metagRoot

F495247

General Info

Members	Datasets	Scaffolds	Average Seq Length
1660	645	1551	436

Family's Representative Sequence

Representative Sequence	3300046660\|Ga0495625_0012405\|Ga0495625_0012405_2188_3693
Length	501
Sequence	LEANGNAAPLRDARERAYGWVGGLSPLLPTLIRDINARVTNLPQTGGLVKSQSANPLTEQFMKIKLAAFAPGLLALALASPAHAQVEVQWWHSMTGGLNEWVNDLAKQFNESQKDYKIVPTFKGNYDESMTAAVAAFRAGNAPHILQVFEVGTATMMSAKGAIKPVGEVMKQSGVSFDPKAYVPAVSGYYTAPNGEMLSFPFNSSTTIFYYNKDAFKAAGLDPNKAPTTWPEVVAAAAKLKASGSKCPYTTSWMSWVHLESFSTWHNTLFATQNNGFGGPSARLAFNSPLHLRHFDNLANMSKQGLFVYKGRASVAVPSFVSGECAMLTGSSGSYADVSKGAKFAYGLAALPYYPDVPGAPQNTAIGGASLWVMSGKKPAEYKGVAEFFKFLSSPDVQSASHKRTGYLPITTAAYQLTEKSGFYTEKPGTDVAVTQMIRKTTDKSRGIRLGNFVQIRTIIDEETEQIWAGKKDAKTALNDAVKRGNEQLERFEKQNKAPAP

Samples

	Sample ID	Description	Type	Environment
1	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
2	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
3	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
4	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
5	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
6	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
7	2547132374	Acidovorax radicis N35	Isolate	Unclassified
8	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
9	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
10	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
11	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
12	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
13	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
14	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
15	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
16	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
17	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
18	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
19	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
20	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
21	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
22	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
23	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
24	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
25	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
26	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
27	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
28	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
29	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
30	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
31	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
32	2643221658	Variovorax sp. Root411	Isolate	Unclassified
33	2643221672	Variovorax sp. Root434	Isolate	Unclassified
34	2643221683	Variovorax sp. Root473	Isolate	Unclassified
35	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
36	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
37	2721755523	Delftia sp. HK171	Isolate	Unclassified
38	2738541277	Variovorax sp. GV051	Isolate	Unclassified
39	2738541307	Variovorax sp. GV008	Isolate	Unclassified
40	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
41	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
42	2738543013	Variovorax sp. BT01	Isolate	Unclassified
43	2738543019	Variovorax sp. GV040	Isolate	Unclassified
44	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
45	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
46	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
47	2818991446	Variovorax sp. 1180	Isolate	Unclassified
48	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
49	2831864461	Roseateles noduli HZ7	Isolate	Nodule
50	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
51	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
52	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
53	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
54	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
55	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
56	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
57	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
58	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
59	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
60	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
61	2857576091	Pigmentiphaga sp. R-72090	Isolate	Unclassified
62	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
63	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
64	2876601092	Pantoea endophytica 596	Isolate	Unclassified
65	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
66	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
67	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
68	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
69	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
70	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
71	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
72	2885198086	Variovorax sp. 679	Isolate	Unclassified
73	2885211737	Variovorax sp. 553	Isolate	Unclassified
74	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
75	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
76	2899924645	Variovorax sp. 369	Isolate	Unclassified
77	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
78	2904456579	Variovorax sp. 2002	Isolate	Unclassified
79	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
80	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
81	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
82	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
83	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
84	2928037797	Variovorax sp. 1126	Isolate	Unclassified
85	2928044640	Variovorax sp. 1128	Isolate	Unclassified
86	2928051484	Variovorax sp. 1133	Isolate	Unclassified
87	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
88	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
89	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
90	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
91	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
92	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
93	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
94	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
95	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
96	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
97	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
98	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
99	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
100	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
101	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
102	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
103	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
104	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
105	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
106	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
107	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
108	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
109	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
110	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
111	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
112	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
113	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
114	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
115	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
116	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
117	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
118	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
119	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
120	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
121	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
122	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
123	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
124	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
125	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
126	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
127	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
128	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
129	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
130	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
131	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
132	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
133	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
134	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
135	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
136	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
137	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
138	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
139	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
140	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
141	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
142	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
143	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
144	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
145	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
146	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
147	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
148	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
149	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
150	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
151	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
152	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
153	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
154	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
155	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
156	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
157	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
158	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
159	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
160	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
161	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
162	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
163	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
164	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
165	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
166	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
167	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
168	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
169	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
170	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
171	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
172	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
173	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
174	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
175	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
176	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
177	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
178	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
179	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
180	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
181	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
182	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
183	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
184	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
185	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
186	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
187	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
188	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
189	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
190	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
191	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
192	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
193	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
194	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
195	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
196	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
197	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
198	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
199	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
200	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
201	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
202	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
203	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
204	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
205	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
206	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
207	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
208	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
209	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
210	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
211	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
212	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
213	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
214	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
215	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
216	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
217	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
218	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
219	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
220	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
221	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
222	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
223	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
224	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
225	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
226	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
227	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
228	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
229	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
230	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
231	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
232	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
233	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
234	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
235	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
236	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
237	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
238	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
239	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
240	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
241	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
242	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
243	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
244	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
245	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
246	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
247	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
248	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
249	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
250	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
251	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
252	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
253	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
254	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
255	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
256	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
257	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
258	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
259	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
260	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
261	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
262	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
263	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
264	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
265	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
266	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
267	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
268	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
269	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
270	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
271	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
272	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
273	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
274	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
275	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
276	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
277	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
278	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
279	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
280	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
281	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
282	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
283	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
284	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
285	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
286	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
287	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
288	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
289	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
290	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
291	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
292	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
293	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
294	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
295	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
296	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
297	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
299	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
365	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
366	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
372	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
377	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
381	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
382	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
383	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
384	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
385	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
386	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
387	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
388	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
389	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
390	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
391	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
392	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
393	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
394	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
395	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
396	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
397	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
398	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
399	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
400	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
401	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
402	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
403	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
404	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
405	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
406	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
407	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
408	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
409	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
410	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
411	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
412	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
413	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
414	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
415	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
416	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
417	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
418	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
419	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
420	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
421	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
422	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
423	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
424	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
425	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
426	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
427	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
428	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
429	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
430	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
431	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
432	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
433	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
434	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
435	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
436	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
437	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
438	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
439	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
440	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
441	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
442	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
443	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
444	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
445	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
446	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
447	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
448	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
449	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
450	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
451	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
452	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
453	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
454	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
455	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
456	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
457	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
458	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
459	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
460	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
461	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
462	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
463	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
464	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
465	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
466	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
467	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
468	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
469	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
470	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
471	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
472	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
473	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
474	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
475	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
476	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
477	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
478	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
479	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
480	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
481	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
482	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
483	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
484	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
485	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
486	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
487	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
488	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
489	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
490	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
491	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
492	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
493	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
494	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
495	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
496	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
497	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
498	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
499	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
500	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
501	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
502	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
503	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
504	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
505	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
506	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
507	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
508	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
509	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
510	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
511	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
512	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
513	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
514	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
515	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
516	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
517	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
518	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
519	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
520	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
521	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
522	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
523	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
524	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
525	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
526	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
527	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
528	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
529	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
530	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
531	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
532	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
533	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
534	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
535	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
536	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
537	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
538	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
539	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
540	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
541	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
542	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
543	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
544	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
545	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
546	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
547	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
548	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
549	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
550	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
551	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
552	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
553	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
554	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
555	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
556	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
557	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
558	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
559	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
560	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
561	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
562	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
563	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
564	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
565	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
566	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
567	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
568	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
569	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
570	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
571	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
572	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
573	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
574	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
575	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
576	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
577	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
578	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
579	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
580	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
581	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
582	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
583	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
584	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
585	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
586	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
587	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
588	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
589	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
590	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
591	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
592	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
593	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
594	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
595	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
596	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
597	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
598	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
599	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
600	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
601	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
602	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
603	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
604	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
605	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
606	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
607	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
608	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
609	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
610	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
611	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
612	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
613	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
614	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
615	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
616	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
617	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
618	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
619	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
620	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
621	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
622	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
623	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
624	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
625	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
626	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
627	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
628	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
629	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
630	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
631	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
632	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
633	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
634	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
635	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
636	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
637	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
638	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
639	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
640	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
641	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
642	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
643	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
644	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
645	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	93.25
Metatranscriptomes	0.18
Isolates	6.57

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.77
Nodule	1.14
Rhizoplane	1.87
Rhizosphere	69.58
Stem	0
Stem Tuber	0
Unclassified	9.64

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10000107	3300001989	Bacteria	25402
2	JGI25155J39150_1000022	3300002704	Bacteria	142950
3	JGI25156J39149_1000005	3300002705	Bacteria	263980
4	JGI25162J39368_1002554	3300002737	Bacteria	6924
5	JGI25154J39366_1000017	3300002738	Bacteria	252448
6	JGI25157J39369_1000003	3300002741	Bacteria	274935
7	JGI25157J39369_1000747	3300002741	Bacteria	17104
8	JGI25152J39213_1001428	3300002773	Bacteria	10325
9	JGI25150J39212_1001994	3300002774	Bacteria	5335
10	JGI25159J45721_1001646	3300002987	Bacteria	9081
11	JGI25159J45721_1001983	3300002987	Bacteria	8149
12	JGI25151J46595_10002783	3300003187	Bacteria	10136
13	JGI25151J46595_10003777	3300003187	Bacteria	8216
14	JGI25151J46595_10007702	3300003187	Bacteria	5245
15	JGI25151J46595_10009716	3300003187	Bacteria	4532
16	JGI25406J46586_10000977	3300003203	Bacteria	13433
17	JGI25153J46596_10005438	3300003215	Bacteria	6684
18	rootL2_10004438	3300003322	Bacteria	5836
19	rootL2_10021412	3300003322	Bacteria	3310
20	JGI25160J50197_1000273	3300003354	Bacteria	38119
21	JGI25161J50226_1000095	3300003374	Bacteria	72343
22	Ga0055532_1000271	3300003758	Bacteria	33888
23	Ga0055525_1000004	3300003759	Bacteria	888039
24	Ga0055527_1001088	3300003760	Bacteria	6375
25	Ga0055535_1000380	3300003761	Bacteria	42008
26	Ga0055542_1000062	3300003762	Bacteria	161494
27	Ga0055526_1000968	3300003771	Bacteria	21218
28	Ga0055526_1006110	3300003771	Bacteria	6642
29	Ga0055526_1006746	3300003771	Bacteria	6148
30	Ga0055526_1014527	3300003771	Bacteria	3231
31	Ga0055537_1000483	3300003773	Bacteria	24708
32	Ga0055537_1000717	3300003773	Bacteria	17146
33	Ga0055537_1002502	3300003773	Bacteria	6113
34	Ga0055524_1000073	3300003775	Bacteria	123033
35	Ga0055524_1000658	3300003775	Bacteria	24412
36	Ga0055524_1001688	3300003775	Bacteria	12293
37	Ga0055524_1022732	3300003775	Bacteria	2039
38	Ga0055536_1000060	3300003781	Bacteria	102699
39	Ga0055536_1004647	3300003781	Bacteria	6945
40	Ga0055536_1006788	3300003781	Bacteria	5240
41	Ga0055536_1022945	3300003781	Bacteria	1847
42	Ga0055534_1000337	3300003784	Bacteria	30592
43	Ga0055534_1000467	3300003784	Bacteria	22933
44	Ga0055534_1000548	3300003784	Bacteria	20007
45	Ga0055534_1000929	3300003784	Bacteria	13182
46	Ga0055534_1001861	3300003784	Bacteria	7873
47	Ga0055528_1007433	3300003790	Bacteria	4844
48	Ga0055530_10001136	3300003791	Bacteria	20712
49	Ga0055530_10004473	3300003791	Bacteria	7172
50	Ga0055530_10011023	3300003791	Bacteria	3281
51	Ga0055540_1000037	3300003792	Bacteria	162957
52	Ga0055540_1000202	3300003792	Bacteria	57757
53	Ga0055540_1001461	3300003792	Bacteria	14088
54	Ga0055540_1007521	3300003792	Bacteria	4090
55	Ga0055531_10000007	3300003794	Bacteria	225289
56	Ga0055531_10000112	3300003794	Bacteria	89016
57	Ga0055531_10001286	3300003794	Bacteria	18915
58	Ga0055531_10001923	3300003794	Bacteria	14525
59	Ga0055531_10011360	3300003794	Bacteria	4307
60	Ga0058692_1000039	3300003856	Bacteria	133315
61	Ga0058692_1000291	3300003856	Bacteria	25903
62	Ga0058692_1000442	3300003856	Bacteria	18875
63	Ga0058692_1000709	3300003856	Bacteria	13656
64	Ga0058692_1002728	3300003856	Bacteria	5808
65	Ga0058692_1003453	3300003856	Bacteria	4872
66	Ga0055543_1000218	3300004625	Bacteria	46120
67	Ga0055543_1002869	3300004625	Bacteria	5424
68	Ga0065165_1000016	3300005262	Bacteria	286248
69	Ga0065165_1000942	3300005262	Bacteria	37104
70	Ga0065165_1003934	3300005262	Bacteria	9777
71	Ga0065165_1013762	3300005262	Bacteria	3188
72	Ga0065165_1014362	3300005262	Bacteria	3080
73	Ga0065704_10072179	3300005289	Bacteria	9000
74	Ga0065704_10079023	3300005289	Bacteria	4279
75	Ga0065715_10179597	3300005293	Bacteria	1486
76	Ga0065707_10083647	3300005295	Bacteria	8552
77	Ga0065707_10143859	3300005295	Bacteria	1738
78	Ga0070658_10003011	3300005327	Bacteria	13938
79	Ga0070658_10037598	3300005327	Bacteria	3903
80	Ga0070658_10102728	3300005327	Bacteria	2364
81	Ga0070658_10154433	3300005327	Bacteria	1923
82	Ga0070676_10002537	3300005328	Bacteria	9382
83	Ga0070676_10044429	3300005328	Bacteria	2585
84	Ga0070683_100022694	3300005329	Bacteria	5612
85	Ga0070683_100057870	3300005329	Bacteria	3601
86	Ga0070690_100011726	3300005330	Bacteria	5136
87	Ga0070670_100000655	3300005331	Bacteria	26906
88	Ga0070670_100018023	3300005331	Bacteria	6059
89	Ga0070670_100018207	3300005331	Bacteria	6027
90	Ga0070670_100048709	3300005331	Bacteria	3646
91	Ga0070670_100056163	3300005331	Bacteria	3379
92	Ga0070670_100119152	3300005331	Bacteria	2276
93	Ga0070670_100140245	3300005331	Bacteria	2090
94	Ga0070670_100149189	3300005331	Bacteria	2023
95	Ga0070677_10026317	3300005333	Bacteria	2180
96	Ga0068869_100002039	3300005334	Bacteria	12140
97	Ga0068869_100041135	3300005334	Bacteria	3308
98	Ga0068869_100061697	3300005334	Bacteria	2750
99	Ga0070666_10027838	3300005335	Bacteria	3705
100	Ga0070680_100043209	3300005336	Bacteria	3661
101	Ga0070680_100074544	3300005336	Bacteria	2792
102	Ga0070680_100216976	3300005336	Bacteria	1614
103	Ga0070682_100045907	3300005337	Bacteria	2710
104	Ga0070682_100081811	3300005337	Bacteria	2092
105	Ga0068868_100001312	3300005338	Bacteria	17144
106	Ga0068868_100034469	3300005338	Bacteria	3908
107	Ga0068868_100059565	3300005338	Bacteria	3021
108	Ga0070660_100030267	3300005339	Bacteria	4061
109	Ga0070660_100058604	3300005339	Bacteria	2985
110	Ga0070660_100061785	3300005339	Bacteria	2909
111	Ga0070689_100035794	3300005340	Bacteria	3794
112	Ga0070661_100005150	3300005344	Bacteria	9002
113	Ga0070661_100014669	3300005344	Bacteria	5525
114	Ga0070661_100054923	3300005344	Bacteria	2917
115	Ga0070661_100106474	3300005344	Bacteria	2091
116	Ga0070661_100172581	3300005344	Bacteria	1642
117	Ga0070661_100234732	3300005344	Bacteria	1410
118	Ga0070692_10046303	3300005345	Bacteria	2247
119	Ga0070668_100010679	3300005347	Bacteria	6828
120	Ga0070668_100052341	3300005347	Bacteria	3147
121	Ga0070668_100058264	3300005347	Bacteria	2988
122	Ga0070668_100062460	3300005347	Bacteria	2886
123	Ga0070669_100005401	3300005353	Bacteria	9218
124	Ga0070669_100021493	3300005353	Bacteria	4611
125	Ga0070669_100074591	3300005353	Bacteria	2515
126	Ga0070669_100080628	3300005353	Bacteria	2423
127	Ga0070675_100002072	3300005354	Bacteria	14858
128	Ga0070675_100002276	3300005354	Bacteria	14252
129	Ga0070675_100058320	3300005354	Bacteria	3184
130	Ga0070675_100078798	3300005354	Bacteria	2744
131	Ga0070675_100208047	3300005354	Bacteria	1700
132	Ga0070671_100011136	3300005355	Bacteria	7224
133	Ga0070671_100014642	3300005355	Bacteria	6341
134	Ga0070671_100016334	3300005355	Bacteria	6002
135	Ga0070671_100039869	3300005355	Bacteria	3899
136	Ga0070671_100060152	3300005355	Bacteria	3163
137	Ga0070671_100062719	3300005355	Bacteria	3094
138	Ga0070671_100096888	3300005355	Bacteria	2474
139	Ga0070671_100280307	3300005355	Bacteria	1418
140	Ga0070674_100027721	3300005356	Bacteria	3714
141	Ga0070674_100035402	3300005356	Bacteria	3343
142	Ga0070674_100075881	3300005356	Bacteria	2389
143	Ga0070674_100116276	3300005356	Bacteria	1973
144	Ga0070673_100010612	3300005364	Bacteria	6243
145	Ga0070673_100013521	3300005364	Bacteria	5651
146	Ga0070673_100231207	3300005364	Bacteria	1604
147	Ga0070659_100000722	3300005366	Bacteria	23972
148	Ga0070659_100025249	3300005366	Bacteria	4561
149	Ga0070659_100028792	3300005366	Bacteria	4291
150	Ga0070659_100039166	3300005366	Bacteria	3699
151	Ga0070659_100163697	3300005366	Bacteria	1820
152	Ga0070667_100027408	3300005367	Bacteria	4739
153	Ga0070667_100063891	3300005367	Bacteria	3122
154	Ga0070667_100085520	3300005367	Bacteria	2705
155	Ga0070667_100152503	3300005367	Bacteria	2030
156	Ga0070709_10012257	3300005434	Bacteria	4795
157	Ga0070709_10012358	3300005434	Bacteria	4777
158	Ga0070709_10074315	3300005434	Bacteria	2202
159	Ga0070709_10116577	3300005434	Bacteria	1803
160	Ga0070714_100116842	3300005435	Bacteria	2368
161	Ga0070713_100012928	3300005436	Bacteria	6144
162	Ga0070713_100034409	3300005436	Bacteria	4070
163	Ga0070713_100128246	3300005436	Bacteria	2234
164	Ga0070710_10047349	3300005437	Bacteria	2398
165	Ga0070701_10053676	3300005438	Bacteria	2099
166	Ga0070701_10106001	3300005438	Bacteria	1564
167	Ga0070711_100004600	3300005439	Bacteria	8166
168	Ga0070711_100061747	3300005439	Bacteria	2609
169	Ga0070705_100136038	3300005440	Bacteria	1610
170	Ga0070700_100000839	3300005441	Bacteria	15145
171	Ga0070700_100077353	3300005441	Bacteria	2139
172	Ga0070700_100131794	3300005441	Bacteria	1688
173	Ga0070694_100017278	3300005444	Bacteria	4556
174	Ga0070694_100019073	3300005444	Bacteria	4359
175	Ga0070694_100065476	3300005444	Bacteria	2490
176	Ga0070694_100076118	3300005444	Bacteria	2323
177	Ga0070663_100012806	3300005455	Bacteria	5320
178	Ga0070663_100032290	3300005455	Bacteria	3607
179	Ga0070663_100088288	3300005455	Bacteria	2292
180	Ga0070678_100022651	3300005456	Bacteria	4168
181	Ga0070678_100023376	3300005456	Bacteria	4118
182	Ga0070678_100036246	3300005456	Bacteria	3451
183	Ga0070662_100001216	3300005457	Bacteria	15804
184	Ga0070662_100020556	3300005457	Bacteria	4497
185	Ga0070662_100020619	3300005457	Bacteria	4493
186	Ga0070662_100111838	3300005457	Bacteria	2081
187	Ga0070662_100141538	3300005457	Bacteria	1865
188	Ga0070681_10015201	3300005458	Bacteria	7656
189	Ga0070681_10017457	3300005458	Bacteria	7173
190	Ga0070681_10047156	3300005458	Bacteria	4307
191	Ga0070681_10098398	3300005458	Bacteria	2871
192	Ga0068867_100000081	3300005459	Bacteria	59361
193	Ga0068867_100001697	3300005459	Bacteria	15357
194	Ga0068867_100002106	3300005459	Bacteria	13948
195	Ga0068867_100024737	3300005459	Bacteria	4303
196	Ga0068867_100042493	3300005459	Bacteria	3326
197	Ga0068867_100042821	3300005459	Bacteria	3314
198	Ga0068867_100220926	3300005459	Bacteria	1527
199	Ga0070685_10084032	3300005466	Bacteria	1914
200	Ga0070706_100000463	3300005467	Bacteria	48079
201	Ga0070706_100067449	3300005467	Bacteria	3309
202	Ga0070706_100076557	3300005467	Bacteria	3096
203	Ga0070706_100215096	3300005467	Bacteria	1794
204	Ga0070707_100011237	3300005468	Bacteria	8345
205	Ga0070707_100075144	3300005468	Bacteria	3259
206	Ga0070707_100186478	3300005468	Bacteria	2023
207	Ga0070698_100038594	3300005471	Bacteria	4920
208	Ga0070698_100171427	3300005471	Bacteria	2111
209	Ga0070699_100012659	3300005518	Bacteria	7276
210	Ga0070699_100019325	3300005518	Bacteria	5865
211	Ga0070699_100027789	3300005518	Bacteria	4878
212	Ga0070699_100028721	3300005518	Bacteria	4796
213	Ga0070699_100043010	3300005518	Bacteria	3910
214	Ga0070679_100042804	3300005530	Bacteria	4510
215	Ga0070679_100043504	3300005530	Bacteria	4473
216	Ga0070679_100148911	3300005530	Bacteria	2318
217	Ga0070684_100019385	3300005535	Bacteria	5626
218	Ga0070684_100020668	3300005535	Bacteria	5460
219	Ga0070697_100033017	3300005536	Bacteria	4167
220	Ga0068853_100001296	3300005539	Bacteria	17963
221	Ga0068853_100020194	3300005539	Bacteria	5538
222	Ga0068853_100094553	3300005539	Bacteria	2633
223	Ga0070672_100002859	3300005543	Bacteria	11085
224	Ga0070672_100013320	3300005543	Bacteria	5805
225	Ga0070672_100018087	3300005543	Bacteria	5088
226	Ga0070672_100035554	3300005543	Bacteria	3787
227	Ga0070672_100041756	3300005543	Bacteria	3528
228	Ga0070672_100042391	3300005543	Bacteria	3504
229	Ga0070672_100272863	3300005543	Bacteria	1428
230	Ga0070695_100055428	3300005545	Bacteria	2555
231	Ga0070695_100114020	3300005545	Bacteria	1839
232	Ga0070696_100003263	3300005546	Bacteria	10818
233	Ga0070696_100035707	3300005546	Bacteria	3424
234	Ga0070696_100051492	3300005546	Bacteria	2864
235	Ga0070693_100007795	3300005547	Bacteria	5251
236	Ga0070693_100021450	3300005547	Bacteria	3422
237	Ga0070665_100013839	3300005548	Bacteria	8114
238	Ga0070665_100019707	3300005548	Bacteria	6772
239	Ga0070665_100022394	3300005548	Bacteria	6358
240	Ga0070665_100225384	3300005548	Bacteria	1875
241	Ga0070704_100004279	3300005549	Bacteria	8250
242	Ga0070704_100023273	3300005549	Bacteria	4042
243	Ga0070704_100237986	3300005549	Bacteria	1489
244	Ga0068855_100016883	3300005563	Bacteria	8778
245	Ga0068855_100019918	3300005563	Bacteria	8057
246	Ga0068855_100020624	3300005563	Bacteria	7902
247	Ga0068855_100033144	3300005563	Bacteria	6167
248	Ga0068855_100036519	3300005563	Bacteria	5848
249	Ga0068855_100043350	3300005563	Bacteria	5330
250	Ga0070664_100015251	3300005564	Bacteria	6281
251	Ga0070664_100023069	3300005564	Bacteria	5136
252	Ga0070664_100026646	3300005564	Bacteria	4797
253	Ga0070664_100052551	3300005564	Bacteria	3452
254	Ga0070664_100115380	3300005564	Bacteria	2347
255	Ga0068857_100094504	3300005577	Bacteria	2677
256	Ga0068857_100108286	3300005577	Bacteria	2497
257	Ga0068857_100199948	3300005577	Bacteria	1822
258	Ga0068854_100008019	3300005578	Bacteria	6766
259	Ga0068854_100016437	3300005578	Bacteria	4933
260	Ga0068854_100017824	3300005578	Bacteria	4759
261	Ga0068854_100027690	3300005578	Bacteria	3909
262	Ga0068854_100063337	3300005578	Bacteria	2684
263	Ga0068854_100113326	3300005578	Bacteria	2048
264	Ga0068856_100003497	3300005614	Bacteria	15861
265	Ga0068856_100052020	3300005614	Bacteria	4038
266	Ga0068856_100059045	3300005614	Bacteria	3788
267	Ga0068856_100079103	3300005614	Bacteria	3260
268	Ga0068852_100005381	3300005616	Bacteria	9152
269	Ga0068852_100011356	3300005616	Bacteria	6701
270	Ga0068852_100062192	3300005616	Bacteria	3247
271	Ga0068852_100071351	3300005616	Bacteria	3049
272	Ga0068852_100130031	3300005616	Bacteria	2318
273	Ga0068852_100224054	3300005616	Bacteria	1789
274	Ga0068859_100006667	3300005617	Bacteria	11721
275	Ga0068859_100066678	3300005617	Bacteria	3634
276	Ga0068859_100100311	3300005617	Bacteria	2951
277	Ga0068859_100101706	3300005617	Bacteria	2931
278	Ga0068864_100001804	3300005618	Bacteria	17566
279	Ga0068864_100006924	3300005618	Bacteria	9300
280	Ga0068864_100016465	3300005618	Bacteria	6153
281	Ga0068864_100023957	3300005618	Bacteria	5130
282	Ga0068864_100049117	3300005618	Bacteria	3629
283	Ga0068866_10006603	3300005718	Bacteria	4838
284	Ga0068866_10024029	3300005718	Bacteria	2842
285	Ga0068861_100001859	3300005719	Bacteria	13589
286	Ga0068861_100020979	3300005719	Bacteria	4689
287	Ga0068861_100024799	3300005719	Bacteria	4341
288	Ga0068861_100040101	3300005719	Bacteria	3499
289	Ga0068861_100204498	3300005719	Bacteria	1659
290	Ga0068851_10001662	3300005834	Bacteria	9748
291	Ga0068851_10027158	3300005834	Bacteria	2819
292	Ga0068863_100011245	3300005841	Bacteria	8671
293	Ga0068863_100025859	3300005841	Bacteria	5600
294	Ga0068858_100005397	3300005842	Bacteria	12526
295	Ga0068858_100015128	3300005842	Bacteria	7256
296	Ga0068858_100015409	3300005842	Bacteria	7190
297	Ga0068858_100071444	3300005842	Bacteria	3219
298	Ga0068860_100004248	3300005843	Bacteria	14675
299	Ga0068860_100004659	3300005843	Bacteria	14002
300	Ga0068860_100005775	3300005843	Bacteria	12470
301	Ga0068860_100043724	3300005843	Bacteria	4271
302	Ga0068860_100326033	3300005843	Bacteria	1508
303	Ga0068862_100004558	3300005844	Bacteria	11686
304	Ga0068862_100018849	3300005844	Bacteria	5751
305	Ga0068862_100088092	3300005844	Bacteria	2700
306	Ga0081455_10075970	3300005937	Bacteria	2770
307	Ga0081539_10000917	3300005985	Bacteria	55614
308	Ga0081539_10001716	3300005985	Bacteria	35112
309	Ga0070717_10205910	3300006028	Bacteria	1725
310	Ga0075365_10006309	3300006038	Bacteria	6511
311	Ga0075365_10010415	3300006038	Bacteria	5415
312	Ga0075365_10029292	3300006038	Bacteria	3518
313	Ga0075365_10048041	3300006038	Bacteria	2808
314	Ga0075365_10108442	3300006038	Bacteria	1907
315	Ga0075368_10044752	3300006042	Bacteria	1747
316	Ga0075363_100009368	3300006048	Bacteria	4602
317	Ga0075363_100014193	3300006048	Bacteria	3885
318	Ga0075363_100015200	3300006048	Bacteria	3778
319	Ga0075364_10065161	3300006051	Bacteria	2391
320	Ga0075364_10081682	3300006051	Bacteria	2137
321	Ga0075362_10005983	3300006177	Bacteria	4499
322	Ga0075362_10039533	3300006177	Bacteria	2074
323	Ga0075367_10013296	3300006178	Bacteria	4420
324	Ga0075367_10089875	3300006178	Bacteria	1867
325	Ga0075367_10104720	3300006178	Bacteria	1732
326	Ga0075369_10010911	3300006186	Bacteria	3560
327	Ga0075369_10013394	3300006186	Bacteria	3255
328	Ga0075366_10000565	3300006195	Bacteria	17352
329	Ga0075366_10003522	3300006195	Bacteria	8269
330	Ga0075366_10004894	3300006195	Bacteria	7225
331	Ga0075366_10007992	3300006195	Bacteria	5859
332	Ga0075366_10010633	3300006195	Bacteria	5169
333	Ga0075366_10023928	3300006195	Bacteria	3559
334	Ga0075366_10026377	3300006195	Bacteria	3403
335	Ga0075366_10028720	3300006195	Bacteria	3265
336	Ga0075366_10034048	3300006195	Bacteria	3001
337	Ga0075366_10040231	3300006195	Bacteria	2765
338	Ga0075366_10054534	3300006195	Bacteria	2374
339	Ga0075366_10074127	3300006195	Bacteria	2029
340	Ga0075366_10096754	3300006195	Bacteria	1770
341	Ga0075366_10119325	3300006195	Bacteria	1589
342	Ga0075366_10151653	3300006195	Bacteria	1403
343	Ga0097621_100009452	3300006237	Bacteria	7077
344	Ga0097621_100013544	3300006237	Bacteria	6080
345	Ga0097621_100018736	3300006237	Bacteria	5295
346	Ga0097621_100025502	3300006237	Bacteria	4626
347	Ga0097621_100026295	3300006237	Bacteria	4563
348	Ga0097621_100053592	3300006237	Bacteria	3288
349	Ga0097621_100130284	3300006237	Bacteria	2141
350	Ga0097621_100161786	3300006237	Bacteria	1925
351	Ga0097621_100255942	3300006237	Bacteria	1535
352	Ga0075370_10000350	3300006353	Bacteria	16757
353	Ga0075370_10001008	3300006353	Bacteria	11658
354	Ga0075370_10001666	3300006353	Bacteria	9827
355	Ga0075370_10004844	3300006353	Bacteria	6598
356	Ga0075370_10012071	3300006353	Bacteria	4556
357	Ga0075370_10012595	3300006353	Bacteria	4475
358	Ga0075370_10037247	3300006353	Bacteria	2734
359	Ga0075370_10068955	3300006353	Bacteria	2020
360	Ga0075370_10077352	3300006353	Bacteria	1909
361	Ga0068871_100006413	3300006358	Bacteria	8323
362	Ga0068871_100017680	3300006358	Bacteria	5401
363	Ga0068871_100017837	3300006358	Bacteria	5381
364	Ga0068871_100020611	3300006358	Bacteria	5054
365	Ga0068871_100026397	3300006358	Bacteria	4532
366	Ga0075428_100006866	3300006844	Bacteria	12647
367	Ga0075428_100059027	3300006844	Bacteria	4201
368	Ga0075428_100116127	3300006844	Bacteria	2915
369	Ga0075428_100185526	3300006844	Bacteria	2251
370	Ga0075430_100037043	3300006846	Bacteria	4134
371	Ga0075431_100009882	3300006847	Bacteria	9579
372	Ga0075431_100045869	3300006847	Bacteria	4505
373	Ga0075433_10270596	3300006852	Bacteria	1505
374	Ga0075434_100000247	3300006871	Bacteria	37944
375	Ga0075434_100016216	3300006871	Bacteria	7162
376	Ga0075429_100000463	3300006880	Bacteria	30330
377	Ga0075429_100012319	3300006880	Bacteria	7418
378	Ga0075429_100086523	3300006880	Bacteria	2732
379	Ga0068865_100041887	3300006881	Bacteria	3119
380	Ga0068865_100056658	3300006881	Bacteria	2731
381	Ga0068865_100061617	3300006881	Bacteria	2630
382	Ga0068865_100072442	3300006881	Bacteria	2447
383	Ga0068865_100169693	3300006881	Bacteria	1671
384	Ga0075436_100000153	3300006914	Bacteria	42824
385	Ga0075436_100002208	3300006914	Bacteria	13443
386	Ga0075436_100021164	3300006914	Bacteria	4463
387	Ga0075436_100031066	3300006914	Bacteria	3676
388	Ga0075436_100055576	3300006914	Bacteria	2734
389	Ga0097620_100006667	3300006931	Bacteria	11721
390	Ga0097620_100066676	3300006931	Bacteria	3634
391	Ga0097620_100100310	3300006931	Bacteria	2951
392	Ga0097620_100101706	3300006931	Bacteria	2931
393	Ga0079104_1000055	3300006946	Bacteria	166522
394	Ga0079104_1014636	3300006946	Bacteria	2358
395	Ga0099826_10000020	3300006948	Bacteria	183920
396	Ga0099826_10043559	3300006948	Bacteria	3088
397	Ga0099794_10021968	3300007265	Bacteria	2904
398	Ga0099795_10004825	3300007788	Bacteria	3520
399	Ga0099795_10021877	3300007788	Bacteria	2104
400	Ga0105251_10001513	3300009011	Bacteria	19971
401	Ga0105251_10011195	3300009011	Bacteria	5137
402	Ga0105244_10010701	3300009036	Bacteria	5546
403	Ga0105250_10003376	3300009092	Bacteria	7576
404	Ga0105240_10003800	3300009093	Bacteria	23327
405	Ga0105240_10018026	3300009093	Bacteria	9496
406	Ga0105240_10115080	3300009093	Bacteria	3248
407	Ga0105240_10149092	3300009093	Bacteria	2788
408	Ga0111539_10007501	3300009094	Bacteria	13961
409	Ga0111539_10046081	3300009094	Bacteria	5218
410	Ga0105245_10007918	3300009098	Bacteria	9292
411	Ga0105245_10088093	3300009098	Bacteria	2850
412	Ga0114129_10005167	3300009147	Bacteria	18369
413	Ga0114129_10018075	3300009147	Bacteria	10043
414	Ga0114129_10213674	3300009147	Bacteria	2606
415	Ga0105243_10004191	3300009148	Bacteria	11432
416	Ga0105243_10010403	3300009148	Bacteria	7065
417	Ga0105243_10043569	3300009148	Bacteria	3517
418	Ga0105243_10043909	3300009148	Bacteria	3505
419	Ga0105243_10071599	3300009148	Bacteria	2804
420	Ga0105243_10077762	3300009148	Bacteria	2699
421	Ga0105243_10093592	3300009148	Bacteria	2480
422	Ga0105241_10065167	3300009174	Bacteria	2815
423	Ga0105241_10089016	3300009174	Bacteria	2432
424	Ga0105241_10171876	3300009174	Bacteria	1790
425	Ga0105242_10001697	3300009176	Bacteria	17431
426	Ga0105242_10002028	3300009176	Bacteria	15933
427	Ga0105242_10040904	3300009176	Bacteria	3736
428	Ga0105242_10041709	3300009176	Bacteria	3703
429	Ga0105242_10075746	3300009176	Bacteria	2802
430	Ga0105242_10202976	3300009176	Bacteria	1762
431	Ga0105248_10002030	3300009177	Bacteria	22461
432	Ga0105248_10015980	3300009177	Bacteria	8263
433	Ga0105248_10024858	3300009177	Bacteria	6658
434	Ga0105248_10059994	3300009177	Bacteria	4272
435	Ga0105248_10066533	3300009177	Bacteria	4046
436	Ga0105248_10097012	3300009177	Bacteria	3321
437	Ga0105248_10127574	3300009177	Bacteria	2870
438	Ga0105248_10221961	3300009177	Bacteria	2128
439	Ga0105248_10333486	3300009177	Bacteria	1708
440	Ga0105237_10012592	3300009545	Bacteria	8908
441	Ga0105238_10006104	3300009551	Bacteria	11950
442	Ga0105238_10020927	3300009551	Bacteria	6664
443	Ga0105238_10096631	3300009551	Bacteria	2940
444	Ga0105238_10099453	3300009551	Bacteria	2892
445	Ga0105238_10109604	3300009551	Bacteria	2742
446	Ga0105238_10133369	3300009551	Bacteria	2462
447	Ga0105249_10001475	3300009553	Bacteria	20614
448	Ga0105249_10054022	3300009553	Bacteria	3672
449	Ga0105249_10153732	3300009553	Bacteria	2217
450	Ga0105249_10192154	3300009553	Bacteria	1993
451	Ga0105249_10237119	3300009553	Bacteria	1802
452	Ga0099796_10007483	3300010159	Bacteria	2857
453	Ga0105239_10046513	3300010375	Bacteria	4755
454	Ga0105239_10179760	3300010375	Bacteria	2367
455	Ga0105246_10002163	3300011119	Bacteria	11864
456	Ga0105246_10032227	3300011119	Bacteria	3475
457	Ga0105246_10141477	3300011119	Bacteria	1810
458	Ga0157319_1000008	3300012497	Bacteria	315600
459	Ga0157347_1000789	3300012502	Bacteria	2232
460	Ga0157373_10000081	3300013100	Bacteria	82343
461	Ga0157373_10008814	3300013100	Bacteria	7474
462	Ga0157373_10016114	3300013100	Bacteria	5455
463	Ga0157373_10018126	3300013100	Bacteria	5126
464	Ga0157373_10026235	3300013100	Bacteria	4210
465	Ga0157371_10001827	3300013102	Bacteria	21447
466	Ga0157371_10020896	3300013102	Bacteria	4814
467	Ga0157371_10065579	3300013102	Bacteria	2572
468	Ga0157371_10165541	3300013102	Bacteria	1579
469	Ga0157370_10027854	3300013104	Bacteria	5568
470	Ga0157370_10091315	3300013104	Bacteria	2859
471	Ga0157370_10227594	3300013104	Bacteria	1726
472	Ga0157369_10001065	3300013105	Bacteria	34435
473	Ga0157369_10002069	3300013105	Bacteria	24238
474	Ga0157369_10007564	3300013105	Bacteria	12501
475	Ga0157369_10083686	3300013105	Bacteria	3412
476	Ga0157369_10179640	3300013105	Bacteria	2227
477	Ga0157374_10042081	3300013296	Bacteria	4213
478	Ga0157374_10075672	3300013296	Bacteria	3181
479	Ga0157378_10001998	3300013297	Bacteria	18236
480	Ga0163162_10000314	3300013306	Bacteria	44769
481	Ga0163162_10016393	3300013306	Bacteria	7242
482	Ga0163162_10021214	3300013306	Bacteria	6392
483	Ga0163162_10030137	3300013306	Bacteria	5375
484	Ga0163162_10085712	3300013306	Bacteria	3227
485	Ga0163162_10119864	3300013306	Bacteria	2734
486	Ga0163162_10154753	3300013306	Bacteria	2412
487	Ga0163162_10168017	3300013306	Bacteria	2318
488	Ga0163162_10206137	3300013306	Bacteria	2095
489	Ga0157372_10001667	3300013307	Bacteria	24062
490	Ga0157372_10014005	3300013307	Bacteria	8567
491	Ga0157372_10133919	3300013307	Bacteria	2853
492	Ga0157372_10145265	3300013307	Bacteria	2735
493	Ga0157372_10152193	3300013307	Bacteria	2671
494	Ga0157372_10181148	3300013307	Bacteria	2439
495	Ga0157372_10246392	3300013307	Bacteria	2074
496	Ga0157372_10296465	3300013307	Bacteria	1881
497	Ga0157375_10010300	3300013308	Bacteria	8228
498	Ga0157375_10031315	3300013308	Bacteria	5026
499	Ga0157375_10061416	3300013308	Bacteria	3731
500	Ga0157375_10078372	3300013308	Bacteria	3337
501	Ga0157375_10154851	3300013308	Bacteria	2430
502	Ga0157375_10171662	3300013308	Bacteria	2316
503	Ga0157375_10296407	3300013308	Bacteria	1780
504	Ga0163163_10001639	3300014325	Bacteria	18841
505	Ga0163163_10063892	3300014325	Bacteria	3652
506	Ga0163163_10257800	3300014325	Bacteria	1795
507	Ga0163163_10382441	3300014325	Bacteria	1465
508	Ga0157380_10008262	3300014326	Bacteria	7416
509	Ga0157380_10022246	3300014326	Bacteria	4768
510	Ga0157380_10056722	3300014326	Bacteria	3117
511	Ga0182008_10004122	3300014497	Bacteria	8561
512	Ga0182008_10007102	3300014497	Bacteria	6202
513	Ga0182008_10009794	3300014497	Bacteria	5157
514	Ga0182008_10084240	3300014497	Bacteria	1566
515	Ga0157377_10000048	3300014745	Bacteria	94061
516	Ga0157379_10010467	3300014968	Bacteria	8085
517	Ga0157379_10030571	3300014968	Bacteria	4795
518	Ga0157379_10037678	3300014968	Bacteria	4313
519	Ga0157379_10050970	3300014968	Bacteria	3696
520	Ga0157379_10062117	3300014968	Bacteria	3341
521	Ga0157379_10104187	3300014968	Bacteria	2546
522	Ga0157379_10201015	3300014968	Bacteria	1802
523	Ga0157376_10001621	3300014969	Bacteria	14892
524	Ga0157376_10016439	3300014969	Bacteria	5618
525	Ga0157376_10036986	3300014969	Bacteria	3958
526	Ga0157376_10061988	3300014969	Bacteria	3145
527	Ga0157376_10063786	3300014969	Bacteria	3105
528	Ga0182006_1008526	3300015261	Bacteria	4645
529	Ga0182006_1014990	3300015261	Bacteria	3330
530	Ga0182006_1019059	3300015261	Bacteria	2893
531	Ga0182006_1046030	3300015261	Bacteria	1696
532	Ga0182007_10000642	3300015262	Bacteria	20182
533	Ga0182007_10003593	3300015262	Bacteria	7284
534	Ga0183362_10003	3300015683	Bacteria	977584
535	Ga0163161_10009943	3300017792	Bacteria	6589
536	Ga0163161_10033261	3300017792	Bacteria	3684
537	Ga0163161_10041651	3300017792	Bacteria	3300
538	Ga0163161_10063022	3300017792	Bacteria	2702
539	Ga0163161_10064942	3300017792	Bacteria	2663
540	Ga0163161_10094517	3300017792	Bacteria	2216
541	Ga0213872_10000093	3300021361	Bacteria	83513
542	Ga0213872_10000490	3300021361	Bacteria	31612
543	Ga0213872_10003115	3300021361	Bacteria	9320
544	Ga0213872_10005470	3300021361	Bacteria	6529
545	Ga0213872_10021144	3300021361	Bacteria	2996
546	Ga0209435_100002	3300025206	Bacteria	794178
547	Ga0209435_100018	3300025206	Bacteria	274625
548	Ga0209436_105519	3300025208	Bacteria	2899
549	Ga0209672_101322	3300025228	Bacteria	9450
550	Ga0209147_100051	3300025229	Bacteria	274605
551	Ga0209147_101675	3300025229	Bacteria	7275
552	Ga0209563_100013	3300025230	Bacteria	941463
553	Ga0209437_100136	3300025233	Bacteria	176190
554	Ga0209437_100145	3300025233	Bacteria	163138
555	Ga0209258_100154	3300025242	Bacteria	158235
556	Ga0209258_100760	3300025242	Bacteria	20234
557	Ga0207425_1000540	3300025245	Bacteria	22766
558	Ga0207425_1001617	3300025245	Bacteria	9090
559	Ga0207425_1002353	3300025245	Bacteria	6746
560	Ga0209646_1000001	3300025246	Bacteria	3092932
561	Ga0209646_1000090	3300025246	Bacteria	189912
562	Ga0209026_1000001	3300025250	Bacteria	1228671
563	Ga0209026_1000042	3300025250	Bacteria	273111
564	Ga0209148_1000145	3300025254	Bacteria	161352
565	Ga0209759_1000001	3300025256	Bacteria	2799452
566	Ga0209759_1000933	3300025256	Bacteria	21089
567	Ga0209129_1000027	3300025258	Bacteria	409587
568	Ga0209129_1000054	3300025258	Bacteria	261997
569	Ga0209129_1002683	3300025258	Bacteria	8383
570	Ga0209129_1005664	3300025258	Bacteria	4321
571	Ga0209565_1000067	3300025263	Bacteria	171247
572	Ga0209565_1000092	3300025263	Bacteria	141563
573	Ga0209565_1000128	3300025263	Bacteria	108959
574	Ga0209565_1000648	3300025263	Bacteria	22443
575	Ga0209565_1000708	3300025263	Bacteria	20409
576	Ga0209565_1001327	3300025263	Bacteria	11327
577	Ga0209565_1002114	3300025263	Bacteria	7566
578	Ga0209455_1001361	3300025272	Bacteria	11209
579	Ga0209673_1000008	3300025273	Bacteria	626013
580	Ga0209673_1000097	3300025273	Bacteria	193482
581	Ga0209673_1000172	3300025273	Bacteria	133472
582	Ga0209673_1001430	3300025273	Bacteria	22800
583	Ga0209673_1006310	3300025273	Bacteria	5756
584	Ga0209673_1011746	3300025273	Bacteria	3587
585	Ga0209673_1017095	3300025273	Bacteria	2684
586	Ga0209130_1000072	3300025284	Bacteria	175726
587	Ga0209130_1000315	3300025284	Bacteria	56958
588	Ga0209130_1000954	3300025284	Bacteria	22871
589	Ga0209130_1001108	3300025284	Bacteria	19845
590	Ga0209130_1002024	3300025284	Bacteria	11039
591	Ga0209675_1000038	3300025291	Bacteria	250481
592	Ga0209675_1000221	3300025291	Bacteria	59141
593	Ga0209675_1000690	3300025291	Bacteria	23483
594	Ga0209675_1001507	3300025291	Bacteria	13323
595	Ga0209675_1003314	3300025291	Bacteria	7734
596	Ga0209675_1003374	3300025291	Bacteria	7626
597	Ga0209675_1004564	3300025291	Bacteria	6109
598	Ga0209675_1004790	3300025291	Bacteria	5878
599	Ga0209675_1006032	3300025291	Bacteria	4951
600	Ga0209675_1013233	3300025291	Bacteria	2598
601	Ga0209676_1000012	3300025292	Bacteria	841431
602	Ga0209676_1000023	3300025292	Bacteria	589732
603	Ga0209676_1000048	3300025292	Bacteria	403716
604	Ga0209676_1001679	3300025292	Bacteria	19202
605	Ga0209676_1007984	3300025292	Bacteria	4829
606	Ga0209025_1000026	3300025294	Bacteria	519850
607	Ga0209025_1000173	3300025294	Bacteria	159623
608	Ga0209025_1000174	3300025294	Bacteria	158915
609	Ga0209025_1001066	3300025294	Bacteria	39849
610	Ga0209025_1001606	3300025294	Bacteria	28358
611	Ga0209025_1001733	3300025294	Bacteria	26305
612	Ga0209025_1001987	3300025294	Bacteria	23455
613	Ga0209025_1002139	3300025294	Bacteria	22147
614	Ga0209025_1004985	3300025294	Bacteria	11107
615	Ga0209025_1005561	3300025294	Bacteria	10213
616	Ga0209025_1010865	3300025294	Bacteria	6101
617	Ga0209025_1020817	3300025294	Bacteria	3563
618	Ga0209025_1027510	3300025294	Bacteria	2818
619	Ga0209025_1030667	3300025294	Bacteria	2567
620	Ga0209025_1039297	3300025294	Bacteria	2066
621	Ga0209564_1000008	3300025295	Bacteria	953227
622	Ga0209564_1000139	3300025295	Bacteria	180328
623	Ga0209564_1000241	3300025295	Bacteria	118237
624	Ga0209564_1000435	3300025295	Bacteria	72434
625	Ga0209564_1000998	3300025295	Bacteria	35364
626	Ga0209564_1001515	3300025295	Bacteria	23174
627	Ga0209564_1002737	3300025295	Bacteria	13264
628	Ga0209564_1002822	3300025295	Bacteria	12877
629	Ga0209564_1003293	3300025295	Bacteria	11225
630	Ga0209564_1004319	3300025295	Bacteria	8779
631	Ga0209758_1000034	3300025297	Bacteria	467637
632	Ga0209758_1000052	3300025297	Bacteria	338962
633	Ga0209758_1000146	3300025297	Bacteria	169246
634	Ga0209758_1002271	3300025297	Bacteria	19909
635	Ga0209758_1004536	3300025297	Bacteria	11484
636	Ga0209050_1000012	3300025298	Bacteria	813717
637	Ga0209050_1000022	3300025298	Bacteria	565239
638	Ga0209050_1000165	3300025298	Bacteria	152109
639	Ga0209050_1000294	3300025298	Bacteria	105705
640	Ga0209050_1001032	3300025298	Bacteria	34539
641	Ga0209050_1002988	3300025298	Bacteria	13162
642	Ga0209050_1004806	3300025298	Bacteria	8889
643	Ga0209050_1008642	3300025298	Bacteria	5385
644	Ga0209050_1012744	3300025298	Bacteria	3820
645	Ga0209256_1000001	3300025299	Bacteria	2166974
646	Ga0209256_1000103	3300025299	Bacteria	193900
647	Ga0209256_1000120	3300025299	Bacteria	167691
648	Ga0209256_1000165	3300025299	Bacteria	135104
649	Ga0209256_1000450	3300025299	Bacteria	62771
650	Ga0209256_1000912	3300025299	Bacteria	36188
651	Ga0209256_1001146	3300025299	Bacteria	30061
652	Ga0209256_1001845	3300025299	Bacteria	19655
653	Ga0209256_1023396	3300025299	Bacteria	1843
654	Ga0209256_1025211	3300025299	Bacteria	1737
655	Ga0207426_1000058	3300025302	Bacteria	363857
656	Ga0207426_1000067	3300025302	Bacteria	342108
657	Ga0207426_1000319	3300025302	Bacteria	92696
658	Ga0207426_1002937	3300025302	Bacteria	10035
659	Ga0209051_1000013	3300025303	Bacteria	565239
660	Ga0209051_1000018	3300025303	Bacteria	527061
661	Ga0209051_1000019	3300025303	Bacteria	511268
662	Ga0209051_1000235	3300025303	Bacteria	92799
663	Ga0209051_1000384	3300025303	Bacteria	62340
664	Ga0209051_1001398	3300025303	Bacteria	20776
665	Ga0209051_1002935	3300025303	Bacteria	11678
666	Ga0209051_1005813	3300025303	Bacteria	7098
667	Ga0209051_1007797	3300025303	Bacteria	5785
668	Ga0209257_1000021	3300025304	Bacteria	771986
669	Ga0209257_1000024	3300025304	Bacteria	726068
670	Ga0209257_1000042	3300025304	Bacteria	537149
671	Ga0209257_1000057	3300025304	Bacteria	396985
672	Ga0209257_1000096	3300025304	Bacteria	259390
673	Ga0209257_1000260	3300025304	Bacteria	121653
674	Ga0209257_1001206	3300025304	Bacteria	32484
675	Ga0209257_1010586	3300025304	Bacteria	4634
676	Ga0209257_1010643	3300025304	Bacteria	4608
677	Ga0207697_10016431	3300025315	Bacteria	3049
678	Ga0207656_10003460	3300025321	Bacteria	5429
679	Ga0207656_10006943	3300025321	Bacteria	4105
680	Ga0207696_1000557	3300025711	Bacteria	29652
681	Ga0207696_1003192	3300025711	Bacteria	7579
682	Ga0207696_1003996	3300025711	Bacteria	6479
683	Ga0207655_1000024	3300025728	Bacteria	459774
684	Ga0207655_1000639	3300025728	Bacteria	41880
685	Ga0207655_1000983	3300025728	Bacteria	29240
686	Ga0207655_1003550	3300025728	Bacteria	11549
687	Ga0207655_1030240	3300025728	Bacteria	2522
688	Ga0207713_1000043	3300025735	Bacteria	241808
689	Ga0207713_1008050	3300025735	Bacteria	6124
690	Ga0207713_1027146	3300025735	Bacteria	2606
691	Ga0207713_1042393	3300025735	Bacteria	1890
692	Ga0207682_10011302	3300025893	Bacteria	3488
693	Ga0207682_10015452	3300025893	Bacteria	2971
694	Ga0207682_10030730	3300025893	Bacteria	2153
695	Ga0207642_10052396	3300025899	Bacteria	1851
696	Ga0207688_10015371	3300025901	Bacteria	4152
697	Ga0207680_10001495	3300025903	Bacteria	11047
698	Ga0207699_10026650	3300025906	Bacteria	3190
699	Ga0207699_10067168	3300025906	Bacteria	2179
700	Ga0207645_10007473	3300025907	Bacteria	7715
701	Ga0207645_10052992	3300025907	Bacteria	2592
702	Ga0207645_10056229	3300025907	Bacteria	2512
703	Ga0207645_10129688	3300025907	Bacteria	1641
704	Ga0207645_10148073	3300025907	Bacteria	1531
705	Ga0207643_10027110	3300025908	Bacteria	3175
706	Ga0207643_10076978	3300025908	Bacteria	1928
707	Ga0207705_10008509	3300025909	Bacteria	7487
708	Ga0207705_10032151	3300025909	Bacteria	3749
709	Ga0207705_10060329	3300025909	Bacteria	2739
710	Ga0207684_10002070	3300025910	Bacteria	20640
711	Ga0207684_10031033	3300025910	Bacteria	4548
712	Ga0207654_10028201	3300025911	Bacteria	3060
713	Ga0207654_10036040	3300025911	Bacteria	2761
714	Ga0207654_10051850	3300025911	Bacteria	2363
715	Ga0207654_10141122	3300025911	Bacteria	1536
716	Ga0207707_10010626	3300025912	Bacteria	7996
717	Ga0207707_10016028	3300025912	Bacteria	6536
718	Ga0207707_10026595	3300025912	Bacteria	5057
719	Ga0207707_10040244	3300025912	Bacteria	4082
720	Ga0207695_10005351	3300025913	Bacteria	17072
721	Ga0207695_10023926	3300025913	Bacteria	6890
722	Ga0207695_10109358	3300025913	Bacteria	2746
723	Ga0207695_10261501	3300025913	Bacteria	1628
724	Ga0207671_10017114	3300025914	Bacteria	5604
725	Ga0207671_10032445	3300025914	Bacteria	3888
726	Ga0207693_10004206	3300025915	Bacteria	12205
727	Ga0207693_10024167	3300025915	Bacteria	4825
728	Ga0207660_10023901	3300025917	Bacteria	4132
729	Ga0207660_10061869	3300025917	Bacteria	2696
730	Ga0207660_10083826	3300025917	Bacteria	2348
731	Ga0207660_10123348	3300025917	Bacteria	1965
732	Ga0207660_10215822	3300025917	Bacteria	1504
733	Ga0207662_10061126	3300025918	Bacteria	2261
734	Ga0207657_10000447	3300025919	Bacteria	43815
735	Ga0207657_10003605	3300025919	Bacteria	16496
736	Ga0207657_10004258	3300025919	Bacteria	15161
737	Ga0207657_10027949	3300025919	Bacteria	5156
738	Ga0207649_10029633	3300025920	Bacteria	3233
739	Ga0207649_10051595	3300025920	Bacteria	2548
740	Ga0207649_10091531	3300025920	Bacteria	1992
741	Ga0207649_10111273	3300025920	Bacteria	1830
742	Ga0207652_10012394	3300025921	Bacteria	6889
743	Ga0207652_10015269	3300025921	Bacteria	6234
744	Ga0207652_10212603	3300025921	Bacteria	1742
745	Ga0207646_10002045	3300025922	Bacteria	24234
746	Ga0207646_10030455	3300025922	Bacteria	4891
747	Ga0207646_10083481	3300025922	Bacteria	2857
748	Ga0207646_10090569	3300025922	Bacteria	2738
749	Ga0207681_10043137	3300025923	Bacteria	3017
750	Ga0207681_10058220	3300025923	Bacteria	2645
751	Ga0207681_10063816	3300025923	Bacteria	2541
752	Ga0207681_10075638	3300025923	Bacteria	2362
753	Ga0207681_10081392	3300025923	Bacteria	2286
754	Ga0207681_10118513	3300025923	Bacteria	1938
755	Ga0207694_10017482	3300025924	Bacteria	5419
756	Ga0207694_10056941	3300025924	Bacteria	3037
757	Ga0207694_10079876	3300025924	Bacteria	2566
758	Ga0207650_10003707	3300025925	Bacteria	10445
759	Ga0207650_10014826	3300025925	Bacteria	5421
760	Ga0207650_10056430	3300025925	Bacteria	2918
761	Ga0207650_10096580	3300025925	Bacteria	2267
762	Ga0207650_10138665	3300025925	Bacteria	1910
763	Ga0207650_10225635	3300025925	Bacteria	1509
764	Ga0207659_10002055	3300025926	Bacteria	11945
765	Ga0207659_10002947	3300025926	Bacteria	10134
766	Ga0207659_10003098	3300025926	Bacteria	9930
767	Ga0207659_10058394	3300025926	Bacteria	2769
768	Ga0207687_10209821	3300025927	Bacteria	1527
769	Ga0207687_10213026	3300025927	Bacteria	1517
770	Ga0207700_10022967	3300025928	Bacteria	4289
771	Ga0207700_10032950	3300025928	Bacteria	3702
772	Ga0207700_10040172	3300025928	Bacteria	3413
773	Ga0207700_10139194	3300025928	Bacteria	1992
774	Ga0207700_10195604	3300025928	Bacteria	1701
775	Ga0207664_10050500	3300025929	Bacteria	3280
776	Ga0207664_10081866	3300025929	Bacteria	2628
777	Ga0207664_10090116	3300025929	Bacteria	2512
778	Ga0207644_10000130	3300025931	Bacteria	54417
779	Ga0207644_10002085	3300025931	Bacteria	12942
780	Ga0207644_10022846	3300025931	Bacteria	4276
781	Ga0207644_10067704	3300025931	Bacteria	2603
782	Ga0207644_10165726	3300025931	Bacteria	1721
783	Ga0207690_10003996	3300025932	Bacteria	8718
784	Ga0207690_10013485	3300025932	Bacteria	4912
785	Ga0207690_10037637	3300025932	Bacteria	3142
786	Ga0207690_10064410	3300025932	Bacteria	2503
787	Ga0207706_10000156	3300025933	Bacteria	75583
788	Ga0207706_10016017	3300025933	Bacteria	6775
789	Ga0207706_10025996	3300025933	Bacteria	5242
790	Ga0207706_10036971	3300025933	Bacteria	4336
791	Ga0207706_10054917	3300025933	Bacteria	3514
792	Ga0207706_10070546	3300025933	Bacteria	3073
793	Ga0207686_10011790	3300025934	Bacteria	4794
794	Ga0207686_10128851	3300025934	Bacteria	1733
795	Ga0207709_10000111	3300025935	Bacteria	127580
796	Ga0207709_10044565	3300025935	Bacteria	2681
797	Ga0207670_10004647	3300025936	Bacteria	7440
798	Ga0207670_10167009	3300025936	Bacteria	1647
799	Ga0207704_10010368	3300025938	Bacteria	4544
800	Ga0207704_10034820	3300025938	Bacteria	2878
801	Ga0207665_10002266	3300025939	Bacteria	12985
802	Ga0207691_10003386	3300025940	Bacteria	15512
803	Ga0207691_10010432	3300025940	Bacteria	8913
804	Ga0207691_10011577	3300025940	Bacteria	8471
805	Ga0207691_10019285	3300025940	Bacteria	6456
806	Ga0207691_10022541	3300025940	Bacteria	5937
807	Ga0207691_10032593	3300025940	Bacteria	4858
808	Ga0207691_10053626	3300025940	Bacteria	3681
809	Ga0207691_10057599	3300025940	Bacteria	3536
810	Ga0207711_10020362	3300025941	Bacteria	5530
811	Ga0207711_10021326	3300025941	Bacteria	5413
812	Ga0207711_10035493	3300025941	Bacteria	4226
813	Ga0207711_10053726	3300025941	Bacteria	3455
814	Ga0207711_10165679	3300025941	Bacteria	2003
815	Ga0207711_10174904	3300025941	Bacteria	1950
816	Ga0207689_10001818	3300025942	Bacteria	20157
817	Ga0207689_10015442	3300025942	Bacteria	6465
818	Ga0207661_10086402	3300025944	Bacteria	2603
819	Ga0207679_10007093	3300025945	Bacteria	7101
820	Ga0207679_10012131	3300025945	Bacteria	5609
821	Ga0207679_10033943	3300025945	Bacteria	3595
822	Ga0207679_10037700	3300025945	Bacteria	3438
823	Ga0207679_10147866	3300025945	Bacteria	1908
824	Ga0207667_10006776	3300025949	Bacteria	13836
825	Ga0207667_10010777	3300025949	Bacteria	10663
826	Ga0207667_10016009	3300025949	Bacteria	8490
827	Ga0207667_10019277	3300025949	Bacteria	7621
828	Ga0207667_10024536	3300025949	Bacteria	6618
829	Ga0207667_10110330	3300025949	Bacteria	2838
830	Ga0207667_10203748	3300025949	Bacteria	2029
831	Ga0207651_10001665	3300025960	Bacteria	10209
832	Ga0207651_10003976	3300025960	Bacteria	7344
833	Ga0207651_10005715	3300025960	Bacteria	6421
834	Ga0207651_10005940	3300025960	Bacteria	6322
835	Ga0207712_10008399	3300025961	Bacteria	6524
836	Ga0207712_10070498	3300025961	Bacteria	2511
837	Ga0207712_10206932	3300025961	Bacteria	1560
838	Ga0207668_10015585	3300025972	Bacteria	4725
839	Ga0207668_10084585	3300025972	Bacteria	2312
840	Ga0207668_10107123	3300025972	Bacteria	2089
841	Ga0207668_10134384	3300025972	Bacteria	1893
842	Ga0207668_10240887	3300025972	Bacteria	1463
843	Ga0207640_10037866	3300025981	Bacteria	3038
844	Ga0207640_10075079	3300025981	Bacteria	2290
845	Ga0207640_10101284	3300025981	Bacteria	2020
846	Ga0207658_10004458	3300025986	Bacteria	9728
847	Ga0207658_10004645	3300025986	Bacteria	9520
848	Ga0207658_10050936	3300025986	Bacteria	3049
849	Ga0207658_10083767	3300025986	Bacteria	2452
850	Ga0207677_10007151	3300026023	Bacteria	6147
851	Ga0207677_10018191	3300026023	Bacteria	4213
852	Ga0207677_10033477	3300026023	Bacteria	3317
853	Ga0207677_10040300	3300026023	Bacteria	3078
854	Ga0207677_10173075	3300026023	Bacteria	1690
855	Ga0207703_10002546	3300026035	Bacteria	15741
856	Ga0207703_10009968	3300026035	Bacteria	7451
857	Ga0207703_10012912	3300026035	Bacteria	6510
858	Ga0207703_10016647	3300026035	Bacteria	5734
859	Ga0207703_10042121	3300026035	Bacteria	3661
860	Ga0207703_10092086	3300026035	Bacteria	2551
861	Ga0207639_10013143	3300026041	Bacteria	5785
862	Ga0207639_10013776	3300026041	Bacteria	5670
863	Ga0207639_10059696	3300026041	Bacteria	2939
864	Ga0207639_10076160	3300026041	Bacteria	2641
865	Ga0207639_10126648	3300026041	Bacteria	2107
866	Ga0207639_10131754	3300026041	Bacteria	2071
867	Ga0207678_10030122	3300026067	Bacteria	4738
868	Ga0207678_10043272	3300026067	Bacteria	3897
869	Ga0207678_10050007	3300026067	Bacteria	3612
870	Ga0207678_10083673	3300026067	Bacteria	2729
871	Ga0207678_10149880	3300026067	Bacteria	1991
872	Ga0207678_10157414	3300026067	Bacteria	1940
873	Ga0207708_10001026	3300026075	Bacteria	20900
874	Ga0207708_10021822	3300026075	Bacteria	4831
875	Ga0207708_10092172	3300026075	Bacteria	2337
876	Ga0207708_10153052	3300026075	Bacteria	1817
877	Ga0207702_10002083	3300026078	Bacteria	19317
878	Ga0207702_10075064	3300026078	Bacteria	2920
879	Ga0207702_10133219	3300026078	Bacteria	2239
880	Ga0207641_10016950	3300026088	Bacteria	5964
881	Ga0207641_10032784	3300026088	Bacteria	4314
882	Ga0207641_10037962	3300026088	Bacteria	4025
883	Ga0207641_10091037	3300026088	Bacteria	2669
884	Ga0207641_10235396	3300026088	Bacteria	1704
885	Ga0207648_10000179	3300026089	Bacteria	66602
886	Ga0207648_10001876	3300026089	Bacteria	22992
887	Ga0207648_10002319	3300026089	Bacteria	20537
888	Ga0207648_10006478	3300026089	Bacteria	11630
889	Ga0207648_10006871	3300026089	Bacteria	11280
890	Ga0207648_10015767	3300026089	Bacteria	6932
891	Ga0207648_10021732	3300026089	Bacteria	5765
892	Ga0207648_10025102	3300026089	Bacteria	5314
893	Ga0207648_10047779	3300026089	Bacteria	3750
894	Ga0207648_10050843	3300026089	Bacteria	3623
895	Ga0207648_10057806	3300026089	Bacteria	3384
896	Ga0207648_10082099	3300026089	Bacteria	2811
897	Ga0207676_10001487	3300026095	Bacteria	17339
898	Ga0207676_10008447	3300026095	Bacteria	7323
899	Ga0207676_10009407	3300026095	Bacteria	6955
900	Ga0207676_10014048	3300026095	Bacteria	5751
901	Ga0207674_10004569	3300026116	Bacteria	16624
902	Ga0207674_10013444	3300026116	Bacteria	9085
903	Ga0207674_10041207	3300026116	Bacteria	4777
904	Ga0207674_10137304	3300026116	Bacteria	2406
905	Ga0207674_10188323	3300026116	Bacteria	2013
906	Ga0207675_100000704	3300026118	Bacteria	33126
907	Ga0207675_100001602	3300026118	Bacteria	22678
908	Ga0207675_100021533	3300026118	Bacteria	6004
909	Ga0207675_100022891	3300026118	Bacteria	5812
910	Ga0207675_100044251	3300026118	Bacteria	4159
911	Ga0207675_100046449	3300026118	Bacteria	4057
912	Ga0207675_100110243	3300026118	Bacteria	2597
913	Ga0207675_100129843	3300026118	Bacteria	2389
914	Ga0207675_100222980	3300026118	Bacteria	1817
915	Ga0207683_10013324	3300026121	Bacteria	7011
916	Ga0207683_10024002	3300026121	Bacteria	5248
917	Ga0207683_10026397	3300026121	Bacteria	5012
918	Ga0207683_10060473	3300026121	Bacteria	3330
919	Ga0207683_10079558	3300026121	Bacteria	2906
920	Ga0207683_10096370	3300026121	Bacteria	2638
921	Ga0207698_10001892	3300026142	Bacteria	12258
922	Ga0207698_10004332	3300026142	Bacteria	8639
923	Ga0207698_10020098	3300026142	Bacteria	4590
924	Ga0207698_10064780	3300026142	Bacteria	2866
925	Ga0207698_10065155	3300026142	Bacteria	2860
926	Ga0207698_10151001	3300026142	Bacteria	2016
927	Ga0209281_1000007	3300027111	Bacteria	938265
928	Ga0209281_1000455	3300027111	Bacteria	58143
929	Ga0209389_1000249	3300027296	Bacteria	34712
930	Ga0209371_1000061	3300027312	Bacteria	223014
931	Ga0209371_1000082	3300027312	Bacteria	184560
932	Ga0209371_1000119	3300027312	Bacteria	133367
933	Ga0209371_1000230	3300027312	Bacteria	71436
934	Ga0209371_1001086	3300027312	Bacteria	20323
935	Ga0209371_1001324	3300027312	Bacteria	17288
936	Ga0209371_1002070	3300027312	Bacteria	11949
937	Ga0210000_1002971	3300027462	Bacteria	2423
938	Ga0209999_1000743	3300027543	Bacteria	5317
939	Ga0209970_1000108	3300027614	Bacteria	11841
940	Ga0209983_1009217	3300027665	Bacteria	2017
941	Ga0209282_1000053	3300027666	Bacteria	103311
942	Ga0209282_1000250	3300027666	Bacteria	26928
943	Ga0209588_1004210	3300027671	Bacteria	4044
944	Ga0209971_1001384	3300027682	Bacteria	6026
945	Ga0209966_1006236	3300027695	Bacteria	2067
946	Ga0209974_10006556	3300027876	Bacteria	4060
947	Ga0209974_10006964	3300027876	Bacteria	3914
948	Ga0209974_10029859	3300027876	Bacteria	1807
949	Ga0207428_10003201	3300027907	Bacteria	16012
950	Ga0268266_10059218	3300028379	Bacteria	3299
951	Ga0268266_10095949	3300028379	Bacteria	2605
952	Ga0268266_10304796	3300028379	Bacteria	1487
953	Ga0268265_10004089	3300028380	Bacteria	10253
954	Ga0268265_10013992	3300028380	Bacteria	5463
955	Ga0268265_10076950	3300028380	Bacteria	2619
956	Ga0268265_10246391	3300028380	Bacteria	1580
957	Ga0268264_10000613	3300028381	Bacteria	42687
958	Ga0268264_10037899	3300028381	Bacteria	3976
959	Ga0268264_10073697	3300028381	Bacteria	2898
960	Ga0268264_10248016	3300028381	Bacteria	1653
961	Ga0268264_10271995	3300028381	Bacteria	1583
962	Ga0307517_10001395	3300028786	Bacteria	40607
963	Ga0307515_10000011	3300028794	Bacteria	633903
964	Ga0307515_10000213	3300028794	Bacteria	142742
965	Ga0307515_10000472	3300028794	Bacteria	96172
966	Ga0307515_10000655	3300028794	Bacteria	79837
967	Ga0307515_10003487	3300028794	Bacteria	33051
968	Ga0307515_10009632	3300028794	Bacteria	18642
969	Ga0307515_10048317	3300028794	Bacteria	6436
970	Ga0307515_10069340	3300028794	Bacteria	4822
971	Ga0307515_10201563	3300028794	Bacteria	1864
972	Ga0268256_1000059	3300030500	Bacteria	223875
973	Ga0268256_1000072	3300030500	Bacteria	184436
974	Ga0268256_1000096	3300030500	Bacteria	139457
975	Ga0268256_1001132	3300030500	Bacteria	17288
976	Ga0268256_1004087	3300030500	Bacteria	6237
977	Ga0268256_1009796	3300030500	Bacteria	3146
978	Ga0307511_10000043	3300030521	Bacteria	101232
979	Ga0316183_1035885	3300030742	Bacteria	2538
980	Ga0316182_1411781	3300030745	Bacteria	2360
981	Ga0265330_10000046	3300031235	Bacteria	108853
982	Ga0265332_10000028	3300031238	Bacteria	184029
983	Ga0265332_10000125	3300031238	Bacteria	63932
984	Ga0265332_10000951	3300031238	Bacteria	17144
985	Ga0265328_10003818	3300031239	Bacteria	6620
986	Ga0265328_10022676	3300031239	Bacteria	2387
987	Ga0265331_10001806	3300031250	Bacteria	15206
988	Ga0265327_10000012	3300031251	Bacteria	530403
989	Ga0265327_10001288	3300031251	Bacteria	32919
990	Ga0265327_10010084	3300031251	Bacteria	6702
991	Ga0265327_10011638	3300031251	Bacteria	6033
992	Ga0265327_10022614	3300031251	Bacteria	3751
993	Ga0265327_10034279	3300031251	Bacteria	2819
994	Ga0265316_10053940	3300031344	Bacteria	3148
995	Ga0265316_10224581	3300031344	Bacteria	1385
996	Ga0307513_10000117	3300031456	Bacteria	110951
997	Ga0307513_10002745	3300031456	Bacteria	24211
998	Ga0307513_10003270	3300031456	Bacteria	22086
999	Ga0307513_10008037	3300031456	Bacteria	13552
1000	Ga0307513_10203007	3300031456	Bacteria	1821
1001	Ga0307509_10003946	3300031507	Bacteria	21881
1002	Ga0307509_10005133	3300031507	Bacteria	18400
1003	Ga0307509_10046715	3300031507	Bacteria	4660
1004	Ga0307509_10072791	3300031507	Bacteria	3579
1005	Ga0307509_10113339	3300031507	Bacteria	2709
1006	Ga0307408_100000023	3300031548	Bacteria	295931
1007	Ga0307408_100000101	3300031548	Bacteria	94089
1008	Ga0307408_100001843	3300031548	Bacteria	15443
1009	Ga0307408_100004804	3300031548	Bacteria	9103
1010	Ga0307408_100006023	3300031548	Bacteria	8070
1011	Ga0307408_100016090	3300031548	Bacteria	4987
1012	Ga0307408_100055479	3300031548	Bacteria	2869
1013	Ga0307408_100085525	3300031548	Bacteria	2368
1014	Ga0307508_10000404	3300031616	Bacteria	51734
1015	Ga0307508_10003052	3300031616	Bacteria	17219
1016	Ga0307514_10012483	3300031649	Bacteria	7066
1017	Ga0307514_10089293	3300031649	Bacteria	2252
1018	Ga0316575_10006695	3300031665	Bacteria	4158
1019	Ga0316579_10000811	3300031691	Bacteria	10796
1020	Ga0316579_10001459	3300031691	Bacteria	8597
1021	Ga0265314_10000054	3300031711	Bacteria	184029
1022	Ga0265314_10001039	3300031711	Bacteria	32357
1023	Ga0316576_10009121	3300031727	Bacteria	6388
1024	Ga0316576_10011214	3300031727	Bacteria	5861
1025	Ga0316578_10035796	3300031728	Bacteria	2855
1026	Ga0307516_10001586	3300031730	Bacteria	31257
1027	Ga0307516_10002443	3300031730	Bacteria	24860
1028	Ga0307516_10002741	3300031730	Bacteria	23228
1029	Ga0307516_10020817	3300031730	Bacteria	6769
1030	Ga0307405_10012732	3300031731	Bacteria	4467
1031	Ga0307405_10055945	3300031731	Bacteria	2471
1032	Ga0307405_10071978	3300031731	Bacteria	2226
1033	Ga0307413_10001940	3300031824	Bacteria	8214
1034	Ga0307410_10002072	3300031852	Bacteria	9489
1035	Ga0307410_10009283	3300031852	Bacteria	5510
1036	Ga0307410_10022186	3300031852	Bacteria	3919
1037	Ga0307406_10005067	3300031901	Bacteria	7184
1038	Ga0307406_10006267	3300031901	Bacteria	6555
1039	Ga0307406_10006712	3300031901	Bacteria	6364
1040	Ga0307406_10017326	3300031901	Bacteria	4195
1041	Ga0307406_10042617	3300031901	Bacteria	2834
1042	Ga0307406_10087961	3300031901	Bacteria	2083
1043	Ga0307407_10113724	3300031903	Bacteria	1704
1044	Ga0307412_10003320	3300031911	Bacteria	8939
1045	Ga0307409_100009728	3300031995	Bacteria	5927
1046	Ga0307409_100042544	3300031995	Bacteria	3403
1047	Ga0307409_100142685	3300031995	Bacteria	2066
1048	Ga0307409_100162078	3300031995	Bacteria	1957
1049	Ga0307409_100213215	3300031995	Bacteria	1737
1050	Ga0307409_100263934	3300031995	Bacteria	1582
1051	Ga0307416_100006880	3300032002	Bacteria	7160
1052	Ga0307416_100016563	3300032002	Bacteria	5128
1053	Ga0307416_100175287	3300032002	Bacteria	2002
1054	Ga0307416_100196800	3300032002	Bacteria	1907
1055	Ga0307414_10066022	3300032004	Bacteria	2584
1056	Ga0307414_10134074	3300032004	Bacteria	1928
1057	Ga0307414_10180484	3300032004	Bacteria	1697
1058	Ga0307411_10002409	3300032005	Bacteria	8250
1059	Ga0307411_10008303	3300032005	Bacteria	5367
1060	Ga0307411_10034617	3300032005	Bacteria	3145
1061	Ga0307415_100003806	3300032126	Bacteria	7735
1062	Ga0316593_10023515	3300032168	Bacteria	1945
1063	Ga0307507_10075769	3300033179	Bacteria	3006
1064	Ga0307507_10111544	3300033179	Bacteria	2232
1065	Ga0307510_10035314	3300033180	Bacteria	5586
1066	Ga0307510_10045636	3300033180	Bacteria	4726
1067	Ga0316588_1003205	3300033528	Bacteria	2954
1068	Ga0316596_1019472	3300033541	Bacteria	1722
1069	Ga0373926_0029136	3300035083	Bacteria	1940
1070	Ga0373932_0011766	3300035112	Bacteria	2144
1071	Ga0373943_0035289	3300035170	Bacteria	2389
1072	Ga0373955_0007829	3300035172	Bacteria	4928
1073	Ga0316574_0000070	3300035398	Bacteria	27753
1074	Ga0316574_0004300	3300035398	Bacteria	7441
1075	Ga0373931_0010378	3300035691	Bacteria	4476
1076	Ga0373931_0017241	3300035691	Bacteria	3568
1077	Ga0373935_0067325	3300035692	Bacteria	2302
1078	Ga0373927_0001348	3300035695	Bacteria	18517
1079	Ga0373927_0031512	3300035695	Bacteria	3455
1080	Ga0373927_0042538	3300035695	Bacteria	2943
1081	Ga0373947_0054512	3300035725	Bacteria	2413
1082	Ga0373947_0085900	3300035725	Bacteria	1955
1083	Ga0373937_0004911	3300036401	Bacteria	11367
1084	Ga0373937_0010376	3300036401	Bacteria	8135
1085	Ga0373937_0012886	3300036401	Bacteria	7365
1086	Ga0373937_0093628	3300036401	Bacteria	2786
1087	Ga0373937_0121982	3300036401	Bacteria	2429
1088	Ga0316582_0090752	3300036647	Bacteria	2010
1089	Ga0316584_0182065	3300036712	Bacteria	1555
1090	Ga0373925_0081460	3300037068	Bacteria	2461
1091	Ga0373925_0082078	3300037068	Bacteria	2452
1092	Ga0373925_0164082	3300037068	Bacteria	1751
1093	Ga0395899_0000080	3300037312	Bacteria	171568
1094	Ga0395899_0001691	3300037312	Bacteria	18397
1095	Ga0395899_0004014	3300037312	Bacteria	11598
1096	Ga0395899_0008709	3300037312	Bacteria	7811
1097	Ga0395899_0019141	3300037312	Bacteria	5203
1098	Ga0395899_0024423	3300037312	Bacteria	4569
1099	Ga0395899_0096300	3300037312	Bacteria	2140
1100	Ga0395899_0098267	3300037312	Bacteria	2115
1101	Ga0395899_0102772	3300037312	Bacteria	2062
1102	Ga0395900_0008285	3300037418	Bacteria	10700
1103	Ga0395900_0009158	3300037418	Bacteria	10143
1104	Ga0395900_0015158	3300037418	Bacteria	7859
1105	Ga0395900_0026870	3300037418	Bacteria	5890
1106	Ga0395900_0074221	3300037418	Bacteria	3497
1107	Ga0395900_0084101	3300037418	Bacteria	3269
1108	Ga0395898_0066398	3300037466	Bacteria	3495
1109	Ga0395898_0072998	3300037466	Bacteria	3314
1110	Ga0395898_0133020	3300037466	Bacteria	2381
1111	Ga0395905_0000043	3300037471	Bacteria	247469
1112	Ga0395905_0001875	3300037471	Bacteria	24218
1113	Ga0395905_0007970	3300037471	Bacteria	10471
1114	Ga0395905_0010328	3300037471	Bacteria	9086
1115	Ga0395905_0018407	3300037471	Bacteria	6629
1116	Ga0395905_0022866	3300037471	Bacteria	5910
1117	Ga0395905_0034452	3300037471	Bacteria	4754
1118	Ga0395905_0038287	3300037471	Bacteria	4499
1119	Ga0395905_0082764	3300037471	Bacteria	3007
1120	Ga0395905_0101488	3300037471	Bacteria	2701
1121	Ga0395905_0202737	3300037471	Bacteria	1859
1122	Ga0395905_0249584	3300037471	Bacteria	1658
1123	Ga0395901_0013302	3300038443	Bacteria	8358
1124	Ga0395901_0022794	3300038443	Bacteria	6420
1125	Ga0395901_0022795	3300038443	Bacteria	6419
1126	Ga0395901_0036328	3300038443	Bacteria	5091
1127	Ga0395901_0055485	3300038443	Bacteria	4120
1128	Ga0395901_0097568	3300038443	Bacteria	3081
1129	Ga0395901_0115496	3300038443	Bacteria	2819
1130	Ga0395901_0121820	3300038443	Bacteria	2741
1131	Ga0395901_0190642	3300038443	Bacteria	2150
1132	Ga0395901_0213305	3300038443	Bacteria	2020
1133	Ga0395901_0324211	3300038443	Bacteria	1593
1134	Ga0436365_0450647	3300039437	Bacteria	5200
1135	Ga0436365_1569295	3300039437	Bacteria	3751
1136	Ga0436360_0038189	3300039438	Bacteria	2113
1137	Ga0436361_0101461	3300039447	Bacteria	19447
1138	Ga0436361_0289802	3300039447	Bacteria	31851
1139	Ga0436361_0487065	3300039447	Bacteria	63556
1140	Ga0436361_0523658	3300039447	Bacteria	15267
1141	Ga0436362_0477984	3300039453	Bacteria	2462
1142	Ga0439436_0004746	3300041404	Bacteria	4168
1143	Ga0439436_0004770	3300041404	Bacteria	4159
1144	Ga0439436_0010792	3300041404	Bacteria	2784
1145	Ga0439447_001550	3300041407	Bacteria	8402
1146	Ga0439466_0000011	3300041411	Bacteria	221134
1147	Ga0439466_0020815	3300041411	Bacteria	2333
1148	Ga0439465_0004682	3300041413	Bacteria	4413
1149	Ga0451853_2018397	3300041512	Bacteria	2495
1150	Ga0439431_0002356	3300041997	Bacteria	4179
1151	Ga0439431_0021691	3300041997	Bacteria	1543
1152	Ga0439433_0006012	3300041999	Bacteria	2609
1153	Ga0439437_001073	3300042000	Bacteria	2862
1154	Ga0439442_006447	3300042002	Bacteria	2356
1155	Ga0439445_0001102	3300042004	Bacteria	5773
1156	Ga0439432_002129	3300042006	Bacteria	7457
1157	Ga0439449_0000187	3300042007	Bacteria	21694
1158	Ga0439449_0000620	3300042007	Bacteria	13287
1159	Ga0439449_0001584	3300042007	Bacteria	8924
1160	Ga0439452_002955	3300042010	Bacteria	6052
1161	Ga0439452_004200	3300042010	Bacteria	4880
1162	Ga0439456_007254	3300042013	Bacteria	2272
1163	Ga0439462_0002391	3300042015	Bacteria	4351
1164	Ga0450911_000281	3300042115	Bacteria	18766
1165	Ga0450890_002116	3300042127	Bacteria	2780
1166	Ga0450889_000109	3300042144	Bacteria	8111
1167	Ga0450906_008422	3300042145	Bacteria	1995
1168	Ga0450907_000007	3300042146	Bacteria	111445
1169	Ga0450910_002890	3300042147	Bacteria	2263
1170	Ga0439446_0002089	3300042156	Bacteria	4744
1171	Ga0439446_0002260	3300042156	Bacteria	4600
1172	Ga0439446_0011612	3300042156	Bacteria	2394
1173	Ga0439434_0001503	3300042435	Bacteria	6708
1174	Ga0439434_0007932	3300042435	Bacteria	3112
1175	Ga0439434_0010725	3300042435	Bacteria	2703
1176	Ga0439435_0000773	3300042436	Bacteria	5374
1177	Ga0439435_0023924	3300042436	Bacteria	1607
1178	Ga0439464_0012317	3300042439	Bacteria	2276
1179	Ga0450918_000158	3300042531	Bacteria	14950
1180	Ga0450893_0001452	3300042532	Bacteria	3636
1181	Ga0451577_0000276	3300042876	Bacteria	99531
1182	Ga0451577_0001377	3300042876	Bacteria	32574
1183	Ga0451577_0037888	3300042876	Bacteria	4339
1184	Ga0451577_0065997	3300042876	Bacteria	3227
1185	Ga0451577_0096803	3300042876	Bacteria	2635
1186	Ga0451577_0109094	3300042876	Bacteria	2475
1187	Ga0451577_0135954	3300042876	Bacteria	2207
1188	Ga0466969_0004750	3300044656	Bacteria	7230
1189	Ga0466969_0006748	3300044656	Bacteria	6104
1190	Ga0466972_0008433	3300044658	Bacteria	5167
1191	Ga0453683_0007502	3300044673	Bacteria	7392
1192	Ga0453683_0018762	3300044673	Bacteria	4438
1193	Ga0466965_0006837	3300044683	Bacteria	5210
1194	Ga0466965_0063016	3300044683	Bacteria	1855
1195	Ga0466966_0020148	3300044684	Bacteria	4389
1196	Ga0466961_0014008	3300044693	Bacteria	5140
1197	Ga0466961_0069024	3300044693	Bacteria	2244
1198	Ga0466961_0089172	3300044693	Bacteria	1948
1199	Ga0453684_0000891	3300044712	Bacteria	99637
1200	Ga0453684_0001215	3300044712	Bacteria	79022
1201	Ga0453684_0063372	3300044712	Bacteria	4729
1202	Ga0453684_0074838	3300044712	Bacteria	4261
1203	Ga0453684_0275004	3300044712	Bacteria	1923
1204	Ga0453684_0279876	3300044712	Bacteria	1903
1205	Ga0466971_0030247	3300044719	Bacteria	2423
1206	Ga0466957_0055469	3300044842	Bacteria	2422
1207	Ga0466959_0126070	3300045049	Bacteria	1817
1208	Ga0451576_0000381	3300045051	Bacteria	104080
1209	Ga0451576_0001248	3300045051	Bacteria	44697
1210	Ga0451576_0004449	3300045051	Bacteria	18194
1211	Ga0451576_0023570	3300045051	Bacteria	6663
1212	Ga0451576_0025162	3300045051	Bacteria	6417
1213	Ga0451576_0037463	3300045051	Bacteria	5137
1214	Ga0451576_0073694	3300045051	Bacteria	3553
1215	Ga0451576_0075018	3300045051	Bacteria	3519
1216	Ga0451576_0095370	3300045051	Bacteria	3094
1217	Ga0451576_0102208	3300045051	Bacteria	2981
1218	Ga0451576_0108446	3300045051	Bacteria	2889
1219	Ga0451576_0112207	3300045051	Bacteria	2837
1220	Ga0451576_0137068	3300045051	Bacteria	2552
1221	Ga0451576_0246475	3300045051	Bacteria	1867
1222	Ga0466958_0005009	3300045836	Bacteria	7072
1223	Ga0466967_0168927	3300045976	Bacteria	2057
1224	Ga0466967_0184275	3300045976	Bacteria	1971
1225	Ga0495617_006149	3300046452	Bacteria	4225
1226	Ga0495627_006447	3300046453	Bacteria	4600
1227	Ga0495592_0000083	3300046454	Bacteria	83092
1228	Ga0495590_0004124	3300046457	Bacteria	5889
1229	Ga0495591_000010	3300046458	Bacteria	327794
1230	Ga0495591_001545	3300046458	Bacteria	14085
1231	Ga0495591_016234	3300046458	Bacteria	2603
1232	Ga0495653_0075170	3300046463	Bacteria	2515
1233	Ga0495650_0000034	3300046471	Bacteria	410132
1234	Ga0495650_0013823	3300046471	Bacteria	4243
1235	Ga0495580_0012135	3300046472	Bacteria	6626
1236	Ga0495605_0002892	3300046474	Bacteria	10422
1237	Ga0495639_0010783	3300046475	Bacteria	3933
1238	Ga0495639_0014230	3300046475	Bacteria	3443
1239	Ga0495664_0057886	3300046477	Bacteria	2306
1240	Ga0495596_0003191	3300046500	Bacteria	8438
1241	Ga0495596_0003690	3300046500	Bacteria	7654
1242	Ga0495607_0002446	3300046501	Bacteria	15121
1243	Ga0495607_0025190	3300046501	Bacteria	3702
1244	Ga0495606_0000511	3300046507	Bacteria	63022
1245	Ga0495608_0015861	3300046511	Bacteria	5214
1246	Ga0495610_0002147	3300046512	Bacteria	16766
1247	Ga0495610_0008257	3300046512	Bacteria	6772
1248	Ga0495616_0003177	3300046513	Bacteria	10604
1249	Ga0495616_0003776	3300046513	Bacteria	9662
1250	Ga0495620_0010395	3300046515	Bacteria	4912
1251	Ga0495631_0075004	3300046518	Bacteria	1460
1252	Ga0495632_0006527	3300046519	Bacteria	7487
1253	Ga0495632_0034565	3300046519	Bacteria	2586
1254	Ga0495632_0047082	3300046519	Bacteria	2140
1255	Ga0495643_0019675	3300046522	Bacteria	3902
1256	Ga0495643_0033289	3300046522	Bacteria	2853
1257	Ga0495644_0054049	3300046523	Bacteria	1508
1258	Ga0495648_0041629	3300046524	Bacteria	2899
1259	Ga0495648_0060928	3300046524	Bacteria	2243
1260	Ga0495642_0031685	3300046528	Bacteria	2120
1261	Ga0495652_0048893	3300046529	Bacteria	3622
1262	Ga0495654_0000151	3300046530	Bacteria	71530
1263	Ga0495654_0005248	3300046530	Bacteria	7561
1264	Ga0495654_0005475	3300046530	Bacteria	7363
1265	Ga0495654_0045127	3300046530	Bacteria	2176
1266	Ga0495665_0010247	3300046531	Bacteria	5072
1267	Ga0495587_0007225	3300046536	Bacteria	7207
1268	Ga0495598_0017969	3300046537	Bacteria	1831
1269	Ga0495597_0001315	3300046542	Bacteria	18215
1270	Ga0495597_0066425	3300046542	Bacteria	1563
1271	Ga0495645_0012915	3300046543	Bacteria	5896
1272	Ga0495645_0148003	3300046543	Bacteria	1634
1273	Ga0495667_0005954	3300046559	Bacteria	8251
1274	Ga0495656_0000090	3300046615	Bacteria	39387
1275	Ga0495656_0019103	3300046615	Bacteria	2641
1276	Ga0495625_0001055	3300046660	Bacteria	36138
1277	Ga0495625_0012405	3300046660	Bacteria	6906
1278	Ga0495625_0025375	3300046660	Bacteria	4496
1279	Ga0495635_0016210	3300046663	Bacteria	5201
1280	Ga0495635_0029296	3300046663	Bacteria	3827
1281	Ga0495599_0003944	3300046678	Bacteria	8726
1282	Ga0495623_0002115	3300046679	Bacteria	13286
1283	Ga0495647_0007199	3300046681	Bacteria	3720
1284	Ga0495658_0039464	3300046683	Bacteria	2619
1285	Ga0495669_0006300	3300046684	Bacteria	4954
1286	Ga0495669_0060059	3300046684	Bacteria	1718
1287	Ga0495613_0122850	3300046689	Bacteria	1863
1288	Ga0495671_0000586	3300046692	Bacteria	26926
1289	Ga0495649_0002049	3300046694	Bacteria	14526
1290	Ga0495649_0030910	3300046694	Bacteria	2955
1291	Ga0495660_0000020	3300046810	Bacteria	304768
1292	Ga0495660_0022000	3300046810	Bacteria	3645
1293	Ga0495660_0131274	3300046810	Bacteria	1256
1294	Ga0495581_0046287	3300047315	Bacteria	2513
1295	Ga0495672_0000011	3300047320	Bacteria	535362
1296	Ga0495672_0000040	3300047320	Bacteria	268573
1297	Ga0495676_0022957	3300047321	Bacteria	5421
1298	Ga0495680_0119611	3300047322	Bacteria	1946
1299	Ga0495683_0035539	3300047323	Bacteria	2532
1300	Ga0495687_001485	3300047443	Bacteria	21418
1301	Ga0495677_0020104	3300047445	Bacteria	2420
1302	Ga0495679_002610	3300047446	Bacteria	9059
1303	Ga0495685_052242	3300047447	Bacteria	1384
1304	Ga0495673_0000020	3300047469	Bacteria	548327
1305	Ga0495684_0138161	3300047471	Bacteria	1828
1306	Ga0495593_0023748	3300047673	Bacteria	3404
1307	Ga0495614_0026926	3300048089	Bacteria	2479
1308	Ga0496100_0089285	3300048903	Bacteria	2099
1309	Ga0496100_0115867	3300048903	Bacteria	1869
1310	Ga0496101_0000053	3300048904	Bacteria	139859
1311	Ga0496101_0041259	3300048904	Bacteria	3290
1312	Ga0496102_0003600	3300048905	Bacteria	13123
1313	Ga0496102_0060046	3300048905	Bacteria	3478
1314	Ga0496102_0082257	3300048905	Bacteria	2969
1315	Ga0496102_0085748	3300048905	Bacteria	2908
1316	Ga0496104_0006891	3300048907	Bacteria	10020
1317	Ga0496105_0003958	3300048908	Bacteria	11086
1318	Ga0496105_0010709	3300048908	Bacteria	7216
1319	Ga0496105_0079874	3300048908	Bacteria	2701
1320	Ga0496106_0032806	3300048909	Bacteria	3872
1321	Ga0496107_0037525	3300048910	Bacteria	3477
1322	Ga0496107_0137712	3300048910	Bacteria	1804
1323	Ga0496107_0162446	3300048910	Bacteria	1655
1324	Ga0496108_0275988	3300048911	Bacteria	1463
1325	Ga0496109_0118029	3300048912	Bacteria	2470
1326	Ga0496110_0008002	3300048913	Bacteria	8472
1327	Ga0496110_0167068	3300048913	Bacteria	1995
1328	Ga0496110_0176348	3300048913	Bacteria	1940
1329	Ga0496110_0219326	3300048913	Bacteria	1729
1330	Ga0496112_0081588	3300048915	Bacteria	3198
1331	Ga0496113_0036962	3300048916	Bacteria	3581
1332	Ga0496114_0083481	3300048917	Bacteria	2703
1333	Ga0496114_0084255	3300048917	Bacteria	2691
1334	Ga0496115_0027385	3300048918	Bacteria	4457
1335	Ga0496116_0000129	3300048919	Bacteria	158284
1336	Ga0496116_0000734	3300048919	Bacteria	41881
1337	Ga0496116_0006777	3300048919	Bacteria	10309
1338	Ga0496116_0009524	3300048919	Bacteria	8271
1339	Ga0496116_0044616	3300048919	Bacteria	3009
1340	Ga0496116_0053637	3300048919	Bacteria	2661
1341	Ga0496117_0000092	3300048920	Bacteria	202608
1342	Ga0496117_0000224	3300048920	Bacteria	106727
1343	Ga0496117_0011620	3300048920	Bacteria	7869
1344	Ga0496117_0015917	3300048920	Bacteria	6372
1345	Ga0496117_0074534	3300048920	Bacteria	2259
1346	Ga0496118_0000053	3300048921	Bacteria	235810
1347	Ga0496118_0000718	3300048921	Bacteria	53459
1348	Ga0496118_0006660	3300048921	Bacteria	12604
1349	Ga0496118_0041408	3300048921	Bacteria	3647
1350	Ga0496119_0000285	3300048922	Bacteria	70929
1351	Ga0496119_0000555	3300048922	Bacteria	50572
1352	Ga0496119_0002224	3300048922	Bacteria	21627
1353	Ga0496119_0005370	3300048922	Bacteria	12319
1354	Ga0496119_0067533	3300048922	Bacteria	2108
1355	Ga0496120_0000024	3300048923	Bacteria	236853
1356	Ga0496120_0000178	3300048923	Bacteria	107847
1357	Ga0496120_0000388	3300048923	Bacteria	70929
1358	Ga0496120_0000548	3300048923	Bacteria	57387
1359	Ga0496120_0001587	3300048923	Bacteria	26441
1360	Ga0496121_0000304	3300048924	Bacteria	102259
1361	Ga0496121_0005682	3300048924	Bacteria	15867
1362	Ga0496121_0027348	3300048924	Bacteria	5338
1363	Ga0496121_0029597	3300048924	Bacteria	5058
1364	Ga0496122_0001889	3300048925	Bacteria	31699
1365	Ga0496122_0009582	3300048925	Bacteria	10158
1366	Ga0496122_0010689	3300048925	Bacteria	9423
1367	Ga0496123_0001035	3300048926	Bacteria	42221
1368	Ga0496123_0002189	3300048926	Bacteria	24885
1369	Ga0496123_0003349	3300048926	Bacteria	18135
1370	Ga0496123_0019217	3300048926	Bacteria	5391
1371	Ga0496123_0027207	3300048926	Bacteria	4265
1372	Ga0496124_0000251	3300048927	Bacteria	103690
1373	Ga0496124_0001528	3300048927	Bacteria	33674
1374	Ga0496124_0026597	3300048927	Bacteria	5214
1375	Ga0496124_0059353	3300048927	Bacteria	3214
1376	Ga0496124_0064591	3300048927	Bacteria	3054
1377	Ga0496124_0081532	3300048927	Bacteria	2658
1378	Ga0496125_0001627	3300048928	Bacteria	31652
1379	Ga0496125_0007136	3300048928	Bacteria	11923
1380	Ga0496125_0037381	3300048928	Bacteria	4222
1381	Ga0496125_0041178	3300048928	Bacteria	3953
1382	Ga0496125_0067848	3300048928	Bacteria	2808
1383	Ga0495678_002665	3300049459	Bacteria	11815
1384	Ga0495682_0000022	3300049460	Bacteria	183265
1385	Ga0501291_006589	3300049514	Bacteria	1552
1386	Ga0501298_010776	3300049521	Bacteria	1578
1387	Ga0501298_018127	3300049521	Bacteria	1292
1388	Ga0501303_001929	3300049526	Bacteria	1572
1389	Ga0501034_0074934	3300049571	Bacteria	3392
1390	Ga0501036_0024340	3300049572	Bacteria	5104
1391	Ga0501036_0055815	3300049572	Bacteria	3347
1392	Ga0501039_0005064	3300049575	Bacteria	9993
1393	Ga0501039_0130938	3300049575	Bacteria	1969
1394	Ga0501040_0018020	3300049576	Bacteria	4688
1395	Ga0501041_0051976	3300049577	Bacteria	2498
1396	Ga0501041_0064562	3300049577	Bacteria	2242
1397	Ga0501042_0025236	3300049578	Bacteria	4174
1398	Ga0501042_0101347	3300049578	Bacteria	2071
1399	Ga0501042_0171251	3300049578	Bacteria	1566
1400	Ga0501043_0000057	3300049579	Bacteria	103997
1401	Ga0501046_0000075	3300049580	Bacteria	104000
1402	Ga0501046_0011964	3300049580	Bacteria	7403
1403	Ga0501047_0000081	3300049581	Bacteria	122697
1404	Ga0501047_0127977	3300049581	Bacteria	2420
1405	Ga0501048_0003517	3300049582	Bacteria	11908
1406	Ga0501048_0034983	3300049582	Bacteria	3619
1407	Ga0501069_0002412	3300049585	Bacteria	9502
1408	Ga0501070_0002316	3300049586	Bacteria	16713
1409	Ga0501070_0089982	3300049586	Bacteria	2540
1410	Ga0501070_0099387	3300049586	Bacteria	2407
1411	Ga0501071_0091465	3300049587	Bacteria	2235
1412	Ga0501072_0045021	3300049588	Bacteria	3469
1413	Ga0501072_0064683	3300049588	Bacteria	2884
1414	Ga0501073_0015213	3300049589	Bacteria	5581
1415	Ga0501073_0057209	3300049589	Bacteria	2727
1416	Ga0501074_0002551	3300049590	Bacteria	12709
1417	Ga0501075_0033424	3300049591	Bacteria	3826
1418	Ga0501076_0028788	3300049592	Bacteria	4317
1419	Ga0501076_0104655	3300049592	Bacteria	2284
1420	Ga0501211_001156	3300049658	Bacteria	2801
1421	Ga0501222_000664	3300049662	Bacteria	5028
1422	Ga0501227_004625	3300049665	Bacteria	2955
1423	Ga0501235_004422	3300049669	Bacteria	3035
1424	Ga0501249_006914	3300049679	Bacteria	2338
1425	Ga0501253_001878	3300049683	Bacteria	2254
1426	Ga0501221_000960	3300049704	Bacteria	4720
1427	Ga0501229_000783	3300049706	Bacteria	3588
1428	Ga0501079_0005427	3300049741	Bacteria	9500
1429	Ga0501079_0016872	3300049741	Bacteria	5576
1430	Ga0501079_0065864	3300049741	Bacteria	2795
1431	Ga0501080_0004208	3300049742	Bacteria	12772
1432	Ga0501080_0007125	3300049742	Bacteria	10095
1433	Ga0501080_0061602	3300049742	Bacteria	3493
1434	Ga0501080_0133218	3300049742	Bacteria	2300
1435	Ga0501081_0013820	3300049743	Bacteria	5313
1436	Ga0501081_0046984	3300049743	Bacteria	2969
1437	Ga0501083_0001718	3300049744	Bacteria	14921
1438	Ga0501083_0028189	3300049744	Bacteria	3872
1439	Ga0501262_000577	3300049759	Bacteria	4369
1440	Ga0501262_003349	3300049759	Bacteria	1834
1441	Ga0501283_001053	3300049779	Bacteria	3626
1442	Ga0501035_0248252	3300049822	Bacteria	1512
1443	Ga0501044_0065371	3300049823	Bacteria	3709
1444	Ga0501045_0004966	3300049824	Bacteria	9218
1445	Ga0501045_0010264	3300049824	Bacteria	6559
1446	Ga0501045_0023822	3300049824	Bacteria	4393
1447	Ga0501045_0057455	3300049824	Bacteria	2847
1448	nmdc:mga03683_19923_c1	3300050489	Bacteria	2567
1449	nmdc:mga03683_21456_c1	3300050489	Bacteria	2491
1450	nmdc:mga03n38_22636_c1	3300050490	Bacteria	2546
1451	nmdc:mga03n38_64134_c1	3300050490	Bacteria	1681
1452	nmdc:mga03n38_7643_c1	3300050490	Bacteria	3834
1453	nmdc:mga00v17_21665_c1	3300050491	Bacteria	3697
1454	nmdc:mga00v17_30925_c1	3300050491	Bacteria	3153
1455	nmdc:mga00v17_51405_c1	3300050491	Bacteria	2506
1456	nmdc:mga0yw44_110325_c1	3300050492	Bacteria	1762
1457	nmdc:mga0yw44_14581_c1	3300050492	Bacteria	4178
1458	nmdc:mga0yw44_785_c1	3300050492	Bacteria	5057
1459	nmdc:mga0yw44_90550_c1	3300050492	Bacteria	1932
1460	nmdc:mga0k408_100765_c1	3300050493	Bacteria	1703
1461	nmdc:mga0k408_101141_c1	3300050493	Bacteria	1699
1462	nmdc:mga0k408_118788_c1	3300050493	Bacteria	1565
1463	nmdc:mga0k408_13542_c1	3300050493	Bacteria	4476
1464	nmdc:mga0k408_138_c1	3300050493	Bacteria	36717
1465	nmdc:mga0k408_16735_c1	3300050493	Bacteria	4075
1466	nmdc:mga0k408_19960_c1	3300050493	Bacteria	3751
1467	nmdc:mga0k408_2064_c1	3300050493	Bacteria	10745
1468	nmdc:mga0k408_29331_c1	3300050493	Bacteria	3131
1469	nmdc:mga0k408_34607_c1	3300050493	Bacteria	2893
1470	nmdc:mga0k408_40887_c1	3300050493	Bacteria	2669
1471	nmdc:mga0k408_42033_c1	3300050493	Bacteria	2633
1472	nmdc:mga0k408_57440_c1	3300050493	Bacteria	2259
1473	nmdc:mga0k408_576_c1	3300050493	Bacteria	20303
1474	nmdc:mga0k408_5849_c1	3300050493	Bacteria	6553
1475	nmdc:mga0k408_7033_c1	3300050493	Bacteria	6006
1476	nmdc:mga0k408_7262_c1	3300050493	Bacteria	5921
1477	nmdc:mga0k408_7453_c1	3300050493	Bacteria	5843
1478	nmdc:mga0k408_8618_c1	3300050493	Bacteria	5479
1479	nmdc:mga0k408_93429_c1	3300050493	Bacteria	1769
1480	nmdc:mga06z11_18151_c1	3300050494	Bacteria	3208
1481	nmdc:mga07m45_11357_c1	3300050496	Bacteria	4677
1482	nmdc:mga07m45_1226_c1	3300050496	Bacteria	11616
1483	nmdc:mga07m45_28774_c1	3300050496	Bacteria	3068
1484	nmdc:mga07m45_31118_c1	3300050496	Bacteria	2297
1485	nmdc:mga07m45_32283_c1	3300050496	Bacteria	2904
1486	nmdc:mga07m45_3534_c1	3300050496	Bacteria	7549
1487	nmdc:mga07m45_4924_c1	3300050496	Bacteria	6581
1488	nmdc:mga07m45_639_c1	3300050496	Bacteria	13305
1489	nmdc:mga07m45_9657_c1	3300050496	Bacteria	5014
1490	nmdc:mga05p37_181_c1	3300050507	Bacteria	61821
1491	nmdc:mga05p37_21359_c1	3300050507	Bacteria	7840
1492	nmdc:mga05p37_241233_c1	3300050507	Bacteria	2173
1493	nmdc:mga09592_1507_c1	3300050508	Bacteria	18749
1494	nmdc:mga09592_239456_c1	3300050508	Bacteria	1572
1495	nmdc:mga09592_64009_c1	3300050508	Bacteria	3113
1496	nmdc:mga09592_64418_c1	3300050508	Bacteria	3103
1497	nmdc:mga06r32_33024_c1	3300050510	Bacteria	4873
1498	nmdc:mga06r32_73337_c1	3300050510	Bacteria	3316
1499	nmdc:mga08y16_14999_c1	3300050511	Bacteria	8151
1500	nmdc:mga08y16_18394_c1	3300050511	Bacteria	7366
1501	nmdc:mga08y16_224_c1	3300050511	Bacteria	50738
1502	nmdc:mga08y16_315156_c1	3300050511	Bacteria	1611
1503	nmdc:mga0n895_10661_c1	3300050512	Bacteria	8138
1504	nmdc:mga0n895_1144_c1	3300050512	Bacteria	19418
1505	nmdc:mga0n895_278806_c1	3300050512	Bacteria	1695
1506	nmdc:mga0rr50_42782_c1	3300050513	Bacteria	3310
1507	nmdc:mga0rr50_60153_c1	3300050513	Bacteria	2856
1508	nmdc:mga0rr50_7490_c1	3300050513	Bacteria	6737
1509	nmdc:mga08x19_175135_c1	3300050514	Bacteria	1462
1510	nmdc:mga08x19_219_c1	3300050514	Bacteria	43753
1511	nmdc:mga08x19_63571_c1	3300050514	Bacteria	2395
1512	nmdc:mga08x19_8071_c1	3300050514	Bacteria	6255
1513	nmdc:mga0a205_15430_c1	3300050515	Bacteria	7139
1514	nmdc:mga0sz30_10668_c1	3300050516	Bacteria	3526
1515	nmdc:mga0sz30_24146_c1	3300050516	Bacteria	2479
1516	nmdc:mga0sz30_6332_c1	3300050516	Bacteria	4391
1517	Ga0495601_0005224	3300053077	Bacteria	7554
1518	Ga0500610_0025769	3300053079	Bacteria	2936
1519	Ga0495619_0023985	3300053085	Bacteria	3912
1520	Ga0495619_0048368	3300053085	Bacteria	2802
1521	Ga0500578_0000652	3300053086	Bacteria	41736
1522	Ga0500646_0002088	3300053090	Bacteria	5207
1523	Ga0500651_0038486	3300053093	Bacteria	3013
1524	Ga0500593_011591	3300053117	Bacteria	3724
1525	Ga0500593_011860	3300053117	Bacteria	3683
1526	Ga0500594_0005824	3300053118	Bacteria	2743
1527	Ga0500621_000009	3300053126	Bacteria	173209
1528	Ga0500652_000885	3300053131	Bacteria	9913
1529	Ga0500658_0000507	3300053134	Bacteria	16624
1530	Ga0500658_0000854	3300053134	Bacteria	12508
1531	Ga0500658_0007664	3300053134	Bacteria	3988
1532	Ga0500559_0000019	3300053136	Bacteria	134862
1533	Ga0500559_0014012	3300053136	Bacteria	3389
1534	Ga0500568_0000554	3300053139	Bacteria	27551
1535	Ga0500574_000659	3300053141	Bacteria	4520
1536	Ga0500590_037396	3300053148	Bacteria	2508
1537	Ga0500616_0011698	3300053153	Bacteria	5168
1538	Ga0500616_0049014	3300053153	Bacteria	2237
1539	Ga0500619_001082	3300053154	Bacteria	4728
1540	Ga0500622_0000124	3300053156	Bacteria	81245
1541	Ga0500622_0003679	3300053156	Bacteria	10064
1542	Ga0500622_0005264	3300053156	Bacteria	7806
1543	Ga0500622_0018184	3300053156	Bacteria	3737
1544	Ga0500645_001181	3300053730	Bacteria	13913
1545	Ga0500645_010134	3300053730	Bacteria	3132
1546	Ga0500661_003043	3300055283	Bacteria	3151
1547	Ga0590071_001042	3300059421	Bacteria	7524
1548	Ga0501082_0059346	3300060353	Bacteria	3297
1549	Ga0501082_0092527	3300060353	Bacteria	2612
1550	Ga0501082_0201357	3300060353	Bacteria	1732
1551	Ga0501082_0258310	3300060353	Bacteria	1515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049514	Ga0501291_006589	Ga0501291_006589_423_1526	365
2	3300050510	nmdc:mga06r32_73337_c1	nmdc:mga06r32_73337_c1_27_1139	367
3	3300025936	Ga0207670_10167009	Ga0207670_101670091	368
4	3300037068	Ga0373925_0081460	Ga0373925_0081460_374_1696	396
5	3300046810	Ga0495660_0131274	Ga0495660_0131274_15_1205	396
6	3300003856	Ga0058692_1003453	Ga0058692_10034533	399
7	3300053093	Ga0500651_0038486	Ga0500651_0038486_1786_3000	402
8	3300037466	Ga0395898_0133020	Ga0395898_0133020_24_1238	403
9	3300038443	Ga0395901_0324211	Ga0395901_0324211_62_1279	403
10	3300049521	Ga0501298_018127	Ga0501298_018127_19_1236	403
11	3300005328	Ga0070676_10044429	Ga0070676_100444292	404
12	3300005459	Ga0068867_100024737	Ga0068867_1000247372	404
13	3300005577	Ga0068857_100094504	Ga0068857_1000945042	404
14	3300006195	Ga0075366_10023928	Ga0075366_100239284	404
15	3300025907	Ga0207645_10052992	Ga0207645_100529922	404
16	3300025960	Ga0207651_10005940	Ga0207651_100059403	404
17	3300026041	Ga0207639_10131754	Ga0207639_101317542	404
18	3300037312	Ga0395899_0102772	Ga0395899_0102772_790_2007	404
19	3300044712	Ga0453684_0001215	Ga0453684_0001215_7539_8858	404
20	3300046458	Ga0495591_016234	Ga0495591_016234_1344_2558	404
21	3300031507	Ga0307509_10046715	Ga0307509_100467153	405
22	3300027665	Ga0209983_1009217	Ga0209983_10092172	409
23	3300032004	Ga0307414_10134074	Ga0307414_101340742	409
24	3300038443	Ga0395901_0213305	Ga0395901_0213305_450_1754	409
25	3300049579	Ga0501043_0000057	Ga0501043_0000057_56560_57882	409
26	3300049580	Ga0501046_0000075	Ga0501046_0000075_56560_57882	409
27	3300049581	Ga0501047_0000081	Ga0501047_0000081_56560_57882	409
28	3300049582	Ga0501048_0003517	Ga0501048_0003517_7508_8830	409
29	3300037471	Ga0395905_0038287	Ga0395905_0038287_2174_3478	410
30	3300042876	Ga0451577_0096803	Ga0451577_0096803_671_1975	410
31	3300005459	Ga0068867_100000081	Ga0068867_1000000813	411
32	3300009148	Ga0105243_10010403	Ga0105243_100104032	411
33	3300014745	Ga0157377_10000048	Ga0157377_1000004860	411
34	3300026089	Ga0207648_10002319	Ga0207648_100023192	411
35	3300037471	Ga0395905_0018407	Ga0395905_0018407_1076_2386	411
36	3300037471	Ga0395905_0249584	Ga0395905_0249584_101_1417	411
37	3300044712	Ga0453684_0275004	Ga0453684_0275004_122_1426	411
38	3300046528	Ga0495642_0031685	Ga0495642_0031685_136_1446	411
39	3300046684	Ga0495669_0060059	Ga0495669_0060059_136_1446	411
40	3300047445	Ga0495677_0020104	Ga0495677_0020104_525_1829	411
41	3300009174	Ga0105241_10089016	Ga0105241_100890162	412
42	3300014969	Ga0157376_10001621	Ga0157376_100016217	412
43	3300035112	Ga0373932_0011766	Ga0373932_0011766_698_2020	412
44	3300035691	Ga0373931_0017241	Ga0373931_0017241_1155_2477	412
45	3300025940	Ga0207691_10019285	Ga0207691_100192852	413
46	3300026089	Ga0207648_10006871	Ga0207648_100068712	413
47	3300037471	Ga0395905_0007970	Ga0395905_0007970_6798_8132	413
48	3300037471	Ga0395905_0022866	Ga0395905_0022866_4592_5884	413
49	3300006914	Ga0075436_100031066	Ga0075436_1000310664	414
50	3300009147	Ga0114129_10213674	Ga0114129_102136742	414
51	3300050507	nmdc:mga05p37_241233_c1	nmdc:mga05p37_241233_c1_315_1616	414
52	3300050514	nmdc:mga08x19_63571_c1	nmdc:mga08x19_63571_c1_833_2134	414
53	3300005338	Ga0068868_100059565	Ga0068868_1000595652	415
54	3300006195	Ga0075366_10028720	Ga0075366_100287203	415
55	3300009177	Ga0105248_10066533	Ga0105248_100665334	415
56	3300013306	Ga0163162_10016393	Ga0163162_100163932	415
57	3300014968	Ga0157379_10104187	Ga0157379_101041872	415
58	3300021361	Ga0213872_10000490	Ga0213872_1000049022	415
59	3300025941	Ga0207711_10021326	Ga0207711_100213265	415
60	3300026023	Ga0207677_10018191	Ga0207677_100181914	415
61	3300039447	Ga0436361_0289802	Ga0436361_0289802_12521_13840	415
62	3300041997	Ga0439431_0002356	Ga0439431_0002356_2627_3895	415
63	3300042531	Ga0450918_000158	Ga0450918_000158_9416_10729	415
64	3300046537	Ga0495598_0017969	Ga0495598_0017969_53_1369	415
65	3300049743	Ga0501081_0046984	Ga0501081_0046984_296_1603	415
66	3300049779	Ga0501283_001053	Ga0501283_001053_2088_3362	415
67	iso_pu_bacteria	2904541872	2904545117	415
68	3300005444	Ga0070694_100076118	Ga0070694_1000761182	416
69	3300005545	Ga0070695_100114020	Ga0070695_1001140202	416
70	3300025940	Ga0207691_10003386	Ga0207691_1000338611	416
71	3300026116	Ga0207674_10041207	Ga0207674_100412075	416
72	3300027462	Ga0210000_1002971	Ga0210000_10029711	416
73	3300027695	Ga0209966_1006236	Ga0209966_10062362	416
74	3300031235	Ga0265330_10000046	Ga0265330_1000004617	416
75	3300031238	Ga0265332_10000028	Ga0265332_1000002895	416
76	3300031711	Ga0265314_10000054	Ga0265314_1000005495	416
77	3300003203	JGI25406J46586_10000977	JGI25406J46586_100009773	417
78	3300005295	Ga0065707_10143859	Ga0065707_101438591	417
79	3300005331	Ga0070670_100000655	Ga0070670_1000006555	417
80	3300005347	Ga0070668_100052341	Ga0070668_1000523412	417
81	3300005353	Ga0070669_100005401	Ga0070669_1000054013	417
82	3300005441	Ga0070700_100000839	Ga0070700_1000008399	417
83	3300005563	Ga0068855_100016883	Ga0068855_1000168838	417
84	3300005719	Ga0068861_100001859	Ga0068861_1000018593	417
85	3300009094	Ga0111539_10046081	Ga0111539_100460815	417
86	3300009553	Ga0105249_10001475	Ga0105249_1000147512	417
87	3300014326	Ga0157380_10008262	Ga0157380_100082622	417
88	3300025925	Ga0207650_10003707	Ga0207650_100037072	417
89	3300025961	Ga0207712_10008399	Ga0207712_100083994	417
90	3300025972	Ga0207668_10015585	Ga0207668_100155852	417
91	3300026075	Ga0207708_10001026	Ga0207708_100010267	417
92	3300026089	Ga0207648_10001876	Ga0207648_100018769	417
93	3300026118	Ga0207675_100001602	Ga0207675_1000016027	417
94	3300036712	Ga0316584_0182065	Ga0316584_0182065_241_1518	417
95	3300050511	nmdc:mga08y16_14999_c1	nmdc:mga08y16_14999_c1_4309_5619	417
96	iso_pu_bacteria	8055431914	8055434797	417
97	3300006195	Ga0075366_10000565	Ga0075366_100005658	418
98	3300014325	Ga0163163_10001639	Ga0163163_100016392	418
99	3300050493	nmdc:mga0k408_7033_c1	nmdc:mga0k408_7033_c1_3499_4809	418
100	3300005335	Ga0070666_10027838	Ga0070666_100278381	419
101	3300005347	Ga0070668_100058264	Ga0070668_1000582641	419
102	3300005356	Ga0070674_100116276	Ga0070674_1001162762	419
103	3300005364	Ga0070673_100231207	Ga0070673_1002312072	419
104	3300006914	Ga0075436_100021164	Ga0075436_1000211642	419
105	3300009553	Ga0105249_10237119	Ga0105249_102371192	419
106	3300013104	Ga0157370_10091315	Ga0157370_100913152	419
107	3300013306	Ga0163162_10154753	Ga0163162_101547532	419
108	3300025928	Ga0207700_10195604	Ga0207700_101956042	419
109	3300025972	Ga0207668_10084585	Ga0207668_100845851	419
110	3300026089	Ga0207648_10082099	Ga0207648_100820992	419
111	3300039438	Ga0436360_0038189	Ga0436360_0038189_719_2047	419
112	3300041997	Ga0439431_0021691	Ga0439431_0021691_203_1513	419
113	3300045051	Ga0451576_0095370	Ga0451576_0095370_665_1984	419
114	3300053136	Ga0500559_0014012	Ga0500559_0014012_785_2095	419
115	3300059421	Ga0590071_001042	Ga0590071_001042_2858_4192	419
116	3300005367	Ga0070667_100152503	Ga0070667_1001525032	420
117	3300005455	Ga0070663_100088288	Ga0070663_1000882882	420
118	3300005543	Ga0070672_100041756	Ga0070672_1000417563	420
119	3300005719	Ga0068861_100040101	Ga0068861_1000401011	420
120	3300005843	Ga0068860_100326033	Ga0068860_1003260332	420
121	3300025925	Ga0207650_10096580	Ga0207650_100965802	420
122	3300025940	Ga0207691_10022541	Ga0207691_100225415	420
123	3300025981	Ga0207640_10101284	Ga0207640_101012842	420
124	3300026067	Ga0207678_10149880	Ga0207678_101498802	420
125	3300026121	Ga0207683_10060473	Ga0207683_100604732	420
126	3300028794	Ga0307515_10069340	Ga0307515_100693402	420
127	iso_pu_bacteria	2643221544	2643744991	420
128	iso_pu_bacteria	2738541337	2739058935	420
129	3300005340	Ga0070689_100035794	Ga0070689_1000357943	421
130	3300005459	Ga0068867_100220926	Ga0068867_1002209261	421
131	3300005518	Ga0070699_100012659	Ga0070699_1000126593	421
132	3300005546	Ga0070696_100051492	Ga0070696_1000514923	421
133	3300005549	Ga0070704_100237986	Ga0070704_1002379861	421
134	3300006871	Ga0075434_100016216	Ga0075434_1000162165	421
135	3300006880	Ga0075429_100086523	Ga0075429_1000865233	421
136	3300025918	Ga0207662_10061126	Ga0207662_100611261	421
137	3300025936	Ga0207670_10004647	Ga0207670_100046472	421
138	3300031251	Ga0265327_10010084	Ga0265327_100100844	421
139	3300032002	Ga0307416_100006880	Ga0307416_1000068804	421
140	3300045051	Ga0451576_0102208	Ga0451576_0102208_1338_2630	421
141	3300048905	Ga0496102_0082257	Ga0496102_0082257_1296_2615	421
142	3300049662	Ga0501222_000664	Ga0501222_000664_2164_3444	421
143	3300050493	nmdc:mga0k408_57440_c1	nmdc:mga0k408_57440_c1_920_2236	421
144	3300050508	nmdc:mga09592_64009_c1	nmdc:mga09592_64009_c1_930_2222	421
145	3300050512	nmdc:mga0n895_10661_c1	nmdc:mga0n895_10661_c1_1705_2997	421
146	3300050513	nmdc:mga0rr50_60153_c1	nmdc:mga0rr50_60153_c1_789_2081	421
147	3300053156	Ga0500622_0005264	Ga0500622_0005264_3870_5153	421
148	iso_pu_bacteria	2884811622	2884811695	421
149	iso_pu_bacteria	2884836552	2884841319	421
150	iso_pu_bacteria	2884852848	2884856193	421
151	iso_pu_bacteria	2896154374	2896156881	421
152	3300005337	Ga0070682_100081811	Ga0070682_1000818111	422
153	3300005985	Ga0081539_10001716	Ga0081539_1000171618	422
154	3300006844	Ga0075428_100116127	Ga0075428_1001161272	422
155	3300009098	Ga0105245_10088093	Ga0105245_100880932	422
156	3300009177	Ga0105248_10024858	Ga0105248_100248583	422
157	3300025941	Ga0207711_10020362	Ga0207711_100203623	422
158	3300031548	Ga0307408_100000023	Ga0307408_100000023107	422
159	3300032005	Ga0307411_10034617	Ga0307411_100346172	422
160	3300042000	Ga0439437_001073	Ga0439437_001073_803_2131	422
161	3300042144	Ga0450889_000109	Ga0450889_000109_6165_7493	422
162	3300042532	Ga0450893_0001452	Ga0450893_0001452_1712_3016	422
163	3300049658	Ga0501211_001156	Ga0501211_001156_722_2038	422
164	3300049665	Ga0501227_004625	Ga0501227_004625_1090_2406	422
165	3300049669	Ga0501235_004422	Ga0501235_004422_363_1679	422
166	3300049679	Ga0501249_006914	Ga0501249_006914_71_1387	422
167	3300049683	Ga0501253_001878	Ga0501253_001878_270_1586	422
168	3300049704	Ga0501221_000960	Ga0501221_000960_1504_2820	422
169	3300049706	Ga0501229_000783	Ga0501229_000783_470_1786	422
170	3300050492	nmdc:mga0yw44_785_c1	nmdc:mga0yw44_785_c1_2062_3384	422
171	iso_pu_bacteria	2643221639	2644222768	422
172	iso_pu_bacteria	2643221646	2644260688	422
173	3300005336	Ga0070680_100074544	Ga0070680_1000745441	423
174	3300005339	Ga0070660_100030267	Ga0070660_1000302674	423
175	3300005344	Ga0070661_100172581	Ga0070661_1001725811	423
176	3300005616	Ga0068852_100224054	Ga0068852_1002240542	423
177	3300013104	Ga0157370_10227594	Ga0157370_102275942	423
178	3300025917	Ga0207660_10061869	Ga0207660_100618692	423
179	3300025919	Ga0207657_10027949	Ga0207657_100279492	423
180	3300025920	Ga0207649_10111273	Ga0207649_101112732	423
181	3300037312	Ga0395899_0001691	Ga0395899_0001691_7097_8413	423
182	3300038443	Ga0395901_0036328	Ga0395901_0036328_1941_3257	423
183	3300039447	Ga0436361_0523658	Ga0436361_0523658_8171_9475	423
184	3300048926	Ga0496123_0027207	Ga0496123_0027207_2575_3873	423
185	3300003794	Ga0055531_10000007	Ga0055531_10000007120	424
186	3300006186	Ga0075369_10010911	Ga0075369_100109112	424
187	3300025298	Ga0209050_1004806	Ga0209050_10048062	424
188	3300025303	Ga0209051_1005813	Ga0209051_10058132	424
189	3300025304	Ga0209257_1000021	Ga0209257_1000021108	424
190	3300035691	Ga0373931_0010378	Ga0373931_0010378_1640_2941	424
191	3300042876	Ga0451577_0065997	Ga0451577_0065997_1300_2601	424
192	3300048905	Ga0496102_0085748	Ga0496102_0085748_448_1740	424
193	3300049571	Ga0501034_0074934	Ga0501034_0074934_60_1361	424
194	3300049578	Ga0501042_0101347	Ga0501042_0101347_745_2049	424
195	3300050516	nmdc:mga0sz30_24146_c1	nmdc:mga0sz30_24146_c1_295_1605	424
196	iso_pu_bacteria	2548876994	2550697409	424
197	iso_pu_bacteria	2818991445	2819594809	424
198	iso_pu_bacteria	2928115317	2928120674	424
199	3300002704	JGI25155J39150_1000022	JGI25155J39150_100002273	425
200	3300002705	JGI25156J39149_1000005	JGI25156J39149_100000565	425
201	3300002738	JGI25154J39366_1000017	JGI25154J39366_100001757	425
202	3300002741	JGI25157J39369_1000003	JGI25157J39369_100000373	425
203	3300002774	JGI25150J39212_1001994	JGI25150J39212_10019942	425
204	3300002987	JGI25159J45721_1001646	JGI25159J45721_10016467	425
205	3300002987	JGI25159J45721_1001983	JGI25159J45721_10019835	425
206	3300003187	JGI25151J46595_10007702	JGI25151J46595_100077022	425
207	3300003354	JGI25160J50197_1000273	JGI25160J50197_10002732	425
208	3300003374	JGI25161J50226_1000095	JGI25161J50226_100009512	425
209	3300003773	Ga0055537_1000483	Ga0055537_10004832	425
210	3300003775	Ga0055524_1000073	Ga0055524_100007397	425
211	3300003781	Ga0055536_1004647	Ga0055536_10046472	425
212	3300003781	Ga0055536_1022945	Ga0055536_10229452	425
213	3300003784	Ga0055534_1000548	Ga0055534_10005483	425
214	3300003790	Ga0055528_1007433	Ga0055528_10074334	425
215	3300003791	Ga0055530_10001136	Ga0055530_100011362	425
216	3300003792	Ga0055540_1000037	Ga0055540_1000037109	425
217	3300003794	Ga0055531_10000112	Ga0055531_1000011258	425
218	3300004625	Ga0055543_1000218	Ga0055543_100021810	425
219	3300005262	Ga0065165_1003934	Ga0065165_10039341	425
220	3300005262	Ga0065165_1013762	Ga0065165_10137623	425
221	3300005262	Ga0065165_1014362	Ga0065165_10143623	425
222	3300005366	Ga0070659_100163697	Ga0070659_1001636971	425
223	3300005616	Ga0068852_100130031	Ga0068852_1001300311	425
224	3300021361	Ga0213872_10000093	Ga0213872_1000009362	425
225	3300021361	Ga0213872_10021144	Ga0213872_100211441	425
226	3300025206	Ga0209435_100002	Ga0209435_100002180	425
227	3300025208	Ga0209436_105519	Ga0209436_1055192	425
228	3300025245	Ga0207425_1001617	Ga0207425_10016173	425
229	3300025245	Ga0207425_1002353	Ga0207425_10023533	425
230	3300025246	Ga0209646_1000001	Ga0209646_10000012323	425
231	3300025250	Ga0209026_1000001	Ga0209026_1000001980	425
232	3300025256	Ga0209759_1000001	Ga0209759_10000011954	425
233	3300025258	Ga0209129_1005664	Ga0209129_10056643	425
234	3300025263	Ga0209565_1000128	Ga0209565_1000128108	425
235	3300025263	Ga0209565_1000708	Ga0209565_100070820	425
236	3300025273	Ga0209673_1000008	Ga0209673_1000008130	425
237	3300025273	Ga0209673_1006310	Ga0209673_10063102	425
238	3300025284	Ga0209130_1000072	Ga0209130_100007291	425
239	3300025284	Ga0209130_1000315	Ga0209130_100031545	425
240	3300025291	Ga0209675_1000221	Ga0209675_100022120	425
241	3300025291	Ga0209675_1003314	Ga0209675_10033142	425
242	3300025291	Ga0209675_1013233	Ga0209675_10132332	425
243	3300025292	Ga0209676_1000023	Ga0209676_1000023303	425
244	3300025292	Ga0209676_1001679	Ga0209676_10016799	425
245	3300025294	Ga0209025_1001733	Ga0209025_100173313	425
246	3300025294	Ga0209025_1027510	Ga0209025_10275102	425
247	3300025295	Ga0209564_1000435	Ga0209564_100043558	425
248	3300025295	Ga0209564_1000998	Ga0209564_100099820	425
249	3300025295	Ga0209564_1004319	Ga0209564_10043192	425
250	3300025297	Ga0209758_1002271	Ga0209758_100227117	425
251	3300025298	Ga0209050_1000022	Ga0209050_1000022285	425
252	3300025298	Ga0209050_1002988	Ga0209050_10029882	425
253	3300025298	Ga0209050_1008642	Ga0209050_10086422	425
254	3300025299	Ga0209256_1000001	Ga0209256_10000011771	425
255	3300025299	Ga0209256_1023396	Ga0209256_10233961	425
256	3300025302	Ga0207426_1000319	Ga0207426_100031985	425
257	3300025302	Ga0207426_1002937	Ga0207426_10029377	425
258	3300025303	Ga0209051_1000013	Ga0209051_1000013285	425
259	3300025304	Ga0209257_1000042	Ga0209257_1000042201	425
260	3300025304	Ga0209257_1010643	Ga0209257_10106433	425
261	3300025932	Ga0207690_10064410	Ga0207690_100644103	425
262	3300031456	Ga0307513_10002745	Ga0307513_100027456	425
263	3300031548	Ga0307408_100004804	Ga0307408_1000048042	425
264	3300031901	Ga0307406_10017326	Ga0307406_100173261	425
265	3300035172	Ga0373955_0007829	Ga0373955_0007829_1937_3244	425
266	3300036401	Ga0373937_0004911	Ga0373937_0004911_7173_8480	425
267	3300046463	Ga0495653_0075170	Ga0495653_0075170_61_1368	425
268	3300046511	Ga0495608_0015861	Ga0495608_0015861_1908_3215	425
269	3300046529	Ga0495652_0048893	Ga0495652_0048893_1311_2618	425
270	3300046536	Ga0495587_0007225	Ga0495587_0007225_4228_5535	425
271	3300046543	Ga0495645_0012915	Ga0495645_0012915_112_1419	425
272	3300046559	Ga0495667_0005954	Ga0495667_0005954_2886_4193	425
273	3300046615	Ga0495656_0000090	Ga0495656_0000090_37140_38429	425
274	3300046663	Ga0495635_0029296	Ga0495635_0029296_1282_2589	425
275	3300046678	Ga0495599_0003944	Ga0495599_0003944_420_1727	425
276	3300046679	Ga0495623_0002115	Ga0495623_0002115_1826_3133	425
277	3300047471	Ga0495684_0138161	Ga0495684_0138161_296_1603	425
278	3300049578	Ga0501042_0171251	Ga0501042_0171251_11_1315	425
279	3300049743	Ga0501081_0013820	Ga0501081_0013820_1922_3226	425
280	3300050491	nmdc:mga00v17_51405_c1	nmdc:mga00v17_51405_c1_257_1570	425
281	3300053077	Ga0495601_0005224	Ga0495601_0005224_4242_5549	425
282	3300053085	Ga0495619_0048368	Ga0495619_0048368_531_1838	425
283	3300053117	Ga0500593_011860	Ga0500593_011860_1434_2750	425
284	3300053156	Ga0500622_0018184	Ga0500622_0018184_1502_2803	425
285	3300053730	Ga0500645_001181	Ga0500645_001181_2927_4240	425
286	3300053730	Ga0500645_010134	Ga0500645_010134_862_2175	425
287	3300055283	Ga0500661_003043	Ga0500661_003043_622_1935	425
288	iso_pu_bacteria	2511231002	2511244604	425
289	iso_pu_bacteria	2643221628	2644161853	425
290	iso_pu_bacteria	2643221644	2644246838	425
291	iso_pu_bacteria	2643221654	2644301399	425
292	iso_pu_bacteria	2721755523	2722881999	425
293	iso_pu_bacteria	2738543013	2739248288	425
294	iso_pu_bacteria	2839138175	2839143975	425
295	iso_pu_bacteria	2842677519	2842677540	425
296	iso_pu_bacteria	2885192300	2885196925	425
297	iso_pu_bacteria	2894023352	2894024348	425
298	iso_pu_bacteria	2919462493	2919467186	425
299	iso_pu_bacteria	2929520902	2929523626	425
300	iso_pu_bacteria	2954767861	2954768818	425
301	3300003792	Ga0055540_1007521	Ga0055540_10075214	426
302	3300003794	Ga0055531_10001923	Ga0055531_1000192313	426
303	3300005434	Ga0070709_10116577	Ga0070709_101165772	426
304	3300005439	Ga0070711_100061747	Ga0070711_1000617472	426
305	3300005518	Ga0070699_100043010	Ga0070699_1000430104	426
306	3300005545	Ga0070695_100055428	Ga0070695_1000554282	426
307	3300025273	Ga0209673_1011746	Ga0209673_10117462	426
308	3300025303	Ga0209051_1000384	Ga0209051_100038450	426
309	3300025304	Ga0209257_1000096	Ga0209257_1000096129	426
310	3300025929	Ga0207664_10081866	Ga0207664_100818662	426
311	3300025949	Ga0207667_10110330	Ga0207667_101103302	426
312	3300026023	Ga0207677_10007151	Ga0207677_100071512	426
313	3300026035	Ga0207703_10092086	Ga0207703_100920863	426
314	3300031711	Ga0265314_10001039	Ga0265314_1000103921	426
315	3300035170	Ga0373943_0035289	Ga0373943_0035289_376_1680	426
316	3300035695	Ga0373927_0031512	Ga0373927_0031512_394_1698	426
317	3300036401	Ga0373937_0012886	Ga0373937_0012886_3457_4773	426
318	3300036401	Ga0373937_0121982	Ga0373937_0121982_394_1698	426
319	3300037068	Ga0373925_0082078	Ga0373925_0082078_353_1657	426
320	3300037418	Ga0395900_0015158	Ga0395900_0015158_1245_2555	426
321	3300037466	Ga0395898_0072998	Ga0395898_0072998_677_1987	426
322	3300037471	Ga0395905_0000043	Ga0395905_0000043_142183_143487	426
323	3300037471	Ga0395905_0001875	Ga0395905_0001875_12593_13897	426
324	3300037471	Ga0395905_0010328	Ga0395905_0010328_6199_7509	426
325	3300037471	Ga0395905_0034452	Ga0395905_0034452_2625_3929	426
326	3300037471	Ga0395905_0101488	Ga0395905_0101488_752_2056	426
327	3300037471	Ga0395905_0202737	Ga0395905_0202737_114_1424	426
328	3300038443	Ga0395901_0013302	Ga0395901_0013302_5471_6781	426
329	3300038443	Ga0395901_0097568	Ga0395901_0097568_649_1959	426
330	3300038443	Ga0395901_0190642	Ga0395901_0190642_807_2129	426
331	3300039437	Ga0436365_0450647	Ga0436365_0450647_346_1647	426
332	3300042115	Ga0450911_000281	Ga0450911_000281_16585_17892	426
333	3300044656	Ga0466969_0004750	Ga0466969_0004750_3714_5093	426
334	3300044656	Ga0466969_0006748	Ga0466969_0006748_1324_2634	426
335	3300044673	Ga0453683_0007502	Ga0453683_0007502_599_1900	426
336	3300044673	Ga0453683_0018762	Ga0453683_0018762_542_1837	426
337	3300044684	Ga0466966_0020148	Ga0466966_0020148_1796_3106	426
338	3300044693	Ga0466961_0014008	Ga0466961_0014008_3421_4725	426
339	3300044693	Ga0466961_0069024	Ga0466961_0069024_626_1936	426
340	3300044693	Ga0466961_0089172	Ga0466961_0089172_439_1743	426
341	3300044719	Ga0466971_0030247	Ga0466971_0030247_431_1735	426
342	3300045049	Ga0466959_0126070	Ga0466959_0126070_465_1775	426
343	3300045051	Ga0451576_0000381	Ga0451576_0000381_41166_42467	426
344	3300045051	Ga0451576_0037463	Ga0451576_0037463_1587_2894	426
345	3300046472	Ga0495580_0012135	Ga0495580_0012135_3119_4423	426
346	3300046475	Ga0495639_0010783	Ga0495639_0010783_154_1458	426
347	3300046531	Ga0495665_0010247	Ga0495665_0010247_864_2168	426
348	3300046615	Ga0495656_0019103	Ga0495656_0019103_877_2181	426
349	3300046663	Ga0495635_0016210	Ga0495635_0016210_3722_5026	426
350	3300046681	Ga0495647_0007199	Ga0495647_0007199_927_2231	426
351	3300046683	Ga0495658_0039464	Ga0495658_0039464_85_1389	426
352	3300046689	Ga0495613_0122850	Ga0495613_0122850_226_1530	426
353	3300047447	Ga0495685_052242	Ga0495685_052242_55_1365	426
354	3300048924	Ga0496121_0005682	Ga0496121_0005682_984_2291	426
355	3300048927	Ga0496124_0059353	Ga0496124_0059353_1371_2678	426
356	3300048928	Ga0496125_0037381	Ga0496125_0037381_2296_3600	426
357	3300048928	Ga0496125_0041178	Ga0496125_0041178_393_1700	426
358	3300049592	Ga0501076_0104655	Ga0501076_0104655_939_2252	426
359	3300050493	nmdc:mga0k408_42033_c1	nmdc:mga0k408_42033_c1_1225_2553	426
360	3300053085	Ga0495619_0023985	Ga0495619_0023985_514_1818	426
361	iso_pu_bacteria	2513020051	2513231038	426
362	iso_pu_bacteria	2513237150	2513955020	426
363	iso_pu_bacteria	2513237165	2514041404	426
364	iso_pu_bacteria	2547132374	2548499014	426
365	iso_pu_bacteria	2599185214	2599623384	426
366	iso_pu_bacteria	2599185226	2599675398	426
367	iso_pu_bacteria	2599185227	2599680989	426
368	iso_pu_bacteria	2599185229	2599693004	426
369	iso_pu_bacteria	2643221570	2643867780	426
370	iso_pu_bacteria	2643221596	2643991642	426
371	iso_pu_bacteria	2643221609	2644062187	426
372	iso_pu_bacteria	2643221611	2644071375	426
373	iso_pu_bacteria	2643221652	2644293389	426
374	iso_pu_bacteria	2643221658	2644325550	426
375	iso_pu_bacteria	2643221672	2644399269	426
376	iso_pu_bacteria	2643221683	2644467046	426
377	iso_pu_bacteria	2643221717	2644648471	426
378	iso_pu_bacteria	2738541277	2738718206	426
379	iso_pu_bacteria	2738543012	2739245798	426
380	iso_pu_bacteria	2738543019	2739281393	426
381	iso_pu_bacteria	2816332133	2816470492	426
382	iso_pu_bacteria	2818991446	2819600560	426
383	iso_pu_bacteria	2831265667	2831267714	426
384	iso_pu_bacteria	2838054893	2838061558	426
385	iso_pu_bacteria	2842718218	2842718737	426
386	iso_pu_bacteria	2842733646	2842736352	426
387	iso_pu_bacteria	2842747753	2842748860	426
388	iso_pu_bacteria	2881101125	2881102988	426
389	iso_pu_bacteria	2885198086	2885198816	426
390	iso_pu_bacteria	2885211737	2885211804	426
391	iso_pu_bacteria	2899924645	2899928293	426
392	iso_pu_bacteria	2904449895	2904451830	426
393	iso_pu_bacteria	2904456579	2904462513	426
394	iso_pu_bacteria	2928037797	2928041245	426
395	iso_pu_bacteria	2928044640	2928048087	426
396	iso_pu_bacteria	2928051484	2928055928	426
397	iso_pu_bacteria	2928064002	2928066591	426
398	iso_pu_bacteria	2928070936	2928077255	426
399	iso_pu_bacteria	2928084124	2928087556	426
400	iso_pu_bacteria	2945909444	2945910100	426
401	iso_pu_bacteria	2945945610	2945946132	426
402	iso_pu_bacteria	2945972063	2945975732	426
403	iso_pu_bacteria	2945984333	2945987884	426
404	iso_pu_bacteria	2974320154	2974320379	426
405	iso_pu_bacteria	2990710928	2990713910	426
406	iso_pu_bacteria	644736347	644748182	426
407	3300002741	JGI25157J39369_1000747	JGI25157J39369_100074713	427
408	3300003758	Ga0055532_1000271	Ga0055532_100027125	427
409	3300005327	Ga0070658_10037598	Ga0070658_100375983	427
410	3300005331	Ga0070670_100048709	Ga0070670_1000487092	427
411	3300005344	Ga0070661_100005150	Ga0070661_1000051501	427
412	3300005356	Ga0070674_100035402	Ga0070674_1000354023	427
413	3300005366	Ga0070659_100000722	Ga0070659_1000007222	427
414	3300005456	Ga0070678_100023376	Ga0070678_1000233761	427
415	3300005530	Ga0070679_100148911	Ga0070679_1001489112	427
416	3300005548	Ga0070665_100022394	Ga0070665_1000223942	427
417	3300005563	Ga0068855_100043350	Ga0068855_1000433505	427
418	3300005564	Ga0070664_100015251	Ga0070664_1000152512	427
419	3300005564	Ga0070664_100052551	Ga0070664_1000525513	427
420	3300005578	Ga0068854_100063337	Ga0068854_1000633373	427
421	3300005616	Ga0068852_100011356	Ga0068852_1000113566	427
422	3300005616	Ga0068852_100062192	Ga0068852_1000621923	427
423	3300005985	Ga0081539_10000917	Ga0081539_1000091749	427
424	3300006038	Ga0075365_10010415	Ga0075365_100104152	427
425	3300006048	Ga0075363_100015200	Ga0075363_1000152002	427
426	3300006177	Ga0075362_10039533	Ga0075362_100395331	427
427	3300006178	Ga0075367_10089875	Ga0075367_100898752	427
428	3300006195	Ga0075366_10004894	Ga0075366_100048942	427
429	3300006195	Ga0075366_10026377	Ga0075366_100263771	427
430	3300006195	Ga0075366_10054534	Ga0075366_100545342	427
431	3300006195	Ga0075366_10074127	Ga0075366_100741272	427
432	3300006195	Ga0075366_10151653	Ga0075366_101516531	427
433	3300006237	Ga0097621_100130284	Ga0097621_1001302842	427
434	3300006353	Ga0075370_10004844	Ga0075370_100048443	427
435	3300006353	Ga0075370_10077352	Ga0075370_100773522	427
436	3300006846	Ga0075430_100037043	Ga0075430_1000370432	427
437	3300006914	Ga0075436_100000153	Ga0075436_10000015310	427
438	3300006914	Ga0075436_100002208	Ga0075436_1000022086	427
439	3300007788	Ga0099795_10004825	Ga0099795_100048252	427
440	3300009011	Ga0105251_10011195	Ga0105251_100111954	427
441	3300009093	Ga0105240_10003800	Ga0105240_100038009	427
442	3300009093	Ga0105240_10018026	Ga0105240_100180269	427
443	3300009148	Ga0105243_10077762	Ga0105243_100777622	427
444	3300009176	Ga0105242_10040904	Ga0105242_100409042	427
445	3300009551	Ga0105238_10020927	Ga0105238_100209275	427
446	3300013102	Ga0157371_10165541	Ga0157371_101655412	427
447	3300013105	Ga0157369_10007564	Ga0157369_100075645	427
448	3300013307	Ga0157372_10014005	Ga0157372_100140055	427
449	3300013308	Ga0157375_10171662	Ga0157375_101716622	427
450	3300014497	Ga0182008_10084240	Ga0182008_100842401	427
451	3300025206	Ga0209435_100018	Ga0209435_10001890	427
452	3300025229	Ga0209147_100051	Ga0209147_10005190	427
453	3300025233	Ga0209437_100145	Ga0209437_10014510	427
454	3300025242	Ga0209258_100760	Ga0209258_1007609	427
455	3300025246	Ga0209646_1000090	Ga0209646_10000909	427
456	3300025250	Ga0209026_1000042	Ga0209026_1000042156	427
457	3300025256	Ga0209759_1000933	Ga0209759_10009333	427
458	3300025272	Ga0209455_1001361	Ga0209455_10013615	427
459	3300025735	Ga0207713_1042393	Ga0207713_10423932	427
460	3300025893	Ga0207682_10015452	Ga0207682_100154522	427
461	3300025909	Ga0207705_10008509	Ga0207705_100085092	427
462	3300025913	Ga0207695_10005351	Ga0207695_100053515	427
463	3300025913	Ga0207695_10023926	Ga0207695_100239266	427
464	3300025913	Ga0207695_10261501	Ga0207695_102615012	427
465	3300025920	Ga0207649_10029633	Ga0207649_100296331	427
466	3300025924	Ga0207694_10017482	Ga0207694_100174823	427
467	3300025928	Ga0207700_10032950	Ga0207700_100329502	427
468	3300025929	Ga0207664_10050500	Ga0207664_100505003	427
469	3300025932	Ga0207690_10013485	Ga0207690_100134855	427
470	3300025945	Ga0207679_10007093	Ga0207679_100070932	427
471	3300025945	Ga0207679_10147866	Ga0207679_101478661	427
472	3300025949	Ga0207667_10203748	Ga0207667_102037482	427
473	3300025981	Ga0207640_10075079	Ga0207640_100750792	427
474	3300026041	Ga0207639_10126648	Ga0207639_101266483	427
475	3300026067	Ga0207678_10050007	Ga0207678_100500072	427
476	3300026078	Ga0207702_10133219	Ga0207702_101332191	427
477	3300026089	Ga0207648_10025102	Ga0207648_100251022	427
478	3300026142	Ga0207698_10004332	Ga0207698_100043323	427
479	3300026142	Ga0207698_10151001	Ga0207698_101510013	427
480	3300027543	Ga0209999_1000743	Ga0209999_10007434	427
481	3300027682	Ga0209971_1001384	Ga0209971_10013843	427
482	3300028794	Ga0307515_10048317	Ga0307515_100483176	427
483	3300028794	Ga0307515_10201563	Ga0307515_102015631	427
484	3300031238	Ga0265332_10000125	Ga0265332_1000012524	427
485	3300031239	Ga0265328_10022676	Ga0265328_100226761	427
486	3300031251	Ga0265327_10034279	Ga0265327_100342793	427
487	3300031456	Ga0307513_10203007	Ga0307513_102030072	427
488	3300031665	Ga0316575_10006695	Ga0316575_100066951	427
489	3300032002	Ga0307416_100175287	Ga0307416_1001752871	427
490	3300032002	Ga0307416_100196800	Ga0307416_1001968001	427
491	3300035083	Ga0373926_0029136	Ga0373926_0029136_522_1823	427
492	3300035398	Ga0316574_0004300	Ga0316574_0004300_3246_4556	427
493	3300037418	Ga0395900_0008285	Ga0395900_0008285_2504_3811	427
494	3300038443	Ga0395901_0121820	Ga0395901_0121820_685_1992	427
495	3300042156	Ga0439446_0002089	Ga0439446_0002089_3036_4343	427
496	3300042435	Ga0439434_0007932	Ga0439434_0007932_374_1681	427
497	3300042436	Ga0439435_0000773	Ga0439435_0000773_2311_3618	427
498	3300042876	Ga0451577_0037888	Ga0451577_0037888_1747_3054	427
499	3300044712	Ga0453684_0063372	Ga0453684_0063372_2862_4178	427
500	3300044712	Ga0453684_0279876	Ga0453684_0279876_375_1682	427
501	3300044842	Ga0466957_0055469	Ga0466957_0055469_769_2076	427
502	3300045051	Ga0451576_0004449	Ga0451576_0004449_3175_4482	427
503	3300045051	Ga0451576_0112207	Ga0451576_0112207_1445_2755	427
504	3300047443	Ga0495687_001485	Ga0495687_001485_18317_19627	427
505	3300048919	Ga0496116_0044616	Ga0496116_0044616_245_1552	427
506	3300048925	Ga0496122_0001889	Ga0496122_0001889_5913_7220	427
507	3300048926	Ga0496123_0001035	Ga0496123_0001035_16496_17803	427
508	3300048928	Ga0496125_0001627	Ga0496125_0001627_24379_25686	427
509	3300049572	Ga0501036_0055815	Ga0501036_0055815_1752_3062	427
510	3300049577	Ga0501041_0064562	Ga0501041_0064562_520_1830	427
511	3300049578	Ga0501042_0025236	Ga0501042_0025236_773_2083	427
512	3300049581	Ga0501047_0127977	Ga0501047_0127977_695_2002	427
513	3300049585	Ga0501069_0002412	Ga0501069_0002412_5652_7031	427
514	3300049586	Ga0501070_0002316	Ga0501070_0002316_7113_8492	427
515	3300049588	Ga0501072_0064683	Ga0501072_0064683_164_1474	427
516	3300049590	Ga0501074_0002551	Ga0501074_0002551_5573_6952	427
517	3300049591	Ga0501075_0033424	Ga0501075_0033424_1178_2488	427
518	3300049741	Ga0501079_0005427	Ga0501079_0005427_7175_8554	427
519	3300049742	Ga0501080_0004208	Ga0501080_0004208_6932_8311	427
520	3300049744	Ga0501083_0001718	Ga0501083_0001718_6612_7991	427
521	3300049824	Ga0501045_0023822	Ga0501045_0023822_623_1933	427
522	3300050489	nmdc:mga03683_21456_c1	nmdc:mga03683_21456_c1_951_2255	427
523	3300050490	nmdc:mga03n38_22636_c1	nmdc:mga03n38_22636_c1_808_2112	427
524	3300050491	nmdc:mga00v17_21665_c1	nmdc:mga00v17_21665_c1_1651_2955	427
525	3300050492	nmdc:mga0yw44_14581_c1	nmdc:mga0yw44_14581_c1_1498_2841	427
526	3300050493	nmdc:mga0k408_2064_c1	nmdc:mga0k408_2064_c1_207_1511	427
527	3300050493	nmdc:mga0k408_40887_c1	nmdc:mga0k408_40887_c1_604_1908	427
528	3300050493	nmdc:mga0k408_93429_c1	nmdc:mga0k408_93429_c1_70_1380	427
529	3300050496	nmdc:mga07m45_28774_c1	nmdc:mga07m45_28774_c1_1471_2781	427
530	3300050496	nmdc:mga07m45_32283_c1	nmdc:mga07m45_32283_c1_1525_2835	427
531	3300050508	nmdc:mga09592_239456_c1	nmdc:mga09592_239456_c1_115_1425	427
532	3300050514	nmdc:mga08x19_219_c1	nmdc:mga08x19_219_c1_11731_13065	427
533	3300050514	nmdc:mga08x19_8071_c1	nmdc:mga08x19_8071_c1_332_1639	427
534	3300053131	Ga0500652_000885	Ga0500652_000885_1650_2978	427
535	3300053153	Ga0500616_0049014	Ga0500616_0049014_771_2096	427
536	3300053156	Ga0500622_0000124	Ga0500622_0000124_33371_34699	427
537	3300060353	Ga0501082_0201357	Ga0501082_0201357_103_1413	427
538	iso_pu_bacteria	2585428057	2587728288	427
539	iso_pu_bacteria	2585428058	2587734506	427
540	iso_pu_bacteria	2588253510	2588295004	427
541	iso_pu_bacteria	2643221592	2643971158	427
542	iso_pu_bacteria	2643221625	2644142076	427
543	iso_pu_bacteria	2643221648	2644276301	427
544	iso_pu_bacteria	2738541307	2738880404	427
545	iso_pu_bacteria	2919704043	2919707145	427
546	iso_pu_bacteria	2929160207	2929165295	427
547	iso_pu_bacteria	3003665799	3003667376	427
548	3300002773	JGI25152J39213_1001428	JGI25152J39213_10014286	428
549	3300003187	JGI25151J46595_10002783	JGI25151J46595_100027835	428
550	3300003187	JGI25151J46595_10003777	JGI25151J46595_100037773	428
551	3300003215	JGI25153J46596_10005438	JGI25153J46596_100054383	428
552	3300003322	rootL2_10004438	rootL2_100044383	428
553	3300003322	rootL2_10021412	rootL2_100214123	428
554	3300003771	Ga0055526_1000968	Ga0055526_10009688	428
555	3300003771	Ga0055526_1006110	Ga0055526_10061103	428
556	3300003771	Ga0055526_1014527	Ga0055526_10145271	428
557	3300003773	Ga0055537_1000717	Ga0055537_100071716	428
558	3300003773	Ga0055537_1002502	Ga0055537_10025023	428
559	3300003775	Ga0055524_1000658	Ga0055524_10006582	428
560	3300003775	Ga0055524_1001688	Ga0055524_10016884	428
561	3300003775	Ga0055524_1022732	Ga0055524_10227322	428
562	3300003781	Ga0055536_1000060	Ga0055536_100006052	428
563	3300003781	Ga0055536_1006788	Ga0055536_10067882	428
564	3300003784	Ga0055534_1000337	Ga0055534_100033713	428
565	3300003784	Ga0055534_1000467	Ga0055534_100046721	428
566	3300003784	Ga0055534_1000929	Ga0055534_10009296	428
567	3300003784	Ga0055534_1001861	Ga0055534_10018615	428
568	3300003791	Ga0055530_10004473	Ga0055530_100044732	428
569	3300003794	Ga0055531_10011360	Ga0055531_100113602	428
570	3300005289	Ga0065704_10079023	Ga0065704_100790231	428
571	3300005330	Ga0070690_100011726	Ga0070690_1000117262	428
572	3300005331	Ga0070670_100018207	Ga0070670_1000182073	428
573	3300005331	Ga0070670_100056163	Ga0070670_1000561631	428
574	3300005331	Ga0070670_100119152	Ga0070670_1001191522	428
575	3300005331	Ga0070670_100140245	Ga0070670_1001402452	428
576	3300005331	Ga0070670_100149189	Ga0070670_1001491891	428
577	3300005333	Ga0070677_10026317	Ga0070677_100263171	428
578	3300005334	Ga0068869_100041135	Ga0068869_1000411352	428
579	3300005336	Ga0070680_100043209	Ga0070680_1000432092	428
580	3300005347	Ga0070668_100062460	Ga0070668_1000624602	428
581	3300005353	Ga0070669_100021493	Ga0070669_1000214932	428
582	3300005353	Ga0070669_100080628	Ga0070669_1000806282	428
583	3300005354	Ga0070675_100002276	Ga0070675_1000022769	428
584	3300005354	Ga0070675_100208047	Ga0070675_1002080472	428
585	3300005355	Ga0070671_100039869	Ga0070671_1000398692	428
586	3300005355	Ga0070671_100062719	Ga0070671_1000627191	428
587	3300005356	Ga0070674_100027721	Ga0070674_1000277213	428
588	3300005434	Ga0070709_10012358	Ga0070709_100123582	428
589	3300005436	Ga0070713_100128246	Ga0070713_1001282461	428
590	3300005441	Ga0070700_100077353	Ga0070700_1000773532	428
591	3300005441	Ga0070700_100131794	Ga0070700_1001317941	428
592	3300005444	Ga0070694_100019073	Ga0070694_1000190733	428
593	3300005444	Ga0070694_100065476	Ga0070694_1000654762	428
594	3300005456	Ga0070678_100022651	Ga0070678_1000226512	428
595	3300005457	Ga0070662_100111838	Ga0070662_1001118382	428
596	3300005458	Ga0070681_10047156	Ga0070681_100471561	428
597	3300005459	Ga0068867_100001697	Ga0068867_10000169710	428
598	3300005459	Ga0068867_100042493	Ga0068867_1000424933	428
599	3300005467	Ga0070706_100000463	Ga0070706_10000046343	428
600	3300005467	Ga0070706_100076557	Ga0070706_1000765573	428
601	3300005468	Ga0070707_100011237	Ga0070707_1000112376	428
602	3300005471	Ga0070698_100038594	Ga0070698_1000385944	428
603	3300005471	Ga0070698_100171427	Ga0070698_1001714271	428
604	3300005518	Ga0070699_100027789	Ga0070699_1000277894	428
605	3300005530	Ga0070679_100043504	Ga0070679_1000435043	428
606	3300005543	Ga0070672_100013320	Ga0070672_1000133202	428
607	3300005543	Ga0070672_100018087	Ga0070672_1000180874	428
608	3300005543	Ga0070672_100272863	Ga0070672_1002728631	428
609	3300005546	Ga0070696_100003263	Ga0070696_1000032631	428
610	3300005546	Ga0070696_100035707	Ga0070696_1000357073	428
611	3300005547	Ga0070693_100007795	Ga0070693_1000077953	428
612	3300005548	Ga0070665_100013839	Ga0070665_1000138394	428
613	3300005549	Ga0070704_100004279	Ga0070704_1000042792	428
614	3300005563	Ga0068855_100020624	Ga0068855_1000206244	428
615	3300005563	Ga0068855_100036519	Ga0068855_1000365196	428
616	3300005577	Ga0068857_100199948	Ga0068857_1001999481	428
617	3300005578	Ga0068854_100027690	Ga0068854_1000276904	428
618	3300005616	Ga0068852_100005381	Ga0068852_1000053818	428
619	3300005617	Ga0068859_100066678	Ga0068859_1000666783	428
620	3300005617	Ga0068859_100100311	Ga0068859_1001003112	428
621	3300005617	Ga0068859_100101706	Ga0068859_1001017063	428
622	3300005618	Ga0068864_100006924	Ga0068864_1000069248	428
623	3300005618	Ga0068864_100016465	Ga0068864_1000164654	428
624	3300005718	Ga0068866_10006603	Ga0068866_100066035	428
625	3300005718	Ga0068866_10024029	Ga0068866_100240292	428
626	3300005719	Ga0068861_100020979	Ga0068861_1000209792	428
627	3300005834	Ga0068851_10001662	Ga0068851_100016624	428
628	3300005841	Ga0068863_100011245	Ga0068863_1000112457	428
629	3300005842	Ga0068858_100015409	Ga0068858_1000154095	428
630	3300005842	Ga0068858_100071444	Ga0068858_1000714443	428
631	3300005843	Ga0068860_100004248	Ga0068860_1000042485	428
632	3300005843	Ga0068860_100005775	Ga0068860_10000577510	428
633	3300005844	Ga0068862_100004558	Ga0068862_1000045588	428
634	3300005844	Ga0068862_100018849	Ga0068862_1000188492	428
635	3300005844	Ga0068862_100088092	Ga0068862_1000880923	428
636	3300006028	Ga0070717_10205910	Ga0070717_102059102	428
637	3300006038	Ga0075365_10006309	Ga0075365_100063093	428
638	3300006038	Ga0075365_10048041	Ga0075365_100480412	428
639	3300006042	Ga0075368_10044752	Ga0075368_100447522	428
640	3300006048	Ga0075363_100009368	Ga0075363_1000093683	428
641	3300006048	Ga0075363_100014193	Ga0075363_1000141932	428
642	3300006051	Ga0075364_10081682	Ga0075364_100816821	428
643	3300006178	Ga0075367_10013296	Ga0075367_100132962	428
644	3300006178	Ga0075367_10104720	Ga0075367_101047202	428
645	3300006186	Ga0075369_10013394	Ga0075369_100133942	428
646	3300006195	Ga0075366_10003522	Ga0075366_100035222	428
647	3300006195	Ga0075366_10034048	Ga0075366_100340483	428
648	3300006195	Ga0075366_10096754	Ga0075366_100967542	428
649	3300006195	Ga0075366_10119325	Ga0075366_101193252	428
650	3300006237	Ga0097621_100009452	Ga0097621_1000094522	428
651	3300006237	Ga0097621_100013544	Ga0097621_1000135447	428
652	3300006237	Ga0097621_100018736	Ga0097621_1000187363	428
653	3300006237	Ga0097621_100161786	Ga0097621_1001617862	428
654	3300006353	Ga0075370_10000350	Ga0075370_1000035013	428
655	3300006353	Ga0075370_10001666	Ga0075370_100016668	428
656	3300006353	Ga0075370_10012595	Ga0075370_100125953	428
657	3300006353	Ga0075370_10037247	Ga0075370_100372472	428
658	3300006353	Ga0075370_10068955	Ga0075370_100689552	428
659	3300006358	Ga0068871_100006413	Ga0068871_1000064137	428
660	3300006358	Ga0068871_100017680	Ga0068871_1000176803	428
661	3300006358	Ga0068871_100026397	Ga0068871_1000263973	428
662	3300006844	Ga0075428_100185526	Ga0075428_1001855262	428
663	3300006847	Ga0075431_100009882	Ga0075431_1000098829	428
664	3300006852	Ga0075433_10270596	Ga0075433_102705962	428
665	3300006871	Ga0075434_100000247	Ga0075434_10000024717	428
666	3300006880	Ga0075429_100000463	Ga0075429_10000046331	428
667	3300006881	Ga0068865_100041887	Ga0068865_1000418872	428
668	3300006881	Ga0068865_100056658	Ga0068865_1000566582	428
669	3300006881	Ga0068865_100061617	Ga0068865_1000616172	428
670	3300006881	Ga0068865_100072442	Ga0068865_1000724422	428
671	3300006881	Ga0068865_100169693	Ga0068865_1001696931	428
672	3300006914	Ga0075436_100055576	Ga0075436_1000555763	428
673	3300006931	Ga0097620_100066676	Ga0097620_1000666763	428
674	3300006931	Ga0097620_100100310	Ga0097620_1001003102	428
675	3300006931	Ga0097620_100101706	Ga0097620_1001017063	428
676	3300006946	Ga0079104_1000055	Ga0079104_100005555	428
677	3300006946	Ga0079104_1014636	Ga0079104_10146361	428
678	3300006948	Ga0099826_10000020	Ga0099826_1000002078	428
679	3300006948	Ga0099826_10043559	Ga0099826_100435593	428
680	3300007788	Ga0099795_10021877	Ga0099795_100218772	428
681	3300009092	Ga0105250_10003376	Ga0105250_100033762	428
682	3300009093	Ga0105240_10149092	Ga0105240_101490923	428
683	3300009147	Ga0114129_10018075	Ga0114129_100180759	428
684	3300009148	Ga0105243_10004191	Ga0105243_100041919	428
685	3300009148	Ga0105243_10043569	Ga0105243_100435692	428
686	3300009148	Ga0105243_10043909	Ga0105243_100439092	428
687	3300009148	Ga0105243_10071599	Ga0105243_100715992	428
688	3300009148	Ga0105243_10093592	Ga0105243_100935922	428
689	3300009176	Ga0105242_10002028	Ga0105242_1000202811	428
690	3300009176	Ga0105242_10041709	Ga0105242_100417092	428
691	3300009176	Ga0105242_10075746	Ga0105242_100757462	428
692	3300009176	Ga0105242_10202976	Ga0105242_102029762	428
693	3300009177	Ga0105248_10015980	Ga0105248_100159808	428
694	3300009177	Ga0105248_10097012	Ga0105248_100970122	428
695	3300009177	Ga0105248_10127574	Ga0105248_101275743	428
696	3300009177	Ga0105248_10221961	Ga0105248_102219612	428
697	3300009551	Ga0105238_10006104	Ga0105238_100061044	428
698	3300009553	Ga0105249_10054022	Ga0105249_100540222	428
699	3300009553	Ga0105249_10153732	Ga0105249_101537322	428
700	3300012497	Ga0157319_1000008	Ga0157319_1000008190	428
701	3300013296	Ga0157374_10075672	Ga0157374_100756724	428
702	3300013297	Ga0157378_10001998	Ga0157378_100019984	428
703	3300013306	Ga0163162_10000314	Ga0163162_100003149	428
704	3300013306	Ga0163162_10119864	Ga0163162_101198642	428
705	3300013306	Ga0163162_10168017	Ga0163162_101680172	428
706	3300013307	Ga0157372_10152193	Ga0157372_101521932	428
707	3300013308	Ga0157375_10010300	Ga0157375_100103002	428
708	3300013308	Ga0157375_10078372	Ga0157375_100783722	428
709	3300013308	Ga0157375_10154851	Ga0157375_101548512	428
710	3300013308	Ga0157375_10296407	Ga0157375_102964071	428
711	3300014325	Ga0163163_10382441	Ga0163163_103824411	428
712	3300014326	Ga0157380_10056722	Ga0157380_100567222	428
713	3300014497	Ga0182008_10009794	Ga0182008_100097943	428
714	3300014968	Ga0157379_10037678	Ga0157379_100376782	428
715	3300014968	Ga0157379_10050970	Ga0157379_100509703	428
716	3300014968	Ga0157379_10201015	Ga0157379_102010151	428
717	3300014969	Ga0157376_10036986	Ga0157376_100369862	428
718	3300014969	Ga0157376_10061988	Ga0157376_100619883	428
719	3300014969	Ga0157376_10063786	Ga0157376_100637862	428
720	3300015261	Ga0182006_1008526	Ga0182006_10085261	428
721	3300015261	Ga0182006_1046030	Ga0182006_10460302	428
722	3300017792	Ga0163161_10009943	Ga0163161_100099433	428
723	3300017792	Ga0163161_10033261	Ga0163161_100332612	428
724	3300017792	Ga0163161_10063022	Ga0163161_100630221	428
725	3300017792	Ga0163161_10094517	Ga0163161_100945171	428
726	3300025245	Ga0207425_1000540	Ga0207425_100054019	428
727	3300025258	Ga0209129_1000027	Ga0209129_1000027110	428
728	3300025263	Ga0209565_1000067	Ga0209565_1000067164	428
729	3300025263	Ga0209565_1000092	Ga0209565_100009283	428
730	3300025263	Ga0209565_1002114	Ga0209565_10021145	428
731	3300025273	Ga0209673_1000097	Ga0209673_100009780	428
732	3300025273	Ga0209673_1017095	Ga0209673_10170952	428
733	3300025284	Ga0209130_1002024	Ga0209130_10020243	428
734	3300025291	Ga0209675_1000038	Ga0209675_100003880	428
735	3300025291	Ga0209675_1001507	Ga0209675_10015076	428
736	3300025291	Ga0209675_1003374	Ga0209675_10033744	428
737	3300025291	Ga0209675_1004564	Ga0209675_10045645	428
738	3300025291	Ga0209675_1004790	Ga0209675_10047904	428
739	3300025292	Ga0209676_1000012	Ga0209676_100001255	428
740	3300025292	Ga0209676_1007984	Ga0209676_10079843	428
741	3300025294	Ga0209025_1001606	Ga0209025_10016068	428
742	3300025294	Ga0209025_1001987	Ga0209025_10019873	428
743	3300025294	Ga0209025_1005561	Ga0209025_10055615	428
744	3300025294	Ga0209025_1010865	Ga0209025_10108653	428
745	3300025294	Ga0209025_1020817	Ga0209025_10208172	428
746	3300025295	Ga0209564_1000139	Ga0209564_1000139101	428
747	3300025295	Ga0209564_1002737	Ga0209564_10027378	428
748	3300025295	Ga0209564_1002822	Ga0209564_10028225	428
749	3300025295	Ga0209564_1003293	Ga0209564_10032937	428
750	3300025297	Ga0209758_1000052	Ga0209758_100005210	428
751	3300025297	Ga0209758_1000146	Ga0209758_100014679	428
752	3300025298	Ga0209050_1000165	Ga0209050_1000165113	428
753	3300025299	Ga0209256_1000450	Ga0209256_100045028	428
754	3300025299	Ga0209256_1000912	Ga0209256_100091215	428
755	3300025299	Ga0209256_1001146	Ga0209256_100114613	428
756	3300025299	Ga0209256_1001845	Ga0209256_10018452	428
757	3300025299	Ga0209256_1025211	Ga0209256_10252112	428
758	3300025303	Ga0209051_1002935	Ga0209051_10029353	428
759	3300025303	Ga0209051_1007797	Ga0209051_10077974	428
760	3300025304	Ga0209257_1001206	Ga0209257_100120626	428
761	3300025304	Ga0209257_1010586	Ga0209257_10105862	428
762	3300025315	Ga0207697_10016431	Ga0207697_100164312	428
763	3300025321	Ga0207656_10003460	Ga0207656_100034602	428
764	3300025711	Ga0207696_1003192	Ga0207696_10031922	428
765	3300025893	Ga0207682_10011302	Ga0207682_100113022	428
766	3300025893	Ga0207682_10030730	Ga0207682_100307302	428
767	3300025899	Ga0207642_10052396	Ga0207642_100523962	428
768	3300025901	Ga0207688_10015371	Ga0207688_100153712	428
769	3300025907	Ga0207645_10129688	Ga0207645_101296882	428
770	3300025907	Ga0207645_10148073	Ga0207645_101480731	428
771	3300025908	Ga0207643_10076978	Ga0207643_100769781	428
772	3300025909	Ga0207705_10032151	Ga0207705_100321513	428
773	3300025910	Ga0207684_10002070	Ga0207684_100020703	428
774	3300025910	Ga0207684_10031033	Ga0207684_100310333	428
775	3300025911	Ga0207654_10051850	Ga0207654_100518503	428
776	3300025917	Ga0207660_10023901	Ga0207660_100239013	428
777	3300025921	Ga0207652_10012394	Ga0207652_100123941	428
778	3300025922	Ga0207646_10030455	Ga0207646_100304554	428
779	3300025923	Ga0207681_10043137	Ga0207681_100431371	428
780	3300025923	Ga0207681_10081392	Ga0207681_100813922	428
781	3300025925	Ga0207650_10056430	Ga0207650_100564302	428
782	3300025925	Ga0207650_10138665	Ga0207650_101386652	428
783	3300025926	Ga0207659_10003098	Ga0207659_100030989	428
784	3300025926	Ga0207659_10058394	Ga0207659_100583943	428
785	3300025927	Ga0207687_10209821	Ga0207687_102098211	428
786	3300025927	Ga0207687_10213026	Ga0207687_102130261	428
787	3300025933	Ga0207706_10070546	Ga0207706_100705462	428
788	3300025934	Ga0207686_10011790	Ga0207686_100117902	428
789	3300025934	Ga0207686_10128851	Ga0207686_101288511	428
790	3300025935	Ga0207709_10000111	Ga0207709_10000111104	428
791	3300025935	Ga0207709_10044565	Ga0207709_100445651	428
792	3300025938	Ga0207704_10010368	Ga0207704_100103682	428
793	3300025938	Ga0207704_10034820	Ga0207704_100348202	428
794	3300025940	Ga0207691_10010432	Ga0207691_100104326	428
795	3300025940	Ga0207691_10053626	Ga0207691_100536262	428
796	3300025940	Ga0207691_10057599	Ga0207691_100575994	428
797	3300025941	Ga0207711_10053726	Ga0207711_100537261	428
798	3300025941	Ga0207711_10165679	Ga0207711_101656791	428
799	3300025944	Ga0207661_10086402	Ga0207661_100864022	428
800	3300025949	Ga0207667_10010777	Ga0207667_100107777	428
801	3300025961	Ga0207712_10070498	Ga0207712_100704982	428
802	3300025961	Ga0207712_10206932	Ga0207712_102069321	428
803	3300025972	Ga0207668_10134384	Ga0207668_101343842	428
804	3300025972	Ga0207668_10240887	Ga0207668_102408872	428
805	3300025986	Ga0207658_10004645	Ga0207658_100046453	428
806	3300026035	Ga0207703_10009968	Ga0207703_100099682	428
807	3300026035	Ga0207703_10012912	Ga0207703_100129124	428
808	3300026035	Ga0207703_10042121	Ga0207703_100421212	428
809	3300026075	Ga0207708_10021822	Ga0207708_100218225	428
810	3300026075	Ga0207708_10153052	Ga0207708_101530522	428
811	3300026088	Ga0207641_10032784	Ga0207641_100327843	428
812	3300026088	Ga0207641_10037962	Ga0207641_100379623	428
813	3300026088	Ga0207641_10091037	Ga0207641_100910372	428
814	3300026088	Ga0207641_10235396	Ga0207641_102353961	428
815	3300026089	Ga0207648_10000179	Ga0207648_1000017926	428
816	3300026089	Ga0207648_10015767	Ga0207648_100157677	428
817	3300026089	Ga0207648_10021732	Ga0207648_100217323	428
818	3300026089	Ga0207648_10047779	Ga0207648_100477794	428
819	3300026089	Ga0207648_10050843	Ga0207648_100508431	428
820	3300026095	Ga0207676_10008447	Ga0207676_100084472	428
821	3300026095	Ga0207676_10009407	Ga0207676_100094072	428
822	3300026116	Ga0207674_10137304	Ga0207674_101373042	428
823	3300026118	Ga0207675_100000704	Ga0207675_1000007044	428
824	3300026118	Ga0207675_100021533	Ga0207675_1000215335	428
825	3300026118	Ga0207675_100044251	Ga0207675_1000442512	428
826	3300026121	Ga0207683_10024002	Ga0207683_100240022	428
827	3300026142	Ga0207698_10001892	Ga0207698_100018926	428
828	3300026142	Ga0207698_10020098	Ga0207698_100200983	428
829	3300027111	Ga0209281_1000007	Ga0209281_1000007774	428
830	3300027296	Ga0209389_1000249	Ga0209389_100024913	428
831	3300027666	Ga0209282_1000053	Ga0209282_1000053128	428
832	3300027666	Ga0209282_1000250	Ga0209282_100025017	428
833	3300027671	Ga0209588_1004210	Ga0209588_10042104	428
834	3300028379	Ga0268266_10059218	Ga0268266_100592182	428
835	3300028379	Ga0268266_10095949	Ga0268266_100959493	428
836	3300028379	Ga0268266_10304796	Ga0268266_103047961	428
837	3300028380	Ga0268265_10004089	Ga0268265_100040893	428
838	3300028380	Ga0268265_10013992	Ga0268265_100139924	428
839	3300028380	Ga0268265_10076950	Ga0268265_100769502	428
840	3300028381	Ga0268264_10000613	Ga0268264_1000061343	428
841	3300028381	Ga0268264_10037899	Ga0268264_100378992	428
842	3300028381	Ga0268264_10248016	Ga0268264_102480161	428
843	3300028381	Ga0268264_10271995	Ga0268264_102719951	428
844	3300028786	Ga0307517_10001395	Ga0307517_100013957	428
845	3300028794	Ga0307515_10000011	Ga0307515_10000011405	428
846	3300028794	Ga0307515_10003487	Ga0307515_100034872	428
847	3300030500	Ga0268256_1009796	Ga0268256_10097963	428
848	3300030521	Ga0307511_10000043	Ga0307511_1000004354	428
849	3300030745	Ga0316182_1411781	Ga0316182_14117812	428
850	3300031344	Ga0265316_10224581	Ga0265316_102245811	428
851	3300031456	Ga0307513_10000117	Ga0307513_1000011786	428
852	3300031507	Ga0307509_10003946	Ga0307509_100039467	428
853	3300031507	Ga0307509_10005133	Ga0307509_1000513315	428
854	3300031507	Ga0307509_10072791	Ga0307509_100727912	428
855	3300031548	Ga0307408_100016090	Ga0307408_1000160902	428
856	3300031548	Ga0307408_100055479	Ga0307408_1000554792	428
857	3300031548	Ga0307408_100085525	Ga0307408_1000855252	428
858	3300031616	Ga0307508_10003052	Ga0307508_100030524	428
859	3300031649	Ga0307514_10089293	Ga0307514_100892932	428
860	3300031691	Ga0316579_10001459	Ga0316579_100014593	428
861	3300031727	Ga0316576_10009121	Ga0316576_100091211	428
862	3300031730	Ga0307516_10002443	Ga0307516_100024434	428
863	3300031730	Ga0307516_10020817	Ga0307516_100208174	428
864	3300031731	Ga0307405_10071978	Ga0307405_100719782	428
865	3300031901	Ga0307406_10006267	Ga0307406_100062677	428
866	3300031995	Ga0307409_100142685	Ga0307409_1001426852	428
867	3300032168	Ga0316593_10023515	Ga0316593_100235152	428
868	3300033179	Ga0307507_10075769	Ga0307507_100757691	428
869	3300033180	Ga0307510_10035314	Ga0307510_100353142	428
870	3300033180	Ga0307510_10045636	Ga0307510_100456362	428
871	3300033528	Ga0316588_1003205	Ga0316588_10032053	428
872	3300033541	Ga0316596_1019472	Ga0316596_10194722	428
873	3300035725	Ga0373947_0054512	Ga0373947_0054512_503_1816	428
874	3300035725	Ga0373947_0085900	Ga0373947_0085900_538_1851	428
875	3300037068	Ga0373925_0164082	Ga0373925_0164082_155_1462	428
876	3300037312	Ga0395899_0004014	Ga0395899_0004014_6005_7315	428
877	3300037312	Ga0395899_0008709	Ga0395899_0008709_5954_7264	428
878	3300037312	Ga0395899_0019141	Ga0395899_0019141_3852_5168	428
879	3300037312	Ga0395899_0096300	Ga0395899_0096300_316_1632	428
880	3300037418	Ga0395900_0009158	Ga0395900_0009158_4056_5366	428
881	3300037418	Ga0395900_0026870	Ga0395900_0026870_2924_4240	428
882	3300037466	Ga0395898_0066398	Ga0395898_0066398_184_1500	428
883	3300038443	Ga0395901_0022795	Ga0395901_0022795_4017_5327	428
884	3300038443	Ga0395901_0055485	Ga0395901_0055485_558_1874	428
885	3300038443	Ga0395901_0115496	Ga0395901_0115496_1024_2340	428
886	3300039437	Ga0436365_1569295	Ga0436365_1569295_1563_2879	428
887	3300041404	Ga0439436_0004746	Ga0439436_0004746_2187_3497	428
888	3300041404	Ga0439436_0010792	Ga0439436_0010792_660_1973	428
889	3300042007	Ga0439449_0000620	Ga0439449_0000620_1766_3070	428
890	3300042007	Ga0439449_0001584	Ga0439449_0001584_3927_5237	428
891	3300042010	Ga0439452_002955	Ga0439452_002955_2703_4013	428
892	3300042127	Ga0450890_002116	Ga0450890_002116_850_2172	428
893	3300042145	Ga0450906_008422	Ga0450906_008422_46_1359	428
894	3300042147	Ga0450910_002890	Ga0450910_002890_410_1723	428
895	3300042156	Ga0439446_0011612	Ga0439446_0011612_641_1951	428
896	3300042435	Ga0439434_0010725	Ga0439434_0010725_732_2045	428
897	3300042439	Ga0439464_0012317	Ga0439464_0012317_592_1905	428
898	3300042876	Ga0451577_0001377	Ga0451577_0001377_2623_3936	428
899	3300042876	Ga0451577_0109094	Ga0451577_0109094_211_1524	428
900	3300042876	Ga0451577_0135954	Ga0451577_0135954_571_1884	428
901	3300044683	Ga0466965_0006837	Ga0466965_0006837_2975_4276	428
902	3300044712	Ga0453684_0074838	Ga0453684_0074838_1634_2947	428
903	3300045051	Ga0451576_0001248	Ga0451576_0001248_28466_29779	428
904	3300045051	Ga0451576_0075018	Ga0451576_0075018_500_1816	428
905	3300045051	Ga0451576_0246475	Ga0451576_0246475_382_1692	428
906	3300046452	Ga0495617_006149	Ga0495617_006149_690_1976	428
907	3300046454	Ga0495592_0000083	Ga0495592_0000083_79028_80350	428
908	3300046457	Ga0495590_0004124	Ga0495590_0004124_1236_2558	428
909	3300046458	Ga0495591_000010	Ga0495591_000010_54454_55740	428
910	3300046471	Ga0495650_0013823	Ga0495650_0013823_1214_2521	428
911	3300046474	Ga0495605_0002892	Ga0495605_0002892_4295_5605	428
912	3300046500	Ga0495596_0003191	Ga0495596_0003191_5064_6374	428
913	3300046501	Ga0495607_0025190	Ga0495607_0025190_1677_2987	428
914	3300046512	Ga0495610_0002147	Ga0495610_0002147_1494_2804	428
915	3300046513	Ga0495616_0003776	Ga0495616_0003776_2905_4215	428
916	3300046518	Ga0495631_0075004	Ga0495631_0075004_115_1437	428
917	3300046519	Ga0495632_0006527	Ga0495632_0006527_5578_7074	428
918	3300046519	Ga0495632_0034565	Ga0495632_0034565_998_2320	428
919	3300046519	Ga0495632_0047082	Ga0495632_0047082_55_1377	428
920	3300046522	Ga0495643_0019675	Ga0495643_0019675_339_1835	428
921	3300046524	Ga0495648_0060928	Ga0495648_0060928_445_1758	428
922	3300046530	Ga0495654_0000151	Ga0495654_0000151_54486_55772	428
923	3300046530	Ga0495654_0005248	Ga0495654_0005248_4447_5757	428
924	3300046542	Ga0495597_0001315	Ga0495597_0001315_1714_3021	428
925	3300046660	Ga0495625_0012405	Ga0495625_0012405_2188_3693	428
926	3300046684	Ga0495669_0006300	Ga0495669_0006300_1970_3277	428
927	3300046694	Ga0495649_0002049	Ga0495649_0002049_9887_11209	428
928	3300047673	Ga0495593_0023748	Ga0495593_0023748_1726_3048	428
929	3300048907	Ga0496104_0006891	Ga0496104_0006891_7155_8462	428
930	3300048908	Ga0496105_0010709	Ga0496105_0010709_2406_3716	428
931	3300048908	Ga0496105_0079874	Ga0496105_0079874_442_1755	428
932	3300048913	Ga0496110_0008002	Ga0496110_0008002_6440_7753	428
933	3300048913	Ga0496110_0167068	Ga0496110_0167068_650_1960	428
934	3300048915	Ga0496112_0081588	Ga0496112_0081588_1234_2547	428
935	3300048916	Ga0496113_0036962	Ga0496113_0036962_966_2279	428
936	3300048917	Ga0496114_0083481	Ga0496114_0083481_680_1990	428
937	3300048917	Ga0496114_0084255	Ga0496114_0084255_1205_2518	428
938	3300048919	Ga0496116_0000734	Ga0496116_0000734_7549_8835	428
939	3300048919	Ga0496116_0009524	Ga0496116_0009524_1721_3031	428
940	3300048922	Ga0496119_0005370	Ga0496119_0005370_9183_10469	428
941	3300048923	Ga0496120_0000178	Ga0496120_0000178_70986_72272	428
942	3300048924	Ga0496121_0029597	Ga0496121_0029597_3065_4375	428
943	3300048926	Ga0496123_0019217	Ga0496123_0019217_2076_3386	428
944	3300048927	Ga0496124_0001528	Ga0496124_0001528_10617_11903	428
945	3300048927	Ga0496124_0026597	Ga0496124_0026597_3818_5140	428
946	3300049521	Ga0501298_010776	Ga0501298_010776_189_1526	428
947	3300049526	Ga0501303_001929	Ga0501303_001929_171_1508	428
948	3300049575	Ga0501039_0130938	Ga0501039_0130938_239_1558	428
949	3300049589	Ga0501073_0057209	Ga0501073_0057209_1155_2465	428
950	3300049742	Ga0501080_0133218	Ga0501080_0133218_710_2026	428
951	3300049759	Ga0501262_000577	Ga0501262_000577_640_1953	428
952	3300049759	Ga0501262_003349	Ga0501262_003349_107_1444	428
953	3300049824	Ga0501045_0057455	Ga0501045_0057455_629_1945	428
954	3300050490	nmdc:mga03n38_64134_c1	nmdc:mga03n38_64134_c1_338_1651	428
955	3300050491	nmdc:mga00v17_30925_c1	nmdc:mga00v17_30925_c1_929_2251	428
956	3300050492	nmdc:mga0yw44_90550_c1	nmdc:mga0yw44_90550_c1_567_1892	428
957	3300050493	nmdc:mga0k408_100765_c1	nmdc:mga0k408_100765_c1_113_1426	428
958	3300050493	nmdc:mga0k408_101141_c1	nmdc:mga0k408_101141_c1_362_1675	428
959	3300050493	nmdc:mga0k408_118788_c1	nmdc:mga0k408_118788_c1_117_1490	428
960	3300050493	nmdc:mga0k408_138_c1	nmdc:mga0k408_138_c1_34381_35703	428
961	3300050493	nmdc:mga0k408_19960_c1	nmdc:mga0k408_19960_c1_781_2094	428
962	3300050493	nmdc:mga0k408_29331_c1	nmdc:mga0k408_29331_c1_1084_2394	428
963	3300050493	nmdc:mga0k408_34607_c1	nmdc:mga0k408_34607_c1_1502_2824	428
964	3300050493	nmdc:mga0k408_576_c1	nmdc:mga0k408_576_c1_11308_12630	428
965	3300050493	nmdc:mga0k408_7262_c1	nmdc:mga0k408_7262_c1_1904_3226	428
966	3300050493	nmdc:mga0k408_8618_c1	nmdc:mga0k408_8618_c1_844_2166	428
967	3300050494	nmdc:mga06z11_18151_c1	nmdc:mga06z11_18151_c1_171_1493	428
968	3300050496	nmdc:mga07m45_1226_c1	nmdc:mga07m45_1226_c1_426_1739	428
969	3300050496	nmdc:mga07m45_31118_c1	nmdc:mga07m45_31118_c1_353_1675	428
970	3300050496	nmdc:mga07m45_4924_c1	nmdc:mga07m45_4924_c1_784_2106	428
971	3300050496	nmdc:mga07m45_9657_c1	nmdc:mga07m45_9657_c1_2691_4013	428
972	3300050507	nmdc:mga05p37_21359_c1	nmdc:mga05p37_21359_c1_5601_6911	428
973	3300050508	nmdc:mga09592_1507_c1	nmdc:mga09592_1507_c1_16406_17716	428
974	3300050510	nmdc:mga06r32_33024_c1	nmdc:mga06r32_33024_c1_3109_4419	428
975	3300050511	nmdc:mga08y16_18394_c1	nmdc:mga08y16_18394_c1_2236_3546	428
976	3300050512	nmdc:mga0n895_1144_c1	nmdc:mga0n895_1144_c1_16407_17717	428
977	3300050513	nmdc:mga0rr50_42782_c1	nmdc:mga0rr50_42782_c1_1724_3037	428
978	3300050513	nmdc:mga0rr50_7490_c1	nmdc:mga0rr50_7490_c1_4136_5446	428
979	3300050516	nmdc:mga0sz30_6332_c1	nmdc:mga0sz30_6332_c1_1686_3008	428
980	3300053086	Ga0500578_0000652	Ga0500578_0000652_36583_37905	428
981	3300053090	Ga0500646_0002088	Ga0500646_0002088_3233_4609	428
982	3300053134	Ga0500658_0007664	Ga0500658_0007664_1537_2859	428
983	3300053136	Ga0500559_0000019	Ga0500559_0000019_130001_131323	428
984	3300053156	Ga0500622_0003679	Ga0500622_0003679_7710_9032	428
985	iso_pu_bacteria	2585428062	2587754215	428
986	iso_pu_bacteria	2831864461	2831869231	428
987	iso_pu_bacteria	2855730933	2855732098	428
988	iso_pu_bacteria	2855767633	2855768806	428
989	iso_pu_bacteria	2881412998	2881415244	428
990	iso_pu_bacteria	2904479285	2904481717	428
991	iso_pu_bacteria	2939631187	2939635840	428
992	3300003759	Ga0055525_1000004	Ga0055525_1000004498	429
993	3300003761	Ga0055535_1000380	Ga0055535_10003806	429
994	3300003762	Ga0055542_1000062	Ga0055542_1000062162	429
995	3300003771	Ga0055526_1006746	Ga0055526_10067466	429
996	3300003791	Ga0055530_10011023	Ga0055530_100110233	429
997	3300003792	Ga0055540_1000202	Ga0055540_100020222	429
998	3300003792	Ga0055540_1001461	Ga0055540_100146110	429
999	3300003794	Ga0055531_10001286	Ga0055531_100012867	429
1000	3300004625	Ga0055543_1002869	Ga0055543_10028692	429
1001	3300005262	Ga0065165_1000016	Ga0065165_10000162	429
1002	3300005289	Ga0065704_10072179	Ga0065704_100721794	429
1003	3300005295	Ga0065707_10083647	Ga0065707_100836472	429
1004	3300005327	Ga0070658_10102728	Ga0070658_101027281	429
1005	3300005328	Ga0070676_10002537	Ga0070676_100025372	429
1006	3300005331	Ga0070670_100018023	Ga0070670_1000180232	429
1007	3300005334	Ga0068869_100002039	Ga0068869_10000203911	429
1008	3300005338	Ga0068868_100001312	Ga0068868_1000013122	429
1009	3300005338	Ga0068868_100034469	Ga0068868_1000344692	429
1010	3300005344	Ga0070661_100234732	Ga0070661_1002347321	429
1011	3300005353	Ga0070669_100074591	Ga0070669_1000745912	429
1012	3300005354	Ga0070675_100002072	Ga0070675_10000207215	429
1013	3300005354	Ga0070675_100058320	Ga0070675_1000583202	429
1014	3300005354	Ga0070675_100078798	Ga0070675_1000787982	429
1015	3300005355	Ga0070671_100011136	Ga0070671_1000111364	429
1016	3300005355	Ga0070671_100014642	Ga0070671_1000146422	429
1017	3300005355	Ga0070671_100060152	Ga0070671_1000601522	429
1018	3300005355	Ga0070671_100096888	Ga0070671_1000968882	429
1019	3300005355	Ga0070671_100280307	Ga0070671_1002803071	429
1020	3300005356	Ga0070674_100075881	Ga0070674_1000758812	429
1021	3300005364	Ga0070673_100010612	Ga0070673_1000106124	429
1022	3300005364	Ga0070673_100013521	Ga0070673_1000135212	429
1023	3300005367	Ga0070667_100027408	Ga0070667_1000274082	429
1024	3300005367	Ga0070667_100085520	Ga0070667_1000855201	429
1025	3300005436	Ga0070713_100034409	Ga0070713_1000344095	429
1026	3300005438	Ga0070701_10053676	Ga0070701_100536762	429
1027	3300005456	Ga0070678_100036246	Ga0070678_1000362462	429
1028	3300005457	Ga0070662_100020619	Ga0070662_1000206192	429
1029	3300005459	Ga0068867_100002106	Ga0068867_1000021069	429
1030	3300005459	Ga0068867_100042821	Ga0068867_1000428212	429
1031	3300005466	Ga0070685_10084032	Ga0070685_100840322	429
1032	3300005543	Ga0070672_100002859	Ga0070672_10000285910	429
1033	3300005543	Ga0070672_100042391	Ga0070672_1000423912	429
1034	3300005548	Ga0070665_100225384	Ga0070665_1002253842	429
1035	3300005578	Ga0068854_100113326	Ga0068854_1001133262	429
1036	3300005614	Ga0068856_100079103	Ga0068856_1000791032	429
1037	3300005617	Ga0068859_100006667	Ga0068859_1000066679	429
1038	3300005618	Ga0068864_100001804	Ga0068864_1000018048	429
1039	3300005618	Ga0068864_100023957	Ga0068864_1000239574	429
1040	3300005618	Ga0068864_100049117	Ga0068864_1000491174	429
1041	3300005719	Ga0068861_100024799	Ga0068861_1000247993	429
1042	3300005719	Ga0068861_100204498	Ga0068861_1002044982	429
1043	3300005834	Ga0068851_10027158	Ga0068851_100271582	429
1044	3300005841	Ga0068863_100025859	Ga0068863_1000258596	429
1045	3300005842	Ga0068858_100005397	Ga0068858_1000053972	429
1046	3300005842	Ga0068858_100015128	Ga0068858_1000151284	429
1047	3300005843	Ga0068860_100004659	Ga0068860_10000465914	429
1048	3300005843	Ga0068860_100043724	Ga0068860_1000437242	429
1049	3300006038	Ga0075365_10029292	Ga0075365_100292923	429
1050	3300006038	Ga0075365_10108442	Ga0075365_101084422	429
1051	3300006177	Ga0075362_10005983	Ga0075362_100059832	429
1052	3300006195	Ga0075366_10010633	Ga0075366_100106334	429
1053	3300006195	Ga0075366_10040231	Ga0075366_100402312	429
1054	3300006237	Ga0097621_100025502	Ga0097621_1000255022	429
1055	3300006237	Ga0097621_100026295	Ga0097621_1000262951	429
1056	3300006237	Ga0097621_100053592	Ga0097621_1000535922	429
1057	3300006237	Ga0097621_100255942	Ga0097621_1002559421	429
1058	3300006353	Ga0075370_10001008	Ga0075370_100010086	429
1059	3300006353	Ga0075370_10012071	Ga0075370_100120712	429
1060	3300006358	Ga0068871_100017837	Ga0068871_1000178373	429
1061	3300006358	Ga0068871_100020611	Ga0068871_1000206114	429
1062	3300006844	Ga0075428_100006866	Ga0075428_10000686612	429
1063	3300006931	Ga0097620_100006667	Ga0097620_1000066679	429
1064	3300009036	Ga0105244_10010701	Ga0105244_100107012	429
1065	3300009094	Ga0111539_10007501	Ga0111539_1000750114	429
1066	3300009174	Ga0105241_10171876	Ga0105241_101718762	429
1067	3300009176	Ga0105242_10001697	Ga0105242_1000169712	429
1068	3300009177	Ga0105248_10002030	Ga0105248_100020304	429
1069	3300009177	Ga0105248_10059994	Ga0105248_100599944	429
1070	3300009551	Ga0105238_10133369	Ga0105238_101333692	429
1071	3300012502	Ga0157347_1000789	Ga0157347_10007892	429
1072	3300013100	Ga0157373_10026235	Ga0157373_100262354	429
1073	3300013105	Ga0157369_10179640	Ga0157369_101796402	429
1074	3300013296	Ga0157374_10042081	Ga0157374_100420814	429
1075	3300013306	Ga0163162_10021214	Ga0163162_100212142	429
1076	3300013306	Ga0163162_10030137	Ga0163162_100301375	429
1077	3300013306	Ga0163162_10206137	Ga0163162_102061372	429
1078	3300013307	Ga0157372_10133919	Ga0157372_101339192	429
1079	3300013307	Ga0157372_10145265	Ga0157372_101452652	429
1080	3300013308	Ga0157375_10031315	Ga0157375_100313154	429
1081	3300013308	Ga0157375_10061416	Ga0157375_100614162	429
1082	3300014325	Ga0163163_10063892	Ga0163163_100638923	429
1083	3300014325	Ga0163163_10257800	Ga0163163_102578002	429
1084	3300014326	Ga0157380_10022246	Ga0157380_100222462	429
1085	3300014497	Ga0182008_10004122	Ga0182008_100041223	429
1086	3300014497	Ga0182008_10007102	Ga0182008_100071023	429
1087	3300014968	Ga0157379_10010467	Ga0157379_100104677	429
1088	3300014968	Ga0157379_10062117	Ga0157379_100621172	429
1089	3300014969	Ga0157376_10016439	Ga0157376_100164392	429
1090	3300015261	Ga0182006_1019059	Ga0182006_10190591	429
1091	3300015262	Ga0182007_10000642	Ga0182007_100006427	429
1092	3300015262	Ga0182007_10003593	Ga0182007_100035933	429
1093	3300015683	Ga0183362_10003	Ga0183362_10003570	429
1094	3300017792	Ga0163161_10041651	Ga0163161_100416511	429
1095	3300021361	Ga0213872_10003115	Ga0213872_100031157	429
1096	3300021361	Ga0213872_10005470	Ga0213872_100054702	429
1097	3300025228	Ga0209672_101322	Ga0209672_1013225	429
1098	3300025229	Ga0209147_101675	Ga0209147_1016753	429
1099	3300025230	Ga0209563_100013	Ga0209563_100013498	429
1100	3300025242	Ga0209258_100154	Ga0209258_10015413	429
1101	3300025254	Ga0209148_1000145	Ga0209148_100014513	429
1102	3300025258	Ga0209129_1000054	Ga0209129_100005452	429
1103	3300025258	Ga0209129_1002683	Ga0209129_10026832	429
1104	3300025263	Ga0209565_1000648	Ga0209565_10006483	429
1105	3300025263	Ga0209565_1001327	Ga0209565_10013273	429
1106	3300025273	Ga0209673_1000172	Ga0209673_100017258	429
1107	3300025273	Ga0209673_1001430	Ga0209673_100143020	429
1108	3300025284	Ga0209130_1000954	Ga0209130_10009543	429
1109	3300025284	Ga0209130_1001108	Ga0209130_10011081	429
1110	3300025291	Ga0209675_1000690	Ga0209675_10006903	429
1111	3300025292	Ga0209676_1000048	Ga0209676_1000048384	429
1112	3300025294	Ga0209025_1000174	Ga0209025_1000174140	429
1113	3300025294	Ga0209025_1002139	Ga0209025_100213920	429
1114	3300025294	Ga0209025_1004985	Ga0209025_10049853	429
1115	3300025294	Ga0209025_1039297	Ga0209025_10392972	429
1116	3300025295	Ga0209564_1000008	Ga0209564_1000008548	429
1117	3300025295	Ga0209564_1000241	Ga0209564_100024184	429
1118	3300025295	Ga0209564_1001515	Ga0209564_10015153	429
1119	3300025297	Ga0209758_1000034	Ga0209758_1000034386	429
1120	3300025297	Ga0209758_1004536	Ga0209758_10045363	429
1121	3300025298	Ga0209050_1000012	Ga0209050_1000012384	429
1122	3300025298	Ga0209050_1000294	Ga0209050_100029488	429
1123	3300025298	Ga0209050_1001032	Ga0209050_100103254	429
1124	3300025299	Ga0209256_1000103	Ga0209256_100010354	429
1125	3300025299	Ga0209256_1000120	Ga0209256_1000120113	429
1126	3300025299	Ga0209256_1000165	Ga0209256_1000165101	429
1127	3300025302	Ga0207426_1000058	Ga0207426_1000058182	429
1128	3300025302	Ga0207426_1000067	Ga0207426_1000067275	429
1129	3300025303	Ga0209051_1000018	Ga0209051_1000018499	429
1130	3300025303	Ga0209051_1000019	Ga0209051_1000019303	429
1131	3300025303	Ga0209051_1000235	Ga0209051_100023550	429
1132	3300025303	Ga0209051_1001398	Ga0209051_100139815	429
1133	3300025304	Ga0209257_1000024	Ga0209257_1000024330	429
1134	3300025304	Ga0209257_1000057	Ga0209257_1000057242	429
1135	3300025304	Ga0209257_1000260	Ga0209257_100026050	429
1136	3300025728	Ga0207655_1000639	Ga0207655_100063938	429
1137	3300025903	Ga0207680_10001495	Ga0207680_100014952	429
1138	3300025907	Ga0207645_10007473	Ga0207645_100074732	429
1139	3300025907	Ga0207645_10056229	Ga0207645_100562292	429
1140	3300025908	Ga0207643_10027110	Ga0207643_100271102	429
1141	3300025911	Ga0207654_10141122	Ga0207654_101411221	429
1142	3300025923	Ga0207681_10058220	Ga0207681_100582202	429
1143	3300025923	Ga0207681_10063816	Ga0207681_100638162	429
1144	3300025923	Ga0207681_10075638	Ga0207681_100756382	429
1145	3300025924	Ga0207694_10056941	Ga0207694_100569412	429
1146	3300025925	Ga0207650_10014826	Ga0207650_100148265	429
1147	3300025926	Ga0207659_10002055	Ga0207659_100020555	429
1148	3300025926	Ga0207659_10002947	Ga0207659_100029472	429
1149	3300025928	Ga0207700_10139194	Ga0207700_101391942	429
1150	3300025931	Ga0207644_10000130	Ga0207644_1000013038	429
1151	3300025931	Ga0207644_10022846	Ga0207644_100228462	429
1152	3300025931	Ga0207644_10067704	Ga0207644_100677042	429
1153	3300025931	Ga0207644_10165726	Ga0207644_101657262	429
1154	3300025933	Ga0207706_10016017	Ga0207706_100160173	429
1155	3300025933	Ga0207706_10036971	Ga0207706_100369713	429
1156	3300025933	Ga0207706_10054917	Ga0207706_100549172	429
1157	3300025940	Ga0207691_10011577	Ga0207691_100115778	429
1158	3300025940	Ga0207691_10032593	Ga0207691_100325933	429
1159	3300025941	Ga0207711_10035493	Ga0207711_100354932	429
1160	3300025942	Ga0207689_10001818	Ga0207689_1000181811	429
1161	3300025945	Ga0207679_10033943	Ga0207679_100339432	429
1162	3300025960	Ga0207651_10001665	Ga0207651_100016655	429
1163	3300025960	Ga0207651_10003976	Ga0207651_100039767	429
1164	3300025986	Ga0207658_10004458	Ga0207658_100044585	429
1165	3300025986	Ga0207658_10083767	Ga0207658_100837672	429
1166	3300026023	Ga0207677_10033477	Ga0207677_100334772	429
1167	3300026023	Ga0207677_10040300	Ga0207677_100403002	429
1168	3300026035	Ga0207703_10002546	Ga0207703_100025462	429
1169	3300026035	Ga0207703_10016647	Ga0207703_100166472	429
1170	3300026041	Ga0207639_10013776	Ga0207639_100137763	429
1171	3300026067	Ga0207678_10083673	Ga0207678_100836731	429
1172	3300026078	Ga0207702_10075064	Ga0207702_100750641	429
1173	3300026088	Ga0207641_10016950	Ga0207641_100169504	429
1174	3300026089	Ga0207648_10006478	Ga0207648_100064782	429
1175	3300026089	Ga0207648_10057806	Ga0207648_100578062	429
1176	3300026095	Ga0207676_10001487	Ga0207676_100014878	429
1177	3300026095	Ga0207676_10014048	Ga0207676_100140485	429
1178	3300026116	Ga0207674_10188323	Ga0207674_101883232	429
1179	3300026118	Ga0207675_100046449	Ga0207675_1000464494	429
1180	3300026118	Ga0207675_100222980	Ga0207675_1002229802	429
1181	3300026121	Ga0207683_10013324	Ga0207683_100133242	429
1182	3300026121	Ga0207683_10026397	Ga0207683_100263972	429
1183	3300026121	Ga0207683_10079558	Ga0207683_100795582	429
1184	3300026142	Ga0207698_10065155	Ga0207698_100651552	429
1185	3300027111	Ga0209281_1000455	Ga0209281_100045525	429
1186	3300027614	Ga0209970_1000108	Ga0209970_10001088	429
1187	3300027876	Ga0209974_10006556	Ga0209974_100065562	429
1188	3300027876	Ga0209974_10029859	Ga0209974_100298591	429
1189	3300027907	Ga0207428_10003201	Ga0207428_100032015	429
1190	3300028381	Ga0268264_10073697	Ga0268264_100736972	429
1191	3300028794	Ga0307515_10000213	Ga0307515_1000021373	429
1192	3300028794	Ga0307515_10000472	Ga0307515_1000047281	429
1193	3300028794	Ga0307515_10000655	Ga0307515_1000065550	429
1194	3300028794	Ga0307515_10009632	Ga0307515_100096323	429
1195	3300031239	Ga0265328_10003818	Ga0265328_100038184	429
1196	3300031251	Ga0265327_10000012	Ga0265327_1000001264	429
1197	3300031251	Ga0265327_10001288	Ga0265327_1000128821	429
1198	3300031456	Ga0307513_10003270	Ga0307513_100032708	429
1199	3300031456	Ga0307513_10008037	Ga0307513_100080372	429
1200	3300031507	Ga0307509_10113339	Ga0307509_101133392	429
1201	3300031548	Ga0307408_100000101	Ga0307408_10000010111	429
1202	3300031548	Ga0307408_100006023	Ga0307408_1000060236	429
1203	3300031616	Ga0307508_10000404	Ga0307508_1000040413	429
1204	3300031649	Ga0307514_10012483	Ga0307514_100124832	429
1205	3300031730	Ga0307516_10001586	Ga0307516_1000158626	429
1206	3300031730	Ga0307516_10002741	Ga0307516_100027418	429
1207	3300031731	Ga0307405_10012732	Ga0307405_100127322	429
1208	3300031901	Ga0307406_10005067	Ga0307406_100050673	429
1209	3300031901	Ga0307406_10006712	Ga0307406_100067122	429
1210	3300031995	Ga0307409_100009728	Ga0307409_1000097283	429
1211	3300031995	Ga0307409_100263934	Ga0307409_1002639341	429
1212	3300032004	Ga0307414_10066022	Ga0307414_100660222	429
1213	3300032005	Ga0307411_10008303	Ga0307411_100083033	429
1214	3300036401	Ga0373937_0093628	Ga0373937_0093628_375_1688	429
1215	3300037312	Ga0395899_0098267	Ga0395899_0098267_318_1622	429
1216	3300037418	Ga0395900_0074221	Ga0395900_0074221_146_1450	429
1217	3300037418	Ga0395900_0084101	Ga0395900_0084101_1671_2975	429
1218	3300038443	Ga0395901_0022794	Ga0395901_0022794_4758_6062	429
1219	3300039447	Ga0436361_0101461	Ga0436361_0101461_5953_7437	429
1220	3300039447	Ga0436361_0487065	Ga0436361_0487065_52699_54009	429
1221	3300041404	Ga0439436_0004770	Ga0439436_0004770_611_1921	429
1222	3300041411	Ga0439466_0020815	Ga0439466_0020815_626_1936	429
1223	3300041413	Ga0439465_0004682	Ga0439465_0004682_2605_3915	429
1224	3300041999	Ga0439433_0006012	Ga0439433_0006012_688_1998	429
1225	3300042002	Ga0439442_006447	Ga0439442_006447_108_1418	429
1226	3300042004	Ga0439445_0001102	Ga0439445_0001102_2540_3850	429
1227	3300042006	Ga0439432_002129	Ga0439432_002129_3438_4748	429
1228	3300042007	Ga0439449_0000187	Ga0439449_0000187_1915_3225	429
1229	3300042010	Ga0439452_004200	Ga0439452_004200_784_2094	429
1230	3300042015	Ga0439462_0002391	Ga0439462_0002391_914_2224	429
1231	3300042156	Ga0439446_0002260	Ga0439446_0002260_761_2071	429
1232	3300042435	Ga0439434_0001503	Ga0439434_0001503_1224_2534	429
1233	3300042876	Ga0451577_0000276	Ga0451577_0000276_87342_88793	429
1234	3300044658	Ga0466972_0008433	Ga0466972_0008433_3438_4742	429
1235	3300044683	Ga0466965_0063016	Ga0466965_0063016_329_1639	429
1236	3300044712	Ga0453684_0000891	Ga0453684_0000891_10706_12157	429
1237	3300045051	Ga0451576_0025162	Ga0451576_0025162_2804_4120	429
1238	3300045051	Ga0451576_0073694	Ga0451576_0073694_2183_3496	429
1239	3300045051	Ga0451576_0137068	Ga0451576_0137068_873_2180	429
1240	3300046453	Ga0495627_006447	Ga0495627_006447_2236_3546	429
1241	3300046475	Ga0495639_0014230	Ga0495639_0014230_809_2119	429
1242	3300046477	Ga0495664_0057886	Ga0495664_0057886_168_1484	429
1243	3300046512	Ga0495610_0008257	Ga0495610_0008257_5279_6589	429
1244	3300046513	Ga0495616_0003177	Ga0495616_0003177_342_1652	429
1245	3300046515	Ga0495620_0010395	Ga0495620_0010395_2188_3498	429
1246	3300046530	Ga0495654_0045127	Ga0495654_0045127_286_1596	429
1247	3300046660	Ga0495625_0001055	Ga0495625_0001055_19896_21206	429
1248	3300046660	Ga0495625_0025375	Ga0495625_0025375_872_2182	429
1249	3300046810	Ga0495660_0022000	Ga0495660_0022000_1716_3026	429
1250	3300048903	Ga0496100_0115867	Ga0496100_0115867_468_1781	429
1251	3300048904	Ga0496101_0041259	Ga0496101_0041259_1299_2612	429
1252	3300048905	Ga0496102_0003600	Ga0496102_0003600_10176_11489	429
1253	3300048908	Ga0496105_0003958	Ga0496105_0003958_8654_9964	429
1254	3300048909	Ga0496106_0032806	Ga0496106_0032806_2110_3426	429
1255	3300048910	Ga0496107_0037525	Ga0496107_0037525_1654_2970	429
1256	3300048910	Ga0496107_0137712	Ga0496107_0137712_396_1706	429
1257	3300048911	Ga0496108_0275988	Ga0496108_0275988_10_1329	429
1258	3300048912	Ga0496109_0118029	Ga0496109_0118029_332_1651	429
1259	3300048913	Ga0496110_0219326	Ga0496110_0219326_117_1427	429
1260	3300048918	Ga0496115_0027385	Ga0496115_0027385_1486_2802	429
1261	3300048920	Ga0496117_0015917	Ga0496117_0015917_862_2175	429
1262	3300048921	Ga0496118_0006660	Ga0496118_0006660_2187_3500	429
1263	3300048921	Ga0496118_0041408	Ga0496118_0041408_809_2122	429
1264	3300048924	Ga0496121_0027348	Ga0496121_0027348_1494_2804	429
1265	3300048928	Ga0496125_0067848	Ga0496125_0067848_747_2060	429
1266	3300049572	Ga0501036_0024340	Ga0501036_0024340_2781_4106	429
1267	3300049575	Ga0501039_0005064	Ga0501039_0005064_8554_9879	429
1268	3300049576	Ga0501040_0018020	Ga0501040_0018020_297_1622	429
1269	3300049580	Ga0501046_0011964	Ga0501046_0011964_4717_6042	429
1270	3300049582	Ga0501048_0034983	Ga0501048_0034983_1048_2373	429
1271	3300049741	Ga0501079_0016872	Ga0501079_0016872_3440_4765	429
1272	3300049823	Ga0501044_0065371	Ga0501044_0065371_1063_2388	429
1273	3300049824	Ga0501045_0004966	Ga0501045_0004966_7872_9197	429
1274	3300050489	nmdc:mga03683_19923_c1	nmdc:mga03683_19923_c1_1120_2430	429
1275	3300050492	nmdc:mga0yw44_110325_c1	nmdc:mga0yw44_110325_c1_99_1418	429
1276	3300050493	nmdc:mga0k408_13542_c1	nmdc:mga0k408_13542_c1_1906_3219	429
1277	3300050493	nmdc:mga0k408_16735_c1	nmdc:mga0k408_16735_c1_673_1983	429
1278	3300050493	nmdc:mga0k408_7453_c1	nmdc:mga0k408_7453_c1_2354_3679	429
1279	3300050496	nmdc:mga07m45_11357_c1	nmdc:mga07m45_11357_c1_2512_3822	429
1280	3300050496	nmdc:mga07m45_3534_c1	nmdc:mga07m45_3534_c1_1985_3295	429
1281	3300050496	nmdc:mga07m45_639_c1	nmdc:mga07m45_639_c1_11301_12611	429
1282	3300050511	nmdc:mga08y16_224_c1	nmdc:mga08y16_224_c1_42379_43692	429
1283	3300050512	nmdc:mga0n895_278806_c1	nmdc:mga0n895_278806_c1_335_1651	429
1284	3300050516	nmdc:mga0sz30_10668_c1	nmdc:mga0sz30_10668_c1_1878_3191	429
1285	3300053079	Ga0500610_0025769	Ga0500610_0025769_211_1521	429
1286	3300053117	Ga0500593_011591	Ga0500593_011591_1415_2725	429
1287	3300053118	Ga0500594_0005824	Ga0500594_0005824_589_1899	429
1288	3300053134	Ga0500658_0000507	Ga0500658_0000507_11481_12791	429
1289	3300053139	Ga0500568_0000554	Ga0500568_0000554_3870_5180	429
1290	3300053148	Ga0500590_037396	Ga0500590_037396_483_1799	429
1291	3300053153	Ga0500616_0011698	Ga0500616_0011698_3143_4453	429
1292	3300060353	Ga0501082_0092527	Ga0501082_0092527_29_1354	429
1293	3300003187	JGI25151J46595_10009716	JGI25151J46595_100097163	430
1294	3300005262	Ga0065165_1000942	Ga0065165_10009422	430
1295	3300005434	Ga0070709_10012257	Ga0070709_100122572	430
1296	3300005436	Ga0070713_100012928	Ga0070713_1000129282	430
1297	3300005437	Ga0070710_10047349	Ga0070710_100473492	430
1298	3300005439	Ga0070711_100004600	Ga0070711_1000046002	430
1299	3300005440	Ga0070705_100136038	Ga0070705_1001360381	430
1300	3300005468	Ga0070707_100075144	Ga0070707_1000751444	430
1301	3300005563	Ga0068855_100033144	Ga0068855_1000331443	430
1302	3300005577	Ga0068857_100108286	Ga0068857_1001082862	430
1303	3300005616	Ga0068852_100071351	Ga0068852_1000713513	430
1304	3300005937	Ga0081455_10075970	Ga0081455_100759702	430
1305	3300006195	Ga0075366_10007992	Ga0075366_100079922	430
1306	3300009545	Ga0105237_10012592	Ga0105237_100125927	430
1307	3300009551	Ga0105238_10109604	Ga0105238_101096042	430
1308	3300010375	Ga0105239_10046513	Ga0105239_100465132	430
1309	3300013105	Ga0157369_10001065	Ga0157369_100010656	430
1310	3300025291	Ga0209675_1006032	Ga0209675_10060324	430
1311	3300025294	Ga0209025_1000173	Ga0209025_1000173122	430
1312	3300025294	Ga0209025_1001066	Ga0209025_10010662	430
1313	3300025294	Ga0209025_1030667	Ga0209025_10306672	430
1314	3300025298	Ga0209050_1012744	Ga0209050_10127444	430
1315	3300025906	Ga0207699_10026650	Ga0207699_100266502	430
1316	3300025915	Ga0207693_10024167	Ga0207693_100241673	430
1317	3300025922	Ga0207646_10090569	Ga0207646_100905692	430
1318	3300025928	Ga0207700_10040172	Ga0207700_100401723	430
1319	3300025941	Ga0207711_10174904	Ga0207711_101749041	430
1320	3300025949	Ga0207667_10016009	Ga0207667_100160096	430
1321	3300031251	Ga0265327_10022614	Ga0265327_100226143	430
1322	3300031691	Ga0316579_10000811	Ga0316579_100008113	430
1323	3300031727	Ga0316576_10011214	Ga0316576_100112144	430
1324	3300031728	Ga0316578_10035796	Ga0316578_100357962	430
1325	3300035398	Ga0316574_0000070	Ga0316574_0000070_289_1614	430
1326	3300036647	Ga0316582_0090752	Ga0316582_0090752_37_1356	430
1327	3300037471	Ga0395905_0082764	Ga0395905_0082764_1216_2526	430
1328	3300041512	Ga0451853_2018397	Ga0451853_2018397_253_1581	430
1329	3300045976	Ga0466967_0184275	Ga0466967_0184275_555_1880	430
1330	3300047321	Ga0495676_0022957	Ga0495676_0022957_596_1909	430
1331	3300048089	Ga0495614_0026926	Ga0495614_0026926_693_2006	430
1332	3300048919	Ga0496116_0006777	Ga0496116_0006777_6170_7483	430
1333	3300048920	Ga0496117_0011620	Ga0496117_0011620_4147_5460	430
1334	3300049577	Ga0501041_0051976	Ga0501041_0051976_943_2274	430
1335	3300049586	Ga0501070_0099387	Ga0501070_0099387_591_1904	430
1336	3300049587	Ga0501071_0091465	Ga0501071_0091465_673_2004	430
1337	3300049588	Ga0501072_0045021	Ga0501072_0045021_937_2268	430
1338	3300049592	Ga0501076_0028788	Ga0501076_0028788_545_1861	430
1339	3300049741	Ga0501079_0065864	Ga0501079_0065864_996_2327	430
1340	3300049742	Ga0501080_0061602	Ga0501080_0061602_1782_3113	430
1341	3300049744	Ga0501083_0028189	Ga0501083_0028189_2313_3626	430
1342	3300049824	Ga0501045_0010264	Ga0501045_0010264_1181_2512	430
1343	3300050493	nmdc:mga0k408_5849_c1	nmdc:mga0k408_5849_c1_1144_2484	430
1344	3300050511	nmdc:mga08y16_315156_c1	nmdc:mga08y16_315156_c1_247_1569	430
1345	3300053134	Ga0500658_0000854	Ga0500658_0000854_7368_8681	430
1346	3300053141	Ga0500574_000659	Ga0500574_000659_1956_3269	430
1347	3300053154	Ga0500619_001082	Ga0500619_001082_1938_3263	430
1348	3300060353	Ga0501082_0059346	Ga0501082_0059346_1110_2423	430
1349	3300060353	Ga0501082_0258310	Ga0501082_0258310_16_1347	430
1350	iso_pu_bacteria	2834641062	2834643046	430
1351	iso_pu_bacteria	2857576091	2857579865	430
1352	iso_pu_bacteria	8003400568	8003403085	430
1353	3300005293	Ga0065715_10179597	Ga0065715_101795971	431
1354	3300005339	Ga0070660_100058604	Ga0070660_1000586043	431
1355	3300005344	Ga0070661_100106474	Ga0070661_1001064743	431
1356	3300005355	Ga0070671_100016334	Ga0070671_1000163344	431
1357	3300005366	Ga0070659_100028792	Ga0070659_1000287923	431
1358	3300005367	Ga0070667_100063891	Ga0070667_1000638912	431
1359	3300005438	Ga0070701_10106001	Ga0070701_101060011	431
1360	3300005455	Ga0070663_100032290	Ga0070663_1000322902	431
1361	3300005457	Ga0070662_100001216	Ga0070662_1000012163	431
1362	3300005457	Ga0070662_100141538	Ga0070662_1001415381	431
1363	3300005458	Ga0070681_10015201	Ga0070681_100152015	431
1364	3300005458	Ga0070681_10098398	Ga0070681_100983982	431
1365	3300005530	Ga0070679_100042804	Ga0070679_1000428042	431
1366	3300005539	Ga0068853_100001296	Ga0068853_10000129613	431
1367	3300005539	Ga0068853_100020194	Ga0068853_1000201943	431
1368	3300005543	Ga0070672_100035554	Ga0070672_1000355543	431
1369	3300005563	Ga0068855_100019918	Ga0068855_1000199184	431
1370	3300005564	Ga0070664_100023069	Ga0070664_1000230694	431
1371	3300005578	Ga0068854_100017824	Ga0068854_1000178242	431
1372	3300005614	Ga0068856_100003497	Ga0068856_1000034973	431
1373	3300006844	Ga0075428_100059027	Ga0075428_1000590274	431
1374	3300006847	Ga0075431_100045869	Ga0075431_1000458691	431
1375	3300006880	Ga0075429_100012319	Ga0075429_1000123192	431
1376	3300009147	Ga0114129_10005167	Ga0114129_1000516711	431
1377	3300009551	Ga0105238_10096631	Ga0105238_100966313	431
1378	3300009553	Ga0105249_10192154	Ga0105249_101921542	431
1379	3300010375	Ga0105239_10179760	Ga0105239_101797601	431
1380	3300011119	Ga0105246_10141477	Ga0105246_101414772	431
1381	3300013100	Ga0157373_10008814	Ga0157373_100088146	431
1382	3300013100	Ga0157373_10018126	Ga0157373_100181262	431
1383	3300013102	Ga0157371_10020896	Ga0157371_100208962	431
1384	3300013104	Ga0157370_10027854	Ga0157370_100278543	431
1385	3300013105	Ga0157369_10083686	Ga0157369_100836863	431
1386	3300013307	Ga0157372_10001667	Ga0157372_1000166713	431
1387	3300014968	Ga0157379_10030571	Ga0157379_100305712	431
1388	3300025294	Ga0209025_1000026	Ga0209025_1000026100	431
1389	3300025912	Ga0207707_10016028	Ga0207707_100160283	431
1390	3300025914	Ga0207671_10017114	Ga0207671_100171144	431
1391	3300025917	Ga0207660_10123348	Ga0207660_101233482	431
1392	3300025917	Ga0207660_10215822	Ga0207660_102158221	431
1393	3300025919	Ga0207657_10000447	Ga0207657_100004474	431
1394	3300025921	Ga0207652_10212603	Ga0207652_102126032	431
1395	3300025923	Ga0207681_10118513	Ga0207681_101185132	431
1396	3300025931	Ga0207644_10002085	Ga0207644_100020857	431
1397	3300025932	Ga0207690_10003996	Ga0207690_100039963	431
1398	3300025933	Ga0207706_10000156	Ga0207706_1000015641	431
1399	3300025945	Ga0207679_10012131	Ga0207679_100121312	431
1400	3300025949	Ga0207667_10006776	Ga0207667_1000677610	431
1401	3300025960	Ga0207651_10005715	Ga0207651_100057154	431
1402	3300025981	Ga0207640_10037866	Ga0207640_100378662	431
1403	3300025986	Ga0207658_10050936	Ga0207658_100509361	431
1404	3300026041	Ga0207639_10076160	Ga0207639_100761602	431
1405	3300026067	Ga0207678_10043272	Ga0207678_100432722	431
1406	3300026078	Ga0207702_10002083	Ga0207702_100020833	431
1407	3300026121	Ga0207683_10096370	Ga0207683_100963701	431
1408	3300027876	Ga0209974_10006964	Ga0209974_100069644	431
1409	3300028380	Ga0268265_10246391	Ga0268265_102463911	431
1410	3300031852	Ga0307410_10009283	Ga0307410_100092832	431
1411	3300031852	Ga0307410_10022186	Ga0307410_100221863	431
1412	3300031901	Ga0307406_10042617	Ga0307406_100426173	431
1413	3300031903	Ga0307407_10113724	Ga0307407_101137242	431
1414	3300031995	Ga0307409_100162078	Ga0307409_1001620781	431
1415	3300031995	Ga0307409_100213215	Ga0307409_1002132152	431
1416	3300033179	Ga0307507_10111544	Ga0307507_101115442	431
1417	3300035692	Ga0373935_0067325	Ga0373935_0067325_362_1690	431
1418	3300042013	Ga0439456_007254	Ga0439456_007254_224_1564	431
1419	3300042436	Ga0439435_0023924	Ga0439435_0023924_42_1382	431
1420	3300045051	Ga0451576_0023570	Ga0451576_0023570_4279_5598	431
1421	3300045976	Ga0466967_0168927	Ga0466967_0168927_418_1737	431
1422	3300047315	Ga0495581_0046287	Ga0495581_0046287_135_1463	431
1423	3300047322	Ga0495680_0119611	Ga0495680_0119611_104_1432	431
1424	3300048903	Ga0496100_0089285	Ga0496100_0089285_650_1984	431
1425	3300048905	Ga0496102_0060046	Ga0496102_0060046_2040_3374	431
1426	3300048910	Ga0496107_0162446	Ga0496107_0162446_121_1455	431
1427	3300049586	Ga0501070_0089982	Ga0501070_0089982_567_1886	431
1428	3300049589	Ga0501073_0015213	Ga0501073_0015213_59_1378	431
1429	3300049742	Ga0501080_0007125	Ga0501080_0007125_3862_5181	431
1430	3300049822	Ga0501035_0248252	Ga0501035_0248252_67_1386	431
1431	3300050490	nmdc:mga03n38_7643_c1	nmdc:mga03n38_7643_c1_363_1703	431
1432	3300050507	nmdc:mga05p37_181_c1	nmdc:mga05p37_181_c1_33995_35335	431
1433	3300050508	nmdc:mga09592_64418_c1	nmdc:mga09592_64418_c1_1628_2953	431
1434	3300050515	nmdc:mga0a205_15430_c1	nmdc:mga0a205_15430_c1_1440_2774	431
1435	iso_pu_bacteria	2687453129	2687581166	431
1436	3300005327	Ga0070658_10154433	Ga0070658_101544331	432
1437	3300005329	Ga0070683_100022694	Ga0070683_1000226942	432
1438	3300005329	Ga0070683_100057870	Ga0070683_1000578702	432
1439	3300005334	Ga0068869_100061697	Ga0068869_1000616972	432
1440	3300005336	Ga0070680_100216976	Ga0070680_1002169762	432
1441	3300005337	Ga0070682_100045907	Ga0070682_1000459073	432
1442	3300005339	Ga0070660_100061785	Ga0070660_1000617852	432
1443	3300005344	Ga0070661_100014669	Ga0070661_1000146692	432
1444	3300005344	Ga0070661_100054923	Ga0070661_1000549232	432
1445	3300005345	Ga0070692_10046303	Ga0070692_100463032	432
1446	3300005366	Ga0070659_100025249	Ga0070659_1000252492	432
1447	3300005366	Ga0070659_100039166	Ga0070659_1000391663	432
1448	3300005434	Ga0070709_10074315	Ga0070709_100743152	432
1449	3300005435	Ga0070714_100116842	Ga0070714_1001168422	432
1450	3300005444	Ga0070694_100017278	Ga0070694_1000172782	432
1451	3300005455	Ga0070663_100012806	Ga0070663_1000128062	432
1452	3300005457	Ga0070662_100020556	Ga0070662_1000205562	432
1453	3300005458	Ga0070681_10017457	Ga0070681_100174572	432
1454	3300005467	Ga0070706_100067449	Ga0070706_1000674492	432
1455	3300005467	Ga0070706_100215096	Ga0070706_1002150961	432
1456	3300005468	Ga0070707_100186478	Ga0070707_1001864781	432
1457	3300005518	Ga0070699_100019325	Ga0070699_1000193253	432
1458	3300005518	Ga0070699_100028721	Ga0070699_1000287212	432
1459	3300005535	Ga0070684_100019385	Ga0070684_1000193853	432
1460	3300005535	Ga0070684_100020668	Ga0070684_1000206682	432
1461	3300005536	Ga0070697_100033017	Ga0070697_1000330172	432
1462	3300005539	Ga0068853_100094553	Ga0068853_1000945531	432
1463	3300005547	Ga0070693_100021450	Ga0070693_1000214502	432
1464	3300005549	Ga0070704_100023273	Ga0070704_1000232732	432
1465	3300005564	Ga0070664_100026646	Ga0070664_1000266465	432
1466	3300005564	Ga0070664_100115380	Ga0070664_1001153802	432
1467	3300005578	Ga0068854_100008019	Ga0068854_1000080196	432
1468	3300005578	Ga0068854_100016437	Ga0068854_1000164374	432
1469	3300005614	Ga0068856_100052020	Ga0068856_1000520202	432
1470	3300005614	Ga0068856_100059045	Ga0068856_1000590452	432
1471	3300009093	Ga0105240_10115080	Ga0105240_101150802	432
1472	3300009098	Ga0105245_10007918	Ga0105245_100079183	432
1473	3300009174	Ga0105241_10065167	Ga0105241_100651672	432
1474	3300009177	Ga0105248_10333486	Ga0105248_103334861	432
1475	3300009551	Ga0105238_10099453	Ga0105238_100994532	432
1476	3300011119	Ga0105246_10032227	Ga0105246_100322272	432
1477	3300013100	Ga0157373_10016114	Ga0157373_100161145	432
1478	3300013102	Ga0157371_10065579	Ga0157371_100655792	432
1479	3300013307	Ga0157372_10181148	Ga0157372_101811482	432
1480	3300013307	Ga0157372_10246392	Ga0157372_102463921	432
1481	3300013307	Ga0157372_10296465	Ga0157372_102964651	432
1482	3300025321	Ga0207656_10006943	Ga0207656_100069435	432
1483	3300025906	Ga0207699_10067168	Ga0207699_100671682	432
1484	3300025909	Ga0207705_10060329	Ga0207705_100603292	432
1485	3300025911	Ga0207654_10028201	Ga0207654_100282011	432
1486	3300025911	Ga0207654_10036040	Ga0207654_100360402	432
1487	3300025912	Ga0207707_10010626	Ga0207707_100106266	432
1488	3300025912	Ga0207707_10026595	Ga0207707_100265955	432
1489	3300025912	Ga0207707_10040244	Ga0207707_100402444	432
1490	3300025913	Ga0207695_10109358	Ga0207695_101093582	432
1491	3300025914	Ga0207671_10032445	Ga0207671_100324452	432
1492	3300025915	Ga0207693_10004206	Ga0207693_100042063	432
1493	3300025917	Ga0207660_10083826	Ga0207660_100838262	432
1494	3300025919	Ga0207657_10003605	Ga0207657_100036056	432
1495	3300025919	Ga0207657_10004258	Ga0207657_1000425811	432
1496	3300025920	Ga0207649_10051595	Ga0207649_100515952	432
1497	3300025920	Ga0207649_10091531	Ga0207649_100915312	432
1498	3300025921	Ga0207652_10015269	Ga0207652_100152692	432
1499	3300025922	Ga0207646_10002045	Ga0207646_1000204520	432
1500	3300025922	Ga0207646_10083481	Ga0207646_100834812	432
1501	3300025924	Ga0207694_10079876	Ga0207694_100798762	432
1502	3300025925	Ga0207650_10225635	Ga0207650_102256351	432
1503	3300025928	Ga0207700_10022967	Ga0207700_100229673	432
1504	3300025929	Ga0207664_10090116	Ga0207664_100901162	432
1505	3300025932	Ga0207690_10037637	Ga0207690_100376373	432
1506	3300025933	Ga0207706_10025996	Ga0207706_100259962	432
1507	3300025939	Ga0207665_10002266	Ga0207665_100022669	432
1508	3300025942	Ga0207689_10015442	Ga0207689_100154428	432
1509	3300025945	Ga0207679_10037700	Ga0207679_100377002	432
1510	3300025949	Ga0207667_10019277	Ga0207667_100192772	432
1511	3300025949	Ga0207667_10024536	Ga0207667_100245366	432
1512	3300026023	Ga0207677_10173075	Ga0207677_101730752	432
1513	3300026041	Ga0207639_10013143	Ga0207639_100131433	432
1514	3300026041	Ga0207639_10059696	Ga0207639_100596963	432
1515	3300026067	Ga0207678_10030122	Ga0207678_100301225	432
1516	3300026067	Ga0207678_10157414	Ga0207678_101574142	432
1517	3300026075	Ga0207708_10092172	Ga0207708_100921722	432
1518	3300026116	Ga0207674_10004569	Ga0207674_100045692	432
1519	3300026116	Ga0207674_10013444	Ga0207674_100134445	432
1520	3300026118	Ga0207675_100022891	Ga0207675_1000228913	432
1521	3300026118	Ga0207675_100110243	Ga0207675_1001102432	432
1522	3300026118	Ga0207675_100129843	Ga0207675_1001298432	432
1523	3300026142	Ga0207698_10064780	Ga0207698_100647802	432
1524	3300031238	Ga0265332_10000951	Ga0265332_100009514	432
1525	3300031250	Ga0265331_10001806	Ga0265331_1000180613	432
1526	3300031251	Ga0265327_10011638	Ga0265327_100116383	432
1527	3300031344	Ga0265316_10053940	Ga0265316_100539402	432
1528	3300031548	Ga0307408_100001843	Ga0307408_1000018433	432
1529	3300031731	Ga0307405_10055945	Ga0307405_100559452	432
1530	3300031824	Ga0307413_10001940	Ga0307413_100019402	432
1531	3300031852	Ga0307410_10002072	Ga0307410_100020724	432
1532	3300031901	Ga0307406_10087961	Ga0307406_100879611	432
1533	3300031911	Ga0307412_10003320	Ga0307412_100033202	432
1534	3300031995	Ga0307409_100042544	Ga0307409_1000425441	432
1535	3300032002	Ga0307416_100016563	Ga0307416_1000165632	432
1536	3300032004	Ga0307414_10180484	Ga0307414_101804841	432
1537	3300032005	Ga0307411_10002409	Ga0307411_100024092	432
1538	3300032126	Ga0307415_100003806	Ga0307415_1000038062	432
1539	3300035695	Ga0373927_0001348	Ga0373927_0001348_12027_13373	432
1540	3300036401	Ga0373937_0010376	Ga0373937_0010376_1704_3029	432
1541	3300045051	Ga0451576_0108446	Ga0451576_0108446_457_1785	432
1542	3300046543	Ga0495645_0148003	Ga0495645_0148003_75_1427	432
1543	3300050514	nmdc:mga08x19_175135_c1	nmdc:mga08x19_175135_c1_25_1347	432
1544	3300007265	Ga0099794_10021968	Ga0099794_100219683	433
1545	3300010159	Ga0099796_10007483	Ga0099796_100074832	433
1546	3300035695	Ga0373927_0042538	Ga0373927_0042538_983_2314	433
1547	3300046522	Ga0495643_0033289	Ga0495643_0033289_514_1896	433
1548	3300046542	Ga0495597_0066425	Ga0495597_0066425_56_1438	433
1549	3300039453	Ga0436362_0477984	Ga0436362_0477984_831_2159	434
1550	iso_pu_bacteria	2511231025	2511382598	434
1551	iso_pu_bacteria	2511231035	2511435976	434
1552	iso_pu_bacteria	2608642108	2608671670	434
1553	iso_pu_bacteria	2808606414	2809126721	434
1554	iso_pu_bacteria	2844528606	2844532303	434
1555	iso_pu_bacteria	2847797336	2847797675	434
1556	iso_pu_bacteria	2865014394	2865014898	434
1557	iso_pu_bacteria	2869551831	2869552047	434
1558	iso_pu_bacteria	2876601092	2876602561	434
1559	iso_pu_bacteria	2881609920	2881612502	434
1560	iso_pu_bacteria	2908669403	2908674513	434
1561	iso_pu_bacteria	2939602548	2939605626	434
1562	iso_pu_bacteria	2945951305	2945955243	434
1563	iso_pu_bacteria	2978975091	2978977721	434
1564	iso_pu_bacteria	8016733728	8016737616	434
1565	iso_pu_bacteria	8019499862	8019504220	434
1566	3300045836	Ga0466958_0005009	Ga0466958_0005009_5060_6388	436
1567	3300005327	Ga0070658_10003011	Ga0070658_100030117	437
1568	3300037312	Ga0395899_0024423	Ga0395899_0024423_1384_2715	437
1569	3300001989	JGI24739J22299_10000107	JGI24739J22299_1000010715	438
1570	3300002737	JGI25162J39368_1002554	JGI25162J39368_10025544	438
1571	3300003760	Ga0055527_1001088	Ga0055527_10010881	438
1572	3300003856	Ga0058692_1000039	Ga0058692_100003944	438
1573	3300003856	Ga0058692_1000291	Ga0058692_100029120	438
1574	3300003856	Ga0058692_1000442	Ga0058692_10004428	438
1575	3300003856	Ga0058692_1000709	Ga0058692_100070914	438
1576	3300003856	Ga0058692_1002728	Ga0058692_10027284	438
1577	3300005347	Ga0070668_100010679	Ga0070668_1000106797	438
1578	3300005548	Ga0070665_100019707	Ga0070665_1000197073	438
1579	3300006051	Ga0075364_10065161	Ga0075364_100651612	438
1580	3300009011	Ga0105251_10001513	Ga0105251_1000151314	438
1581	3300011119	Ga0105246_10002163	Ga0105246_1000216313	438
1582	3300013100	Ga0157373_10000081	Ga0157373_1000008170	438
1583	3300013102	Ga0157371_10001827	Ga0157371_1000182722	438
1584	3300013105	Ga0157369_10002069	Ga0157369_1000206919	438
1585	3300013306	Ga0163162_10085712	Ga0163162_100857122	438
1586	3300015261	Ga0182006_1014990	Ga0182006_10149903	438
1587	3300017792	Ga0163161_10064942	Ga0163161_100649423	438
1588	3300025233	Ga0209437_100136	Ga0209437_10013667	438
1589	3300025711	Ga0207696_1000557	Ga0207696_100055718	438
1590	3300025711	Ga0207696_1003996	Ga0207696_10039967	438
1591	3300025728	Ga0207655_1000024	Ga0207655_1000024388	438
1592	3300025728	Ga0207655_1000983	Ga0207655_100098311	438
1593	3300025728	Ga0207655_1003550	Ga0207655_100355012	438
1594	3300025728	Ga0207655_1030240	Ga0207655_10302402	438
1595	3300025735	Ga0207713_1000043	Ga0207713_1000043110	438
1596	3300025735	Ga0207713_1008050	Ga0207713_10080504	438
1597	3300025735	Ga0207713_1027146	Ga0207713_10271462	438
1598	3300025972	Ga0207668_10107123	Ga0207668_101071232	438
1599	3300027312	Ga0209371_1000061	Ga0209371_1000061125	438
1600	3300027312	Ga0209371_1000082	Ga0209371_1000082114	438
1601	3300027312	Ga0209371_1000119	Ga0209371_100011943	438
1602	3300027312	Ga0209371_1000230	Ga0209371_100023048	438
1603	3300027312	Ga0209371_1001086	Ga0209371_100108621	438
1604	3300027312	Ga0209371_1001324	Ga0209371_100132410	438
1605	3300027312	Ga0209371_1002070	Ga0209371_100207011	438
1606	3300030500	Ga0268256_1000059	Ga0268256_100005989	438
1607	3300030500	Ga0268256_1000072	Ga0268256_1000072113	438
1608	3300030500	Ga0268256_1000096	Ga0268256_100009686	438
1609	3300030500	Ga0268256_1001132	Ga0268256_100113210	438
1610	3300030500	Ga0268256_1004087	Ga0268256_10040871	438
1611	3300030742	Ga0316183_1035885	Ga0316183_10358852	438
1612	3300037312	Ga0395899_0000080	Ga0395899_0000080_107001_108341	438
1613	3300041407	Ga0439447_001550	Ga0439447_001550_6288_7604	438
1614	3300041411	Ga0439466_0000011	Ga0439466_0000011_83874_85190	438
1615	3300042146	Ga0450907_000007	Ga0450907_000007_30898_32214	438
1616	3300046458	Ga0495591_001545	Ga0495591_001545_8276_9595	438
1617	3300046471	Ga0495650_0000034	Ga0495650_0000034_99231_100550	438
1618	3300046500	Ga0495596_0003690	Ga0495596_0003690_1413_2729	438
1619	3300046501	Ga0495607_0002446	Ga0495607_0002446_6421_7740	438
1620	3300046507	Ga0495606_0000511	Ga0495606_0000511_53883_55202	438
1621	3300046523	Ga0495644_0054049	Ga0495644_0054049_124_1443	438
1622	3300046524	Ga0495648_0041629	Ga0495648_0041629_1488_2804	438
1623	3300046530	Ga0495654_0005475	Ga0495654_0005475_1084_2403	438
1624	3300046692	Ga0495671_0000586	Ga0495671_0000586_19977_21296	438
1625	3300046694	Ga0495649_0030910	Ga0495649_0030910_1575_2894	438
1626	3300046810	Ga0495660_0000020	Ga0495660_0000020_226596_227915	438
1627	3300047320	Ga0495672_0000011	Ga0495672_0000011_122652_123971	438
1628	3300047320	Ga0495672_0000040	Ga0495672_0000040_135625_136941	438
1629	3300047323	Ga0495683_0035539	Ga0495683_0035539_20_1339	438
1630	3300047446	Ga0495679_002610	Ga0495679_002610_5772_7088	438
1631	3300047469	Ga0495673_0000020	Ga0495673_0000020_109746_111065	438
1632	3300048904	Ga0496101_0000053	Ga0496101_0000053_88383_89699	438
1633	3300048913	Ga0496110_0176348	Ga0496110_0176348_524_1840	438
1634	3300048919	Ga0496116_0000129	Ga0496116_0000129_34278_35594	438
1635	3300048919	Ga0496116_0053637	Ga0496116_0053637_114_1430	438
1636	3300048920	Ga0496117_0000092	Ga0496117_0000092_133504_134820	438
1637	3300048920	Ga0496117_0000224	Ga0496117_0000224_21151_22467	438
1638	3300048920	Ga0496117_0074534	Ga0496117_0074534_129_1445	438
1639	3300048921	Ga0496118_0000053	Ga0496118_0000053_100991_102307	438
1640	3300048921	Ga0496118_0000718	Ga0496118_0000718_50845_52161	438
1641	3300048922	Ga0496119_0000285	Ga0496119_0000285_6893_8209	438
1642	3300048922	Ga0496119_0000555	Ga0496119_0000555_47955_49271	438
1643	3300048922	Ga0496119_0002224	Ga0496119_0002224_18340_19656	438
1644	3300048922	Ga0496119_0067533	Ga0496119_0067533_278_1594	438
1645	3300048923	Ga0496120_0000024	Ga0496120_0000024_169193_170509	438
1646	3300048923	Ga0496120_0000388	Ga0496120_0000388_62721_64037	438
1647	3300048923	Ga0496120_0000548	Ga0496120_0000548_6741_8057	438
1648	3300048923	Ga0496120_0001587	Ga0496120_0001587_24559_25875	438
1649	3300048924	Ga0496121_0000304	Ga0496121_0000304_6059_7375	438
1650	3300048925	Ga0496122_0009582	Ga0496122_0009582_5935_7251	438
1651	3300048925	Ga0496122_0010689	Ga0496122_0010689_321_1637	438
1652	3300048926	Ga0496123_0002189	Ga0496123_0002189_1748_3064	438
1653	3300048926	Ga0496123_0003349	Ga0496123_0003349_2621_3937	438
1654	3300048927	Ga0496124_0000251	Ga0496124_0000251_62999_64315	438
1655	3300048927	Ga0496124_0064591	Ga0496124_0064591_1702_3018	438
1656	3300048927	Ga0496124_0081532	Ga0496124_0081532_153_1469	438
1657	3300048928	Ga0496125_0007136	Ga0496125_0007136_4650_5966	438
1658	3300049459	Ga0495678_002665	Ga0495678_002665_5313_6632	438
1659	3300049460	Ga0495682_0000022	Ga0495682_0000022_111534_112853	438
1660	3300053126	Ga0500621_000009	Ga0500621_000009_60417_61736	438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

95

399

0.88 PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

104

431

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4aq4-assembly1.cif.gz_A	substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli	0.9958	26	437
4aq4-assembly1.cif.gz_A	substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli	0.9792	26	437
6x84-assembly2.cif.gz_B	sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s	0.9151	25	434
6x84-assembly2.cif.gz_B	sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s	0.9047	25	434
7c0k-assembly1.cif.gz_A	crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii)	0.8939	23	429

ID	Description	Score	Start	End	Superfamily
af_P0AG80_145_437_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	1.001	145	437	3.40.190.10
af_P0AG80_145_437_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9972	145	437	3.40.190.10
4aq4A02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9915	145	437	3.40.190.10
4aq4A02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.987	145	437	3.40.190.10
4aq4A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9673	26	382	3.40.190.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2X2TAB2-F1-model_v4	sn-glycerol-3-phosphate-binding periplasmic protein UgpB	0.9976	19	437	GO:0016020 GO:0030288 GO:0055085
AF-A0A0R3CB30-F1-model_v4	sn-glycerol-3-phosphate-binding periplasmic protein UgpB	0.9927	19	436	GO:0042597
AF-A0A1G3RQS8-F1-model_v4	sn-glycerol-3-phosphate ABC transporter substrate-binding protein	0.9908	35	437	GO:0030313 GO:0055085
AF-J4WEL3-F1-model_v4	Uncharacterized protein	0.9862	19	133
AF-A0A1G3RQS8-F1-model_v4	sn-glycerol-3-phosphate ABC transporter substrate-binding protein	0.9811	35	437	GO:0030313 GO:0055085

Feature Viewer

pLDDT	pTM	Quality
93.25	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495247

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

95

399

0.88

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

104

431

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map