366_1001235 JGI25154J39366_10012358 362
217 3300002741 JGI25157J39369_1000420 JGI25157J39369_100042019 362
218 3300002741 JGI25157J39369_1001343 JGI25157J39369_10013438 362
219 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001948 362
220 3300003316 rootH1_10015076 rootH1_100150764 362
221 3300003751 Ga0055538_1000001 Ga0055538_100000186 362
222 3300003752 Ga0055539_1000001 Ga0055539_100000186 362
223 3300003756 Ga0055533_1000003 Ga0055533_1000003948 362
224 3300003758 Ga0055532_1000050 Ga0055532_100005064 362
225 3300003759 Ga0055525_1000026 Ga0055525_1000026186 362
226 3300003759 Ga0055525_1000087 Ga0055525_100008759 362
227 3300003794 Ga0055531_10000823 Ga0055531_1000082315 362
228 3300003841 Ga0055541_1000001 Ga0055541_1000001948 362
229 3300004625 Ga0055543_1005341 Ga0055543_10053413 362
230 3300005262 Ga0065165_1001911 Ga0065165_10019115 362
231 3300005337 Ga0070682_100031262 Ga0070682_1000312623 362
232 3300005337 Ga0070682_100060240 Ga0070682_1000602403 362
233 3300005614 Ga0068856_100017575 Ga0068856_1000175755 362
234 3300005616 Ga0068852_100018364 Ga0068852_1000183643 362
235 3300006195 Ga0075366_10027449 Ga0075366_100274493 362
236 3300006353 Ga0075370_10011251 Ga0075370_100112514 362
237 3300006353 Ga0075370_10015818 Ga0075370_100158182 362
238 3300009093 Ga0105240_10018846 Ga0105240_100188461 362
239 3300009093 Ga0105240_10020541 Ga0105240_100205412 362
240 3300013102 Ga0157371_10143951 Ga0157371_101439512 362
241 3300015261 Ga0182006_1060176 Ga0182006_10601761 362
242 3300015265 Ga0182005_1000431 Ga0182005_10004316 362
243 3300021361 Ga0213872_10000004 Ga0213872_1000000469 362
244 3300021361 Ga0213872_10000016 Ga0213872_1000001630 362
245 3300021361 Ga0213872_10050593 Ga0213872_100505932 362
246 3300025206 Ga0209435_100029 Ga0209435_100029112 362
247 3300025206 Ga0209435_100531 Ga0209435_1005317 362
248 3300025224 Ga0209784_100004 Ga0209784_100004942 362
249 3300025225 Ga0209566_100004 Ga0209566_1000041099 362
250 3300025226 Ga0209674_100006 Ga0209674_1000061099 362
251 3300025228 Ga0209672_105771 Ga0209672_1057712 362
252 3300025229 Ga0209147_100004 Ga0209147_100004503 362
253 3300025230 Ga0209563_100005 Ga0209563_1000051408 362
254 3300025230 Ga0209563_100009 Ga0209563_100009942 362
255 3300025231 Ga0207427_101216 Ga0207427_1012166 362
256 3300025233 Ga0209437_100004 Ga0209437_100004942 362
257 3300025233 Ga0209437_100053 Ga0209437_10005366 362
258 3300025242 Ga0209258_100463 Ga0209258_10046336 362
259 3300025246 Ga0209646_1000073 Ga0209646_1000073146 362
260 3300025246 Ga0209646_1000109 Ga0209646_100010950 362
261 3300025250 Ga0209026_1000124 Ga0209026_1000124111 362
262 3300025253 Ga0209677_100005 Ga0209677_100005942 362
263 3300025256 Ga0209759_1000108 Ga0209759_100010820 362
264 3300025256 Ga0209759_1000412 Ga0209759_100041225 362
265 3300025261 Ga0209233_1000005 Ga0209233_10000051099 362
266 3300025272 Ga0209455_1002583 Ga0209455_10025836 362
267 3300025304 Ga0209257_1000354 Ga0209257_100035456 362
268 3300025908 Ga0207643_10102057 Ga0207643_101020572 362
269 3300025913 Ga0207695_10005439 Ga0207695_1000543915 362
270 3300025913 Ga0207695_10292937 Ga0207695_102929371 362
271 3300025949 Ga0207667_10037117 Ga0207667_100371173 362
272 3300026142 Ga0207698_10018066 Ga0207698_100180662 362
273 3300028794 Ga0307515_10036876 Ga0307515_100368764 362
274 3300028794 Ga0307515_10174390 Ga0307515_101743902 362
275 3300031239 Ga0265328_10000004 Ga0265328_10000004143 362
276 3300031250 Ga0265331_10060231 Ga0265331_100602312 362
277 3300031251 Ga0265327_10000043 Ga0265327_1000004367 362
278 3300031548 Ga0307408_100000008 Ga0307408_100000008215 362
279 3300032004 Ga0307414_10078226 Ga0307414_100782263 362
280 3300032005 Ga0307411_10002201 Ga0307411_100022013 362
281 3300035091 Ga0373951_0015022 Ga0373951_0015022_394_1506 362
282 3300035114 Ga0373939_0000164 Ga0373939_0000164_2533_3645 362
283 3300035121 Ga0373960_0015650 Ga0373960_0015650_71_1183 362
284 3300035691 Ga0373931_0000346 Ga0373931_0000346_351_1463 362
285 3300037471 Ga0395905_0019259 Ga0395905_0019259_2947_4056 362
286 3300038443 Ga0395901_0034202 Ga0395901_0034202_1734_2903 362
287 3300039447 Ga0436361_0376061 Ga0436361_0376061_36663_37781 362
288 3300039447 Ga0436361_0583521 Ga0436361_0583521_49516_50628 362
289 3300042126 Ga0450888_001438 Ga0450888_001438_779_1888 362
290 3300042127 Ga0450890_004653 Ga0450890_004653_205_1314 362
291 3300042144 Ga0450889_000167 Ga0450889_000167_2179_3288 362
292 3300042532 Ga0450893_0001807 Ga0450893_0001807_177_1286 362
293 3300044712 Ga0453684_0054587 Ga0453684_0054587_3228_4343 362
294 3300045051 Ga0451576_0090482 Ga0451576_0090482_1811_2920 362
295 3300046454 Ga0495592_0022299 Ga0495592_0022299_3059_4234 362
296 3300046516 Ga0495628_0002970 Ga0495628_0002970_820_1995 362
297 3300046539 Ga0495621_0000945 Ga0495621_0000945_1173_2330 362
298 3300046543 Ga0495645_0016673 Ga0495645_0016673_2829_4004 362
299 3300046660 Ga0495625_0006820 Ga0495625_0006820_5435_6616 362
300 3300046678 Ga0495599_0000399 Ga0495599_0000399_3742_4917 362
301 3300046680 Ga0495646_0001572 Ga0495646_0001572_4464_5639 362
302 3300046680 Ga0495646_0069395 Ga0495646_0069395_390_1565 362
303 3300046809 Ga0495600_0000629 Ga0495600_0000629_3058_4233 362
304 3300047317 Ga0495604_0020547 Ga0495604_0020547_3051_4226 362
305 3300048919 Ga0496116_0005336 Ga0496116_0005336_2831_4012 362
306 3300048921 Ga0496118_0155114 Ga0496118_0155114_231_1412 362
307 3300048925 Ga0496122_0000472 Ga0496122_0000472_24956_26137 362
308 3300048926 Ga0496123_0000361 Ga0496123_0000361_65649_66830 362
309 3300048928 Ga0496125_0009461 Ga0496125_0009461_8327_9508 362
310 3300049687 Ga0501258_001545 Ga0501258_001545_444_1553 362
311 3300049759 Ga0501262_003280 Ga0501262_003280_680_1789 362
312 3300053141 Ga0500574_000611 Ga0500574_000611_1632_2807 362
313 3300053154 Ga0500619_001041 Ga0500619_001041_1576_2751 362
314 3300053156 Ga0500622_0003109 Ga0500622_0003109_8144_9343 362
315 iso_pu_bacteria 2886848708 2886849617 362
316 3300003347 JGI26128J50194_1000545 JGI26128J50194_10005452 363
317 3300003771 Ga0055526_1003759 Ga0055526_10037593 363
318 3300005459 Ga0068867_100171657 Ga0068867_1001716571 363
319 3300006195 Ga0075366_10014706 Ga0075366_100147063 363
320 3300006353 Ga0075370_10001496 Ga0075370_100014966 363
321 3300009036 Ga0105244_10072715 Ga0105244_100727152 363
322 3300009176 Ga0105242_10000970 Ga0105242_1000097015 363
323 3300012497 Ga0157319_1000009 Ga0157319_1000009131 363
324 3300025273 Ga0209673_1003649 Ga0209673_10036495 363
325 3300025295 Ga0209564_1000003 Ga0209564_1000003503 363
326 3300025299 Ga0209256_1003497 Ga0209256_10034979 363
327 3300025932 Ga0207690_10153749 Ga0207690_101537492 363
328 3300025934 Ga0207686_10000809 Ga0207686_100008095 363
329 3300026089 Ga0207648_10196930 Ga0207648_101969302 363
330 3300027312 Ga0209371_1007787 Ga0209371_10077873 363
331 3300027526 Ga0209968_1001087 Ga0209968_10010873 363
332 3300027695 Ga0209966_1000004 Ga0209966_100000474 363
333 3300030500 Ga0268256_1008034 Ga0268256_10080343 363
334 3300031251 Ga0265327_10025250 Ga0265327_100252503 363
335 3300037312 Ga0395899_0001829 Ga0395899_0001829_3161_4330 363
336 3300037312 Ga0395899_0002722 Ga0395899_0002722_10995_12164 363
337 3300037418 Ga0395900_0071579 Ga0395900_0071579_1868_3037 363
338 3300037466 Ga0395898_0056071 Ga0395898_0056071_1525_2694 363
339 3300039062 Ga0400483_219566 Ga0400483_219566_413_1531 363
340 3300042012 Ga0439455_0001605 Ga0439455_0001605_1960_3102 363
341 3300044673 Ga0453683_0016829 Ga0453683_0016829_169_1272 363
342 3300046542 Ga0495597_0000507 Ga0495597_0000507_20105_21226 363
343 3300046558 Ga0495633_0000797 Ga0495633_0000797_15207_16328 363
344 3300048928 Ga0496125_0161292 Ga0496125_0161292_206_1327 363
345 3300049130 Ga0501310_000578 Ga0501310_000578_1480_2667 363
346 3300049518 Ga0501295_002376 Ga0501295_002376_394_1512 363
347 3300049523 Ga0501300_000967 Ga0501300_000967_1145_2332 363
348 3300049663 Ga0501223_003895 Ga0501223_003895_178_1299 363
349 3300049706 Ga0501229_000963 Ga0501229_000963_1996_3183 363
350 3300049763 Ga0501266_000061 Ga0501266_000061_15007_16128 363
351 3300049776 Ga0501280_000779 Ga0501280_000779_3660_4769 363
352 3300049778 Ga0501282_003594 Ga0501282_003594_110_1219 363
353 3300050491 nmdc:mga00v17_59130_c1 nmdc:mga00v17_59130_c1_11_1156 363
354 3300050493 nmdc:mga0k408_15735_c1 nmdc:mga0k408_15735_c1_1659_2843 363
355 3300050496 nmdc:mga07m45_21169_c1 nmdc:mga07m45_21169_c1_2280_3413 363
356 3300050496 nmdc:mga07m45_23333_c1 nmdc:mga07m45_23333_c1_639_1832 363
357 iso_pu_bacteria 2831864461 2831866345 363
358 iso_pu_bacteria 2842733646 2842735956 363
359 iso_pu_bacteria 2842747753 2842748346 363
360 iso_pu_bacteria 2885192300 2885197469 363
361 3300003761 Ga0055535_1000881 Ga0055535_100088119 364
362 3300003763 Ga0055529_1000175 Ga0055529_100017526 364
363 3300006195 Ga0075366_10046494 Ga0075366_100464942 364
364 3300014968 Ga0157379_10030186 Ga0157379_100301862 364
365 3300021361 Ga0213872_10000003 Ga0213872_1000000369 364
366 3300021361 Ga0213872_10000199 Ga0213872_100001993 364
367 3300025242 Ga0209258_100060 Ga0209258_100060191 364
368 3300025256 Ga0209759_1001792 Ga0209759_100179210 364
369 3300025272 Ga0209455_1000093 Ga0209455_100009347 364
370 3300031251 Ga0265327_10000184 Ga0265327_100001847 364
371 3300031507 Ga0307509_10022521 Ga0307509_100225214 364
372 3300031548 Ga0307408_100000513 Ga0307408_10000051315 364
373 3300031649 Ga0307514_10001461 Ga0307514_100014615 364
374 3300031730 Ga0307516_10000254 Ga0307516_100002546 364
375 3300031901 Ga0307406_10000279 Ga0307406_1000027917 364
376 3300037471 Ga0395905_0000373 Ga0395905_0000373_28681_29823 364
377 3300039447 Ga0436361_0136744 Ga0436361_0136744_2888_4012 364
378 3300039447 Ga0436361_0681193 Ga0436361_0681193_14782_15906 364
379 3300041413 Ga0439465_0022298 Ga0439465_0022298_143_1291 364
380 3300041997 Ga0439431_0006327 Ga0439431_0006327_1328_2476 364
381 3300042008 Ga0439450_010822 Ga0439450_010822_218_1381 364
382 3300044712 Ga0453684_0146319 Ga0453684_0146319_1448_2605 364
383 3300047472 Ga0495686_0071230 Ga0495686_0071230_734_1909 364
384 3300048912 Ga0496109_0038419 Ga0496109_0038419_2904_4046 364
385 3300053154 Ga0500619_000015 Ga0500619_000015_41040_42197 364
386 3300059421 Ga0590071_005391 Ga0590071_005391_1372_2505 364
387 iso_pu_bacteria 2511231002 2511245735 364
388 iso_pu_bacteria 2643221611 2644075575 364
389 iso_pu_bacteria 2816332133 2816476184 364
390 iso_pu_bacteria 2881101125 2881102209 364
391 iso_pu_bacteria 2919704043 2919704845 364
392 iso_pu_bacteria 2945984333 2945986414 364
393 3300003187 JGI25151J46595_10005733 JGI25151J46595_100057335 365
394 3300005347 Ga0070668_100153912 Ga0070668_1001539122 365
395 3300005459 Ga0068867_100121514 Ga0068867_1001215142 365
396 3300005539 Ga0068853_100281253 Ga0068853_1002812532 365
397 3300005719 Ga0068861_100000343 Ga0068861_10000034314 365
398 3300005844 Ga0068862_100051442 Ga0068862_1000514423 365
399 3300006048 Ga0075363_100049093 Ga0075363_1000490933 365
400 3300006051 Ga0075364_10096949 Ga0075364_100969493 365
401 3300006195 Ga0075366_10044456 Ga0075366_100444563 365
402 3300006353 Ga0075370_10096614 Ga0075370_100966141 365
403 3300009177 Ga0105248_10051958 Ga0105248_100519584 365
404 3300009545 Ga0105237_10000367 Ga0105237_1000036762 365
405 3300010375 Ga0105239_10000150 Ga0105239_1000015076 365
406 3300013297 Ga0157378_10041290 Ga0157378_100412903 365
407 3300013306 Ga0163162_10003353 Ga0163162_100033534 365
408 3300014326 Ga0157380_10083953 Ga0157380_100839533 365
409 3300025258 Ga0209129_1007373 Ga0209129_10073734 365
410 3300025292 Ga0209676_1002870 Ga0209676_10028704 365
411 3300025294 Ga0209025_1003371 Ga0209025_100337114 365
412 3300025295 Ga0209564_1005307 Ga0209564_10053075 365
413 3300025298 Ga0209050_1005811 Ga0209050_10058113 365
414 3300025304 Ga0209257_1004776 Ga0209257_10047764 365
415 3300025914 Ga0207671_10000808 Ga0207671_1000080819 365
416 3300025949 Ga0207667_10284418 Ga0207667_102844182 365
417 3300025972 Ga0207668_10139821 Ga0207668_101398212 365
418 3300026041 Ga0207639_10205305 Ga0207639_102053052 365
419 3300026118 Ga0207675_100001246 Ga0207675_1000012465 365
420 3300026121 Ga0207683_10026909 Ga0207683_100269092 365
421 3300028380 Ga0268265_10040740 Ga0268265_100407404 365
422 3300028381 Ga0268264_10096750 Ga0268264_100967503 365
423 3300028666 Ga0265336_10000062 Ga0265336_1000006252 365
424 3300037418 Ga0395900_0019397 Ga0395900_0019397_5232_6347 365
425 3300037466 Ga0395898_0193475 Ga0395898_0193475_553_1668 365
426 3300038443 Ga0395901_0271617 Ga0395901_0271617_56_1171 365
427 3300039447 Ga0436361_1205067 Ga0436361_1205067_471_1598 365
428 3300042876 Ga0451577_0000457 Ga0451577_0000457_66855_67982 365
429 3300042876 Ga0451577_0015192 Ga0451577_0015192_5313_6479 365
430 3300044656 Ga0466969_0000002 Ga0466969_0000002_154769_155929 365
431 3300044683 Ga0466965_0030808 Ga0466965_0030808_603_1766 365
432 3300044684 Ga0466966_0009856 Ga0466966_0009856_318_1478 365
433 3300044712 Ga0453684_0000005 Ga0453684_0000005_8469_9596 365
434 3300044712 Ga0453684_0011680 Ga0453684_0011680_5795_6922 365
435 3300044712 Ga0453684_0150699 Ga0453684_0150699_827_1993 365
436 3300044765 Ga0466970_0085316 Ga0466970_0085316_525_1685 365
437 3300045051 Ga0451576_0001449 Ga0451576_0001449_30728_31855 365
438 3300046471 Ga0495650_0009337 Ga0495650_0009337_1442_2608 365
439 3300046512 Ga0495610_0044864 Ga0495610_0044864_1020_2171 365
440 3300047443 Ga0495687_001142 Ga0495687_001142_22251_23402 365
441 3300049581 Ga0501047_0066255 Ga0501047_0066255_1764_2909 365
442 3300049823 Ga0501044_0000379 Ga0501044_0000379_38305_39450 365
443 3300050489 nmdc:mga03683_1137_c1 nmdc:mga03683_1137_c1_1021_2175 365
444 3300050491 nmdc:mga00v17_31656_c1 nmdc:mga00v17_31656_c1_958_2112 365
445 3300050492 nmdc:mga0yw44_4617_c1 nmdc:mga0yw44_4617_c1_4180_5334 365
446 3300050493 nmdc:mga0k408_21431_c2 nmdc:mga0k408_21431_c2_505_1659 365
447 3300050493 nmdc:mga0k408_8464_c1 nmdc:mga0k408_8464_c1_3817_4971 365
448 3300050494 nmdc:mga06z11_28742_c1 nmdc:mga06z11_28742_c1_985_2139 365
449 3300050495 nmdc:mga04h51_11267_c1 nmdc:mga04h51_11267_c1_1304_2458 365
450 3300050496 nmdc:mga07m45_12754_c1 nmdc:mga07m45_12754_c1_3158_4312 365
451 iso_pu_bacteria 8002392321 8002394724 365
452 3300002705 JGI25156J39149_1000581 JGI25156J39149_100058119 366
453 3300002738 JGI25154J39366_1001307 JGI25154J39366_10013073 366
454 3300002741 JGI25157J39369_1000163 JGI25157J39369_100016336 366
455 3300003322 rootL2_10000199 rootL2_1000019914 366
456 3300003323 rootH1_10066204 rootH1_100662041 366
457 3300003752 Ga0055539_1003113 Ga0055539_10031133 366
458 3300003756 Ga0055533_1000006 Ga0055533_100000663 366
459 3300004625 Ga0055543_1002844 Ga0055543_10028444 366
460 3300005262 Ga0065165_1000006 Ga0065165_1000006275 366
461 3300005327 Ga0070658_10166852 Ga0070658_101668522 366
462 3300005366 Ga0070659_100064529 Ga0070659_1000645293 366
463 3300005367 Ga0070667_100281596 Ga0070667_1002815962 366
464 3300005456 Ga0070678_100022537 Ga0070678_1000225373 366
465 3300005466 Ga0070685_10178037 Ga0070685_101780371 366
466 3300005539 Ga0068853_100208762 Ga0068853_1002087622 366
467 3300005548 Ga0070665_100011739 Ga0070665_1000117399 366
468 3300005563 Ga0068855_100011038 Ga0068855_1000110388 366
469 3300005577 Ga0068857_100031841 Ga0068857_1000318414 366
470 3300005614 Ga0068856_100001213 Ga0068856_1000012132 366
471 3300005616 Ga0068852_100231748 Ga0068852_1002317482 366
472 3300005617 Ga0068859_100030477 Ga0068859_1000304773 366
473 3300005841 Ga0068863_100016536 Ga0068863_1000165364 366
474 3300005843 Ga0068860_100039691 Ga0068860_1000396915 366
475 3300006177 Ga0075362_10033589 Ga0075362_100335892 366
476 3300006186 Ga0075369_10101287 Ga0075369_101012871 366
477 3300006195 Ga0075366_10008662 Ga0075366_100086623 366
478 3300006353 Ga0075370_10000245 Ga0075370_1000024515 366
479 3300006353 Ga0075370_10001414 Ga0075370_100014142 366
480 3300006353 Ga0075370_10009707 Ga0075370_100097073 366
481 3300006931 Ga0097620_100030476 Ga0097620_1000304764 366
482 3300006944 Ga0099823_1003573 Ga0099823_10035734 366
483 3300009093 Ga0105240_10058094 Ga0105240_100580943 366
484 3300009098 Ga0105245_10206027 Ga0105245_102060272 366
485 3300009545 Ga0105237_10091314 Ga0105237_100913143 366
486 3300010375 Ga0105239_10126300 Ga0105239_101263002 366
487 3300013297 Ga0157378_10052732 Ga0157378_100527324 366
488 3300013297 Ga0157378_10059389 Ga0157378_100593893 366
489 3300025226 Ga0209674_100003 Ga0209674_1000031273 366
490 3300025230 Ga0209563_100010 Ga0209563_1000101001 366
491 3300025242 Ga0209258_100482 Ga0209258_10048214 366
492 3300025246 Ga0209646_1000242 Ga0209646_100024235 366
493 3300025250 Ga0209026_1000311 Ga0209026_100031135 366
494 3300025253 Ga0209677_100274 Ga0209677_1002743 366
495 3300025253 Ga0209677_100396 Ga0209677_1003963 366
496 3300025253 Ga0209677_103662 Ga0209677_1036624 366
497 3300025256 Ga0209759_1000373 Ga0209759_10003737 366
498 3300025256 Ga0209759_1001241 Ga0209759_10012413 366
499 3300025303 Ga0209051_1001878 Ga0209051_100187813 366
500 3300025303 Ga0209051_1005038 Ga0209051_10050383 366
501 3300025303 Ga0209051_1053509 Ga0209051_10535092 366
502 3300025304 Ga0209257_1001690 Ga0209257_100169012 366
503 3300025909 Ga0207705_10112464 Ga0207705_101124642 366
504 3300025913 Ga0207695_10036213 Ga0207695_100362134 366
505 3300025919 Ga0207657_10044157 Ga0207657_100441572 366
506 3300025927 Ga0207687_10070281 Ga0207687_100702813 366
507 3300025927 Ga0207687_10274339 Ga0207687_102743391 366
508 3300025933 Ga0207706_10034951 Ga0207706_100349514 366
509 3300025937 Ga0207669_10094735 Ga0207669_100947352 366
510 3300025942 Ga0207689_10069464 Ga0207689_100694643 366
511 3300025949 Ga0207667_10072367 Ga0207667_100723672 366
512 3300025981 Ga0207640_10018472 Ga0207640_100184724 366
513 3300026078 Ga0207702_10002147 Ga0207702_100021474 366
514 3300026088 Ga0207641_10036723 Ga0207641_100367234 366
515 3300026116 Ga0207674_10014389 Ga0207674_100143893 366
516 3300026142 Ga0207698_10074454 Ga0207698_100744541 366
517 3300027296 Ga0209389_1009757 Ga0209389_10097575 366
518 3300028381 Ga0268264_10039604 Ga0268264_100396043 366
519 3300028794 Ga0307515_10015490 Ga0307515_1001549012 366
520 3300031730 Ga0307516_10006776 Ga0307516_100067769 366
521 3300031911 Ga0307412_10021521 Ga0307412_100215213 366
522 3300037312 Ga0395899_0190098 Ga0395899_0190098_86_1240 366
523 3300037466 Ga0395898_0002535 Ga0395898_0002535_18077_19342 366
524 3300037466 Ga0395898_0173483 Ga0395898_0173483_818_1972 366
525 3300037471 Ga0395905_0001392 Ga0395905_0001392_21913_23052 366
526 3300037471 Ga0395905_0019945 Ga0395905_0019945_4802_5971 366
527 3300037471 Ga0395905_0044762 Ga0395905_0044762_197_1387 366
528 3300037471 Ga0395905_0051956 Ga0395905_0051956_547_1698 366
529 3300041404 Ga0439436_0002999 Ga0439436_0002999_1907_3046 366
530 3300042002 Ga0439442_009072 Ga0439442_009072_566_1705 366
531 3300042007 Ga0439449_0000770 Ga0439449_0000770_8467_9606 366
532 3300042015 Ga0439462_0002409 Ga0439462_0002409_1875_3014 366
533 3300042125 Ga0450923_010893 Ga0450923_010893_42_1181 366
534 3300042184 Ga0450908_005451 Ga0450908_005451_505_1644 366
535 3300042876 Ga0451577_0005822 Ga0451577_0005822_10877_12028 366
536 3300042876 Ga0451577_0054386 Ga0451577_0054386_1879_2988 366
537 3300044656 Ga0466969_0009674 Ga0466969_0009674_2498_3652 366
538 3300044683 Ga0466965_0014917 Ga0466965_0014917_1552_2706 366
539 3300044684 Ga0466966_0014323 Ga0466966_0014323_2310_3464 366
540 3300044693 Ga0466961_0008940 Ga0466961_0008940_1024_2178 366
541 3300044694 Ga0466963_0066792 Ga0466963_0066792_320_1504 366
542 3300044706 Ga0466964_0009532 Ga0466964_0009532_359_1513 366
543 3300044712 Ga0453684_0342818 Ga0453684_0342818_172_1323 366
544 3300044719 Ga0466971_0032905 Ga0466971_0032905_368_1522 366
545 3300044842 Ga0466957_0015722 Ga0466957_0015722_3180_4334 366
546 3300045049 Ga0466959_0004663 Ga0466959_0004663_1244_2398 366
547 3300046475 Ga0495639_0002696 Ga0495639_0002696_4916_6079 366
548 3300046492 Ga0495585_0044172 Ga0495585_0044172_404_1567 366
549 3300046506 Ga0495583_0000153 Ga0495583_0000153_27742_28896 366
550 3300046507 Ga0495606_0002667 Ga0495606_0002667_18587_19741 366
551 3300046660 Ga0495625_0012120 Ga0495625_0012120_4154_5317 366
552 3300046694 Ga0495649_0001263 Ga0495649_0001263_14486_15640 366
553 3300046794 Ga0495589_0023095 Ga0495589_0023095_601_1755 366
554 3300047318 Ga0495636_0022513 Ga0495636_0022513_775_1920 366
555 3300048907 Ga0496104_0261480 Ga0496104_0261480_85_1242 366
556 3300048927 Ga0496124_0045923 Ga0496124_0045923_2512_3702 366
557 3300049568 Ga0501031_0138779 Ga0501031_0138779_31_1182 366
558 3300049579 Ga0501043_0070134 Ga0501043_0070134_561_1712 366
559 3300049580 Ga0501046_0029614 Ga0501046_0029614_2857_4008 366
560 3300050493 nmdc:mga0k408_84428_c1 nmdc:mga0k408_84428_c1_116_1279 366
561 3300050496 nmdc:mga07m45_19387_c1 nmdc:mga07m45_19387_c1_122_1273 366
562 3300050496 nmdc:mga07m45_831_c1 nmdc:mga07m45_831_c1_9796_10935 366
563 3300050516 nmdc:mga0sz30_20039_c1 nmdc:mga0sz30_20039_c1_54_1217 366
564 3300053080 Ga0500635_0000033 Ga0500635_0000033_2591_3754 366
565 3300059477 Ga0587084_002643 Ga0587084_002643_374_1543 366
566 3300059491 Ga0587070_007438 Ga0587070_007438_239_1408 366
567 3300059493 Ga0587077_008527 Ga0587077_008527_244_1413 366
568 3300059510 Ga0587090_003114 Ga0587090_003114_469_1638 366
569 3300060346 Ga0587111_0007265 Ga0587111_0007265_343_1512 366
570 iso_pu_bacteria 8055225921 8055227047 366
571 3300005364 Ga0070673_100115192 Ga0070673_1001151922 367
572 3300005543 Ga0070672_100123127 Ga0070672_1001231273 367
573 3300006177 Ga0075362_10003993 Ga0075362_100039933 367
574 3300013307 Ga0157372_10129142 Ga0157372_101291423 367
575 3300014497 Ga0182008_10039546 Ga0182008_100395461 367
576 3300014968 Ga0157379_10023602 Ga0157379_100236022 367
577 3300015262 Ga0182007_10001215 Ga0182007_1000121513 367
578 3300015265 Ga0182005_1008518 Ga0182005_10085183 367
579 3300015683 Ga0183362_10001 Ga0183362_10001856 367
580 3300021361 Ga0213872_10004172 Ga0213872_100041722 367
581 3300025256 Ga0209759_1006296 Ga0209759_10062963 367
582 3300025940 Ga0207691_10017166 Ga0207691_100171664 367
583 3300025960 Ga0207651_10124579 Ga0207651_101245792 367
584 3300025986 Ga0207658_10009255 Ga0207658_100092556 367
585 3300026121 Ga0207683_10113081 Ga0207683_101130812 367
586 3300026121 Ga0207683_10142555 Ga0207683_101425553 367
587 3300027543 Ga0209999_1013436 Ga0209999_10134362 367
588 3300028794 Ga0307515_10000208 Ga0307515_1000020825 367
589 3300031251 Ga0265327_10000956 Ga0265327_1000095614 367
590 3300031251 Ga0265327_10050447 Ga0265327_100504472 367
591 3300031456 Ga0307513_10089327 Ga0307513_100893273 367
592 3300031731 Ga0307405_10048866 Ga0307405_100488663 367
593 3300032002 Ga0307416_100162230 Ga0307416_1001622302 367
594 3300037312 Ga0395899_0002713 Ga0395899_0002713_12302_13450 367
595 3300037418 Ga0395900_0000188 Ga0395900_0000188_67454_68719 367
596 3300037418 Ga0395900_0047771 Ga0395900_0047771_1319_2467 367
597 3300037418 Ga0395900_0061956 Ga0395900_0061956_150_1298 367
598 3300037466 Ga0395898_0075075 Ga0395898_0075075_1968_3116 367
599 3300037466 Ga0395898_0130013 Ga0395898_0130013_102_1253 367
600 3300037471 Ga0395905_0002964 Ga0395905_0002964_8803_9972 367
601 3300037471 Ga0395905_0022852 Ga0395905_0022852_1001_2152 367
602 3300037471 Ga0395905_0082668 Ga0395905_0082668_995_2188 367
603 3300038443 Ga0395901_0041955 Ga0395901_0041955_1255_2403 367
604 3300038443 Ga0395901_0136007 Ga0395901_0136007_1124_2275 367
605 3300039447 Ga0436361_0089504 Ga0436361_0089504_2727_3884 367
606 3300041404 Ga0439436_0000600 Ga0439436_0000600_4391_5539 367
607 3300041413 Ga0439465_0001850 Ga0439465_0001850_597_1745 367
608 3300041997 Ga0439431_0001330 Ga0439431_0001330_1643_2791 367
609 3300041999 Ga0439433_0000095 Ga0439433_0000095_11081_12229 367
610 3300042004 Ga0439445_0002081 Ga0439445_0002081_1334_2482 367
611 3300042006 Ga0439432_001088 Ga0439432_001088_4950_6098 367
612 3300042007 Ga0439449_0000064 Ga0439449_0000064_9343_10491 367
613 3300042007 Ga0439449_0009218 Ga0439449_0009218_1091_2239 367
614 3300042010 Ga0439452_002075 Ga0439452_002075_2705_3853 367
615 3300042133 Ga0450896_003283 Ga0450896_003283_146_1294 367
616 3300044683 Ga0466965_0024321 Ga0466965_0024321_218_1363 367
617 3300044683 Ga0466965_0112273 Ga0466965_0112273_85_1254 367
618 3300044719 Ga0466971_0005732 Ga0466971_0005732_2775_3944 367
619 3300045051 Ga0451576_0009855 Ga0451576_0009855_1457_2590 367
620 3300046522 Ga0495643_0017990 Ga0495643_0017990_161_1330 367
621 3300046528 Ga0495642_0029751 Ga0495642_0029751_993_2162 367
622 3300046536 Ga0495587_0153173 Ga0495587_0153173_25_1173 367
623 3300046615 Ga0495656_0000076 Ga0495656_0000076_13324_14472 367
624 3300046665 Ga0495661_0006604 Ga0495661_0006604_2755_3924 367
625 3300048903 Ga0496100_0011298 Ga0496100_0011298_1352_2500 367
626 3300048904 Ga0496101_0021767 Ga0496101_0021767_2290_3438 367
627 3300048905 Ga0496102_0086355 Ga0496102_0086355_486_1634 367
628 3300048908 Ga0496105_0001580 Ga0496105_0001580_4202_5350 367
629 3300048909 Ga0496106_0047710 Ga0496106_0047710_277_1425 367
630 3300048913 Ga0496110_0035522 Ga0496110_0035522_2066_3214 367
631 3300048917 Ga0496114_0055953 Ga0496114_0055953_1012_2160 367
632 3300048925 Ga0496122_0000103 Ga0496122_0000103_143540_144676 367
633 3300048926 Ga0496123_0000261 Ga0496123_0000261_51576_52712 367
634 3300050493 nmdc:mga0k408_129286_c1 nmdc:mga0k408_129286_c1_37_1185 367
635 3300053090 Ga0500646_0004453 Ga0500646_0004453_128_1291 367
636 3300053136 Ga0500559_0004514 Ga0500559_0004514_4543_5679 367
637 3300053151 Ga0500604_0004883 Ga0500604_0004883_255_1418 367
638 3300053156 Ga0500622_0000001 Ga0500622_0000001_153749_154882 367
639 iso_pu_bacteria 2513020051 2513226675 367
640 iso_pu_bacteria 2585428057 2587727680 367
641 iso_pu_bacteria 2585428058 2587733055 367
642 iso_pu_bacteria 2585428062 2587755175 367
643 iso_pu_bacteria 2588253510 2588291353 367
644 iso_pu_bacteria 2599185214 2599625004 367
645 iso_pu_bacteria 2599185226 2599673016 367
646 iso_pu_bacteria 2599185227 2599682534 367
647 iso_pu_bacteria 2599185229 2599694624 367
648 iso_pu_bacteria 2643221556 2643802032 367
649 iso_pu_bacteria 2643221592 2643969500 367
650 iso_pu_bacteria 2643221603 2644028881 367
651 iso_pu_bacteria 2643221625 2644143800 367
652 iso_pu_bacteria 2643221628 2644159385 367
653 iso_pu_bacteria 2643221648 2644276494 367
654 iso_pu_bacteria 2643221658 2644329311 367
655 iso_pu_bacteria 2643221672 2644401184 367
656 iso_pu_bacteria 2643221683 2644467934 367
657 iso_pu_bacteria 2643221684 2644473818 367
658 iso_pu_bacteria 2738541277 2738717446 367
659 iso_pu_bacteria 2738541307 2738879051 367
660 iso_pu_bacteria 2738543013 2739248845 367
661 iso_pu_bacteria 2738543019 2739278132 367
662 iso_pu_bacteria 2739367655 2739613000 367
663 iso_pu_bacteria 2808606418 2809145125 367
664 iso_pu_bacteria 2818991436 2819544962 367
665 iso_pu_bacteria 2818991446 2819596959 367
666 iso_pu_bacteria 2831265667 2831266041 367
667 iso_pu_bacteria 2838054893 2838057830 367
668 iso_pu_bacteria 2842677519 2842679098 367
669 iso_pu_bacteria 2857542790 2857545405 367
670 iso_pu_bacteria 2881927736 2881930902 367
671 iso_pu_bacteria 2885198086 2885203700 367
672 iso_pu_bacteria 2885211737 2885216950 367
673 iso_pu_bacteria 2887375801 2887378569 367
674 iso_pu_bacteria 2899924645 2899930299 367
675 iso_pu_bacteria 2904449895 2904456226 367
676 iso_pu_bacteria 2904456579 2904457582 367
677 iso_pu_bacteria 2904541872 2904543664 367
678 iso_pu_bacteria 2919462493 2919466938 367
679 iso_pu_bacteria 2928037797 2928039412 367
680 iso_pu_bacteria 2928044640 2928044983 367
681 iso_pu_bacteria 2928051484 2928052784 367
682 iso_pu_bacteria 2928064002 2928064543 367
683 iso_pu_bacteria 2928070936 2928075041 367
684 iso_pu_bacteria 2928084124 2928088220 367
685 iso_pu_bacteria 2929160207 2929162785 367
686 iso_pu_bacteria 2929520902 2929527373 367
687 iso_pu_bacteria 2945909444 2945911298 367
688 iso_pu_bacteria 2945945610 2945947310 367
689 iso_pu_bacteria 2945972063 2945977669 367
690 iso_pu_bacteria 2954767861 2954772650 367
691 iso_pu_bacteria 8047673197 8047674105 367
692 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002250 368
693 3300002705 JGI25156J39149_1000003 JGI25156J39149_100000356 368
694 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009250 368
695 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002250 368
696 3300002987 JGI25159J45721_1005712 JGI25159J45721_10057123 368
697 3300002987 JGI25159J45721_1009490 JGI25159J45721_10094901 368
698 3300002987 JGI25159J45721_1012145 JGI25159J45721_10121451 368
699 3300003354 JGI25160J50197_1000257 JGI25160J50197_100025714 368
700 3300003374 JGI25161J50226_1000018 JGI25161J50226_100001852 368
701 3300003771 Ga0055526_1011228 Ga0055526_10112284 368
702 3300003771 Ga0055526_1019259 Ga0055526_10192592 368
703 3300003773 Ga0055537_1000008 Ga0055537_100000872 368
704 3300003775 Ga0055524_1000083 Ga0055524_100008314 368
705 3300003781 Ga0055536_1011405 Ga0055536_10114052 368
706 3300003784 Ga0055534_1000742 Ga0055534_10007423 368
707 3300003791 Ga0055530_10000211 Ga0055530_100002115 368
708 3300003792 Ga0055540_1000012 Ga0055540_100001214 368
709 3300003794 Ga0055531_10000481 Ga0055531_1000048130 368
710 3300004625 Ga0055543_1000993 Ga0055543_100099310 368
711 3300005328 Ga0070676_10065730 Ga0070676_100657301 368
712 3300005355 Ga0070671_100020806 Ga0070671_1000208063 368
713 3300006051 Ga0075364_10021230 Ga0075364_100212304 368
714 3300006058 Ga0075432_10000339 Ga0075432_1000033910 368
715 3300006058 Ga0075432_10023832 Ga0075432_100238322 368
716 3300006177 Ga0075362_10028935 Ga0075362_100289353 368
717 3300006195 Ga0075366_10047353 Ga0075366_100473533 368
718 3300025206 Ga0209435_100001 Ga0209435_100001467 368
719 3300025208 Ga0209436_107658 Ga0209436_1076582 368
720 3300025245 Ga0207425_1003163 Ga0207425_10031634 368
721 3300025245 Ga0207425_1003233 Ga0207425_10032333 368
722 3300025246 Ga0209646_1000001 Ga0209646_1000001836 368
723 3300025250 Ga0209026_1000003 Ga0209026_1000003467 368
724 3300025256 Ga0209759_1000001 Ga0209759_1000001467 368
725 3300025258 Ga0209129_1013173 Ga0209129_10131732 368
726 3300025263 Ga0209565_1000004 Ga0209565_1000004740 368
727 3300025263 Ga0209565_1000606 Ga0209565_100060615 368
728 3300025273 Ga0209673_1000074 Ga0209673_100007442 368
729 3300025284 Ga0209130_1000050 Ga0209130_100005052 368
730 3300025284 Ga0209130_1002121 Ga0209130_10021213 368
731 3300025291 Ga0209675_1000044 Ga0209675_1000044163 368
732 3300025291 Ga0209675_1001581 Ga0209675_10015819 368
733 3300025292 Ga0209676_1000029 Ga0209676_1000029162 368
734 3300025294 Ga0209025_1002339 Ga0209025_100233911 368
735 3300025294 Ga0209025_1007741 Ga0209025_10077413 368
736 3300025295 Ga0209564_1000470 Ga0209564_100047058 368
737 3300025295 Ga0209564_1001907 Ga0209564_100190713 368
738 3300025297 Ga0209758_1012598 Ga0209758_10125984 368
739 3300025298 Ga0209050_1000003 Ga0209050_1000003224 368
740 3300025299 Ga0209256_1000001 Ga0209256_1000001227 368
741 3300025302 Ga0207426_1000071 Ga0207426_1000071204 368
742 3300025302 Ga0207426_1000692 Ga0207426_100069227 368
743 3300025303 Ga0209051_1000003 Ga0209051_1000003224 368
744 3300025304 Ga0209257_1000018 Ga0209257_1000018224 368
745 3300025907 Ga0207645_10006398 Ga0207645_100063982 368
746 3300025920 Ga0207649_10116089 Ga0207649_101160892 368
747 3300025922 Ga0207646_10351787 Ga0207646_103517871 368
748 3300026078 Ga0207702_10094379 Ga0207702_100943792 368
749 3300031456 Ga0307513_10000014 Ga0307513_10000014135 368
750 3300031456 Ga0307513_10000019 Ga0307513_10000019190 368
751 3300031548 Ga0307408_100034061 Ga0307408_1000340612 368
752 3300031730 Ga0307516_10004780 Ga0307516_1000478015 368
753 3300031901 Ga0307406_10010426 Ga0307406_100104263 368
754 3300031901 Ga0307406_10042774 Ga0307406_100427743 368
755 3300031995 Ga0307409_100125018 Ga0307409_1001250182 368
756 3300032126 Ga0307415_100028737 Ga0307415_1000287372 368
757 3300044656 Ga0466969_0011332 Ga0466969_0011332_2736_4004 368
758 3300044658 Ga0466972_0010214 Ga0466972_0010214_2036_3208 368
759 3300044683 Ga0466965_0017774 Ga0466965_0017774_1164_2336 368
760 3300044683 Ga0466965_0076770 Ga0466965_0076770_121_1389 368
761 3300044684 Ga0466966_0048125 Ga0466966_0048125_122_1390 368
762 3300044693 Ga0466961_0030032 Ga0466961_0030032_2129_3397 368
763 3300044694 Ga0466963_0095559 Ga0466963_0095559_430_1698 368
764 3300044706 Ga0466964_0004825 Ga0466964_0004825_1125_2393 368
765 3300044765 Ga0466970_0017427 Ga0466970_0017427_2226_3494 368
766 3300045049 Ga0466959_0001562 Ga0466959_0001562_8103_9371 368
767 3300045976 Ga0466967_0132584 Ga0466967_0132584_284_1552 368
768 3300049823 Ga0501044_0000070 Ga0501044_0000070_54057_55286 368
769 3300050491 nmdc:mga00v17_30066_c1 nmdc:mga00v17_30066_c1_660_1808 368
770 3300050493 nmdc:mga0k408_28418_c1 nmdc:mga0k408_28418_c1_659_1807 368
771 3300050496 nmdc:mga07m45_182_c1 nmdc:mga07m45_182_c1_2900_4078 368
772 3300050496 nmdc:mga07m45_35932_c1 nmdc:mga07m45_35932_c1_1105_2253 368
773 3300053088 Ga0500644_0001013 Ga0500644_0001013_4848_5996 368
774 3300053093 Ga0500651_0027361 Ga0500651_0027361_869_2014 368
775 3300053098 Ga0500650_0021345 Ga0500650_0021345_693_1841 368
776 3300053117 Ga0500593_000815 Ga0500593_000815_3852_5000 368
777 3300053117 Ga0500593_007672 Ga0500593_007672_729_1880 368
778 3300053730 Ga0500645_002026 Ga0500645_002026_173_1321 368
779 3300053730 Ga0500645_002056 Ga0500645_002056_173_1321 368
780 3300059605 Ga0587106_002524 Ga0587106_002524_70_1212 368
781 iso_pu_bacteria 2511231003 2511248486 368
782 iso_pu_bacteria 2511231026 2511386751 368
783 iso_pu_bacteria 2521172590 2521558835 368
784 iso_pu_bacteria 2548876994 2550695498 368
785 iso_pu_bacteria 2551306416 2553003632 368
786 iso_pu_bacteria 2643221554 2643787334 368
787 iso_pu_bacteria 2643221638 2644214150 368
788 iso_pu_bacteria 2643221644 2644243139 368
789 iso_pu_bacteria 2643221645 2644252370 368
790 iso_pu_bacteria 2643221664 2644357139 368
791 iso_pu_bacteria 2738541280 2738741602 368
792 iso_pu_bacteria 2738541297 2738829558 368
793 iso_pu_bacteria 2738541300 2738843782 368
794 iso_pu_bacteria 2738541357 2739153354 368
795 iso_pu_bacteria 2738543003 2739195274 368
796 iso_pu_bacteria 2738543018 2739275137 368
797 iso_pu_bacteria 2738543026 2739321750 368
798 iso_pu_bacteria 2738543029 2739339694 368
799 iso_pu_bacteria 2738543030 2739344181 368
800 iso_pu_bacteria 2765235838 2765569994 368
801 iso_pu_bacteria 2808606386 2808981716 368
802 iso_pu_bacteria 2808606415 2809131346 368
803 iso_pu_bacteria 2808606419 2809150968 368
804 iso_pu_bacteria 2818991445 2819593435 368
805 iso_pu_bacteria 2818991449 2819615363 368
806 iso_pu_bacteria 2821131069 2821131270 368
807 iso_pu_bacteria 2839094727 2839097066 368
808 iso_pu_bacteria 2842711865 2842714386 368
809 iso_pu_bacteria 2852618963 2852622753 368
810 iso_pu_bacteria 2857553236 2857554158 368
811 iso_pu_bacteria 2857558681 2857561507 368
812 iso_pu_bacteria 2857564685 2857565057 368
813 iso_pu_bacteria 2884836552 2884839967 368
814 iso_pu_bacteria 2884852848 2884857265 368
815 iso_pu_bacteria 2896154374 2896157852 368
816 iso_pu_bacteria 2904424332 2904426378 368
817 iso_pu_bacteria 2904439833 2904444735 368
818 iso_pu_bacteria 2904530477 2904534618 368
819 iso_pu_bacteria 2904584206 2904584503 368
820 iso_pu_bacteria 2904589729 2904590971 368
821 iso_pu_bacteria 2904601388 2904605405 368
822 iso_pu_bacteria 2919046199 2919047424 368
823 iso_pu_bacteria 2919079590 2919080910 368
824 iso_pu_bacteria 2919476304 2919478711 368
825 iso_pu_bacteria 2923510766 2923512484 368
826 iso_pu_bacteria 2928115317 2928116296 368
827 iso_pu_bacteria 2928130867 2928132517 368
828 3300003187 JGI25151J46595_10022540 JGI25151J46595_100225401 369
829 3300003371 JGI26145J50221_1002406 JGI26145J50221_10024062 369
830 3300005293 Ga0065715_10137524 Ga0065715_101375242 369
831 3300005331 Ga0070670_100000334 Ga0070670_10000033410 369
832 3300005333 Ga0070677_10002685 Ga0070677_100026852 369
833 3300005335 Ga0070666_10041629 Ga0070666_100416293 369
834 3300005353 Ga0070669_100142037 Ga0070669_1001420372 369
835 3300005354 Ga0070675_100010734 Ga0070675_1000107343 369
836 3300005355 Ga0070671_100018737 Ga0070671_1000187374 369
837 3300005356 Ga0070674_100000872 Ga0070674_1000008723 369
838 3300005364 Ga0070673_100010297 Ga0070673_1000102973 369
839 3300005456 Ga0070678_100006899 Ga0070678_1000068993 369
840 3300005459 Ga0068867_100000820 Ga0068867_10000082011 369
841 3300005543 Ga0070672_100003864 Ga0070672_1000038647 369
842 3300005564 Ga0070664_100024728 Ga0070664_1000247283 369
843 3300005618 Ga0068864_100039151 Ga0068864_1000391513 369
844 3300006051 Ga0075364_10004201 Ga0075364_100042014 369
845 3300025315 Ga0207697_10004138 Ga0207697_100041383 369
846 3300025893 Ga0207682_10003292 Ga0207682_100032923 369
847 3300025923 Ga0207681_10004604 Ga0207681_100046042 369
848 3300025925 Ga0207650_10000913 Ga0207650_1000091314 369
849 3300025926 Ga0207659_10000189 Ga0207659_1000018923 369
850 3300025931 Ga0207644_10029379 Ga0207644_100293793 369
851 3300025937 Ga0207669_10001570 Ga0207669_100015707 369
852 3300025937 Ga0207669_10005261 Ga0207669_100052613 369
853 3300025940 Ga0207691_10002491 Ga0207691_100024913 369
854 3300025945 Ga0207679_10027731 Ga0207679_100277314 369
855 3300025960 Ga0207651_10007212 Ga0207651_100072123 369
856 3300025986 Ga0207658_10109335 Ga0207658_101093352 369
857 3300026089 Ga0207648_10001133 Ga0207648_100011339 369
858 3300026089 Ga0207648_10318847 Ga0207648_103188471 369
859 3300026121 Ga0207683_10022902 Ga0207683_100229023 369
860 3300026121 Ga0207683_10061741 Ga0207683_100617412 369
861 3300026121 Ga0207683_10089363 Ga0207683_100893632 369
862 3300027876 Ga0209974_10002324 Ga0209974_100023247 369
863 3300028794 Ga0307515_10003517 Ga0307515_1000351720 369
864 3300031507 Ga0307509_10041706 Ga0307509_100417063 369
865 3300031616 Ga0307508_10000017 Ga0307508_10000017155 369
866 3300031649 Ga0307514_10004466 Ga0307514_100044666 369
867 3300033179 Ga0307507_10064219 Ga0307507_100642193 369
868 3300037471 Ga0395905_0055716 Ga0395905_0055716_2028_3191 369
869 3300041406 Ga0439439_0030834 Ga0439439_0030834_132_1301 369
870 3300042876 Ga0451577_0001608 Ga0451577_0001608_18432_19550 369
871 3300044712 Ga0453684_0051481 Ga0453684_0051481_1815_2933 369
872 3300045051 Ga0451576_0015538 Ga0451576_0015538_5889_7007 369
873 3300048905 Ga0496102_0011990 Ga0496102_0011990_4536_5684 369
874 3300048905 Ga0496102_0037961 Ga0496102_0037961_1139_2305 369
875 3300048921 Ga0496118_0149690 Ga0496118_0149690_207_1382 369
876 3300048924 Ga0496121_0036731 Ga0496121_0036731_920_2095 369
877 3300048927 Ga0496124_0000151 Ga0496124_0000151_76041_77216 369
878 3300048927 Ga0496124_0000155 Ga0496124_0000155_37084_38250 369
879 3300048928 Ga0496125_0005971 Ga0496125_0005971_4349_5524 369
880 3300050491 nmdc:mga00v17_19444_c1 nmdc:mga00v17_19444_c1_965_2143 369
881 3300053125 Ga0500618_001201 Ga0500618_001201_555_1706 369
882 3300053730 Ga0500645_009453 Ga0500645_009453_1849_3027 369
883 iso_pu_bacteria 2600255292 2601667389 369
884 iso_pu_bacteria 2857547612 2857551886 369
885 iso_pu_bacteria 2885080285 2885083888 369
886 iso_pu_bacteria 2932410948 2932411008 369
887 iso_pu_bacteria 2932416698 2932419425 369
888 3300002738 JGI25154J39366_1001714 JGI25154J39366_10017143 370
889 3300002774 JGI25150J39212_1001844 JGI25150J39212_10018443 370
890 3300003574 Ga0007410J51695_1007930 Ga0007410J51695_10079302 370
891 3300003763 Ga0055529_1000095 Ga0055529_100009533 370
892 3300003771 Ga0055526_1000256 Ga0055526_10002567 370
893 3300003771 Ga0055526_1000412 Ga0055526_100041222 370
894 3300005262 Ga0065165_1016274 Ga0065165_10162742 370
895 3300005330 Ga0070690_100030769 Ga0070690_1000307691 370
896 3300005335 Ga0070666_10003592 Ga0070666_100035924 370
897 3300005347 Ga0070668_100018633 Ga0070668_1000186333 370
898 3300005353 Ga0070669_100165624 Ga0070669_1001656241 370
899 3300005354 Ga0070675_100175651 Ga0070675_1001756512 370
900 3300005367 Ga0070667_100027186 Ga0070667_1000271864 370
901 3300005459 Ga0068867_100018872 Ga0068867_1000188722 370
902 3300005616 Ga0068852_100040581 Ga0068852_1000405814 370
903 3300005617 Ga0068859_100159038 Ga0068859_1001590382 370
904 3300005618 Ga0068864_100002247 Ga0068864_1000022474 370
905 3300005841 Ga0068863_100007447 Ga0068863_1000074477 370
906 3300005844 Ga0068862_100012976 Ga0068862_1000129765 370
907 3300006042 Ga0075368_10076344 Ga0075368_100763441 370
908 3300006051 Ga0075364_10000361 Ga0075364_1000036115 370
909 3300006195 Ga0075366_10049372 Ga0075366_100493722 370
910 3300006353 Ga0075370_10007796 Ga0075370_100077961 370
911 3300006358 Ga0068871_100028781 Ga0068871_1000287813 370
912 3300006931 Ga0097620_100159052 Ga0097620_1001590522 370
913 3300006946 Ga0079104_1010697 Ga0079104_10106973 370
914 3300009036 Ga0105244_10030420 Ga0105244_100304202 370
915 3300013306 Ga0163162_10129458 Ga0163162_101294583 370
916 3300013308 Ga0157375_10030363 Ga0157375_100303633 370
917 3300014326 Ga0157380_10047265 Ga0157380_100472652 370
918 3300014968 Ga0157379_10061146 Ga0157379_100611463 370
919 3300014969 Ga0157376_10327014 Ga0157376_103270142 370
920 3300015261 Ga0182006_1000117 Ga0182006_100011755 370
921 3300015265 Ga0182005_1000007 Ga0182005_1000007432 370
922 3300025246 Ga0209646_1000010 Ga0209646_1000010420 370
923 3300025272 Ga0209455_1000121 Ga0209455_1000121117 370
924 3300025273 Ga0209673_1011832 Ga0209673_10118324 370
925 3300025294 Ga0209025_1005225 Ga0209025_10052255 370
926 3300025295 Ga0209564_1000009 Ga0209564_1000009515 370
927 3300025295 Ga0209564_1000033 Ga0209564_100003379 370
928 3300025297 Ga0209758_1002669 Ga0209758_10026694 370
929 3300025298 Ga0209050_1010897 Ga0209050_10108973 370
930 3300025315 Ga0207697_10011975 Ga0207697_100119752 370
931 3300025728 Ga0207655_1006002 Ga0207655_10060024 370
932 3300025893 Ga0207682_10013079 Ga0207682_100130793 370
933 3300025903 Ga0207680_10003056 Ga0207680_100030562 370
934 3300025923 Ga0207681_10102846 Ga0207681_101028463 370
935 3300025926 Ga0207659_10004058 Ga0207659_100040587 370
936 3300025933 Ga0207706_10061811 Ga0207706_100618113 370
937 3300025938 Ga0207704_10072874 Ga0207704_100728743 370
938 3300025940 Ga0207691_10019152 Ga0207691_100191524 370
939 3300025941 Ga0207711_10041281 Ga0207711_100412814 370
940 3300025960 Ga0207651_10037955 Ga0207651_100379553 370
941 3300025986 Ga0207658_10053784 Ga0207658_100537842 370
942 3300026035 Ga0207703_10003102 Ga0207703_1000310214 370
943 3300026088 Ga0207641_10003303 Ga0207641_1000330313 370
944 3300026095 Ga0207676_10005300 Ga0207676_100053008 370
945 3300026118 Ga0207675_100025406 Ga0207675_1000254063 370
946 3300027111 Ga0209281_1004821 Ga0209281_10048211 370
947 3300028794 Ga0307515_10003519 Ga0307515_1000351914 370
948 3300028794 Ga0307515_10011870 Ga0307515_1001187014 370
949 3300031235 Ga0265330_10000032 Ga0265330_100000325 370
950 3300031238 Ga0265332_10000001 Ga0265332_10000001121 370
951 3300031238 Ga0265332_10000003 Ga0265332_10000003407 370
952 3300031247 Ga0265340_10011616 Ga0265340_100116162 370
953 3300031548 Ga0307408_100001235 Ga0307408_10000123512 370
954 3300031711 Ga0265314_10000022 Ga0265314_10000022122 370
955 3300031730 Ga0307516_10003632 Ga0307516_1000363216 370
956 3300032005 Ga0307411_10170435 Ga0307411_101704352 370
957 3300041452 Ga0451793_1814855 Ga0451793_1814855_365_1522 370
958 3300041505 Ga0451849_0021782 Ga0451849_0021782_142_1293 370
959 3300042439 Ga0439464_0003043 Ga0439464_0003043_2526_3716 370
960 3300042461 Ga0439460_0029524 Ga0439460_0029524_31_1221 370
961 3300044683 Ga0466965_0013125 Ga0466965_0013125_1314_2486 370
962 3300044712 Ga0453684_0296104 Ga0453684_0296104_208_1365 370
963 3300045051 Ga0451576_0304663 Ga0451576_0304663_138_1295 370
964 3300046452 Ga0495617_000050 Ga0495617_000050_26230_27402 370
965 3300046452 Ga0495617_001265 Ga0495617_001265_9497_10669 370
966 3300046453 Ga0495627_000055 Ga0495627_000055_57834_59006 370
967 3300046457 Ga0495590_0000032 Ga0495590_0000032_136864_138075 370
968 3300046460 Ga0495638_0000562 Ga0495638_0000562_39455_40627 370
969 3300046460 Ga0495638_0045974 Ga0495638_0045974_1060_2232 370
970 3300046463 Ga0495653_0000081 Ga0495653_0000081_42433_43617 370
971 3300046471 Ga0495650_0002372 Ga0495650_0002372_13729_14901 370
972 3300046471 Ga0495650_0003041 Ga0495650_0003041_11213_12385 370
973 3300046474 Ga0495605_0000044 Ga0495605_0000044_144173_145345 370
974 3300046474 Ga0495605_0002894 Ga0495605_0002894_9185_10357 370
975 3300046506 Ga0495583_0000145 Ga0495583_0000145_1656_2828 370
976 3300046506 Ga0495583_0000155 Ga0495583_0000155_76064_77236 370
977 3300046507 Ga0495606_0000904 Ga0495606_0000904_36467_37639 370
978 3300046507 Ga0495606_0001037 Ga0495606_0001037_482_1726 370
979 3300046507 Ga0495606_0025667 Ga0495606_0025667_2745_3941 370
980 3300046512 Ga0495610_0000003 Ga0495610_0000003_216212_217384 370
981 3300046512 Ga0495610_0000683 Ga0495610_0000683_23601_24773 370
982 3300046512 Ga0495610_0005108 Ga0495610_0005108_2701_3873 370
983 3300046513 Ga0495616_0012032 Ga0495616_0012032_221_1393 370
984 3300046519 Ga0495632_0028407 Ga0495632_0028407_1034_2185 370
985 3300046520 Ga0495637_0000656 Ga0495637_0000656_9311_10483 370
986 3300046522 Ga0495643_0000228 Ga0495643_0000228_58015_59187 370
987 3300046523 Ga0495644_0005754 Ga0495644_0005754_1881_3053 370
988 3300046524 Ga0495648_0000125 Ga0495648_0000125_87710_88882 370
989 3300046524 Ga0495648_0001315 Ga0495648_0001315_15078_16250 370
990 3300046524 Ga0495648_0042665 Ga0495648_0042665_1394_2566 370
991 3300046524 Ga0495648_0078035 Ga0495648_0078035_321_1505 370
992 3300046530 Ga0495654_0000161 Ga0495654_0000161_34967_36139 370
993 3300046538 Ga0495609_0006386 Ga0495609_0006386_4644_5816 370
994 3300046542 Ga0495597_0001639 Ga0495597_0001639_2355_3539 370
995 3300046542 Ga0495597_0056798 Ga0495597_0056798_118_1290 370
996 3300046558 Ga0495633_0013087 Ga0495633_0013087_2937_4109 370
997 3300046558 Ga0495633_0020919 Ga0495633_0020919_1923_3095 370
998 3300046558 Ga0495633_0022848 Ga0495633_0022848_1684_2856 370
999 3300046616 Ga0495668_0002551 Ga0495668_0002551_13134_14306 370
1000 3300046616 Ga0495668_0006775 Ga0495668_0006775_1593_2804 370
1001 3300046616 Ga0495668_0012859 Ga0495668_0012859_2399_3571 370
1002 3300046660 Ga0495625_0004994 Ga0495625_0004994_2723_3895 370
1003 3300046660 Ga0495625_0016825 Ga0495625_0016825_1537_2688 370
1004 3300046660 Ga0495625_0028305 Ga0495625_0028305_1437_2609 370
1005 3300046660 Ga0495625_0042342 Ga0495625_0042342_1526_2698 370
1006 3300046664 Ga0495659_0000122 Ga0495659_0000122_2756_3928 370
1007 3300046691 Ga0495670_0002575 Ga0495670_0002575_7141_8313 370
1008 3300046692 Ga0495671_0000001 Ga0495671_0000001_450859_452031 370
1009 3300046692 Ga0495671_0000430 Ga0495671_0000430_28380_29552 370
1010 3300046810 Ga0495660_0013093 Ga0495660_0013093_775_1947 370
1011 3300047318 Ga0495636_0000336 Ga0495636_0000336_15037_16209 370
1012 3300047320 Ga0495672_0000176 Ga0495672_0000176_65477_66649 370
1013 3300047443 Ga0495687_000395 Ga0495687_000395_36402_37574 370
1014 3300047443 Ga0495687_002075 Ga0495687_002075_11951_13162 370
1015 3300047443 Ga0495687_002391 Ga0495687_002391_10246_11457 370
1016 3300047446 Ga0495679_009792 Ga0495679_009792_2621_3793 370
1017 3300047447 Ga0495685_000323 Ga0495685_000323_3897_5069 370
1018 3300047469 Ga0495673_0000006 Ga0495673_0000006_741033_742217 370
1019 3300047469 Ga0495673_0000024 Ga0495673_0000024_364708_365892 370
1020 3300047469 Ga0495673_0000049 Ga0495673_0000049_165474_166646 370
1021 3300047470 Ga0495681_0006653 Ga0495681_0006653_3581_4753 370
1022 3300048917 Ga0496114_0048729 Ga0496114_0048729_2302_3474 370
1023 3300048919 Ga0496116_0109107 Ga0496116_0109107_164_1336 370
1024 3300048924 Ga0496121_0062576 Ga0496121_0062576_1393_2565 370
1025 3300048926 Ga0496123_0001654 Ga0496123_0001654_9736_10908 370
1026 3300048928 Ga0496125_0005102 Ga0496125_0005102_5354_6517 370
1027 3300049459 Ga0495678_000223 Ga0495678_000223_36714_37886 370
1028 3300049460 Ga0495682_0001584 Ga0495682_0001584_6415_7587 370
1029 3300049574 Ga0501038_0101445 Ga0501038_0101445_693_1850 370
1030 3300049823 Ga0501044_0239282 Ga0501044_0239282_69_1226 370
1031 3300050491 nmdc:mga00v17_3261_c1 nmdc:mga00v17_3261_c1_2305_3477 370
1032 3300050494 nmdc:mga06z11_12650_c1 nmdc:mga06z11_12650_c1_1948_3105 370
1033 3300050496 nmdc:mga07m45_110521_c1 nmdc:mga07m45_110521_c1_315_1472 370
1034 3300053125 Ga0500618_000469 Ga0500618_000469_15596_16768 370
1035 3300053157 Ga0500624_001676 Ga0500624_001676_1143_2306 370
1036 iso_pu_bacteria 2508501125 2509131313 370
1037 3300001979 JGI24740J21852_10004992 JGI24740J21852_100049922 371
1038 3300002739 JGI25158J39367_1005220 JGI25158J39367_10052201 371
1039 3300002773 JGI25152J39213_1000550 JGI25152J39213_100055013 371
1040 3300002774 JGI25150J39212_1002871 JGI25150J39212_10028712 371
1041 3300002987 JGI25159J45721_1000800 JGI25159J45721_100080012 371
1042 3300002987 JGI25159J45721_1004502 JGI25159J45721_10045023 371
1043 3300003163 Ga0006759J45824_1003446 Ga0006759J45824_10034462 371
1044 3300003187 JGI25151J46595_10012448 JGI25151J46595_100124482 371
1045 3300003215 JGI25153J46596_10003458 JGI25153J46596_100034584 371
1046 3300003215 JGI25153J46596_10008695 JGI25153J46596_100086955 371
1047 3300003215 JGI25153J46596_10012758 JGI25153J46596_100127582 371
1048 3300003215 JGI25153J46596_10021011 JGI25153J46596_100210112 371
1049 3300003308 Ga0006777J48905_1005637 Ga0006777J48905_10056371 371
1050 3300003354 JGI25160J50197_1000586 JGI25160J50197_100058618 371
1051 3300003544 Ga0007417J51691_1021004 Ga0007417J51691_10210042 371
1052 3300003574 Ga0007410J51695_1013383 Ga0007410J51695_10133832 371
1053 3300003574 Ga0007410J51695_1013461 Ga0007410J51695_10134612 371
1054 3300003575 Ga0007409J51694_1007957 Ga0007409J51694_10079571 371
1055 3300003575 Ga0007409J51694_1014187 Ga0007409J51694_10141872 371
1056 3300003577 Ga0007416J51690_1015392 Ga0007416J51690_10153922 371
1057 3300003577 Ga0007416J51690_1017208 Ga0007416J51690_10172083 371
1058 3300003578 Ga0006562J51391_1019774 Ga0006562J51391_10197742 371
1059 3300003693 Ga0032354_1010901 Ga0032354_10109012 371
1060 3300003693 Ga0032354_1037686 Ga0032354_10376862 371
1061 3300003752 Ga0055539_1000021 Ga0055539_1000021109 371
1062 3300003756 Ga0055533_1000029 Ga0055533_1000029109 371
1063 3300003759 Ga0055525_1000001 Ga0055525_1000001200 371
1064 3300003759 Ga0055525_1000033 Ga0055525_1000033109 371
1065 3300003761 Ga0055535_1000270 Ga0055535_100027014 371
1066 3300003762 Ga0055542_1000027 Ga0055542_100002786 371
1067 3300003762 Ga0055542_1007204 Ga0055542_10072042 371
1068 3300003771 Ga0055526_1019561 Ga0055526_10195612 371
1069 3300003773 Ga0055537_1000143 Ga0055537_100014323 371
1070 3300003773 Ga0055537_1000638 Ga0055537_100063810 371
1071 3300003773 Ga0055537_1003491 Ga0055537_10034914 371
1072 3300003775 Ga0055524_1000161 Ga0055524_100016123 371
1073 3300003784 Ga0055534_1000226 Ga0055534_100022628 371
1074 3300003784 Ga0055534_1000304 Ga0055534_100030410 371
1075 3300003784 Ga0055534_1002938 Ga0055534_10029384 371
1076 3300003784 Ga0055534_1009543 Ga0055534_10095432 371
1077 3300003790 Ga0055528_1002845 Ga0055528_10028455 371
1078 3300003790 Ga0055528_1006547 Ga0055528_10065476 371
1079 3300003791 Ga0055530_10002691 Ga0055530_100026912 371
1080 3300003791 Ga0055530_10009042 Ga0055530_100090424 371
1081 3300003791 Ga0055530_10009823 Ga0055530_100098232 371
1082 3300003792 Ga0055540_1000062 Ga0055540_100006217 371
1083 3300003792 Ga0055540_1002597 Ga0055540_10025978 371
1084 3300003792 Ga0055540_1006225 Ga0055540_10062252 371
1085 3300003792 Ga0055540_1007759 Ga0055540_10077593 371
1086 3300003794 Ga0055531_10002967 Ga0055531_100029672 371
1087 3300003794 Ga0055531_10008585 Ga0055531_100085854 371
1088 3300003794 Ga0055531_10009809 Ga0055531_100098094 371
1089 3300003794 Ga0055531_10018344 Ga0055531_100183442 371
1090 3300003841 Ga0055541_1000029 Ga0055541_100002914 371
1091 3300003841 Ga0055541_1000045 Ga0055541_100004523 371
1092 3300004625 Ga0055543_1001717 Ga0055543_10017175 371
1093 3300004625 Ga0055543_1002038 Ga0055543_10020384 371
1094 3300004625 Ga0055543_1002954 Ga0055543_10029545 371
1095 3300005262 Ga0065165_1000268 Ga0065165_100026868 371
1096 3300005262 Ga0065165_1005783 Ga0065165_10057835 371
1097 3300005262 Ga0065165_1042039 Ga0065165_10420391 371
1098 3300005289 Ga0065704_10087556 Ga0065704_100875563 371
1099 3300005339 Ga0070660_100200320 Ga0070660_1002003202 371
1100 3300005344 Ga0070661_100000264 Ga0070661_10000026412 371
1101 3300005344 Ga0070661_100071413 Ga0070661_1000714133 371
1102 3300005366 Ga0070659_100000798 Ga0070659_10000079810 371
1103 3300005366 Ga0070659_100121600 Ga0070659_1001216002 371
1104 3300005366 Ga0070659_100203703 Ga0070659_1002037032 371
1105 3300005456 Ga0070678_100041594 Ga0070678_1000415942 371
1106 3300005539 Ga0068853_100222964 Ga0068853_1002229642 371
1107 3300005563 Ga0068855_100002429 Ga0068855_10000242914 371
1108 3300005563 Ga0068855_100040371 Ga0068855_1000403715 371
1109 3300005563 Ga0068855_100048665 Ga0068855_1000486654 371
1110 3300005563 Ga0068855_100353836 Ga0068855_1003538362 371
1111 3300005564 Ga0070664_100003853 Ga0070664_10000385312 371
1112 3300005564 Ga0070664_100160054 Ga0070664_1001600543 371
1113 3300005577 Ga0068857_100239237 Ga0068857_1002392372 371
1114 3300006038 Ga0075365_10020443 Ga0075365_100204432 371
1115 3300006051 Ga0075364_10015913 Ga0075364_100159134 371
1116 3300006177 Ga0075362_10001523 Ga0075362_100015237 371
1117 3300006177 Ga0075362_10007315 Ga0075362_100073154 371
1118 3300006178 Ga0075367_10133290 Ga0075367_101332902 371
1119 3300006195 Ga0075366_10006029 Ga0075366_100060294 371
1120 3300006353 Ga0075370_10005283 Ga0075370_100052832 371
1121 3300006946 Ga0079104_1000186 Ga0079104_100018617 371
1122 3300006948 Ga0099826_10000001 Ga0099826_100000011039 371
1123 3300006948 Ga0099826_10001313 Ga0099826_1000131310 371
1124 3300009036 Ga0105244_10003650 Ga0105244_100036503 371
1125 3300009148 Ga0105243_10003626 Ga0105243_100036265 371
1126 3300009148 Ga0105243_10012597 Ga0105243_100125974 371
1127 3300009148 Ga0105243_10046565 Ga0105243_100465654 371
1128 3300009545 Ga0105237_10046093 Ga0105237_100460933 371
1129 3300011119 Ga0105246_10048906 Ga0105246_100489063 371
1130 3300013100 Ga0157373_10024986 Ga0157373_100249863 371
1131 3300013100 Ga0157373_10069956 Ga0157373_100699562 371
1132 3300013102 Ga0157371_10000001 Ga0157371_10000001184 371
1133 3300013104 Ga0157370_10198943 Ga0157370_101989432 371
1134 3300013105 Ga0157369_10006099 Ga0157369_100060995 371
1135 3300013306 Ga0163162_10166104 Ga0163162_101661042 371
1136 3300014497 Ga0182008_10000317 Ga0182008_1000031712 371
1137 3300014497 Ga0182008_10008860 Ga0182008_100088603 371
1138 3300014497 Ga0182008_10016908 Ga0182008_100169082 371
1139 3300014497 Ga0182008_10019892 Ga0182008_100198922 371
1140 3300015261 Ga0182006_1000002 Ga0182006_1000002308 371
1141 3300015261 Ga0182006_1001371 Ga0182006_100137113 371
1142 3300015261 Ga0182006_1010814 Ga0182006_10108143 371
1143 3300015261 Ga0182006_1014280 Ga0182006_10142802 371
1144 3300015262 Ga0182007_10000045 Ga0182007_1000004543 371
1145 3300015262 Ga0182007_10002141 Ga0182007_100021415 371
1146 3300015262 Ga0182007_10006337 Ga0182007_100063372 371
1147 3300015265 Ga0182005_1000002 Ga0182005_1000002782 371
1148 3300017792 Ga0163161_10000943 Ga0163161_1000094314 371
1149 3300017792 Ga0163161_10054079 Ga0163161_100540792 371
1150 3300021361 Ga0213872_10000026 Ga0213872_10000026118 371
1151 3300025208 Ga0209436_100074 Ga0209436_10007439 371
1152 3300025208 Ga0209436_107406 Ga0209436_1074062 371
1153 3300025224 Ga0209784_100033 Ga0209784_100033109 371
1154 3300025225 Ga0209566_100037 Ga0209566_100037109 371
1155 3300025226 Ga0209674_100055 Ga0209674_100055109 371
1156 3300025228 Ga0209672_101759 Ga0209672_1017596 371
1157 3300025230 Ga0209563_100007 Ga0209563_100007897 371
1158 3300025230 Ga0209563_100056 Ga0209563_100056109 371
1159 3300025242 Ga0209258_100048 Ga0209258_100048289 371
1160 3300025245 Ga0207425_1000001 Ga0207425_10000011691 371
1161 3300025245 Ga0207425_1000089 Ga0207425_10000896 371
1162 3300025245 Ga0207425_1000275 Ga0207425_100027542 371
1163 3300025245 Ga0207425_1000596 Ga0207425_100059617 371
1164 3300025250 Ga0209026_1004281 Ga0209026_10042814 371
1165 3300025253 Ga0209677_100034 Ga0209677_100034109 371
1166 3300025253 Ga0209677_111576 Ga0209677_1115762 371
1167 3300025254 Ga0209148_1000040 Ga0209148_1000040289 371
1168 3300025254 Ga0209148_1000241 Ga0209148_100024150 371
1169 3300025258 Ga0209129_1000001 Ga0209129_1000001868 371
1170 3300025258 Ga0209129_1000007 Ga0209129_1000007177 371
1171 3300025258 Ga0209129_1000148 Ga0209129_100014860 371
1172 3300025258 Ga0209129_1004204 Ga0209129_10042043 371
1173 3300025263 Ga0209565_1000009 Ga0209565_1000009140 371
1174 3300025263 Ga0209565_1000153 Ga0209565_100015326 371
1175 3300025263 Ga0209565_1000292 Ga0209565_100029226 371
1176 3300025263 Ga0209565_1000311 Ga0209565_100031139 371
1177 3300025263 Ga0209565_1001694 Ga0209565_10016946 371
1178 3300025263 Ga0209565_1003078 Ga0209565_10030784 371
1179 3300025273 Ga0209673_1000019 Ga0209673_1000019242 371
1180 3300025273 Ga0209673_1000423 Ga0209673_10004235 371
1181 3300025273 Ga0209673_1000794 Ga0209673_100079412 371
1182 3300025273 Ga0209673_1003547 Ga0209673_10035474 371
1183 3300025273 Ga0209673_1012266 Ga0209673_10122663 371
1184 3300025284 Ga0209130_1000143 Ga0209130_100014380 371
1185 3300025284 Ga0209130_1000172 Ga0209130_100017213 371
1186 3300025284 Ga0209130_1000329 Ga0209130_100032913 371
1187 3300025284 Ga0209130_1000460 Ga0209130_100046040 371
1188 3300025284 Ga0209130_1004145 Ga0209130_10041452 371
1189 3300025284 Ga0209130_1005713 Ga0209130_10057133 371
1190 3300025291 Ga0209675_1000028 Ga0209675_1000028114 371
1191 3300025291 Ga0209675_1000150 Ga0209675_100015026 371
1192 3300025291 Ga0209675_1001931 Ga0209675_10019314 371
1193 3300025291 Ga0209675_1002255 Ga0209675_10022554 371
1194 3300025291 Ga0209675_1007563 Ga0209675_10075633 371
1195 3300025292 Ga0209676_1000004 Ga0209676_1000004929 371
1196 3300025292 Ga0209676_1003529 Ga0209676_10035292 371
1197 3300025292 Ga0209676_1003660 Ga0209676_10036608 371
1198 3300025292 Ga0209676_1016751 Ga0209676_10167513 371
1199 3300025294 Ga0209025_1000111 Ga0209025_100011113 371
1200 3300025294 Ga0209025_1000624 Ga0209025_100062442 371
1201 3300025294 Ga0209025_1008867 Ga0209025_10088673 371
1202 3300025295 Ga0209564_1000058 Ga0209564_1000058180 371
1203 3300025295 Ga0209564_1000153 Ga0209564_1000153178 371
1204 3300025295 Ga0209564_1000178 Ga0209564_100017840 371
1205 3300025295 Ga0209564_1000251 Ga0209564_100025155 371
1206 3300025295 Ga0209564_1001234 Ga0209564_100123415 371
1207 3300025295 Ga0209564_1008824 Ga0209564_10088245 371
1208 3300025297 Ga0209758_1000025 Ga0209758_1000025349 371
1209 3300025297 Ga0209758_1000116 Ga0209758_1000116129 371
1210 3300025297 Ga0209758_1000387 Ga0209758_100038755 371
1211 3300025297 Ga0209758_1000439 Ga0209758_10004398 371
1212 3300025297 Ga0209758_1005897 Ga0209758_10058974 371
1213 3300025298 Ga0209050_1000002 Ga0209050_10000021439 371
1214 3300025298 Ga0209050_1000412 Ga0209050_10004122 371
1215 3300025298 Ga0209050_1001086 Ga0209050_10010869 371
1216 3300025298 Ga0209050_1001892 Ga0209050_10018925 371
1217 3300025298 Ga0209050_1020874 Ga0209050_10208742 371
1218 3300025298 Ga0209050_1021056 Ga0209050_10210562 371
1219 3300025299 Ga0209256_1000005 Ga0209256_1000005580 371
1220 3300025299 Ga0209256_1000024 Ga0209256_1000024281 371
1221 3300025299 Ga0209256_1000093 Ga0209256_1000093167 371
1222 3300025299 Ga0209256_1000488 Ga0209256_100048840 371
1223 3300025302 Ga0207426_1000001 Ga0207426_1000001229 371
1224 3300025302 Ga0207426_1000028 Ga0207426_1000028121 371
1225 3300025302 Ga0207426_1001345 Ga0207426_10013454 371
1226 3300025303 Ga0209051_1000002 Ga0209051_10000021209 371
1227 3300025303 Ga0209051_1000063 Ga0209051_1000063209 371
1228 3300025303 Ga0209051_1000268 Ga0209051_100026885 371
1229 3300025303 Ga0209051_1001146 Ga0209051_100114614 371
1230 3300025303 Ga0209051_1003892 Ga0209051_10038922 371
1231 3300025304 Ga0209257_1000002 Ga0209257_10000021350 371
1232 3300025304 Ga0209257_1000275 Ga0209257_100027521 371
1233 3300025304 Ga0209257_1002262 Ga0209257_10022625 371
1234 3300025304 Ga0209257_1002313 Ga0209257_100231316 371
1235 3300025304 Ga0209257_1002999 Ga0209257_10029994 371
1236 3300025304 Ga0209257_1019761 Ga0209257_10197613 371
1237 3300025728 Ga0207655_1003482 Ga0207655_10034829 371
1238 3300025909 Ga0207705_10000768 Ga0207705_100007684 371
1239 3300025911 Ga0207654_10005978 Ga0207654_100059783 371
1240 3300025920 Ga0207649_10002218 Ga0207649_1000221810 371
1241 3300025932 Ga0207690_10000541 Ga0207690_1000054115 371
1242 3300025932 Ga0207690_10005319 Ga0207690_100053194 371
1243 3300025933 Ga0207706_10049695 Ga0207706_100496954 371
1244 3300025933 Ga0207706_10128454 Ga0207706_101284541 371
1245 3300025935 Ga0207709_10001797 Ga0207709_1000179712 371
1246 3300025935 Ga0207709_10004048 Ga0207709_100040487 371
1247 3300025945 Ga0207679_10001861 Ga0207679_100018613 371
1248 3300025949 Ga0207667_10000034 Ga0207667_1000003415 371
1249 3300025949 Ga0207667_10054097 Ga0207667_100540972 371
1250 3300026041 Ga0207639_10219849 Ga0207639_102198492 371
1251 3300026067 Ga0207678_10093712 Ga0207678_100937123 371
1252 3300026089 Ga0207648_10175045 Ga0207648_101750452 371
1253 3300026116 Ga0207674_10046656 Ga0207674_100466563 371
1254 3300026142 Ga0207698_10331714 Ga0207698_103317141 371
1255 3300027111 Ga0209281_1000442 Ga0209281_100044242 371
1256 3300027614 Ga0209970_1000814 Ga0209970_10008144 371
1257 3300027666 Ga0209282_1000001 Ga0209282_10000012163 371
1258 3300030736 Ga0316180_1024577 Ga0316180_10245776 371
1259 3300030744 Ga0316181_1063388 Ga0316181_10633881 371
1260 3300030745 Ga0316182_1344291 Ga0316182_13442916 371
1261 3300031548 Ga0307408_100010270 Ga0307408_1000102701 371
1262 3300031548 Ga0307408_100014180 Ga0307408_1000141801 371
1263 3300031548 Ga0307408_100028168 Ga0307408_1000281684 371
1264 3300031711 Ga0265314_10055744 Ga0265314_100557442 371
1265 3300031824 Ga0307413_10037276 Ga0307413_100372762 371
1266 3300031901 Ga0307406_10001221 Ga0307406_100012215 371
1267 3300031903 Ga0307407_10002597 Ga0307407_100025973 371
1268 3300031911 Ga0307412_10073409 Ga0307412_100734093 371
1269 3300032002 Ga0307416_100013315 Ga0307416_1000133154 371
1270 3300032002 Ga0307416_100092334 Ga0307416_1000923342 371
1271 3300032002 Ga0307416_100107319 Ga0307416_1001073193 371
1272 3300032004 Ga0307414_10022373 Ga0307414_100223734 371
1273 3300032005 Ga0307411_10015220 Ga0307411_100152203 371
1274 3300037312 Ga0395899_0000028 Ga0395899_0000028_243283_244452 371
1275 3300037312 Ga0395899_0001707 Ga0395899_0001707_859_2028 371
1276 3300037312 Ga0395899_0089861 Ga0395899_0089861_210_1379 371
1277 3300037312 Ga0395899_0129776 Ga0395899_0129776_411_1592 371
1278 3300037418 Ga0395900_0000404 Ga0395900_0000404_8553_9734 371
1279 3300037418 Ga0395900_0006862 Ga0395900_0006862_1239_2408 371
1280 3300037418 Ga0395900_0007487 Ga0395900_0007487_9653_10822 371
1281 3300037418 Ga0395900_0145451 Ga0395900_0145451_497_1666 371
1282 3300037471 Ga0395905_0052375 Ga0395905_0052375_1384_2556 371
1283 3300038443 Ga0395901_0000217 Ga0395901_0000217_63294_64475 371
1284 3300038443 Ga0395901_0002151 Ga0395901_0002151_11574_12743 371
1285 3300038443 Ga0395901_0019360 Ga0395901_0019360_562_1731 371
1286 3300039447 Ga0436361_0052780 Ga0436361_0052780_10444_11616 371
1287 3300041443 Ga0451789_0718700 Ga0451789_0718700_988_2157 371
1288 3300042012 Ga0439455_0021277 Ga0439455_0021277_269_1441 371
1289 3300042122 Ga0450920_003022 Ga0450920_003022_1527_2678 371
1290 3300042156 Ga0439446_0013167 Ga0439446_0013167_847_1998 371
1291 3300042157 Ga0439458_0013844 Ga0439458_0013844_601_1770 371
1292 3300042435 Ga0439434_0013333 Ga0439434_0013333_32_1183 371
1293 3300042531 Ga0450918_000566 Ga0450918_000566_890_2041 371
1294 3300044658 Ga0466972_0016157 Ga0466972_0016157_336_1517 371
1295 3300044658 Ga0466972_0050698 Ga0466972_0050698_426_1595 371
1296 3300044706 Ga0466964_0007990 Ga0466964_0007990_576_1757 371
1297 3300044735 Ga0466968_0000328 Ga0466968_0000328_8802_9983 371
1298 3300044765 Ga0466970_0020495 Ga0466970_0020495_1579_2748 371
1299 3300044842 Ga0466957_0000791 Ga0466957_0000791_14976_16145 371
1300 3300045049 Ga0466959_0035280 Ga0466959_0035280_1610_2779 371
1301 3300045049 Ga0466959_0090620 Ga0466959_0090620_144_1313 371
1302 3300046452 Ga0495617_000029 Ga0495617_000029_135490_136659 371
1303 3300046453 Ga0495627_006898 Ga0495627_006898_1164_2312 371
1304 3300046455 Ga0495603_0047614 Ga0495603_0047614_275_1444 371
1305 3300046457 Ga0495590_0000060 Ga0495590_0000060_2116_3285 371
1306 3300046458 Ga0495591_000596 Ga0495591_000596_10382_11551 371
1307 3300046459 Ga0495629_0031756 Ga0495629_0031756_1697_2866 371
1308 3300046459 Ga0495629_0044071 Ga0495629_0044071_466_1635 371
1309 3300046460 Ga0495638_0019435 Ga0495638_0019435_2644_3792 371
1310 3300046462 Ga0495651_0002000 Ga0495651_0002000_7849_9024 371
1311 3300046471 Ga0495650_0000048 Ga0495650_0000048_206934_208103 371
1312 3300046471 Ga0495650_0000161 Ga0495650_0000161_39053_40228 371
1313 3300046471 Ga0495650_0000890 Ga0495650_0000890_20099_21268 371
1314 3300046473 Ga0495582_0017401 Ga0495582_0017401_1391_2560 371
1315 3300046474 Ga0495605_0000180 Ga0495605_0000180_63444_64613 371
1316 3300046474 Ga0495605_0000494 Ga0495605_0000494_9024_10193 371
1317 3300046474 Ga0495605_0087919 Ga0495605_0087919_252_1421 371
1318 3300046491 Ga0495584_0000613 Ga0495584_0000613_19147_20316 371
1319 3300046491 Ga0495584_0009159 Ga0495584_0009159_3864_5033 371
1320 3300046491 Ga0495584_0010710 Ga0495584_0010710_380_1549 371
1321 3300046491 Ga0495584_0012788 Ga0495584_0012788_617_1786 371
1322 3300046491 Ga0495584_0024369 Ga0495584_0024369_623_1792 371
1323 3300046492 Ga0495585_0001109 Ga0495585_0001109_18750_19919 371
1324 3300046492 Ga0495585_0004398 Ga0495585_0004398_7418_8587 371
1325 3300046492 Ga0495585_0021342 Ga0495585_0021342_1097_2266 371
1326 3300046492 Ga0495585_0038591 Ga0495585_0038591_781_1953 371
1327 3300046499 Ga0495594_0022012 Ga0495594_0022012_1823_2992 371
1328 3300046500 Ga0495596_0000481 Ga0495596_0000481_22446_23615 371
1329 3300046500 Ga0495596_0001056 Ga0495596_0001056_14677_15846 371
1330 3300046500 Ga0495596_0009863 Ga0495596_0009863_2984_4153 371
1331 3300046501 Ga0495607_0002872 Ga0495607_0002872_5128_6297 371
1332 3300046501 Ga0495607_0012437 Ga0495607_0012437_3894_5108 371
1333 3300046501 Ga0495607_0017013 Ga0495607_0017013_2615_3784 371
1334 3300046501 Ga0495607_0022647 Ga0495607_0022647_570_1739 371
1335 3300046501 Ga0495607_0039947 Ga0495607_0039947_183_1355 371
1336 3300046501 Ga0495607_0064366 Ga0495607_0064366_466_1635 371
1337 3300046501 Ga0495607_0094293 Ga0495607_0094293_188_1357 371
1338 3300046506 Ga0495583_0000622 Ga0495583_0000622_13041_14210 371
1339 3300046506 Ga0495583_0014837 Ga0495583_0014837_2711_3880 371
1340 3300046506 Ga0495583_0014978 Ga0495583_0014978_125_1339 371
1341 3300046507 Ga0495606_0000232 Ga0495606_0000232_94405_95580 371
1342 3300046507 Ga0495606_0000510 Ga0495606_0000510_29727_30902 371
1343 3300046507 Ga0495606_0133542 Ga0495606_0133542_188_1357 371
1344 3300046512 Ga0495610_0001267 Ga0495610_0001267_11221_12390 371
1345 3300046512 Ga0495610_0012154 Ga0495610_0012154_3429_4577 371
1346 3300046513 Ga0495616_0000368 Ga0495616_0000368_19417_20616 371
1347 3300046513 Ga0495616_0002113 Ga0495616_0002113_3294_4463 371
1348 3300046513 Ga0495616_0002290 Ga0495616_0002290_1863_3011 371
1349 3300046513 Ga0495616_0008854 Ga0495616_0008854_3426_4595 371
1350 3300046513 Ga0495616_0009537 Ga0495616_0009537_3801_4970 371
1351 3300046513 Ga0495616_0052526 Ga0495616_0052526_525_1700 371
1352 3300046513 Ga0495616_0055107 Ga0495616_0055107_237_1406 371
1353 3300046516 Ga0495628_0001041 Ga0495628_0001041_1184_2359 371
1354 3300046518 Ga0495631_0006567 Ga0495631_0006567_2565_3737 371
1355 3300046518 Ga0495631_0010855 Ga0495631_0010855_2695_3864 371
1356 3300046518 Ga0495631_0012627 Ga0495631_0012627_2559_3707 371
1357 3300046519 Ga0495632_0000675 Ga0495632_0000675_26224_27399 371
1358 3300046519 Ga0495632_0000792 Ga0495632_0000792_23291_24460 371
1359 3300046519 Ga0495632_0015558 Ga0495632_0015558_1047_2219 371
1360 3300046519 Ga0495632_0019623 Ga0495632_0019623_2335_3504 371
1361 3300046519 Ga0495632_0040734 Ga0495632_0040734_232_1401 371
1362 3300046520 Ga0495637_0000004 Ga0495637_0000004_272153_273322 371
1363 3300046520 Ga0495637_0009348 Ga0495637_0009348_1973_3121 371
1364 3300046522 Ga0495643_0001906 Ga0495643_0001906_16257_17426 371
1365 3300046522 Ga0495643_0013184 Ga0495643_0013184_3260_4429 371
1366 3300046524 Ga0495648_0035276 Ga0495648_0035276_901_2070 371
1367 3300046525 Ga0495663_0008647 Ga0495663_0008647_1350_2519 371
1368 3300046526 Ga0495666_0017689 Ga0495666_0017689_1854_3023 371
1369 3300046526 Ga0495666_0047683 Ga0495666_0047683_529_1698 371
1370 3300046528 Ga0495642_0019418 Ga0495642_0019418_923_2092 371
1371 3300046528 Ga0495642_0023200 Ga0495642_0023200_988_2157 371
1372 3300046529 Ga0495652_0038674 Ga0495652_0038674_617_1792 371
1373 3300046530 Ga0495654_0025295 Ga0495654_0025295_206_1354 371
1374 3300046531 Ga0495665_0009055 Ga0495665_0009055_2039_3208 371
1375 3300046531 Ga0495665_0011262 Ga0495665_0011262_2660_3829 371
1376 3300046531 Ga0495665_0070394 Ga0495665_0070394_146_1315 371
1377 3300046535 Ga0495586_0001459 Ga0495586_0001459_1635_2804 371
1378 3300046536 Ga0495587_0043411 Ga0495587_0043411_1398_2567 371
1379 3300046538 Ga0495609_0000059 Ga0495609_0000059_91965_93134 371
1380 3300046538 Ga0495609_0062901 Ga0495609_0062901_85_1254 371
1381 3300046542 Ga0495597_0003206 Ga0495597_0003206_5897_7066 371
1382 3300046542 Ga0495597_0018497 Ga0495597_0018497_199_1368 371
1383 3300046542 Ga0495597_0051766 Ga0495597_0051766_466_1635 371
1384 3300046542 Ga0495597_0054921 Ga0495597_0054921_544_1713 371
1385 3300046557 Ga0495622_0000078 Ga0495622_0000078_11540_12715 371
1386 3300046558 Ga0495633_0010563 Ga0495633_0010563_2288_3463 371
1387 3300046616 Ga0495668_0000368 Ga0495668_0000368_20822_21997 371
1388 3300046616 Ga0495668_0000657 Ga0495668_0000657_10707_11876 371
1389 3300046616 Ga0495668_0024425 Ga0495668_0024425_1315_2529 371
1390 3300046642 Ga0495634_0002308 Ga0495634_0002308_12228_13421 371
1391 3300046642 Ga0495634_0150923 Ga0495634_0150923_204_1373 371
1392 3300046648 Ga0495611_0020391 Ga0495611_0020391_245_1414 371
1393 3300046648 Ga0495611_0034656 Ga0495611_0034656_65_1234 371
1394 3300046660 Ga0495625_0000436 Ga0495625_0000436_5373_6524 371
1395 3300046660 Ga0495625_0007896 Ga0495625_0007896_2083_3297 371
1396 3300046660 Ga0495625_0048793 Ga0495625_0048793_203_1351 371
1397 3300046664 Ga0495659_0002747 Ga0495659_0002747_2574_3788 371
1398 3300046665 Ga0495661_0002354 Ga0495661_0002354_460_1629 371
1399 3300046665 Ga0495661_0015281 Ga0495661_0015281_1246_2415 371
1400 3300046665 Ga0495661_0015765 Ga0495661_0015765_3355_4569 371
1401 3300046665 Ga0495661_0034833 Ga0495661_0034833_1547_2716 371
1402 3300046665 Ga0495661_0055909 Ga0495661_0055909_425_1597 371
1403 3300046665 Ga0495661_0134382 Ga0495661_0134382_76_1233 371
1404 3300046674 Ga0495588_0000189 Ga0495588_0000189_35195_36364 371
1405 3300046674 Ga0495588_0023206 Ga0495588_0023206_1336_2505 371
1406 3300046674 Ga0495588_0053574 Ga0495588_0053574_866_2035 371
1407 3300046674 Ga0495588_0088646 Ga0495588_0088646_146_1315 371
1408 3300046679 Ga0495623_0006506 Ga0495623_0006506_529_1722 371
1409 3300046679 Ga0495623_0048215 Ga0495623_0048215_1482_2657 371
1410 3300046684 Ga0495669_0000508 Ga0495669_0000508_9395_10564 371
1411 3300046684 Ga0495669_0008827 Ga0495669_0008827_1749_2963 371
1412 3300046689 Ga0495613_0014523 Ga0495613_0014523_1505_2674 371
1413 3300046691 Ga0495670_0032566 Ga0495670_0032566_466_1635 371
1414 3300046691 Ga0495670_0052998 Ga0495670_0052998_822_1991 371
1415 3300046694 Ga0495649_0013899 Ga0495649_0013899_3037_4206 371
1416 3300046794 Ga0495589_0000052 Ga0495589_0000052_23963_25132 371
1417 3300046794 Ga0495589_0000317 Ga0495589_0000317_13287_14456 371
1418 3300046794 Ga0495589_0008909 Ga0495589_0008909_766_1938 371
1419 3300046794 Ga0495589_0026040 Ga0495589_0026040_1228_2397 371
1420 3300046809 Ga0495600_0029278 Ga0495600_0029278_620_1789 371
1421 3300046809 Ga0495600_0100965 Ga0495600_0100965_453_1622 371
1422 3300046810 Ga0495660_0002980 Ga0495660_0002980_6943_8169 371
1423 3300046810 Ga0495660_0004826 Ga0495660_0004826_6029_7198 371
1424 3300047315 Ga0495581_0041096 Ga0495581_0041096_518_1687 371
1425 3300047315 Ga0495581_0052322 Ga0495581_0052322_1044_2213 371
1426 3300047317 Ga0495604_0008571 Ga0495604_0008571_3091_4260 371
1427 3300047317 Ga0495604_0025805 Ga0495604_0025805_1168_2337 371
1428 3300047318 Ga0495636_0000461 Ga0495636_0000461_3196_4365 371
1429 3300047318 Ga0495636_0002901 Ga0495636_0002901_666_1880 371
1430 3300047320 Ga0495672_0000093 Ga0495672_0000093_60039_61208 371
1431 3300047320 Ga0495672_0000342 Ga0495672_0000342_2928_4097 371
1432 3300047320 Ga0495672_0001378 Ga0495672_0001378_20852_22021 371
1433 3300047320 Ga0495672_0030482 Ga0495672_0030482_582_1751 371
1434 3300047321 Ga0495676_0019249 Ga0495676_0019249_1642_2790 371
1435 3300047321 Ga0495676_0037983 Ga0495676_0037983_72_1241 371
1436 3300047323 Ga0495683_0000248 Ga0495683_0000248_19197_20366 371
1437 3300047323 Ga0495683_0000343 Ga0495683_0000343_14120_15289 371
1438 3300047323 Ga0495683_0002649 Ga0495683_0002649_6920_8092 371
1439 3300047443 Ga0495687_000087 Ga0495687_000087_49270_50439 371
1440 3300047443 Ga0495687_000598 Ga0495687_000598_25976_27145 371
1441 3300047443 Ga0495687_000913 Ga0495687_000913_26022_27191 371
1442 3300047443 Ga0495687_007698 Ga0495687_007698_1626_2840 371
1443 3300047444 Ga0495675_0028624 Ga0495675_0028624_1777_2946 371
1444 3300047445 Ga0495677_0000070 Ga0495677_0000070_50509_51678 371
1445 3300047445 Ga0495677_0018251 Ga0495677_0018251_292_1506 371
1446 3300047445 Ga0495677_0020382 Ga0495677_0020382_570_1739 371
1447 3300047446 Ga0495679_009305 Ga0495679_009305_1224_2396 371
1448 3300047447 Ga0495685_018588 Ga0495685_018588_406_1620 371
1449 3300047470 Ga0495681_0002290 Ga0495681_0002290_11142_12356 371
1450 3300047470 Ga0495681_0002823 Ga0495681_0002823_8897_10066 371
1451 3300047472 Ga0495686_0001319 Ga0495686_0001319_13429_14598 371
1452 3300047472 Ga0495686_0002420 Ga0495686_0002420_6734_7903 371
1453 3300047472 Ga0495686_0009713 Ga0495686_0009713_1631_2818 371
1454 3300047673 Ga0495593_0003834 Ga0495593_0003834_5007_6176 371
1455 3300047673 Ga0495593_0022003 Ga0495593_0022003_111_1259 371
1456 3300048088 Ga0495602_0054070 Ga0495602_0054070_2044_3213 371
1457 3300048089 Ga0495614_0000563 Ga0495614_0000563_3973_5121 371
1458 3300048091 Ga0495626_0000085 Ga0495626_0000085_49964_51133 371
1459 3300048091 Ga0495626_0000178 Ga0495626_0000178_25628_26797 371
1460 3300048091 Ga0495626_0001048 Ga0495626_0001048_41_1210 371
1461 3300048091 Ga0495626_0005716 Ga0495626_0005716_3129_4397 371
1462 3300048091 Ga0495626_0016181 Ga0495626_0016181_1702_2871 371
1463 3300048091 Ga0495626_0016736 Ga0495626_0016736_1396_2565 371
1464 3300048904 Ga0496101_0051336 Ga0496101_0051336_147_1295 371
1465 3300048905 Ga0496102_0029346 Ga0496102_0029346_241_1410 371
1466 3300048905 Ga0496102_0078090 Ga0496102_0078090_514_1683 371
1467 3300048913 Ga0496110_0105558 Ga0496110_0105558_1169_2341 371
1468 3300048918 Ga0496115_0007765 Ga0496115_0007765_3249_4418 371
1469 3300048918 Ga0496115_0058190 Ga0496115_0058190_1030_2199 371
1470 3300048920 Ga0496117_0000001 Ga0496117_0000001_1727028_1728203 371
1471 3300048920 Ga0496117_0014655 Ga0496117_0014655_2169_3317 371
1472 3300048921 Ga0496118_0000078 Ga0496118_0000078_36140_37315 371
1473 3300048921 Ga0496118_0030575 Ga0496118_0030575_2198_3355 371
1474 3300048921 Ga0496118_0061288 Ga0496118_0061288_83_1231 371
1475 3300048924 Ga0496121_0041851 Ga0496121_0041851_2715_3890 371
1476 3300048924 Ga0496121_0092447 Ga0496121_0092447_1074_2222 371
1477 3300048925 Ga0496122_0002104 Ga0496122_0002104_4504_5679 371
1478 3300048925 Ga0496122_0040011 Ga0496122_0040011_463_1632 371
1479 3300048926 Ga0496123_0026803 Ga0496123_0026803_2822_3997 371
1480 3300048926 Ga0496123_0054174 Ga0496123_0054174_354_1523 371
1481 3300048926 Ga0496123_0096880 Ga0496123_0096880_156_1304 371
1482 3300048926 Ga0496123_0107743 Ga0496123_0107743_337_1485 371
1483 3300048927 Ga0496124_0004832 Ga0496124_0004832_11832_13001 371
1484 3300048928 Ga0496125_0029672 Ga0496125_0029672_1346_2503 371
1485 3300048928 Ga0496125_0035455 Ga0496125_0035455_1323_2498 371
1486 3300049459 Ga0495678_000439 Ga0495678_000439_26136_27305 371
1487 3300049459 Ga0495678_000771 Ga0495678_000771_2755_3924 371
1488 3300049459 Ga0495678_002291 Ga0495678_002291_4276_5445 371
1489 3300049459 Ga0495678_003472 Ga0495678_003472_8004_9173 371
1490 3300049459 Ga0495678_039382 Ga0495678_039382_593_1807 371
1491 3300049460 Ga0495682_0029415 Ga0495682_0029415_45_1214 371
1492 3300049759 Ga0501262_000587 Ga0501262_000587_1991_3142 371
1493 3300049822 Ga0501035_0006524 Ga0501035_0006524_2372_3553 371
1494 3300050496 nmdc:mga07m45_11535_c1 nmdc:mga07m45_11535_c1_2010_3158 371
1495 3300050496 nmdc:mga07m45_51285_c1 nmdc:mga07m45_51285_c1_929_2077 371
1496 3300050516 nmdc:mga0sz30_30537_c1 nmdc:mga0sz30_30537_c1_983_2131 371
1497 3300053079 Ga0500610_0020964 Ga0500610_0020964_1989_3146 371
1498 3300053086 Ga0500578_0000002 Ga0500578_0000002_128121_129290 371
1499 3300053090 Ga0500646_0004257 Ga0500646_0004257_837_2006 371
1500 3300053093 Ga0500651_0000042 Ga0500651_0000042_640_1788 371
1501 3300053109 Ga0500569_035869 Ga0500569_035869_78_1247 371
1502 3300053110 Ga0500571_000096 Ga0500571_000096_14585_15733 371
1503 3300053121 Ga0500607_002839 Ga0500607_002839_2002_3159 371
1504 3300053131 Ga0500652_000102 Ga0500652_000102_22449_23618 371
1505 3300053134 Ga0500658_0000966 Ga0500658_0000966_8091_9239 371
1506 3300053134 Ga0500658_0001050 Ga0500658_0001050_7675_8823 371
1507 3300053142 Ga0500577_0007624 Ga0500577_0007624_257_1426 371
1508 3300053153 Ga0500616_0017939 Ga0500616_0017939_1751_2899 371
1509 3300053156 Ga0500622_0000236 Ga0500622_0000236_4669_5838 371
1510 3300053177 Ga0500636_0009640 Ga0500636_0009640_1261_2409 371
1511 3300053724 Ga0500570_060536 Ga0500570_060536_229_1392 371
1512 3300059491 Ga0587070_000720 Ga0587070_000720_1319_2488 371
1513 3300059505 Ga0587083_0004811 Ga0587083_0004811_329_1498 371
1514 3300059507 Ga0587086_000607 Ga0587086_000607_512_1681 371
1515 3300059510 Ga0587090_000296 Ga0587090_000296_1167_2336 371
1516 3300059623 Ga0587101_000694 Ga0587101_000694_550_1719 371
1517 3300059623 Ga0587101_000876 Ga0587101_000876_74_1243 371
1518 3300059641 Ga0587068_000631 Ga0587068_000631_1456_2625 371
1519 3300059644 Ga0587075_002891 Ga0587075_002891_103_1272 371
1520 3300059645 Ga0587076_000849 Ga0587076_000849_512_1681 371
1521 3300060346 Ga0587111_0006959 Ga0587111_0006959_601_1770 371
1522 3300005328 Ga0070676_10058257 Ga0070676_100582573 372
1523 3300005334 Ga0068869_100052976 Ga0068869_1000529763 372
1524 3300005338 Ga0068868_100024313 Ga0068868_1000243132 372
1525 3300005339 Ga0070660_100001317 Ga0070660_10000131710 372
1526 3300005354 Ga0070675_100045668 Ga0070675_1000456682 372
1527 3300005459 Ga0068867_100016759 Ga0068867_1000167593 372
1528 3300005563 Ga0068855_100107915 Ga0068855_1001079152 372
1529 3300006195 Ga0075366_10081180 Ga0075366_100811802 372
1530 3300006846 Ga0075430_100023615 Ga0075430_1000236155 372
1531 3300006880 Ga0075429_100003825 Ga0075429_1000038253 372
1532 3300009093 Ga0105240_10005173 Ga0105240_1000517314 372
1533 3300009545 Ga0105237_10009389 Ga0105237_100093892 372
1534 3300010375 Ga0105239_10258439 Ga0105239_102584391 372
1535 3300013100 Ga0157373_10002505 Ga0157373_100025056 372
1536 3300013104 Ga0157370_10002966 Ga0157370_100029661 372
1537 3300013105 Ga0157369_10000724 Ga0157369_100007242 372
1538 3300013105 Ga0157369_10126414 Ga0157369_101264142 372
1539 3300013296 Ga0157374_10000067 Ga0157374_1000006726 372
1540 3300013296 Ga0157374_10140959 Ga0157374_101409591 372
1541 3300013307 Ga0157372_10006459 Ga0157372_100064598 372
1542 3300014497 Ga0182008_10001784 Ga0182008_100017844 372
1543 3300015262 Ga0182007_10035831 Ga0182007_100358312 372
1544 3300025228 Ga0209672_101060 Ga0209672_1010601 372
1545 3300025256 Ga0209759_1008599 Ga0209759_10085992 372
1546 3300025904 Ga0207647_10000176 Ga0207647_1000017633 372
1547 3300025907 Ga0207645_10009991 Ga0207645_100099913 372
1548 3300025908 Ga0207643_10067634 Ga0207643_100676342 372
1549 3300025913 Ga0207695_10002501 Ga0207695_1000250123 372
1550 3300025914 Ga0207671_10026808 Ga0207671_100268084 372
1551 3300025919 Ga0207657_10000843 Ga0207657_1000084314 372
1552 3300025926 Ga0207659_10004477 Ga0207659_100044777 372
1553 3300025937 Ga0207669_10105297 Ga0207669_101052972 372
1554 3300025938 Ga0207704_10087309 Ga0207704_100873091 372
1555 3300025940 Ga0207691_10013616 Ga0207691_100136163 372
1556 3300025942 Ga0207689_10099680 Ga0207689_100996802 372
1557 3300026023 Ga0207677_10006156 Ga0207677_100061562 372
1558 3300026089 Ga0207648_10021300 Ga0207648_100213004 372
1559 3300037466 Ga0395898_0021367 Ga0395898_0021367_2061_3197 372
1560 3300042005 Ga0439448_0000095 Ga0439448_0000095_2046_3182 372
1561 3300050508 nmdc:mga09592_3371_c1 nmdc:mga09592_3371_c1_2466_3638 372
1562 3300050509 nmdc:mga0qj67_13392_c1 nmdc:mga0qj67_13392_c1_4560_5732 372
1563 3300005367 Ga0070667_100002781 Ga0070667_10000278111 373
1564 3300005455 Ga0070663_100002931 Ga0070663_1000029312 373
1565 3300005548 Ga0070665_100234756 Ga0070665_1002347562 373
1566 3300005548 Ga0070665_100293540 Ga0070665_1002935402 373
1567 3300006195 Ga0075366_10005443 Ga0075366_100054432 373
1568 3300025986 Ga0207658_10006468 Ga0207658_100064685 373
1569 3300026067 Ga0207678_10002552 Ga0207678_100025522 373
1570 3300028379 Ga0268266_10145296 Ga0268266_101452962 373
1571 3300049521 Ga0501298_013028 Ga0501298_013028_53_1234 373
1572 3300049683 Ga0501253_006016 Ga0501253_006016_173_1354 373
1573 3300050493 nmdc:mga0k408_4539_c1 nmdc:mga0k408_4539_c1_234_1397 373
1574 3300005616 Ga0068852_100143431 Ga0068852_1001434312 374
1575 3300009148 Ga0105243_10015371 Ga0105243_100153713 374
1576 3300014745 Ga0157377_10000014 Ga0157377_10000014168 374
1577 3300025935 Ga0207709_10009473 Ga0207709_100094733 374
1578 3300026089 Ga0207648_10000142 Ga0207648_1000014255 374
1579 3300026142 Ga0207698_10118215 Ga0207698_101182152 374
1580 3300049579 Ga0501043_0000141 Ga0501043_0000141_39184_40437 374
1581 3300049580 Ga0501046_0000047 Ga0501046_0000047_20335_21588 374
1582 3300049581 Ga0501047_0000058 Ga0501047_0000058_119159_120412 374
1583 3300049582 Ga0501048_0002761 Ga0501048_0002761_1148_2401 374
1584 3300049649 Ga0501198_000002 Ga0501198_000002_49983_51155 374
1585 3300049662 Ga0501222_000002 Ga0501222_000002_137804_138976 374
1586 iso_pu_bacteria 2885266251 2885266961 375
1587 iso_pu_bacteria 2900577576 2900580112 375
1588 iso_pu_bacteria 2928058823 2928062719 375
1589 3300031250 Ga0265331_10008102 Ga0265331_100081021 376
1590 3300031251 Ga0265327_10000261 Ga0265327_1000026165 376
1591 iso_pu_bacteria 2596583598 2597028707 379
1592 iso_pu_bacteria 2599185178 2599445389 379
1593 3300003752 Ga0055539_1000172 Ga0055539_100017235 380
1594 3300003759 Ga0055525_1000662 Ga0055525_100066211 380
1595 3300003841 Ga0055541_1000370 Ga0055541_100037012 380
1596 3300025224 Ga0209784_100003 Ga0209784_100003591 380
1597 3300025225 Ga0209566_100002 Ga0209566_1000021634 380
1598 3300025225 Ga0209566_101006 Ga0209566_1010064 380
1599 3300025226 Ga0209674_100008 Ga0209674_100008555 380
1600 3300025230 Ga0209563_100004 Ga0209563_1000041047 380
1601 3300025253 Ga0209677_100009 Ga0209677_100009585 380
1602 3300001915 JGI24741J21665_1000199 JGI24741J21665_100019914 383
1603 3300001979 JGI24740J21852_10000895 JGI24740J21852_100008955 383
1604 3300001979 JGI24740J21852_10001585 JGI24740J21852_100015858 383
1605 3300002705 JGI25156J39149_1001438 JGI25156J39149_10014389 383
1606 3300002705 JGI25156J39149_1005219 JGI25156J39149_10052193 383
1607 3300002738 JGI25154J39366_1000235 JGI25154J39366_100023531 383
1608 3300003758 Ga0055532_1000002 Ga0055532_1000002120 383
1609 3300003758 Ga0055532_1000029 Ga0055532_1000029167 383
1610 3300003762 Ga0055542_1001549 Ga0055542_10015493 383
1611 3300003763 Ga0055529_1000062 Ga0055529_1000062136 383
1612 3300003841 Ga0055541_1000532 Ga0055541_10005322 383
1613 3300005339 Ga0070660_100066074 Ga0070660_1000660742 383
1614 3300005344 Ga0070661_100000139 Ga0070661_10000013919 383
1615 3300005366 Ga0070659_100001576 Ga0070659_10000157616 383
1616 3300005455 Ga0070663_100000006 Ga0070663_100000006193 383
1617 3300005564 Ga0070664_100000002 Ga0070664_10000000272 383
1618 3300005577 Ga0068857_100027590 Ga0068857_1000275903 383
1619 3300005578 Ga0068854_100000043 Ga0068854_10000004314 383
1620 3300005614 Ga0068856_100000028 Ga0068856_1000000285 383
1621 3300009093 Ga0105240_10088709 Ga0105240_100887094 383
1622 3300013100 Ga0157373_10036278 Ga0157373_100362783 383
1623 3300013102 Ga0157371_10000204 Ga0157371_1000020447 383
1624 3300013104 Ga0157370_10000013 Ga0157370_10000013159 383
1625 3300013105 Ga0157369_10002173 Ga0157369_1000217317 383
1626 3300014497 Ga0182008_10069701 Ga0182008_100697012 383
1627 3300015261 Ga0182006_1002284 Ga0182006_10022849 383
1628 3300015262 Ga0182007_10003073 Ga0182007_100030735 383
1629 3300020069 Ga0197907_11358827 Ga0197907_113588274 383
1630 3300020075 Ga0206349_1321444 Ga0206349_13214442 383
1631 3300020076 Ga0206355_1123131 Ga0206355_11231313 383
1632 3300020077 Ga0206351_10143154 Ga0206351_101431549 383
1633 3300020080 Ga0206350_10286196 Ga0206350_102861964 383
1634 3300020610 Ga0154015_1106824 Ga0154015_11068248 383
1635 3300022467 Ga0224712_10003779 Ga0224712_100037794 383
1636 3300025224 Ga0209784_100522 Ga0209784_1005223 383
1637 3300025225 Ga0209566_100731 Ga0209566_10073116 383
1638 3300025226 Ga0209674_100217 Ga0209674_10021716 383
1639 3300025228 Ga0209672_100052 Ga0209672_100052116 383
1640 3300025228 Ga0209672_100190 Ga0209672_10019017 383
1641 3300025229 Ga0209147_100002 Ga0209147_1000021652 383
1642 3300025230 Ga0209563_102380 Ga0209563_1023804 383
1643 3300025242 Ga0209258_100002 Ga0209258_1000021652 383
1644 3300025246 Ga0209646_1000022 Ga0209646_1000022406 383
1645 3300025254 Ga0209148_1000021 Ga0209148_1000021406 383
1646 3300025254 Ga0209148_1002487 Ga0209148_10024875 383
1647 3300025256 Ga0209759_1001285 Ga0209759_10012853 383
1648 3300025272 Ga0209455_1000021 Ga0209455_1000021239 383
1649 3300025913 Ga0207695_10004682 Ga0207695_1000468215 383
1650 3300025920 Ga0207649_10000193 Ga0207649_1000019334 383
1651 3300025932 Ga0207690_10007619 Ga0207690_100076196 383
1652 3300025945 Ga0207679_10000001 Ga0207679_10000001245 383
1653 3300025981 Ga0207640_10000098 Ga0207640_1000009814 383
1654 3300026067 Ga0207678_10000001 Ga0207678_10000001189 383
1655 3300026078 Ga0207702_10000009 Ga0207702_1000000938 383
1656 3300026116 Ga0207674_10001006 Ga0207674_100010068 383
1657 3300037418 Ga0395900_0030419 Ga0395900_0030419_1235_2386 383
1658 3300044693 Ga0466961_0000197 Ga0466961_0000197_5229_6380 383
1659 3300044735 Ga0466968_0003733 Ga0466968_0003733_1066_2217 383
1660 3300044765 Ga0466970_0001953 Ga0466970_0001953_5234_6385 383
1661 3300044842 Ga0466957_0039113 Ga0466957_0039113_40_1191 383
1662 3300045049 Ga0466959_0019040 Ga0466959_0019040_205_1356 383
1663 3300059477 Ga0587084_000476 Ga0587084_000476_1426_2577 383
1664 3300059492 Ga0587073_0004837 Ga0587073_0004837_491_1642 383
1665 3300059504 Ga0587082_000566 Ga0587082_000566_1516_2667 383
1666 3300059505 Ga0587083_0002910 Ga0587083_0002910_533_1684 383
1667 3300059508 Ga0587088_001141 Ga0587088_001141_58_1209 383
1668 3300059604 Ga0587098_002515 Ga0587098_002515_50_1201 383
1669 3300059623 Ga0587101_003309 Ga0587101_003309_174_1325 383
1670 3300059630 Ga0587128_005367 Ga0587128_005367_86_1237 383
1671 3300059640 Ga0587067_000005 Ga0587067_000005_2147_3298 383
1672 3300059643 Ga0587072_000020 Ga0587072_000020_6739_7890 383
1673 3300059644 Ga0587075_005763 Ga0587075_005763_281_1432 383
1674 3300059645 Ga0587076_005786 Ga0587076_005786_147_1298 383
1675 3300059647 Ga0587079_000879 Ga0587079_000879_475_1626 383
1676 3300059650 Ga0587104_000148 Ga0587104_000148_51_1202 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21016

RlmN_N

Ribosomal RNA large subunit methyltransferase N-terminal domain

36

95

0.98

PF04055

Radical_SAM

Radical SAM superfamily

138

314

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9549 5 337
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9544 5 338
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9493 5 337
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9488 5 338
5hr7-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn from escherichia coli with cross-linked in vitro transcribed trna 0.9357 4 362
ID Description Score Start End Superfamily
3rfaA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9932 5 65 1.10.150.530
3rfaB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9883 5 65 1.10.150.530
4pl1B01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9845 5 65 1.10.150.530
3rf9A01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9812 3 65 1.10.150.530
af_P36979_1_78_1.10.150.530 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9699 2 65 1.10.150.530
ID Description Score Start End GO Terms
AF-A0A4Q3IUE4-F1-model_v4 deleted 0.9863 1 107
AF-A0A418Y6T8-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN (EC 2.1.1.192) 0.9841 1 341 GO:0002935
GO:0005737
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A350QFG5-F1-model_v4 Bifunctional tRNA (Adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN 0.9805 3 94 GO:0008168
GO:0030488
GO:0070475
AF-A0A352S223-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN 0.979 1 171 GO:0008168
GO:0030488
GO:0046872
GO:0051539
GO:0070475
AF-A0A3D1GPL1-F1-model_v4 deleted 0.9775 4 99

Feature Viewer

pLDDT pTM Quality
86.96 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map