F494858

General Info

Members Datasets Scaffolds Average Seq Length
1575 510 1542 112

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_36568|Ga0400490_36568_496_879
Length 127
Sequence MVKRTKYVKVKGGLKMKKIEAIIKPFKLDDVKEALNNVGIQGMTVSEVKAYGRQKGHKEIYRGAEYAVDFIPKIKIEVVTDAERVDQVVEAIREAANTGKIGDGKIFVVPVEQALRVRTGETGPDAL

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
4 2643221576 Nocardioides sp. Root614 Isolate Unclassified
5 2643221590 Nocardioides sp. Root682 Isolate Unclassified
6 2643221604 Nocardioides sp. Root190 Isolate Unclassified
7 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
8 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
9 2643221692 Nocardia sp. Root136 Isolate Unclassified
10 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
11 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
12 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
13 2738541305 Nocardioides sp. CF167 Isolate Unclassified
14 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
15 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
16 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
17 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
18 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
19 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
20 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
21 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
22 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
23 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
24 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
25 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
26 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
27 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
28 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
29 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
30 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
31 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
36 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
39 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
40 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
43 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
82 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
83 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
120 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
162 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
165 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
166 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
167 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
168 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
169 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
170 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
171 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
172 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
173 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
174 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
200 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
201 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
202 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
273 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
278 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
279 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
283 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
284 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
285 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
286 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
287 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
288 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
289 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
290 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
291 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
292 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
293 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
294 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
297 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
298 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
299 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
300 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
301 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
302 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
303 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
304 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
306 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
307 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
308 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
309 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
310 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
311 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
312 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
313 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
314 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
315 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
316 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
317 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
318 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
321 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
322 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
323 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
324 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
325 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
326 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
327 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
328 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
329 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
330 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
331 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
332 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
333 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
334 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
335 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
336 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
337 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
338 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
339 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
340 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
341 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
342 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
343 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
344 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
345 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
346 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
347 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
348 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
349 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
350 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
351 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
352 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
353 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
354 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
355 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
356 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
357 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
358 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
359 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
360 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
361 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
362 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
363 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
364 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
365 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
366 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
367 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
368 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
369 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
370 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
373 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
376 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
377 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
378 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
379 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
380 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
381 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
382 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
383 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
384 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
385 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
388 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
389 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
392 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
395 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
396 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
397 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
398 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
401 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
402 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
403 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
406 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
407 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
410 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
411 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
414 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
415 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
416 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
417 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
418 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
419 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
420 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
421 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
422 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
423 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
424 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
425 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
426 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
427 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
428 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
429 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
430 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
431 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
432 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
433 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
434 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
438 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
441 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
442 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
443 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
444 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
445 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
461 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
462 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
463 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
464 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
465 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
466 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
467 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
468 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
469 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
470 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
471 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
472 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
473 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
476 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
477 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
478 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
479 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
480 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
483 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
484 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
485 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
486 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
487 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
488 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
489 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
490 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
493 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
494 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
495 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
496 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
497 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
498 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
501 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
510 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 1.65
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 0.06
Rhizoplane 8
Rhizosphere 74.22
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1009137 3300001977 Bacteria 1485
2 JGI24737J22298_10091536 3300001990 Bacteria 902
3 JGI24737J22298_10130260 3300001990 Bacteria 743
4 JGI24743J22301_10000740 3300001991 Bacteria 4074
5 JGI24743J22301_10078436 3300001991 Bacteria 695
6 JGI24735J21928_10055529 3300002067 Bacteria 1141
7 JGI24735J21928_10187667 3300002067 Bacteria 599
8 JGI24750J21931_1001661 3300002070 Bacteria 2727
9 JGI24750J21931_1056839 3300002070 Bacteria 620
10 JGI24745J21846_1000717 3300002073 Bacteria 2999
11 JGI24745J21846_1009308 3300002073 Bacteria 1112
12 JGI24745J21846_1024120 3300002073 Bacteria 721
13 JGI24748J21848_1028065 3300002074 Bacteria 691
14 JGI24749J21850_1002988 3300002076 Bacteria 2366
15 JGI24749J21850_1022394 3300002076 Bacteria 896
16 JGI24744J21845_10038317 3300002077 Bacteria 901
17 JGI24034J26672_10008321 3300002239 Bacteria 1515
18 JGI24034J26672_10077401 3300002239 Bacteria 603
19 JGI24742J22300_10001093 3300002244 Bacteria 4204
20 JGI24742J22300_10004381 3300002244 Bacteria 2310
21 JGI24751J29686_10004169 3300002459 Bacteria 2932
22 Ga0006781J51513_1014724 3300003568 Bacteria 672
23 Ga0055528_1038670 3300003790 Bacteria 1102
24 Ga0055540_1003109 3300003792 Bacteria 8241
25 Ga0055540_1015249 3300003792 Bacteria 2248
26 Ga0055540_1025290 3300003792 Bacteria 1457
27 Ga0058861_11637123 3300004800 Bacteria 514
28 Ga0058860_11736522 3300004801 Bacteria 649
29 Ga0058860_12078576 3300004801 Bacteria 918
30 Ga0058860_12084339 3300004801 Bacteria 748
31 Ga0065704_10149048 3300005289 Bacteria 1445
32 Ga0065707_10434809 3300005295 Bacteria 816
33 Ga0065707_10451764 3300005295 Bacteria 800
34 Ga0070658_10361823 3300005327 Bacteria 1243
35 Ga0070658_10732481 3300005327 Bacteria 859
36 Ga0070676_10005073 3300005328 Bacteria 6985
37 Ga0070676_10063008 3300005328 Bacteria 2208
38 Ga0070676_10427437 3300005328 Bacteria 927
39 Ga0070676_10767904 3300005328 Bacteria 709
40 Ga0070683_100003739 3300005329 Bacteria 12411
41 Ga0070683_100112312 3300005329 Bacteria 2571
42 Ga0070683_100410969 3300005329 Bacteria 1291
43 Ga0070683_100502378 3300005329 Bacteria 1158
44 Ga0070683_100783154 3300005329 Bacteria 914
45 Ga0070690_100001844 3300005330 Bacteria 11243
46 Ga0070690_101010682 3300005330 Bacteria 655
47 Ga0070670_100063968 3300005331 Bacteria 3156
48 Ga0070670_101022416 3300005331 Bacteria 752
49 Ga0070677_10153815 3300005333 Bacteria 1073
50 Ga0070677_10765178 3300005333 Bacteria 549
51 Ga0068869_100091366 3300005334 Bacteria 2290
52 Ga0068869_100109361 3300005334 Bacteria 2101
53 Ga0068869_100334752 3300005334 Bacteria 1231
54 Ga0068869_100695175 3300005334 Bacteria 867
55 Ga0070666_10023477 3300005335 Bacteria 4015
56 Ga0070666_10096059 3300005335 Bacteria 2040
57 Ga0070666_10449288 3300005335 Bacteria 931
58 Ga0070682_100009670 3300005337 Bacteria 5459
59 Ga0070682_100047304 3300005337 Bacteria 2674
60 Ga0070682_100207174 3300005337 Bacteria 1387
61 Ga0070682_100230040 3300005337 Bacteria 1325
62 Ga0068868_100000294 3300005338 Bacteria 33573
63 Ga0068868_100209754 3300005338 Bacteria 1627
64 Ga0068868_100362969 3300005338 Bacteria 1243
65 Ga0068868_100380424 3300005338 Bacteria 1214
66 Ga0068868_100878939 3300005338 Bacteria 813
67 Ga0068868_101026527 3300005338 Bacteria 755
68 Ga0068868_101409946 3300005338 Bacteria 650
69 Ga0068868_101753688 3300005338 Bacteria 586
70 Ga0070660_100487677 3300005339 Bacteria 1024
71 Ga0070660_100915166 3300005339 Bacteria 740
72 Ga0070689_100192857 3300005340 Bacteria 1660
73 Ga0070689_100365195 3300005340 Bacteria 1214
74 Ga0070691_10019240 3300005341 Bacteria 3149
75 Ga0070691_10028158 3300005341 Bacteria 2624
76 Ga0070691_10675366 3300005341 Bacteria 618
77 Ga0070687_100485089 3300005343 Bacteria 829
78 Ga0070687_100711481 3300005343 Bacteria 703
79 Ga0070661_100101221 3300005344 Bacteria 2143
80 Ga0070661_100227148 3300005344 Bacteria 1433
81 Ga0070692_10043035 3300005345 Bacteria 2321
82 Ga0070692_10059450 3300005345 Bacteria 2009
83 Ga0070668_100001698 3300005347 Bacteria 15974
84 Ga0070668_100007254 3300005347 Bacteria 8219
85 Ga0070668_100057428 3300005347 Bacteria 3007
86 Ga0070668_101339257 3300005347 Bacteria 651
87 Ga0070669_100043136 3300005353 Bacteria 3284
88 Ga0070669_100132378 3300005353 Bacteria 1915
89 Ga0070669_100810711 3300005353 Bacteria 796
90 Ga0070675_100061047 3300005354 Bacteria 3112
91 Ga0070675_100222890 3300005354 Bacteria 1643
92 Ga0070671_100031066 3300005355 Bacteria 4410
93 Ga0070671_100057589 3300005355 Bacteria 3234
94 Ga0070671_100093840 3300005355 Bacteria 2515
95 Ga0070671_100226080 3300005355 Bacteria 1588
96 Ga0070671_100365493 3300005355 Bacteria 1232
97 Ga0070671_100601033 3300005355 Bacteria 951
98 Ga0070671_101079674 3300005355 Bacteria 705
99 Ga0070674_100000432 3300005356 Bacteria 21107
100 Ga0070674_100016186 3300005356 Bacteria 4674
101 Ga0070674_100027176 3300005356 Bacteria 3747
102 Ga0070674_100050015 3300005356 Bacteria 2876
103 Ga0070674_100971694 3300005356 Bacteria 744
104 Ga0070674_101325492 3300005356 Bacteria 643
105 Ga0070673_100060410 3300005364 Bacteria 3004
106 Ga0070688_100497703 3300005365 Bacteria 919
107 Ga0070688_100557456 3300005365 Bacteria 872
108 Ga0070659_100030040 3300005366 Bacteria 4204
109 Ga0070659_100193188 3300005366 Bacteria 1673
110 Ga0070659_100623279 3300005366 Bacteria 928
111 Ga0070667_100000063 3300005367 Bacteria 138777
112 Ga0070667_100000727 3300005367 Bacteria 31611
113 Ga0070667_100007584 3300005367 Bacteria 8998
114 Ga0070667_100043232 3300005367 Bacteria 3781
115 Ga0070667_100222334 3300005367 Bacteria 1681
116 Ga0070667_100280985 3300005367 Bacteria 1495
117 Ga0070667_100329283 3300005367 Bacteria 1379
118 Ga0070667_101219759 3300005367 Bacteria 704
119 Ga0070709_10331032 3300005434 Bacteria 1120
120 Ga0070709_11688647 3300005434 Bacteria 517
121 Ga0070714_100741965 3300005435 Bacteria 949
122 Ga0070713_100608299 3300005436 Bacteria 1039
123 Ga0070713_100852676 3300005436 Bacteria 875
124 Ga0070710_10000157 3300005437 Bacteria 31451
125 Ga0070710_10001774 3300005437 Bacteria 10199
126 Ga0070710_10002188 3300005437 Bacteria 9229
127 Ga0070710_10317361 3300005437 Bacteria 1022
128 Ga0070710_11168060 3300005437 Bacteria 568
129 Ga0070701_10003543 3300005438 Bacteria 6193
130 Ga0070701_10052055 3300005438 Bacteria 2125
131 Ga0070701_10363302 3300005438 Bacteria 908
132 Ga0070711_100001192 3300005439 Bacteria 14041
133 Ga0070711_100119406 3300005439 Bacteria 1947
134 Ga0070711_101816995 3300005439 Bacteria 535
135 Ga0070705_100005561 3300005440 Bacteria 6148
136 Ga0070705_100080888 3300005440 Bacteria 1994
137 Ga0070700_100006361 3300005441 Bacteria 6308
138 Ga0070700_100265158 3300005441 Bacteria 1238
139 Ga0070700_100271430 3300005441 Bacteria 1225
140 Ga0070694_100030276 3300005444 Bacteria 3539
141 Ga0070663_100002103 3300005455 Bacteria 11142
142 Ga0070663_100095066 3300005455 Bacteria 2214
143 Ga0070663_100095802 3300005455 Bacteria 2206
144 Ga0070663_100226358 3300005455 Bacteria 1471
145 Ga0070663_100348934 3300005455 Bacteria 1198
146 Ga0070663_100388781 3300005455 Bacteria 1138
147 Ga0070663_101271169 3300005455 Bacteria 649
148 Ga0070663_101688641 3300005455 Bacteria 566
149 Ga0070678_100000565 3300005456 Bacteria 18131
150 Ga0070678_100088255 3300005456 Bacteria 2370
151 Ga0070678_100236406 3300005456 Bacteria 1525
152 Ga0070678_100373980 3300005456 Bacteria 1231
153 Ga0070662_100049566 3300005457 Bacteria 3028
154 Ga0070662_100082643 3300005457 Bacteria 2395
155 Ga0070662_100984334 3300005457 Bacteria 722
156 Ga0070681_10891414 3300005458 Bacteria 808
157 Ga0070681_10937231 3300005458 Bacteria 785
158 Ga0068867_100001406 3300005459 Bacteria 16624
159 Ga0068867_100020147 3300005459 Bacteria 4751
160 Ga0070685_10026757 3300005466 Bacteria 3181
161 Ga0070685_10056035 3300005466 Bacteria 2291
162 Ga0070685_10210577 3300005466 Bacteria 1268
163 Ga0070685_10375141 3300005466 Bacteria 979
164 Ga0070685_10876491 3300005466 Bacteria 666
165 Ga0070706_100137399 3300005467 Bacteria 2281
166 Ga0070698_100239605 3300005471 Bacteria 1747
167 Ga0070698_101813556 3300005471 Bacteria 563
168 Ga0070679_100227891 3300005530 Bacteria 1823
169 Ga0070679_100855217 3300005530 Bacteria 853
170 Ga0070679_102055450 3300005530 Bacteria 521
171 Ga0070684_100007186 3300005535 Bacteria 8653
172 Ga0070684_100153537 3300005535 Bacteria 2087
173 Ga0070684_100243951 3300005535 Bacteria 1642
174 Ga0070684_100338808 3300005535 Bacteria 1382
175 Ga0070684_100375848 3300005535 Bacteria 1308
176 Ga0068853_100000008 3300005539 Bacteria 259050
177 Ga0068853_100004306 3300005539 Bacteria 11005
178 Ga0068853_100128710 3300005539 Bacteria 2264
179 Ga0068853_100208390 3300005539 Bacteria 1781
180 Ga0070672_100159286 3300005543 Bacteria 1871
181 Ga0070672_100357713 3300005543 Bacteria 1245
182 Ga0070672_101818115 3300005543 Bacteria 548
183 Ga0070686_100192328 3300005544 Bacteria 1457
184 Ga0070686_100481462 3300005544 Bacteria 960
185 Ga0070695_100031005 3300005545 Bacteria 3331
186 Ga0070695_100073069 3300005545 Bacteria 2250
187 Ga0070696_100034464 3300005546 Bacteria 3483
188 Ga0070696_100097805 3300005546 Bacteria 2099
189 Ga0070693_100194527 3300005547 Bacteria 1314
190 Ga0070693_100301734 3300005547 Bacteria 1080
191 Ga0070693_100342553 3300005547 Bacteria 1021
192 Ga0070693_100374315 3300005547 Bacteria 981
193 Ga0070665_100000854 3300005548 Bacteria 39668
194 Ga0070665_100001944 3300005548 Bacteria 23298
195 Ga0070665_100006611 3300005548 Bacteria 11783
196 Ga0070665_100008241 3300005548 Bacteria 10545
197 Ga0070665_100072202 3300005548 Bacteria 3459
198 Ga0070665_100170001 3300005548 Bacteria 2181
199 Ga0070665_100285516 3300005548 Bacteria 1652
200 Ga0070665_100336606 3300005548 Bacteria 1514
201 Ga0070665_100366289 3300005548 Bacteria 1448
202 Ga0070704_100000118 3300005549 Bacteria 28378
203 Ga0070704_100143690 3300005549 Bacteria 1867
204 Ga0070704_100468465 3300005549 Bacteria 1088
205 Ga0068855_100123877 3300005563 Bacteria 2957
206 Ga0068855_100129340 3300005563 Bacteria 2885
207 Ga0068855_100232433 3300005563 Bacteria 2064
208 Ga0070664_100316735 3300005564 Bacteria 1413
209 Ga0070664_100612565 3300005564 Bacteria 1010
210 Ga0070664_101006070 3300005564 Bacteria 783
211 Ga0070664_101967956 3300005564 Bacteria 555
212 Ga0068857_100207673 3300005577 Bacteria 1786
213 Ga0068857_100758154 3300005577 Bacteria 925
214 Ga0068857_101171325 3300005577 Bacteria 744
215 Ga0068857_101779070 3300005577 Bacteria 603
216 Ga0068854_100001658 3300005578 Bacteria 13560
217 Ga0068854_100042027 3300005578 Bacteria 3233
218 Ga0068854_100101383 3300005578 Bacteria 2159
219 Ga0068854_100104853 3300005578 Bacteria 2124
220 Ga0068854_100132218 3300005578 Bacteria 1906
221 Ga0068854_100487552 3300005578 Bacteria 1036
222 Ga0068856_100421669 3300005614 Bacteria 1354
223 Ga0068856_101093158 3300005614 Bacteria 815
224 Ga0068856_101572041 3300005614 Bacteria 671
225 Ga0070702_100082083 3300005615 Bacteria 1933
226 Ga0068852_100069750 3300005616 Bacteria 3082
227 Ga0068852_100278464 3300005616 Bacteria 1612
228 Ga0068852_100436574 3300005616 Bacteria 1294
229 Ga0068859_100001738 3300005617 Bacteria 22189
230 Ga0068859_100014581 3300005617 Bacteria 7894
231 Ga0068859_100348979 3300005617 Bacteria 1574
232 Ga0068859_101219890 3300005617 Bacteria 828
233 Ga0068864_100253264 3300005618 Bacteria 1635
234 Ga0068864_100621331 3300005618 Bacteria 1050
235 Ga0068864_102417676 3300005618 Bacteria 532
236 Ga0068866_10000223 3300005718 Bacteria 26905
237 Ga0068866_10045191 3300005718 Bacteria 2207
238 Ga0068861_100000102 3300005719 Bacteria 42240
239 Ga0068861_100112552 3300005719 Bacteria 2182
240 Ga0068861_100435364 3300005719 Bacteria 1171
241 Ga0068861_100717759 3300005719 Bacteria 930
242 Ga0068851_10111846 3300005834 Bacteria 1459
243 Ga0068851_10154750 3300005834 Bacteria 1255
244 Ga0068851_10525642 3300005834 Bacteria 712
245 Ga0068870_10033046 3300005840 Bacteria 2636
246 Ga0068870_10152647 3300005840 Bacteria 1362
247 Ga0068870_10631137 3300005840 Bacteria 732
248 Ga0068863_100000159 3300005841 Bacteria 71831
249 Ga0068863_100020326 3300005841 Bacteria 6349
250 Ga0068863_100191508 3300005841 Bacteria 1965
251 Ga0068863_100240230 3300005841 Bacteria 1748
252 Ga0068863_100546886 3300005841 Bacteria 1143
253 Ga0068863_100683808 3300005841 Bacteria 1019
254 Ga0068863_102444463 3300005841 Bacteria 532
255 Ga0068858_100003537 3300005842 Bacteria 15472
256 Ga0068858_100014324 3300005842 Bacteria 7478
257 Ga0068858_100136283 3300005842 Bacteria 2303
258 Ga0068858_100202471 3300005842 Bacteria 1877
259 Ga0068858_100355007 3300005842 Bacteria 1405
260 Ga0068858_100519699 3300005842 Bacteria 1151
261 Ga0068858_100586177 3300005842 Bacteria 1081
262 Ga0068858_100755424 3300005842 Bacteria 948
263 Ga0068858_101048492 3300005842 Bacteria 800
264 Ga0068858_101489854 3300005842 Bacteria 667
265 Ga0068860_100000065 3300005843 Bacteria 186634
266 Ga0068860_100004391 3300005843 Bacteria 14404
267 Ga0068860_100049951 3300005843 Bacteria 3983
268 Ga0068860_100103246 3300005843 Bacteria 2721
269 Ga0068860_100384941 3300005843 Bacteria 1385
270 Ga0068860_100387280 3300005843 Bacteria 1381
271 Ga0068860_100939655 3300005843 Bacteria 882
272 Ga0068860_102501168 3300005843 Bacteria 536
273 Ga0068862_100000028 3300005844 Bacteria 184197
274 Ga0068862_100004645 3300005844 Bacteria 11572
275 Ga0068862_100175587 3300005844 Bacteria 1920
276 Ga0068862_100329293 3300005844 Bacteria 1412
277 Ga0068862_100369665 3300005844 Bacteria 1334
278 Ga0068862_100940534 3300005844 Bacteria 852
279 Ga0068862_100991210 3300005844 Bacteria 830
280 Ga0068862_101507088 3300005844 Bacteria 678
281 Ga0081455_10034938 3300005937 Bacteria 4499
282 Ga0081455_10038480 3300005937 Bacteria 4236
283 Ga0081455_10039799 3300005937 Bacteria 4151
284 Ga0081455_10266434 3300005937 Bacteria 1245
285 Ga0081538_10087521 3300005981 Bacteria 1625
286 Ga0081538_10184231 3300005981 Bacteria 888
287 Ga0081540_1231623 3300005983 Bacteria 652
288 Ga0081539_10256095 3300005985 Bacteria 775
289 Ga0081539_10483318 3300005985 Bacteria 513
290 Ga0070717_10136767 3300006028 Bacteria 2111
291 Ga0070717_10420158 3300006028 Bacteria 1203
292 Ga0070717_10540826 3300006028 Bacteria 1055
293 Ga0070717_11364882 3300006028 Bacteria 644
294 Ga0075365_10004975 3300006038 Bacteria 7116
295 Ga0075365_10010381 3300006038 Bacteria 5420
296 Ga0075365_10018458 3300006038 Bacteria 4289
297 Ga0075365_10019045 3300006038 Bacteria 4229
298 Ga0075365_10037041 3300006038 Bacteria 3165
299 Ga0075365_10052552 3300006038 Bacteria 2695
300 Ga0075365_10186545 3300006038 Bacteria 1450
301 Ga0075365_10646549 3300006038 Bacteria 747
302 Ga0075365_10706787 3300006038 Bacteria 712
303 Ga0075365_10771655 3300006038 Bacteria 679
304 Ga0075368_10015071 3300006042 Bacteria 2862
305 Ga0075368_10189310 3300006042 Bacteria 869
306 Ga0075363_100001992 3300006048 Bacteria 8129
307 Ga0075363_100003443 3300006048 Bacteria 6725
308 Ga0075363_100004128 3300006048 Bacteria 6304
309 Ga0075363_100005632 3300006048 Bacteria 5598
310 Ga0075363_100034798 3300006048 Bacteria 2631
311 Ga0075363_100171281 3300006048 Bacteria 1232
312 Ga0075363_100320646 3300006048 Bacteria 902
313 Ga0075363_100329524 3300006048 Bacteria 889
314 Ga0075363_100339771 3300006048 Bacteria 875
315 Ga0075363_100431636 3300006048 Bacteria 776
316 Ga0075363_100670715 3300006048 Bacteria 625
317 Ga0075363_100785272 3300006048 Bacteria 578
318 Ga0075363_100822956 3300006048 Bacteria 566
319 Ga0075364_10002164 3300006051 Bacteria 11011
320 Ga0075364_10004549 3300006051 Bacteria 7986
321 Ga0075364_10010132 3300006051 Bacteria 5686
322 Ga0075364_10011838 3300006051 Bacteria 5311
323 Ga0075364_10019526 3300006051 Bacteria 4255
324 Ga0075364_10044433 3300006051 Bacteria 2889
325 Ga0075364_10092800 3300006051 Bacteria 2004
326 Ga0075364_10120350 3300006051 Bacteria 1757
327 Ga0075364_10127492 3300006051 Bacteria 1707
328 Ga0075364_10136411 3300006051 Bacteria 1649
329 Ga0075364_10188732 3300006051 Bacteria 1395
330 Ga0075364_10258905 3300006051 Bacteria 1183
331 Ga0075364_10403700 3300006051 Bacteria 932
332 Ga0075364_10506659 3300006051 Bacteria 825
333 Ga0075364_10575400 3300006051 Bacteria 770
334 Ga0075364_10816427 3300006051 Bacteria 635
335 Ga0075364_10823038 3300006051 Bacteria 633
336 Ga0070715_10054198 3300006163 Bacteria 1736
337 Ga0070716_100044004 3300006173 Bacteria 2500
338 Ga0070716_100086412 3300006173 Bacteria 1886
339 Ga0070716_101749793 3300006173 Bacteria 514
340 Ga0070712_100028928 3300006175 Bacteria 3711
341 Ga0070712_100129203 3300006175 Bacteria 1913
342 Ga0075362_10019058 3300006177 Bacteria 2848
343 Ga0075362_10059605 3300006177 Bacteria 1724
344 Ga0075362_10091074 3300006177 Bacteria 1415
345 Ga0075362_10173371 3300006177 Bacteria 1043
346 Ga0075362_10176475 3300006177 Bacteria 1034
347 Ga0075362_10177547 3300006177 Bacteria 1031
348 Ga0075362_10188123 3300006177 Bacteria 1002
349 Ga0075362_10241029 3300006177 Bacteria 888
350 Ga0075367_10143767 3300006178 Bacteria 1478
351 Ga0075367_10237878 3300006178 Bacteria 1141
352 Ga0075367_10480168 3300006178 Bacteria 788
353 Ga0075369_10001294 3300006186 Bacteria 8506
354 Ga0075369_10004421 3300006186 Bacteria 5191
355 Ga0075369_10021270 3300006186 Bacteria 2664
356 Ga0075369_10026351 3300006186 Bacteria 2422
357 Ga0075369_10028754 3300006186 Bacteria 2331
358 Ga0075369_10057719 3300006186 Bacteria 1689
359 Ga0075369_10084915 3300006186 Bacteria 1407
360 Ga0075369_10175267 3300006186 Bacteria 986
361 Ga0075369_10185186 3300006186 Bacteria 958
362 Ga0075369_10192127 3300006186 Bacteria 941
363 Ga0075369_10193525 3300006186 Bacteria 937
364 Ga0075369_10231155 3300006186 Bacteria 857
365 Ga0075366_10266048 3300006195 Bacteria 1047
366 Ga0097621_100090017 3300006237 Bacteria 2567
367 Ga0097621_100200313 3300006237 Bacteria 1733
368 Ga0097621_100307108 3300006237 Bacteria 1402
369 Ga0075370_10018360 3300006353 Bacteria 3795
370 Ga0075370_10022193 3300006353 Bacteria 3483
371 Ga0075370_10048410 3300006353 Bacteria 2408
372 Ga0075370_10123434 3300006353 Bacteria 1508
373 Ga0075370_10135133 3300006353 Bacteria 1440
374 Ga0075370_10141422 3300006353 Bacteria 1407
375 Ga0075370_10216582 3300006353 Bacteria 1131
376 Ga0075370_10577153 3300006353 Bacteria 681
377 Ga0075370_10881793 3300006353 Bacteria 547
378 Ga0075370_10891840 3300006353 Bacteria 543
379 Ga0068871_100036299 3300006358 Bacteria 3924
380 Ga0075428_100001045 3300006844 Bacteria 29392
381 Ga0075428_100382501 3300006844 Bacteria 1509
382 Ga0075430_100000584 3300006846 Bacteria 27631
383 Ga0075430_100013583 3300006846 Bacteria 6938
384 Ga0075430_100351367 3300006846 Bacteria 1217
385 Ga0075430_101583642 3300006846 Bacteria 538
386 Ga0075431_100005079 3300006847 Bacteria 12945
387 Ga0075431_100166352 3300006847 Bacteria 2267
388 Ga0075431_100746827 3300006847 Bacteria 954
389 Ga0075433_10829303 3300006852 Bacteria 808
390 Ga0075434_102379697 3300006871 Bacteria 532
391 Ga0075434_102479628 3300006871 Bacteria 520
392 Ga0075429_100000239 3300006880 Bacteria 37819
393 Ga0075429_100078813 3300006880 Bacteria 2872
394 Ga0075429_100547908 3300006880 Bacteria 1014
395 Ga0068865_100021459 3300006881 Bacteria 4199
396 Ga0068865_100047317 3300006881 Bacteria 2955
397 Ga0068865_100077509 3300006881 Bacteria 2375
398 Ga0097620_100001738 3300006931 Bacteria 22189
399 Ga0097620_100014581 3300006931 Bacteria 7894
400 Ga0097620_100348981 3300006931 Bacteria 1574
401 Ga0097620_101219883 3300006931 Bacteria 828
402 Ga0099795_10072995 3300007788 Bacteria 1298
403 Ga0105251_10130464 3300009011 Bacteria 1139
404 Ga0105251_10231878 3300009011 Bacteria 831
405 Ga0105244_10188843 3300009036 Bacteria 975
406 Ga0105244_10286329 3300009036 Bacteria 764
407 Ga0105240_11790938 3300009093 Bacteria 640
408 Ga0105240_12392781 3300009093 Bacteria 547
409 Ga0111539_11012605 3300009094 Bacteria 966
410 Ga0111539_11035932 3300009094 Bacteria 954
411 Ga0111539_12626146 3300009094 Bacteria 584
412 Ga0105245_10002148 3300009098 Bacteria 17862
413 Ga0105245_10023039 3300009098 Bacteria 5464
414 Ga0105245_10094083 3300009098 Bacteria 2762
415 Ga0105245_10125055 3300009098 Bacteria 2406
416 Ga0105245_10292460 3300009098 Bacteria 1596
417 Ga0105245_10329873 3300009098 Bacteria 1506
418 Ga0105245_10453784 3300009098 Bacteria 1291
419 Ga0105245_12359924 3300009098 Bacteria 585
420 Ga0105245_13201277 3300009098 Bacteria 507
421 Ga0105247_10000910 3300009101 Bacteria 22259
422 Ga0105247_10001417 3300009101 Bacteria 17402
423 Ga0105247_10041632 3300009101 Bacteria 2812
424 Ga0105247_10549785 3300009101 Bacteria 849
425 Ga0114129_10000630 3300009147 Bacteria 43905
426 Ga0114129_10015455 3300009147 Bacteria 10857
427 Ga0114129_10447398 3300009147 Bacteria 1695
428 Ga0114129_11391354 3300009147 Bacteria 866
429 Ga0105243_10000749 3300009148 Bacteria 31120
430 Ga0105243_10001698 3300009148 Bacteria 18980
431 Ga0105243_10173179 3300009148 Bacteria 1871
432 Ga0105243_10188246 3300009148 Bacteria 1801
433 Ga0105243_10857420 3300009148 Bacteria 900
434 Ga0105243_10994948 3300009148 Bacteria 841
435 Ga0105241_10110243 3300009174 Bacteria 2202
436 Ga0105241_11308274 3300009174 Bacteria 691
437 Ga0105242_10001751 3300009176 Bacteria 17151
438 Ga0105242_10025438 3300009176 Bacteria 4685
439 Ga0105242_10617550 3300009176 Bacteria 1049
440 Ga0105242_10620977 3300009176 Bacteria 1047
441 Ga0105242_11130143 3300009176 Bacteria 799
442 Ga0105242_11319185 3300009176 Bacteria 746
443 Ga0105248_10000074 3300009177 Bacteria 114554
444 Ga0105248_10000866 3300009177 Bacteria 33994
445 Ga0105248_10002067 3300009177 Bacteria 22238
446 Ga0105248_10086446 3300009177 Bacteria 3528
447 Ga0105248_10974345 3300009177 Bacteria 958
448 Ga0105248_11077002 3300009177 Bacteria 908
449 Ga0105237_10008588 3300009545 Bacteria 11047
450 Ga0105237_10022604 3300009545 Bacteria 6450
451 Ga0105237_10047568 3300009545 Bacteria 4312
452 Ga0105237_10181051 3300009545 Bacteria 2108
453 Ga0105237_10553168 3300009545 Bacteria 1157
454 Ga0105238_10115132 3300009551 Bacteria 2668
455 Ga0105238_10146536 3300009551 Bacteria 2337
456 Ga0105238_10617448 3300009551 Bacteria 1093
457 Ga0105238_10819260 3300009551 Bacteria 947
458 Ga0105238_11383414 3300009551 Bacteria 731
459 Ga0105249_10000011 3300009553 Bacteria 292812
460 Ga0105249_10087908 3300009553 Bacteria 2901
461 Ga0105249_10843870 3300009553 Bacteria 981
462 Ga0105249_10928112 3300009553 Bacteria 938
463 Ga0105249_11173766 3300009553 Bacteria 838
464 Ga0105147_107378 3300009982 Bacteria 933
465 Ga0099796_10067410 3300010159 Bacteria 1283
466 Ga0105239_10004818 3300010375 Bacteria 15985
467 Ga0105239_10104944 3300010375 Bacteria 3129
468 Ga0105239_10164146 3300010375 Bacteria 2483
469 Ga0105239_10279132 3300010375 Bacteria 1880
470 Ga0105239_10307743 3300010375 Bacteria 1785
471 Ga0105239_10420470 3300010375 Bacteria 1514
472 Ga0105239_12366326 3300010375 Bacteria 618
473 Ga0105246_10086450 3300011119 Bacteria 2248
474 Ga0105246_10295793 3300011119 Bacteria 1305
475 Ga0105246_10413595 3300011119 Bacteria 1123
476 Ga0105246_10635357 3300011119 Bacteria 927
477 Ga0105246_10700431 3300011119 Bacteria 888
478 Ga0105246_11978218 3300011119 Bacteria 562
479 Ga0157320_1005717 3300012481 Bacteria 838
480 Ga0157318_1018289 3300012482 Bacteria 599
481 Ga0157318_1026463 3300012482 Bacteria 549
482 Ga0157322_1008065 3300012490 Bacteria 796
483 Ga0157347_1008962 3300012502 Bacteria 1027
484 Ga0157347_1024943 3300012502 Bacteria 721
485 Ga0157313_1002533 3300012503 Bacteria 1104
486 Ga0157342_1067772 3300012507 Bacteria 537
487 Ga0157315_1004046 3300012508 Bacteria 1027
488 Ga0157316_1021982 3300012510 Bacteria 706
489 Ga0157327_1053083 3300012512 Bacteria 582
490 Ga0157338_1077613 3300012515 Bacteria 531
491 Ga0157371_10102336 3300013102 Bacteria 2032
492 Ga0157371_10344503 3300013102 Bacteria 1084
493 Ga0157369_10220113 3300013105 Bacteria 1987
494 Ga0157369_10302992 3300013105 Bacteria 1662
495 Ga0157369_10408074 3300013105 Bacteria 1409
496 Ga0157369_10414438 3300013105 Bacteria 1397
497 Ga0157374_10390538 3300013296 Bacteria 1387
498 Ga0157374_12613147 3300013296 Bacteria 533
499 Ga0157378_10003428 3300013297 Bacteria 14073
500 Ga0157378_10044356 3300013297 Bacteria 3948
501 Ga0157378_10101291 3300013297 Bacteria 2630
502 Ga0157378_10383218 3300013297 Bacteria 1381
503 Ga0157378_10406819 3300013297 Bacteria 1342
504 Ga0157378_11529488 3300013297 Bacteria 712
505 Ga0163162_10028193 3300013306 Bacteria 5554
506 Ga0163162_10109815 3300013306 Bacteria 2855
507 Ga0163162_10116452 3300013306 Bacteria 2773
508 Ga0163162_10127076 3300013306 Bacteria 2656
509 Ga0163162_10494571 3300013306 Bacteria 1354
510 Ga0163162_11284467 3300013306 Bacteria 831
511 Ga0163162_11467082 3300013306 Bacteria 777
512 Ga0163162_13040623 3300013306 Bacteria 539
513 Ga0157372_10004262 3300013307 Bacteria 15291
514 Ga0157372_10489765 3300013307 Bacteria 1434
515 Ga0157372_10652866 3300013307 Bacteria 1225
516 Ga0157372_11433589 3300013307 Bacteria 796
517 Ga0157375_10005386 3300013308 Bacteria 11119
518 Ga0157375_10256587 3300013308 Bacteria 1910
519 Ga0157375_10324202 3300013308 Bacteria 1705
520 Ga0157375_10579032 3300013308 Bacteria 1283
521 Ga0157375_10630115 3300013308 Bacteria 1230
522 Ga0157375_10880256 3300013308 Bacteria 1040
523 Ga0157375_11101865 3300013308 Bacteria 929
524 Ga0157375_11159459 3300013308 Bacteria 906
525 Ga0157375_11255987 3300013308 Bacteria 870
526 Ga0157375_11944175 3300013308 Bacteria 699
527 Ga0163163_10023167 3300014325 Bacteria 5891
528 Ga0163163_10087543 3300014325 Bacteria 3125
529 Ga0163163_10122780 3300014325 Bacteria 2632
530 Ga0163163_10347754 3300014325 Bacteria 1538
531 Ga0163163_11293184 3300014325 Bacteria 791
532 Ga0163163_11861827 3300014325 Bacteria 662
533 Ga0157380_10000237 3300014326 Bacteria 33183
534 Ga0157380_10075401 3300014326 Bacteria 2741
535 Ga0157380_10366619 3300014326 Bacteria 1354
536 Ga0157380_11730448 3300014326 Bacteria 683
537 Ga0182008_10077616 3300014497 Bacteria 1634
538 Ga0182008_10148238 3300014497 Bacteria 1176
539 Ga0182008_10182726 3300014497 Bacteria 1062
540 Ga0182008_10385361 3300014497 Bacteria 750
541 Ga0157377_10112781 3300014745 Bacteria 1636
542 Ga0157377_10192958 3300014745 Bacteria 1288
543 Ga0157377_11611190 3300014745 Bacteria 520
544 Ga0157379_10007925 3300014968 Bacteria 9207
545 Ga0157379_10074991 3300014968 Bacteria 3028
546 Ga0157379_10144817 3300014968 Bacteria 2142
547 Ga0157379_10409500 3300014968 Bacteria 1247
548 Ga0157376_10188605 3300014969 Bacteria 1889
549 Ga0157376_11133278 3300014969 Bacteria 809
550 Ga0157376_11866897 3300014969 Bacteria 637
551 Ga0182005_1256412 3300015265 Bacteria 543
552 Ga0163161_10065853 3300017792 Bacteria 2644
553 Ga0163161_10142806 3300017792 Bacteria 1814
554 Ga0163161_10404017 3300017792 Bacteria 1096
555 Ga0163161_11023095 3300017792 Bacteria 706
556 Ga0163161_11557081 3300017792 Bacteria 582
557 Ga0197907_11426222 3300020069 Bacteria 794
558 Ga0206356_10240197 3300020070 Bacteria 939
559 Ga0206349_1178622 3300020075 Bacteria 586
560 Ga0206351_10681403 3300020077 Bacteria 1265
561 Ga0206352_11063218 3300020078 Bacteria 685
562 Ga0206350_11033110 3300020080 Bacteria 637
563 Ga0206354_10335322 3300020081 Bacteria 591
564 Ga0206353_11291616 3300020082 Bacteria 1066
565 Ga0206353_11308277 3300020082 Bacteria 2242
566 Ga0154015_1120890 3300020610 Bacteria 684
567 Ga0213872_10459463 3300021361 Bacteria 511
568 Ga0213876_10001461 3300021384 Bacteria 14715
569 Ga0213876_10003185 3300021384 Bacteria 9441
570 Ga0213876_10021975 3300021384 Bacteria 3374
571 Ga0213876_10026469 3300021384 Bacteria 3058
572 Ga0213875_10018987 3300021388 Bacteria 3309
573 Ga0213875_10024212 3300021388 Bacteria 2896
574 Ga0224712_10518931 3300022467 Bacteria 577
575 Ga0209673_1004406 3300025273 Bacteria 7557
576 Ga0209051_1000075 3300025303 Bacteria 205011
577 Ga0209051_1001588 3300025303 Bacteria 18639
578 Ga0209051_1002744 3300025303 Bacteria 12207
579 Ga0209051_1004012 3300025303 Bacteria 9320
580 Ga0209051_1025031 3300025303 Bacteria 2441
581 Ga0207656_10118256 3300025321 Bacteria 1231
582 Ga0207656_10291560 3300025321 Bacteria 806
583 Ga0207656_10304253 3300025321 Bacteria 790
584 Ga0207713_1247300 3300025735 Bacteria 527
585 Ga0207682_10202389 3300025893 Bacteria 913
586 Ga0207692_10000317 3300025898 Bacteria 16718
587 Ga0207692_10000331 3300025898 Bacteria 16326
588 Ga0207692_10074299 3300025898 Bacteria 1801
589 Ga0207692_10297822 3300025898 Bacteria 981
590 Ga0207692_10614552 3300025898 Bacteria 700
591 Ga0207642_10000160 3300025899 Bacteria 19128
592 Ga0207642_10110363 3300025899 Bacteria 1399
593 Ga0207710_10000014 3300025900 Bacteria 408072
594 Ga0207710_10041076 3300025900 Bacteria 2051
595 Ga0207710_10063619 3300025900 Bacteria 1679
596 Ga0207710_10607791 3300025900 Bacteria 571
597 Ga0207688_10000631 3300025901 Bacteria 17344
598 Ga0207688_10006546 3300025901 Bacteria 6339
599 Ga0207688_10222871 3300025901 Bacteria 1136
600 Ga0207688_10769766 3300025901 Bacteria 610
601 Ga0207680_10026510 3300025903 Bacteria 3214
602 Ga0207680_10120901 3300025903 Bacteria 1712
603 Ga0207680_10479348 3300025903 Bacteria 885
604 Ga0207680_11176577 3300025903 Bacteria 547
605 Ga0207647_10017510 3300025904 Bacteria 4870
606 Ga0207647_10086228 3300025904 Bacteria 1877
607 Ga0207685_10004014 3300025905 Bacteria 3674
608 Ga0207685_10109333 3300025905 Bacteria 1195
609 Ga0207685_10843237 3300025905 Bacteria 507
610 Ga0207699_10065031 3300025906 Bacteria 2209
611 Ga0207645_10017899 3300025907 Bacteria 4673
612 Ga0207645_10021140 3300025907 Bacteria 4247
613 Ga0207645_10049724 3300025907 Bacteria 2677
614 Ga0207643_10045122 3300025908 Bacteria 2489
615 Ga0207643_10051420 3300025908 Bacteria 2339
616 Ga0207643_10746686 3300025908 Bacteria 633
617 Ga0207705_10072083 3300025909 Bacteria 2505
618 Ga0207684_10198488 3300025910 Bacteria 1731
619 Ga0207654_10136085 3300025911 Bacteria 1561
620 Ga0207654_11135893 3300025911 Bacteria 569
621 Ga0207707_10135543 3300025912 Bacteria 2153
622 Ga0207671_10010740 3300025914 Bacteria 7525
623 Ga0207671_10013353 3300025914 Bacteria 6544
624 Ga0207671_10028935 3300025914 Bacteria 4139
625 Ga0207671_10088374 3300025914 Bacteria 2331
626 Ga0207671_10166969 3300025914 Bacteria 1707
627 Ga0207693_10000049 3300025915 Bacteria 100347
628 Ga0207693_10002617 3300025915 Bacteria 15636
629 Ga0207693_11176874 3300025915 Bacteria 579
630 Ga0207663_10001494 3300025916 Bacteria 10906
631 Ga0207663_10035053 3300025916 Bacteria 3007
632 Ga0207663_11083633 3300025916 Bacteria 644
633 Ga0207660_10702816 3300025917 Bacteria 825
634 Ga0207660_10870080 3300025917 Bacteria 735
635 Ga0207662_10260711 3300025918 Bacteria 1141
636 Ga0207662_10260758 3300025918 Bacteria 1141
637 Ga0207657_10350824 3300025919 Bacteria 1164
638 Ga0207649_10066837 3300025920 Bacteria 2280
639 Ga0207649_10140923 3300025920 Bacteria 1650
640 Ga0207649_10522217 3300025920 Bacteria 905
641 Ga0207649_11230732 3300025920 Bacteria 592
642 Ga0207652_10166285 3300025921 Bacteria 1978
643 Ga0207652_10403971 3300025921 Bacteria 1233
644 Ga0207646_10400379 3300025922 Bacteria 1240
645 Ga0207681_10028077 3300025923 Bacteria 3643
646 Ga0207681_10035110 3300025923 Bacteria 3302
647 Ga0207681_10050022 3300025923 Bacteria 2827
648 Ga0207681_10121637 3300025923 Bacteria 1915
649 Ga0207681_10667987 3300025923 Bacteria 862
650 Ga0207694_10215270 3300025924 Bacteria 1566
651 Ga0207694_10955787 3300025924 Bacteria 725
652 Ga0207694_11105258 3300025924 Bacteria 671
653 Ga0207650_10163822 3300025925 Bacteria 1763
654 Ga0207650_10325514 3300025925 Bacteria 1260
655 Ga0207650_10402537 3300025925 Bacteria 1133
656 Ga0207650_11365842 3300025925 Bacteria 603
657 Ga0207659_10009210 3300025926 Bacteria 6168
658 Ga0207659_10715109 3300025926 Bacteria 858
659 Ga0207659_10851646 3300025926 Bacteria 784
660 Ga0207687_10001708 3300025927 Bacteria 15148
661 Ga0207687_10026892 3300025927 Bacteria 3855
662 Ga0207687_10080102 3300025927 Bacteria 2356
663 Ga0207687_10212439 3300025927 Bacteria 1519
664 Ga0207687_11526881 3300025927 Bacteria 574
665 Ga0207700_10609805 3300025928 Bacteria 972
666 Ga0207700_11037360 3300025928 Bacteria 733
667 Ga0207700_11051162 3300025928 Bacteria 728
668 Ga0207700_11056046 3300025928 Bacteria 726
669 Ga0207664_10306627 3300025929 Bacteria 1398
670 Ga0207644_10053801 3300025931 Bacteria 2898
671 Ga0207644_10056619 3300025931 Bacteria 2829
672 Ga0207644_10096839 3300025931 Bacteria 2209
673 Ga0207644_10191945 3300025931 Bacteria 1606
674 Ga0207644_10314359 3300025931 Bacteria 1265
675 Ga0207644_11006581 3300025931 Bacteria 699
676 Ga0207690_10011725 3300025932 Bacteria 5242
677 Ga0207690_10048262 3300025932 Bacteria 2830
678 Ga0207690_10150184 3300025932 Bacteria 1726
679 Ga0207690_11318502 3300025932 Bacteria 603
680 Ga0207706_10002210 3300025933 Bacteria 18982
681 Ga0207706_10009194 3300025933 Bacteria 9079
682 Ga0207706_10031561 3300025933 Bacteria 4719
683 Ga0207706_10049657 3300025933 Bacteria 3707
684 Ga0207686_10020608 3300025934 Bacteria 3769
685 Ga0207709_10002277 3300025935 Bacteria 12179
686 Ga0207709_10017986 3300025935 Bacteria 3953
687 Ga0207709_10033999 3300025935 Bacteria 3000
688 Ga0207709_10372371 3300025935 Bacteria 1084
689 Ga0207709_10434132 3300025935 Bacteria 1011
690 Ga0207709_10723642 3300025935 Bacteria 798
691 Ga0207670_10181052 3300025936 Bacteria 1588
692 Ga0207670_10336751 3300025936 Bacteria 1191
693 Ga0207669_10001461 3300025937 Bacteria 10075
694 Ga0207669_10158704 3300025937 Bacteria 1594
695 Ga0207669_10675941 3300025937 Bacteria 846
696 Ga0207669_11203348 3300025937 Bacteria 642
697 Ga0207669_11861913 3300025937 Bacteria 514
698 Ga0207704_10008232 3300025938 Bacteria 4970
699 Ga0207704_10083613 3300025938 Bacteria 2072
700 Ga0207704_10155925 3300025938 Bacteria 1618
701 Ga0207704_10812929 3300025938 Bacteria 781
702 Ga0207704_11888374 3300025938 Bacteria 514
703 Ga0207665_10002483 3300025939 Bacteria 12423
704 Ga0207665_10458147 3300025939 Bacteria 980
705 Ga0207691_10021497 3300025940 Bacteria 6092
706 Ga0207691_10336033 3300025940 Bacteria 1293
707 Ga0207711_10000149 3300025941 Bacteria 74062
708 Ga0207711_10000293 3300025941 Bacteria 53424
709 Ga0207711_10034977 3300025941 Bacteria 4256
710 Ga0207711_10112403 3300025941 Bacteria 2424
711 Ga0207711_10707092 3300025941 Bacteria 940
712 Ga0207689_10003988 3300025942 Bacteria 13424
713 Ga0207689_10010644 3300025942 Bacteria 7916
714 Ga0207689_10104793 3300025942 Bacteria 2324
715 Ga0207689_10395664 3300025942 Bacteria 1151
716 Ga0207661_10013648 3300025944 Bacteria 5932
717 Ga0207661_10265296 3300025944 Bacteria 1531
718 Ga0207661_10733125 3300025944 Bacteria 909
719 Ga0207661_10882081 3300025944 Bacteria 824
720 Ga0207661_11022736 3300025944 Bacteria 761
721 Ga0207679_10003180 3300025945 Bacteria 10138
722 Ga0207679_10984840 3300025945 Bacteria 773
723 Ga0207667_10095620 3300025949 Bacteria 3066
724 Ga0207667_10344719 3300025949 Bacteria 1520
725 Ga0207667_10374246 3300025949 Bacteria 1451
726 Ga0207651_10413748 3300025960 Bacteria 1149
727 Ga0207712_10000020 3300025961 Bacteria 292796
728 Ga0207712_10015240 3300025961 Bacteria 4956
729 Ga0207712_10024663 3300025961 Bacteria 3986
730 Ga0207712_10154120 3300025961 Bacteria 1778
731 Ga0207712_10550596 3300025961 Bacteria 992
732 Ga0207712_10613393 3300025961 Bacteria 942
733 Ga0207712_10761901 3300025961 Bacteria 849
734 Ga0207712_11157655 3300025961 Bacteria 689
735 Ga0207712_11163672 3300025961 Bacteria 688
736 Ga0207712_11285413 3300025961 Bacteria 654
737 Ga0207668_10001701 3300025972 Bacteria 12875
738 Ga0207668_10025323 3300025972 Bacteria 3838
739 Ga0207668_10106388 3300025972 Bacteria 2095
740 Ga0207668_10130949 3300025972 Bacteria 1915
741 Ga0207668_11860640 3300025972 Bacteria 543
742 Ga0207640_10002719 3300025981 Bacteria 9452
743 Ga0207640_10033289 3300025981 Bacteria 3205
744 Ga0207640_10093104 3300025981 Bacteria 2093
745 Ga0207640_10198158 3300025981 Bacteria 1519
746 Ga0207640_10435098 3300025981 Bacteria 1077
747 Ga0207640_10487843 3300025981 Bacteria 1023
748 Ga0207658_10000705 3300025986 Bacteria 29012
749 Ga0207658_10002382 3300025986 Bacteria 13772
750 Ga0207658_10030696 3300025986 Bacteria 3808
751 Ga0207658_10098757 3300025986 Bacteria 2282
752 Ga0207658_10265555 3300025986 Bacteria 1464
753 Ga0207658_10382966 3300025986 Bacteria 1232
754 Ga0207677_10001547 3300026023 Bacteria 12174
755 Ga0207677_10005497 3300026023 Bacteria 6881
756 Ga0207677_10045643 3300026023 Bacteria 2927
757 Ga0207677_10086991 3300026023 Bacteria 2261
758 Ga0207677_12144642 3300026023 Bacteria 520
759 Ga0207703_10009826 3300026035 Bacteria 7505
760 Ga0207703_10103837 3300026035 Bacteria 2413
761 Ga0207703_10140370 3300026035 Bacteria 2096
762 Ga0207703_10852250 3300026035 Bacteria 871
763 Ga0207703_11137834 3300026035 Bacteria 750
764 Ga0207703_11318081 3300026035 Bacteria 694
765 Ga0207639_10000014 3300026041 Bacteria 274629
766 Ga0207639_10182147 3300026041 Bacteria 1788
767 Ga0207639_10315920 3300026041 Bacteria 1385
768 Ga0207639_10359625 3300026041 Bacteria 1302
769 Ga0207639_11162585 3300026041 Bacteria 724
770 Ga0207678_10004946 3300026067 Bacteria 11961
771 Ga0207678_10005360 3300026067 Bacteria 11485
772 Ga0207678_10006947 3300026067 Bacteria 10046
773 Ga0207678_10008339 3300026067 Bacteria 9135
774 Ga0207678_10016548 3300026067 Bacteria 6475
775 Ga0207678_10040316 3300026067 Bacteria 4051
776 Ga0207678_10256724 3300026067 Bacteria 1498
777 Ga0207678_10345147 3300026067 Bacteria 1283
778 Ga0207678_11214864 3300026067 Bacteria 667
779 Ga0207678_11604696 3300026067 Bacteria 573
780 Ga0207708_10000411 3300026075 Bacteria 33673
781 Ga0207708_10009167 3300026075 Bacteria 7323
782 Ga0207708_10051450 3300026075 Bacteria 3136
783 Ga0207708_10287701 3300026075 Bacteria 1333
784 Ga0207708_10399738 3300026075 Bacteria 1136
785 Ga0207708_11559991 3300026075 Bacteria 580
786 Ga0207702_10088248 3300026078 Bacteria 2709
787 Ga0207702_10333492 3300026078 Bacteria 1447
788 Ga0207702_11874663 3300026078 Bacteria 591
789 Ga0207702_12007634 3300026078 Bacteria 569
790 Ga0207641_10000156 3300026088 Bacteria 97171
791 Ga0207641_10005640 3300026088 Bacteria 10665
792 Ga0207641_10074251 3300026088 Bacteria 2933
793 Ga0207641_10388903 3300026088 Bacteria 1337
794 Ga0207641_10447763 3300026088 Bacteria 1247
795 Ga0207641_10510873 3300026088 Bacteria 1168
796 Ga0207641_10811149 3300026088 Bacteria 926
797 Ga0207648_10000187 3300026089 Bacteria 65094
798 Ga0207648_10021171 3300026089 Bacteria 5846
799 Ga0207648_10412054 3300026089 Bacteria 1226
800 Ga0207648_11410953 3300026089 Bacteria 655
801 Ga0207676_10119057 3300026095 Bacteria 2223
802 Ga0207676_10257388 3300026095 Bacteria 1574
803 Ga0207676_10289527 3300026095 Bacteria 1491
804 Ga0207676_10453416 3300026095 Bacteria 1209
805 Ga0207676_10523843 3300026095 Bacteria 1129
806 Ga0207674_10157842 3300026116 Bacteria 2223
807 Ga0207674_10491455 3300026116 Bacteria 1186
808 Ga0207674_11351235 3300026116 Bacteria 682
809 Ga0207675_100007266 3300026118 Bacteria 10470
810 Ga0207675_100037100 3300026118 Bacteria 4546
811 Ga0207675_100040821 3300026118 Bacteria 4334
812 Ga0207675_100112620 3300026118 Bacteria 2568
813 Ga0207675_100271099 3300026118 Bacteria 1647
814 Ga0207675_100763740 3300026118 Bacteria 978
815 Ga0207675_102284424 3300026118 Bacteria 555
816 Ga0207683_10000197 3300026121 Bacteria 52074
817 Ga0207683_10018813 3300026121 Bacteria 5892
818 Ga0207683_10044768 3300026121 Bacteria 3869
819 Ga0207683_10491606 3300026121 Bacteria 1133
820 Ga0207683_10715564 3300026121 Bacteria 928
821 Ga0207683_10737800 3300026121 Bacteria 913
822 Ga0207683_11255125 3300026121 Bacteria 686
823 Ga0207698_10052130 3300026142 Bacteria 3133
824 Ga0207698_10882532 3300026142 Bacteria 901
825 Ga0209179_1042011 3300027512 Bacteria 964
826 Ga0209813_10022207 3300027866 Bacteria 1792
827 Ga0209813_10085630 3300027866 Bacteria 1049
828 Ga0209813_10092942 3300027866 Bacteria 1015
829 Ga0207428_10214819 3300027907 Bacteria 1444
830 Ga0207428_11004476 3300027907 Bacteria 586
831 Ga0268266_10000790 3300028379 Bacteria 42179
832 Ga0268266_10004113 3300028379 Bacteria 14053
833 Ga0268266_10005771 3300028379 Bacteria 11462
834 Ga0268266_10010049 3300028379 Bacteria 8298
835 Ga0268266_10039707 3300028379 Bacteria 4009
836 Ga0268266_10088855 3300028379 Bacteria 2704
837 Ga0268266_10163125 3300028379 Bacteria 2017
838 Ga0268266_10217416 3300028379 Bacteria 1755
839 Ga0268266_10293212 3300028379 Bacteria 1515
840 Ga0268266_10293327 3300028379 Bacteria 1515
841 Ga0268266_10473582 3300028379 Bacteria 1193
842 Ga0268265_10000004 3300028380 Bacteria 648376
843 Ga0268265_10002855 3300028380 Bacteria 12705
844 Ga0268265_10016518 3300028380 Bacteria 5073
845 Ga0268265_10396222 3300028380 Bacteria 1275
846 Ga0268265_10493407 3300028380 Bacteria 1152
847 Ga0268265_10987079 3300028380 Bacteria 831
848 Ga0268265_11299897 3300028380 Bacteria 727
849 Ga0268264_10000024 3300028381 Bacteria 470081
850 Ga0268264_10016896 3300028381 Bacteria 5973
851 Ga0268264_10024451 3300028381 Bacteria 4932
852 Ga0268264_10029708 3300028381 Bacteria 4479
853 Ga0268264_10163812 3300028381 Bacteria 2006
854 Ga0268264_10294835 3300028381 Bacteria 1524
855 Ga0268264_10298094 3300028381 Bacteria 1517
856 Ga0268264_10371595 3300028381 Bacteria 1367
857 Ga0307515_10204607 3300028794 Bacteria 1839
858 Ga0265320_10048049 3300031240 Bacteria 2084
859 Ga0265327_10002454 3300031251 Bacteria 19559
860 Ga0307513_10037955 3300031456 Bacteria 5354
861 Ga0307513_10055057 3300031456 Bacteria 4259
862 Ga0307408_101961418 3300031548 Bacteria 562
863 Ga0265313_10098090 3300031595 Bacteria 1304
864 Ga0307508_10156965 3300031616 Bacteria 1879
865 Ga0307508_10703720 3300031616 Bacteria 620
866 Ga0316575_10007335 3300031665 Bacteria 3988
867 Ga0316575_10007876 3300031665 Bacteria 3866
868 Ga0316579_10008965 3300031691 Bacteria 4194
869 Ga0316579_10031451 3300031691 Bacteria 2430
870 Ga0316579_10043581 3300031691 Bacteria 2088
871 Ga0316579_10061252 3300031691 Bacteria 1771
872 Ga0265314_10169200 3300031711 Bacteria 1321
873 Ga0316576_10000398 3300031727 Bacteria 20067
874 Ga0316576_10029666 3300031727 Bacteria 3869
875 Ga0316578_10058753 3300031728 Bacteria 2261
876 Ga0316578_10132299 3300031728 Bacteria 1501
877 Ga0316578_10253691 3300031728 Bacteria 1055
878 Ga0316577_10001959 3300031733 Bacteria 9994
879 Ga0316577_10049367 3300031733 Bacteria 2349
880 Ga0316577_10054599 3300031733 Bacteria 2229
881 Ga0316577_10249605 3300031733 Bacteria 1004
882 Ga0316577_10426598 3300031733 Bacteria 753
883 Ga0316577_10524821 3300031733 Bacteria 673
884 Ga0307413_10052519 3300031824 Bacteria 2462
885 Ga0307413_10116419 3300031824 Bacteria 1801
886 Ga0307413_10365562 3300031824 Bacteria 1119
887 Ga0307413_10466053 3300031824 Bacteria 1006
888 Ga0307413_11255222 3300031824 Bacteria 646
889 Ga0307410_10016305 3300031852 Bacteria 4428
890 Ga0307410_10624192 3300031852 Bacteria 901
891 Ga0307410_11018881 3300031852 Bacteria 715
892 Ga0307410_11380185 3300031852 Bacteria 618
893 Ga0307410_11800009 3300031852 Bacteria 544
894 Ga0326468_10011879 3300031889 Bacteria 907
895 Ga0326468_10016670 3300031889 Bacteria 828
896 Ga0307406_10353254 3300031901 Bacteria 1149
897 Ga0307406_12072545 3300031901 Bacteria 509
898 Ga0307407_10048718 3300031903 Bacteria 2414
899 Ga0307407_10415751 3300031903 Bacteria 968
900 Ga0307407_11407658 3300031903 Bacteria 549
901 Ga0307412_10811513 3300031911 Bacteria 813
902 Ga0307412_11859020 3300031911 Bacteria 555
903 Ga0307409_100032570 3300031995 Bacteria 3781
904 Ga0307409_100441735 3300031995 Bacteria 1253
905 Ga0307409_100774939 3300031995 Bacteria 965
906 Ga0307409_101183221 3300031995 Bacteria 787
907 Ga0307409_102325683 3300031995 Bacteria 565
908 Ga0307416_100390565 3300032002 Bacteria 1425
909 Ga0307416_100569940 3300032002 Bacteria 1208
910 Ga0307416_100746841 3300032002 Bacteria 1071
911 Ga0307416_101262981 3300032002 Bacteria 844
912 Ga0307416_101331958 3300032002 Bacteria 824
913 Ga0307414_10214447 3300032004 Bacteria 1576
914 Ga0307414_10743877 3300032004 Bacteria 891
915 Ga0307414_11012852 3300032004 Bacteria 765
916 Ga0307414_11391166 3300032004 Bacteria 652
917 Ga0307414_11899485 3300032004 Bacteria 556
918 Ga0307411_10442897 3300032005 Bacteria 1085
919 Ga0307411_10811491 3300032005 Bacteria 825
920 Ga0307415_100045746 3300032126 Bacteria 2937
921 Ga0307415_100163448 3300032126 Bacteria 1728
922 Ga0307415_100374808 3300032126 Bacteria 1206
923 Ga0307415_100392103 3300032126 Bacteria 1183
924 Ga0307415_100486258 3300032126 Bacteria 1076
925 Ga0307415_101306970 3300032126 Bacteria 687
926 Ga0316583_10069374 3300032133 Bacteria 1233
927 Ga0316585_10000902 3300032137 Bacteria 7604
928 Ga0316585_10020401 3300032137 Bacteria 2029
929 Ga0316585_10038286 3300032137 Bacteria 1524
930 Ga0316580_10002058 3300032139 Bacteria 5452
931 Ga0316580_10284596 3300032139 Bacteria 513
932 Ga0316592_1008409 3300033524 Bacteria 2040
933 Ga0316592_1036293 3300033524 Bacteria 1083
934 Ga0373948_0073184 3300034817 Bacteria 771
935 Ga0373928_0042360 3300035084 Bacteria 1050
936 Ga0373951_0042569 3300035091 Bacteria 1099
937 Ga0373932_0010605 3300035112 Bacteria 2234
938 Ga0373941_0093946 3300035115 Bacteria 1034
939 Ga0373956_0002594 3300035119 Bacteria 7327
940 Ga0373956_0058148 3300035119 Bacteria 1748
941 Ga0373957_0013160 3300035120 Bacteria 2802
942 Ga0373946_0071724 3300035171 Bacteria 1498
943 Ga0373942_0035245 3300035207 Bacteria 1342
944 Ga0373962_0015861 3300035242 Bacteria 1937
945 Ga0373962_0023794 3300035242 Bacteria 1634
946 Ga0373962_0082484 3300035242 Bacteria 978
947 Ga0316574_0024519 3300035398 Bacteria 3611
948 Ga0316574_0044952 3300035398 Bacteria 2733
949 Ga0316574_0095991 3300035398 Bacteria 1894
950 Ga0373931_0000708 3300035691 Bacteria 13798
951 Ga0373931_0019136 3300035691 Bacteria 3413
952 Ga0373931_0073314 3300035691 Bacteria 1873
953 Ga0373931_0211085 3300035691 Bacteria 1164
954 Ga0316582_0001228 3300036647 Bacteria 11045
955 Ga0316582_0024357 3300036647 Bacteria 3621
956 Ga0316582_0050531 3300036647 Bacteria 2634
957 Ga0316582_0315653 3300036647 Bacteria 1074
958 Ga0316582_0317346 3300036647 Bacteria 1071
959 Ga0316582_0525276 3300036647 Bacteria 816
960 Ga0316584_0000275 3300036712 Bacteria 26134
961 Ga0316584_0057027 3300036712 Bacteria 2924
962 Ga0316584_0181441 3300036712 Bacteria 1558
963 Ga0316584_0235187 3300036712 Bacteria 1342
964 Ga0395905_0194145 3300037471 Unclassified 1904
965 Ga0316581_0007185 3300037588 Bacteria 2978
966 Ga0316581_0044900 3300037588 Bacteria 1350
967 Ga0316581_0223521 3300037588 Bacteria 579
968 Ga0436364_0760747 3300037853 Bacteria 7194
969 Ga0436364_0845355 3300037853 Bacteria 7479
970 Ga0436364_1364710 3300037853 Bacteria 19673
971 Ga0395901_1189580 3300038443 Bacteria 729
972 Ga0400490_36568 3300038726 Bacteria 1041
973 Ga0400489_06127 3300039093 Bacteria 80653
974 Ga0436365_0273886 3300039437 Bacteria 901
975 Ga0436365_0479579 3300039437 Bacteria 3451
976 Ga0436365_0491830 3300039437 Bacteria 10392
977 Ga0436365_0557871 3300039437 Bacteria 11773
978 Ga0436365_1378611 3300039437 Bacteria 178407
979 Ga0436365_1610385 3300039437 Bacteria 545
980 Ga0436360_0649702 3300039438 Bacteria 2175
981 Ga0436360_0784050 3300039438 Bacteria 625
982 Ga0436361_0647117 3300039447 Bacteria 1091
983 Ga0436363_0646025 3300039450 Bacteria 1192
984 Ga0436363_0709857 3300039450 Bacteria 1143
985 Ga0436363_1475318 3300039450 Bacteria 1206
986 Ga0439461_0001461 3300041410 Bacteria 3656
987 Ga0439461_0012367 3300041410 Bacteria 1596
988 Ga0439466_0001133 3300041411 Bacteria 10386
989 Ga0439466_0002368 3300041411 Bacteria 7387
990 Ga0439466_0003153 3300041411 Bacteria 6416
991 Ga0439466_0125687 3300041411 Bacteria 790
992 Ga0439465_0003067 3300041413 Bacteria 5467
993 Ga0439465_0017485 3300041413 Bacteria 2238
994 Ga0439465_0023712 3300041413 Bacteria 1931
995 Ga0439465_0027037 3300041413 Bacteria 1816
996 Ga0439465_0108002 3300041413 Bacteria 966
997 Ga0439465_0109394 3300041413 Bacteria 960
998 Ga0439465_0432978 3300041413 Bacteria 503
999 Ga0451791_0802285 3300041451 Bacteria 583
1000 Ga0451793_0498716 3300041452 Bacteria 1398
1001 Ga0451793_1359655 3300041452 Bacteria 1107
1002 Ga0451797_1349284 3300041453 Bacteria 569
1003 Ga0451795_0233023 3300041456 Bacteria 636
1004 Ga0451795_0796965 3300041456 Bacteria 2329
1005 Ga0451795_1668447 3300041456 Bacteria 1091
1006 Ga0451802_0010223 3300041460 Bacteria 574
1007 Ga0451802_1569976 3300041460 Bacteria 620
1008 Ga0451802_2096868 3300041460 Bacteria 799
1009 Ga0451804_0358484 3300041463 Bacteria 552
1010 Ga0451807_1978118 3300041486 Bacteria 876
1011 Ga0451833_1185815 3300041491 Bacteria 605
1012 Ga0451841_0562277 3300041498 Bacteria 637
1013 Ga0451841_1380544 3300041498 Bacteria 769
1014 Ga0451845_0708748 3300041501 Bacteria 568
1015 Ga0451849_0162247 3300041505 Bacteria 753
1016 Ga0451851_0045888 3300041507 Bacteria 546
1017 Ga0451851_0380025 3300041507 Bacteria 692
1018 Ga0451855_1824859 3300041511 Bacteria 556
1019 Ga0451853_3405597 3300041512 Bacteria 1213
1020 Ga0451853_3529090 3300041512 Bacteria 760
1021 Ga0451853_3781773 3300041512 Bacteria 602
1022 Ga0439431_0005209 3300041997 Bacteria 2865
1023 Ga0439431_0040675 3300041997 Bacteria 1183
1024 Ga0439442_013160 3300042002 Bacteria 1697
1025 Ga0439445_0079224 3300042004 Bacteria 916
1026 Ga0439445_0096996 3300042004 Bacteria 834
1027 Ga0439450_202910 3300042008 Bacteria 531
1028 Ga0439434_0008501 3300042435 Bacteria 3010
1029 Ga0439459_0009839 3300042438 Bacteria 1657
1030 Ga0439459_0092127 3300042438 Bacteria 730
1031 Ga0439459_0157966 3300042438 Bacteria 597
1032 Ga0439459_0203983 3300042438 Bacteria 541
1033 Ga0439459_0228813 3300042438 Bacteria 518
1034 Ga0451577_0000214 3300042876 Bacteria 120639
1035 Ga0451577_0000245 3300042876 Bacteria 106824
1036 Ga0451577_0000397 3300042876 Bacteria 79933
1037 Ga0451577_0000657 3300042876 Bacteria 54556
1038 Ga0451577_0032106 3300042876 Bacteria 4731
1039 Ga0451577_0189510 3300042876 Bacteria 1855
1040 Ga0451577_0280691 3300042876 Bacteria 1509
1041 Ga0439440_0244442 3300042993 Bacteria 545
1042 Ga0466969_0543469 3300044656 Bacteria 531
1043 Ga0466972_0001217 3300044658 Bacteria 12395
1044 Ga0466972_0019024 3300044658 Bacteria 3433
1045 Ga0466972_0053985 3300044658 Bacteria 1934
1046 Ga0466972_0122085 3300044658 Bacteria 1228
1047 Ga0466972_0260525 3300044658 Bacteria 810
1048 Ga0466972_0628351 3300044658 Bacteria 508
1049 Ga0453683_0206420 3300044673 Bacteria 1248
1050 Ga0453683_0215620 3300044673 Bacteria 1220
1051 Ga0453683_0409559 3300044673 Bacteria 874
1052 Ga0466965_0001800 3300044683 Bacteria 8884
1053 Ga0466965_0005062 3300044683 Bacteria 5908
1054 Ga0466965_0048842 3300044683 Bacteria 2097
1055 Ga0466965_0366997 3300044683 Bacteria 791
1056 Ga0466965_0554676 3300044683 Bacteria 649
1057 Ga0466966_0056643 3300044684 Bacteria 2479
1058 Ga0466966_0074289 3300044684 Bacteria 2125
1059 Ga0466966_0217687 3300044684 Bacteria 1153
1060 Ga0466961_0070508 3300044693 Bacteria 2219
1061 Ga0466961_0169903 3300044693 Bacteria 1356
1062 Ga0466961_0219010 3300044693 Bacteria 1173
1063 Ga0466961_0753639 3300044693 Bacteria 582
1064 Ga0466963_0134891 3300044694 Bacteria 1707
1065 Ga0466963_0139193 3300044694 Bacteria 1680
1066 Ga0466963_0246334 3300044694 Bacteria 1254
1067 Ga0466963_0364648 3300044694 Bacteria 1018
1068 Ga0466963_0415871 3300044694 Bacteria 948
1069 Ga0466963_1099214 3300044694 Bacteria 559
1070 Ga0466963_1319599 3300044694 Bacteria 506
1071 Ga0466964_0304563 3300044706 Bacteria 804
1072 Ga0466964_0884824 3300044706 Bacteria 510
1073 Ga0453684_0000775 3300044712 Bacteria 110153
1074 Ga0453684_0000807 3300044712 Bacteria 106824
1075 Ga0453684_0001237 3300044712 Bacteria 77865
1076 Ga0453684_0087225 3300044712 Bacteria 3868
1077 Ga0453684_0130803 3300044712 Bacteria 3011
1078 Ga0453684_0184801 3300044712 Bacteria 2444
1079 Ga0453684_0319074 3300044712 Bacteria 1760
1080 Ga0453684_1143054 3300044712 Bacteria 820
1081 Ga0466971_0013676 3300044719 Bacteria 3568
1082 Ga0466971_0064306 3300044719 Bacteria 1661
1083 Ga0466971_0088209 3300044719 Bacteria 1419
1084 Ga0466968_0003111 3300044735 Bacteria 6124
1085 Ga0466968_0018075 3300044735 Bacteria 2825
1086 Ga0466968_0054323 3300044735 Bacteria 1717
1087 Ga0466970_0014253 3300044765 Bacteria 4078
1088 Ga0466970_0109875 3300044765 Bacteria 1505
1089 Ga0466970_0361068 3300044765 Bacteria 825
1090 Ga0466970_0405261 3300044765 Bacteria 778
1091 Ga0466957_0009531 3300044842 Bacteria 5544
1092 Ga0466957_0023651 3300044842 Bacteria 3633
1093 Ga0466957_0303998 3300044842 Bacteria 1072
1094 Ga0466957_0909134 3300044842 Bacteria 629
1095 Ga0466960_0001745 3300044901 Bacteria 7994
1096 Ga0466960_0002863 3300044901 Bacteria 6540
1097 Ga0466960_1045688 3300044901 Bacteria 503
1098 Ga0466959_0002679 3300045049 Bacteria 11431
1099 Ga0466959_0005845 3300045049 Bacteria 8469
1100 Ga0466959_0006544 3300045049 Bacteria 8084
1101 Ga0466959_0033448 3300045049 Bacteria 3802
1102 Ga0466959_0078991 3300045049 Bacteria 2373
1103 Ga0451576_0001761 3300045051 Bacteria 35528
1104 Ga0451576_0159560 3300045051 Bacteria 2353
1105 Ga0451576_0806743 3300045051 Bacteria 985
1106 Ga0466958_0005851 3300045836 Bacteria 6656
1107 Ga0466958_0035124 3300045836 Bacteria 2994
1108 Ga0466958_0098648 3300045836 Bacteria 1814
1109 Ga0466958_0106464 3300045836 Bacteria 1748
1110 Ga0466958_0274405 3300045836 Bacteria 1080
1111 Ga0466967_0004120 3300045976 Bacteria 9713
1112 Ga0466967_0007601 3300045976 Bacteria 7838
1113 Ga0466967_0009446 3300045976 Bacteria 7234
1114 Ga0466967_0027631 3300045976 Bacteria 4722
1115 Ga0466967_0029860 3300045976 Bacteria 4568
1116 Ga0466967_0035323 3300045976 Bacteria 4253
1117 Ga0466967_0087539 3300045976 Bacteria 2824
1118 Ga0466967_0109847 3300045976 Bacteria 2532
1119 Ga0466967_0218303 3300045976 Bacteria 1811
1120 Ga0466967_0367220 3300045976 Bacteria 1395
1121 Ga0466967_0389064 3300045976 Bacteria 1355
1122 Ga0466967_0636704 3300045976 Bacteria 1054
1123 Ga0466967_1009710 3300045976 Bacteria 828
1124 Ga0466967_1183078 3300045976 Bacteria 762
1125 Ga0466967_1185461 3300045976 Bacteria 761
1126 Ga0466967_1322294 3300045976 Bacteria 718
1127 Ga0466967_1346771 3300045976 Bacteria 711
1128 Ga0495592_0366934 3300046454 Bacteria 919
1129 Ga0495629_0011150 3300046459 Bacteria 6530
1130 Ga0495629_0045239 3300046459 Bacteria 3088
1131 Ga0495638_0000853 3300046460 Bacteria 31744
1132 Ga0495651_0017427 3300046462 Bacteria 5562
1133 Ga0495653_0098942 3300046463 Bacteria 2117
1134 Ga0495582_0034319 3300046473 Bacteria 2789
1135 Ga0495605_0456587 3300046474 Bacteria 526
1136 Ga0495639_0635570 3300046475 Bacteria 550
1137 Ga0495584_0325212 3300046491 Unclassified 781
1138 Ga0495594_0013700 3300046499 Bacteria 4238
1139 Ga0495594_0032693 3300046499 Bacteria 2825
1140 Ga0495596_0277045 3300046500 Bacteria 652
1141 Ga0495606_0015475 3300046507 Bacteria 5874
1142 Ga0495606_0249002 3300046507 Bacteria 987
1143 Ga0495608_0087367 3300046511 Bacteria 2020
1144 Ga0495610_0405807 3300046512 Bacteria 502
1145 Ga0495628_0559545 3300046516 Bacteria 820
1146 Ga0495648_0044914 3300046524 Bacteria 2753
1147 Ga0495648_0051495 3300046524 Bacteria 2508
1148 Ga0495665_0010315 3300046531 Bacteria 5056
1149 Ga0495665_0032820 3300046531 Bacteria 2778
1150 Ga0495586_0458260 3300046535 Bacteria 735
1151 Ga0495587_0024379 3300046536 Bacteria 3708
1152 Ga0495597_0220001 3300046542 Bacteria 754
1153 Ga0495645_0462818 3300046543 Bacteria 798
1154 Ga0495667_0013000 3300046559 Bacteria 5639
1155 Ga0495667_0131885 3300046559 Unclassified 1612
1156 Ga0495656_0157325 3300046615 Bacteria 1102
1157 Ga0495668_0000573 3300046616 Bacteria 45058
1158 Ga0495668_0050024 3300046616 Bacteria 2317
1159 Ga0495634_0242373 3300046642 Bacteria 1105
1160 Ga0495625_0721381 3300046660 Bacteria 587
1161 Ga0495635_0140501 3300046663 Bacteria 1645
1162 Ga0495635_0346880 3300046663 Bacteria 991
1163 Ga0495588_0015106 3300046674 Bacteria 3710
1164 Ga0495599_0201415 3300046678 Bacteria 1223
1165 Ga0495623_0489509 3300046679 Bacteria 650
1166 Ga0495658_0490892 3300046683 Bacteria 785
1167 Ga0495613_0868840 3300046689 Bacteria 585
1168 Ga0495624_0047468 3300046690 Bacteria 2729
1169 Ga0495649_0319500 3300046694 Bacteria 788
1170 Ga0495649_0364153 3300046694 Bacteria 729
1171 Ga0495649_0495193 3300046694 Bacteria 608
1172 Ga0495649_0599615 3300046694 Bacteria 543
1173 Ga0495600_0016103 3300046809 Bacteria 4739
1174 Ga0495674_0006391 3300047319 Bacteria 11296
1175 Ga0495674_1049464 3300047319 Bacteria 622
1176 Ga0495672_0036052 3300047320 Bacteria 3040
1177 Ga0495672_0090161 3300047320 Bacteria 1686
1178 Ga0495680_0013487 3300047322 Bacteria 7128
1179 Ga0495683_0000600 3300047323 Bacteria 27060
1180 Ga0495675_0048468 3300047444 Bacteria 2702
1181 Ga0495673_0001120 3300047469 Bacteria 23015
1182 Ga0495684_0085947 3300047471 Bacteria 2385
1183 Ga0495686_0006863 3300047472 Bacteria 8626
1184 Ga0495593_0002902 3300047673 Bacteria 10332
1185 Ga0495602_0105727 3300048088 Bacteria 2299
1186 Ga0495602_0443573 3300048088 Bacteria 917
1187 Ga0495602_0573010 3300048088 Bacteria 780
1188 Ga0495626_0221263 3300048091 Bacteria 769
1189 Ga0496100_0000009 3300048903 Bacteria 225785
1190 Ga0496100_0002407 3300048903 Bacteria 9478
1191 Ga0496100_0007381 3300048903 Bacteria 6062
1192 Ga0496100_0026882 3300048903 Bacteria 3533
1193 Ga0496100_0191492 3300048903 Bacteria 1485
1194 Ga0496100_0518948 3300048903 Bacteria 919
1195 Ga0496100_1540379 3300048903 Bacteria 525
1196 Ga0496101_0000018 3300048904 Bacteria 236102
1197 Ga0496101_0000102 3300048904 Bacteria 88779
1198 Ga0496101_0000432 3300048904 Bacteria 26783
1199 Ga0496101_0003436 3300048904 Bacteria 9886
1200 Ga0496101_0005964 3300048904 Bacteria 7809
1201 Ga0496101_0228082 3300048904 Bacteria 1447
1202 Ga0496101_0710255 3300048904 Bacteria 794
1203 Ga0496102_0000037 3300048905 Bacteria 199368
1204 Ga0496102_0000780 3300048905 Bacteria 31010
1205 Ga0496102_0001298 3300048905 Bacteria 22464
1206 Ga0496102_0001336 3300048905 Bacteria 22132
1207 Ga0496102_0092889 3300048905 Bacteria 2795
1208 Ga0496102_0114549 3300048905 Bacteria 2515
1209 Ga0496102_0137965 3300048905 Bacteria 2285
1210 Ga0496102_0545922 3300048905 Bacteria 1082
1211 Ga0496102_0833969 3300048905 Bacteria 844
1212 Ga0496102_0968251 3300048905 Bacteria 772
1213 Ga0496102_1002108 3300048905 Bacteria 756
1214 Ga0496102_1131243 3300048905 Bacteria 703
1215 Ga0496103_0000004 3300048906 Bacteria 510080
1216 Ga0496103_0000596 3300048906 Bacteria 28496
1217 Ga0496103_0001397 3300048906 Bacteria 16238
1218 Ga0496103_0002679 3300048906 Bacteria 11134
1219 Ga0496103_0039196 3300048906 Bacteria 2911
1220 Ga0496103_0182369 3300048906 Bacteria 1349
1221 Ga0496103_0789399 3300048906 Bacteria 599
1222 Ga0496103_0973489 3300048906 Bacteria 529
1223 Ga0496104_0013710 3300048907 Bacteria 7310
1224 Ga0496104_0032236 3300048907 Bacteria 4876
1225 Ga0496104_0336251 3300048907 Bacteria 1423
1226 Ga0496104_0588700 3300048907 Bacteria 1023
1227 Ga0496104_0835641 3300048907 Bacteria 827
1228 Ga0496105_0003385 3300048908 Bacteria 11787
1229 Ga0496105_0094088 3300048908 Bacteria 2475
1230 Ga0496105_0911050 3300048908 Bacteria 662
1231 Ga0496106_0001347 3300048909 Bacteria 18419
1232 Ga0496106_0003543 3300048909 Bacteria 11620
1233 Ga0496106_0010681 3300048909 Bacteria 6786
1234 Ga0496106_0031383 3300048909 Bacteria 3959
1235 Ga0496106_0076031 3300048909 Bacteria 2573
1236 Ga0496106_0183651 3300048909 Bacteria 1661
1237 Ga0496106_0384494 3300048909 Bacteria 1128
1238 Ga0496106_0865511 3300048909 Bacteria 715
1239 Ga0496106_1541725 3300048909 Bacteria 510
1240 Ga0496107_0000160 3300048910 Bacteria 34324
1241 Ga0496107_0000421 3300048910 Bacteria 22921
1242 Ga0496107_0000619 3300048910 Bacteria 19912
1243 Ga0496107_0007417 3300048910 Bacteria 7561
1244 Ga0496107_0103306 3300048910 Bacteria 2091
1245 Ga0496107_0473956 3300048910 Bacteria 929
1246 Ga0496107_0610868 3300048910 Bacteria 805
1247 Ga0496107_1111027 3300048910 Bacteria 571
1248 Ga0496107_1136263 3300048910 Bacteria 563
1249 Ga0496108_0000503 3300048911 Bacteria 30879
1250 Ga0496108_0001938 3300048911 Bacteria 16589
1251 Ga0496108_0002821 3300048911 Bacteria 13941
1252 Ga0496108_0074152 3300048911 Bacteria 2873
1253 Ga0496108_0160235 3300048911 Bacteria 1944
1254 Ga0496108_0203985 3300048911 Bacteria 1716
1255 Ga0496108_0281978 3300048911 Bacteria 1446
1256 Ga0496108_0303752 3300048911 Bacteria 1390
1257 Ga0496108_0968988 3300048911 Bacteria 727
1258 Ga0496109_0000136 3300048912 Bacteria 73612
1259 Ga0496109_0005195 3300048912 Bacteria 10872
1260 Ga0496109_0015193 3300048912 Bacteria 6702
1261 Ga0496109_0118649 3300048912 Bacteria 2463
1262 Ga0496109_0152932 3300048912 Bacteria 2161
1263 Ga0496109_0447116 3300048912 Bacteria 1221
1264 Ga0496109_0758146 3300048912 Bacteria 908
1265 Ga0496109_0858100 3300048912 Bacteria 846
1266 Ga0496109_0882504 3300048912 Bacteria 832
1267 Ga0496109_1448369 3300048912 Bacteria 622
1268 Ga0496110_0000175 3300048913 Bacteria 39577
1269 Ga0496110_0015920 3300048913 Bacteria 6272
1270 Ga0496110_0119399 3300048913 Bacteria 2374
1271 Ga0496110_0226937 3300048913 Bacteria 1698
1272 Ga0496110_0606456 3300048913 Bacteria 993
1273 Ga0496110_0713701 3300048913 Bacteria 905
1274 Ga0496110_1157961 3300048913 Bacteria 682
1275 Ga0496111_0163113 3300048914 Bacteria 1655
1276 Ga0496111_0207170 3300048914 Bacteria 1457
1277 Ga0496111_0237690 3300048914 Bacteria 1353
1278 Ga0496112_0010429 3300048915 Bacteria 8427
1279 Ga0496112_0014667 3300048915 Bacteria 7283
1280 Ga0496112_0099681 3300048915 Bacteria 2875
1281 Ga0496112_0163989 3300048915 Bacteria 2188
1282 Ga0496112_0658322 3300048915 Bacteria 977
1283 Ga0496113_0029506 3300048916 Bacteria 3962
1284 Ga0496113_0054586 3300048916 Bacteria 2991
1285 Ga0496113_0558612 3300048916 Bacteria 918
1286 Ga0496113_0634836 3300048916 Bacteria 854
1287 Ga0496113_0723947 3300048916 Bacteria 793
1288 Ga0496113_1069928 3300048916 Bacteria 633
1289 Ga0496113_1077254 3300048916 Bacteria 631
1290 Ga0496113_1106036 3300048916 Bacteria 621
1291 Ga0496114_0000108 3300048917 Bacteria 59737
1292 Ga0496114_0002178 3300048917 Bacteria 14918
1293 Ga0496114_0008558 3300048917 Bacteria 8112
1294 Ga0496114_0103287 3300048917 Bacteria 2436
1295 Ga0496114_0150460 3300048917 Bacteria 2019
1296 Ga0496114_0311774 3300048917 Bacteria 1390
1297 Ga0496115_0002120 3300048918 Bacteria 14181
1298 Ga0496115_0003879 3300048918 Bacteria 10782
1299 Ga0496115_0164525 3300048918 Bacteria 1834
1300 Ga0496115_0207774 3300048918 Bacteria 1617
1301 Ga0496115_0217917 3300048918 Bacteria 1575
1302 Ga0496115_0520494 3300048918 Bacteria 954
1303 Ga0496116_0000276 3300048919 Bacteria 89506
1304 Ga0496116_0006980 3300048919 Bacteria 10119
1305 Ga0496116_0008066 3300048919 Bacteria 9210
1306 Ga0496117_0000003 3300048920 Bacteria 1881097
1307 Ga0496117_0001470 3300048920 Bacteria 33884
1308 Ga0496117_0008421 3300048920 Bacteria 9798
1309 Ga0496117_0303302 3300048920 Bacteria 844
1310 Ga0496118_0000001 3300048921 Bacteria 1881100
1311 Ga0496118_0000275 3300048921 Bacteria 90451
1312 Ga0496118_0000292 3300048921 Bacteria 87325
1313 Ga0496118_0026151 3300048921 Bacteria 4979
1314 Ga0496118_0146119 3300048921 Bacteria 1488
1315 Ga0496119_0008565 3300048922 Bacteria 8967
1316 Ga0496119_0023844 3300048922 Bacteria 4324
1317 Ga0496119_0041498 3300048922 Bacteria 2929
1318 Ga0496120_0041051 3300048923 Bacteria 2714
1319 Ga0496120_0109134 3300048923 Bacteria 1448
1320 Ga0496121_0000023 3300048924 Bacteria 463448
1321 Ga0496121_0000338 3300048924 Bacteria 97703
1322 Ga0496121_0007403 3300048924 Bacteria 13267
1323 Ga0496122_0000164 3300048925 Bacteria 158055
1324 Ga0496122_0009281 3300048925 Bacteria 10402
1325 Ga0496123_0010653 3300048926 Bacteria 8092
1326 Ga0496123_0043624 3300048926 Bacteria 3077
1327 Ga0496124_0000014 3300048927 Bacteria 463448
1328 Ga0496124_0564792 3300048927 Bacteria 748
1329 Ga0496124_0578178 3300048927 Bacteria 735
1330 Ga0496125_0000020 3300048928 Bacteria 463448
1331 Ga0496125_0029379 3300048928 Bacteria 4940
1332 Ga0496125_0040854 3300048928 Bacteria 3972
1333 Ga0496125_0200100 3300048928 Bacteria 1309
1334 Ga0496126_0000023 3300048929 Bacteria 463448
1335 Ga0496126_0000551 3300048929 Bacteria 72093
1336 Ga0496126_0023801 3300048929 Bacteria 5928
1337 Ga0496126_0059158 3300048929 Bacteria 3452
1338 Ga0496126_0158692 3300048929 Bacteria 1934
1339 Ga0496126_0190455 3300048929 Bacteria 1738
1340 Ga0501031_0003702 3300049568 Bacteria 9834
1341 Ga0501031_0171056 3300049568 Bacteria 1420
1342 Ga0501032_0001621 3300049569 Bacteria 17960
1343 Ga0501032_0035426 3300049569 Bacteria 3411
1344 Ga0501032_0119942 3300049569 Bacteria 1739
1345 Ga0501033_0086401 3300049570 Bacteria 2296
1346 Ga0501033_0152461 3300049570 Bacteria 1667
1347 Ga0501034_0001139 3300049571 Bacteria 37012
1348 Ga0501034_0029751 3300049571 Bacteria 5552
1349 Ga0501034_0099925 3300049571 Bacteria 2896
1350 Ga0501034_0216930 3300049571 Bacteria 1867
1351 Ga0501036_0010498 3300049572 Bacteria 7651
1352 Ga0501036_0125427 3300049572 Bacteria 2168
1353 Ga0501036_0252028 3300049572 Bacteria 1479
1354 Ga0501036_0303405 3300049572 Bacteria 1335
1355 Ga0501037_0006173 3300049573 Bacteria 8757
1356 Ga0501037_0007556 3300049573 Bacteria 7957
1357 Ga0501037_0046066 3300049573 Bacteria 3199
1358 Ga0501038_0004812 3300049574 Bacteria 12541
1359 Ga0501038_0018526 3300049574 Bacteria 6287
1360 Ga0501038_0605968 3300049574 Bacteria 828
1361 Ga0501039_0000288 3300049575 Bacteria 35904
1362 Ga0501039_1242759 3300049575 Bacteria 575
1363 Ga0501039_1518099 3300049575 Bacteria 515
1364 Ga0501040_0009730 3300049576 Bacteria 6274
1365 Ga0501040_0362908 3300049576 Bacteria 1038
1366 Ga0501041_0021864 3300049577 Bacteria 3831
1367 Ga0501041_0317519 3300049577 Bacteria 983
1368 Ga0501042_0006845 3300049578 Bacteria 7439
1369 Ga0501042_0509395 3300049578 Bacteria 874
1370 Ga0501043_0000411 3300049579 Bacteria 38553
1371 Ga0501043_0011824 3300049579 Bacteria 6839
1372 Ga0501046_0000379 3300049580 Bacteria 44584
1373 Ga0501046_0080819 3300049580 Bacteria 2511
1374 Ga0501046_1109554 3300049580 Bacteria 546
1375 Ga0501047_0011583 3300049581 Bacteria 8345
1376 Ga0501048_0004750 3300049582 Bacteria 10352
1377 Ga0501048_0013403 3300049582 Bacteria 6085
1378 Ga0501068_0105440 3300049584 Bacteria 1749
1379 Ga0501070_0000614 3300049586 Bacteria 32686
1380 Ga0501070_0004013 3300049586 Bacteria 12651
1381 Ga0501070_0360846 3300049586 Bacteria 1179
1382 Ga0501070_0494311 3300049586 Bacteria 983
1383 Ga0501071_0025791 3300049587 Bacteria 4120
1384 Ga0501071_0238186 3300049587 Bacteria 1372
1385 Ga0501071_0783669 3300049587 Bacteria 735
1386 Ga0501071_1084832 3300049587 Bacteria 619
1387 Ga0501072_0051976 3300049588 Bacteria 3226
1388 Ga0501072_0877308 3300049588 Bacteria 701
1389 Ga0501073_0143935 3300049589 Bacteria 1652
1390 Ga0501073_0368147 3300049589 Bacteria 993
1391 Ga0501074_0080367 3300049590 Bacteria 2339
1392 Ga0501074_0700742 3300049590 Bacteria 715
1393 Ga0501075_0047180 3300049591 Bacteria 3237
1394 Ga0501076_0018055 3300049592 Bacteria 5369
1395 Ga0501077_0034363 3300049593 Bacteria 3227
1396 Ga0501079_0013376 3300049741 Bacteria 6257
1397 Ga0501079_0358559 3300049741 Bacteria 1143
1398 Ga0501080_0150278 3300049742 Bacteria 2153
1399 Ga0501081_0061314 3300049743 Bacteria 2607
1400 Ga0501083_0090351 3300049744 Bacteria 2023
1401 Ga0501083_0167049 3300049744 Bacteria 1438
1402 Ga0501035_0042357 3300049822 Bacteria 4106
1403 Ga0501035_0268415 3300049822 Bacteria 1445
1404 Ga0501035_0313828 3300049822 Bacteria 1318
1405 Ga0501044_0003840 3300049823 Bacteria 16857
1406 Ga0501044_0028044 3300049823 Bacteria 5942
1407 Ga0501044_0206920 3300049823 Bacteria 1918
1408 Ga0501044_0254571 3300049823 Bacteria 1696
1409 Ga0501044_1117906 3300049823 Bacteria 657
1410 Ga0501044_1224326 3300049823 Bacteria 618
1411 Ga0501045_0001109 3300049824 Bacteria 17791
1412 Ga0501045_0438708 3300049824 Bacteria 971
1413 Ga0501045_0770583 3300049824 Bacteria 709
1414 nmdc:mga03683_106176_c1 3300050489 Bacteria 1238
1415 nmdc:mga03683_145329_c1 3300050489 Bacteria 1068
1416 nmdc:mga03683_149341_c1 3300050489 Bacteria 1054
1417 nmdc:mga03683_157540_c1 3300050489 Bacteria 1027
1418 nmdc:mga03683_18271_c1 3300050489 Bacteria 1649
1419 nmdc:mga03683_246717_c1 3300050489 Bacteria 828
1420 nmdc:mga03683_81237_c1 3300050489 Bacteria 1400
1421 nmdc:mga03683_97128_c1 3300050489 Bacteria 1291
1422 nmdc:mga03683_99291_c1 3300050489 Bacteria 1278
1423 nmdc:mga03n38_172110_c1 3300050490 Bacteria 1104
1424 nmdc:mga03n38_179110_c1 3300050490 Bacteria 1085
1425 nmdc:mga03n38_25072_c1 3300050490 Bacteria 2444
1426 nmdc:mga03n38_373_c1 3300050490 Bacteria 11013
1427 nmdc:mga03n38_39017_c1 3300050490 Bacteria 2058
1428 nmdc:mga03n38_4813_c1 3300050490 Bacteria 4520
1429 nmdc:mga03n38_57573_c1 3300050490 Bacteria 1758
1430 nmdc:mga03n38_64317_c1 3300050490 Bacteria 1679
1431 nmdc:mga03n38_669542_c1 3300050490 Bacteria 596
1432 nmdc:mga03n38_754669_c1 3300050490 Bacteria 564
1433 nmdc:mga00v17_107222_c1 3300050491 Bacteria 1769
1434 nmdc:mga00v17_112128_c1 3300050491 Bacteria 1731
1435 nmdc:mga00v17_145703_c1 3300050491 Bacteria 1520
1436 nmdc:mga00v17_14672_c1 3300050491 Bacteria 4381
1437 nmdc:mga00v17_15818_c1 3300050491 Bacteria 4242
1438 nmdc:mga00v17_163030_c1 3300050491 Bacteria 1436
1439 nmdc:mga00v17_171862_c1 3300050491 Bacteria 1397
1440 nmdc:mga00v17_24548_c1 3300050491 Bacteria 3498
1441 nmdc:mga00v17_259078_c1 3300050491 Bacteria 1128
1442 nmdc:mga00v17_31938_c1 3300050491 Bacteria 3109
1443 nmdc:mga00v17_321294_c1 3300050491 Bacteria 1006
1444 nmdc:mga00v17_371485_c1 3300050491 Bacteria 930
1445 nmdc:mga00v17_44498_c1 3300050491 Bacteria 2677
1446 nmdc:mga00v17_48101_c1 3300050491 Bacteria 2584
1447 nmdc:mga00v17_72702_c1 3300050491 Bacteria 2134
1448 nmdc:mga00v17_828239_c1 3300050491 Bacteria 589
1449 nmdc:mga00v17_8314_c1 3300050491 Bacteria 5582
1450 nmdc:mga00v17_88659_c1 3300050491 Bacteria 1940
1451 nmdc:mga00v17_915332_c1 3300050491 Bacteria 555
1452 nmdc:mga00v17_939_c2 3300050491 Bacteria 8747
1453 nmdc:mga0yw44_1011118_c1 3300050492 Bacteria 563
1454 nmdc:mga0yw44_10139_c1 3300050492 Bacteria 4800
1455 nmdc:mga0yw44_11473_c1 3300050492 Bacteria 4577
1456 nmdc:mga0yw44_1238278_c1 3300050492 Bacteria 503
1457 nmdc:mga0yw44_1244897_c1 3300050492 Bacteria 502
1458 nmdc:mga0yw44_137849_c1 3300050492 Bacteria 1584
1459 nmdc:mga0yw44_197652_c1 3300050492 Bacteria 1327
1460 nmdc:mga0yw44_197807_c1 3300050492 Bacteria 1327
1461 nmdc:mga0yw44_209043_c2 3300050492 Bacteria 637
1462 nmdc:mga0yw44_212467_c1 3300050492 Bacteria 1280
1463 nmdc:mga0yw44_4800_c1 3300050492 Bacteria 6270
1464 nmdc:mga0yw44_563269_c1 3300050492 Bacteria 774
1465 nmdc:mga0yw44_623801_c1 3300050492 Bacteria 733
1466 nmdc:mga0yw44_757020_c1 3300050492 Bacteria 660
1467 nmdc:mga0k408_127449_c1 3300050493 Bacteria 1510
1468 nmdc:mga0k408_269814_c1 3300050493 Bacteria 1016
1469 nmdc:mga06z11_114540_c1 3300050494 Bacteria 1497
1470 nmdc:mga06z11_376919_c1 3300050494 Bacteria 852
1471 nmdc:mga06z11_4204_c1 3300050494 Bacteria 5638
1472 nmdc:mga06z11_529606_c1 3300050494 Bacteria 715
1473 nmdc:mga04h51_101730_c1 3300050495 Bacteria 1048
1474 nmdc:mga04h51_13989_c1 3300050495 Bacteria 2284
1475 nmdc:mga04h51_87934_c1 3300050495 Bacteria 1113
1476 nmdc:mga07m45_115229_c1 3300050496 Bacteria 1550
1477 nmdc:mga07m45_161133_c1 3300050496 Bacteria 1302
1478 nmdc:mga07m45_207132_c1 3300050496 Bacteria 1141
1479 nmdc:mga07m45_24220_c1 3300050496 Bacteria 3323
1480 nmdc:mga07m45_247687_c1 3300050496 Bacteria 1037
1481 nmdc:mga07m45_36730_c1 3300050496 Bacteria 2730
1482 nmdc:mga07m45_47279_c1 3300050496 Bacteria 2419
1483 nmdc:mga07m45_9033_c1 3300050496 Bacteria 5149
1484 nmdc:mga07m45_920710_c1 3300050496 Bacteria 500
1485 nmdc:mga05p37_1396971_c1 3300050507 Bacteria 705
1486 nmdc:mga05p37_2880_c1 3300050507 Bacteria 19975
1487 nmdc:mga05p37_485785_c1 3300050507 Bacteria 1421
1488 nmdc:mga05p37_50868_c1 3300050507 Bacteria 5095
1489 nmdc:mga09592_1018_c1 3300050508 Bacteria 22263
1490 nmdc:mga09592_216798_c1 3300050508 Bacteria 1658
1491 nmdc:mga09592_764472_c1 3300050508 Bacteria 819
1492 nmdc:mga0qj67_20833_c1 3300050509 Bacteria 5023
1493 nmdc:mga06r32_35717_c1 3300050510 Bacteria 4690
1494 nmdc:mga06r32_41498_c1 3300050510 Bacteria 4372
1495 nmdc:mga06r32_619661_c1 3300050510 Bacteria 1052
1496 nmdc:mga08y16_348176_c1 3300050511 Bacteria 1522
1497 nmdc:mga08y16_38223_c1 3300050511 Bacteria 5041
1498 nmdc:mga0n895_2169642_c1 3300050512 Bacteria 511
1499 nmdc:mga0a205_827423_c1 3300050515 Bacteria 773
1500 nmdc:mga0sz30_123819_c1 3300050516 Bacteria 1137
1501 nmdc:mga0sz30_13617_c1 3300050516 Bacteria 3188
1502 nmdc:mga0sz30_144402_c2 3300050516 Bacteria 749
1503 nmdc:mga0sz30_166905_c1 3300050516 Bacteria 976
1504 nmdc:mga0sz30_1775_c1 3300050516 Bacteria 7659
1505 nmdc:mga0sz30_186679_c1 3300050516 Bacteria 920
1506 nmdc:mga0sz30_202324_c1 3300050516 Bacteria 882
1507 nmdc:mga0sz30_218474_c1 3300050516 Bacteria 847
1508 nmdc:mga0sz30_275279_c1 3300050516 Bacteria 750
1509 nmdc:mga0sz30_340264_c1 3300050516 Bacteria 670
1510 nmdc:mga0sz30_34285_c1 3300050516 Bacteria 2112
1511 nmdc:mga0sz30_421837_c1 3300050516 Bacteria 598
1512 nmdc:mga0sz30_471171_c1 3300050516 Bacteria 564
1513 nmdc:mga0sz30_488380_c1 3300050516 Bacteria 554
1514 nmdc:mga0sz30_77563_c1 3300050516 Bacteria 1002
1515 Ga0495595_0051342 3300053084 Bacteria 1911
1516 Ga0500643_018937 3300053087 Bacteria 2275
1517 Ga0500643_121135 3300053087 Bacteria 705
1518 Ga0500556_0007787 3300053104 Bacteria 3069
1519 Ga0500562_037974 3300053108 Bacteria 1279
1520 Ga0500589_350845 3300053147 Bacteria 507
1521 Ga0500604_0288738 3300053151 Bacteria 569
1522 Ga0500616_0066511 3300053153 Bacteria 1850
1523 Ga0501084_0009555 3300054114 Bacteria 8028
1524 Ga0590074_054935 3300059423 Bacteria 733
1525 Ga0587070_236075 3300059491 Bacteria 502
1526 Ga0587073_0129148 3300059492 Bacteria 692
1527 Ga0587082_045256 3300059504 Bacteria 821
1528 Ga0587082_114522 3300059504 Bacteria 603
1529 Ga0587072_035935 3300059643 Bacteria 946
1530 Ga0587079_142822 3300059647 Bacteria 612
1531 Ga0587079_152893 3300059647 Bacteria 598
1532 Ga0587119_049619 3300059658 Bacteria 623
1533 Ga0501082_0016287 3300060353 Bacteria 6400
1534 Ga0501082_0688152 3300060353 Bacteria 895
1535 Ga0501082_1560461 3300060353 Bacteria 576
1536 Ga0466962_0012558 3300061719 Bacteria 4073
1537 Ga0466962_0013071 3300061719 Bacteria 3993
1538 Ga0466962_0143964 3300061719 Bacteria 1155
1539 Ga0466962_0208426 3300061719 Bacteria 956
1540 Ga0466962_0398271 3300061719 Bacteria 689
1541 Ga0530510_0031591 3300061734 Bacteria 3807
1542 Ga0530510_0522075 3300061734 Unclassified 901

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100783154 Ga0070683_1007831541 102
2 3300005530 Ga0070679_100227891 Ga0070679_1002278912 102
3 3300005535 Ga0070684_100243951 Ga0070684_1002439512 102
4 3300006028 Ga0070717_10136767 Ga0070717_101367672 102
5 3300020610 Ga0154015_1120890 Ga0154015_11208901 102
6 3300021384 Ga0213876_10001461 Ga0213876_100014614 102
7 3300021384 Ga0213876_10003185 Ga0213876_100031854 102
8 3300025921 Ga0207652_10166285 Ga0207652_101662852 102
9 3300025928 Ga0207700_11051162 Ga0207700_110511621 102
10 3300025944 Ga0207661_10733125 Ga0207661_107331251 102
11 3300037853 Ga0436364_0760747 Ga0436364_0760747_541_879 102
12 3300039437 Ga0436365_0557871 Ga0436365_0557871_7741_8079 102
13 3300039437 Ga0436365_1378611 Ga0436365_1378611_8099_8437 102
14 3300039450 Ga0436363_1475318 Ga0436363_1475318_470_808 102
15 3300044694 Ga0466963_0415871 Ga0466963_0415871_61_399 102
16 3300044719 Ga0466971_0088209 Ga0466971_0088209_70_408 102
17 3300044842 Ga0466957_0023651 Ga0466957_0023651_2002_2340 102
18 3300044901 Ga0466960_0001745 Ga0466960_0001745_5875_6213 102
19 3300045836 Ga0466958_0274405 Ga0466958_0274405_226_564 102
20 3300045976 Ga0466967_0027631 Ga0466967_0027631_2749_3087 102
21 3300045976 Ga0466967_0029860 Ga0466967_0029860_2474_2812 102
22 3300045976 Ga0466967_0035323 Ga0466967_0035323_3856_4194 102
23 3300045976 Ga0466967_0636704 Ga0466967_0636704_690_1028 102
24 3300045976 Ga0466967_1183078 Ga0466967_1183078_240_578 102
25 3300046459 Ga0495629_0045239 Ga0495629_0045239_2419_2757 102
26 3300046542 Ga0495597_0220001 Ga0495597_0220001_35_373 102
27 3300047319 Ga0495674_0006391 Ga0495674_0006391_8668_9006 102
28 3300048906 Ga0496103_0789399 Ga0496103_0789399_105_443 102
29 3300048918 Ga0496115_0217917 Ga0496115_0217917_329_667 102
30 3300048921 Ga0496118_0000292 Ga0496118_0000292_84089_84427 102
31 3300049568 Ga0501031_0171056 Ga0501031_0171056_958_1296 102
32 3300049569 Ga0501032_0035426 Ga0501032_0035426_1575_1913 102
33 3300049571 Ga0501034_0001139 Ga0501034_0001139_31749_32087 102
34 3300049572 Ga0501036_0252028 Ga0501036_0252028_480_818 102
35 3300049573 Ga0501037_0007556 Ga0501037_0007556_3063_3401 102
36 3300049574 Ga0501038_0605968 Ga0501038_0605968_359_697 102
37 3300049579 Ga0501043_0011824 Ga0501043_0011824_6408_6746 102
38 3300049580 Ga0501046_0000379 Ga0501046_0000379_27567_27905 102
39 3300049580 Ga0501046_1109554 Ga0501046_1109554_10_348 102
40 3300049581 Ga0501047_0011583 Ga0501047_0011583_6881_7219 102
41 3300049582 Ga0501048_0004750 Ga0501048_0004750_6317_6655 102
42 3300049586 Ga0501070_0004013 Ga0501070_0004013_11535_11873 102
43 3300049742 Ga0501080_0150278 Ga0501080_0150278_1688_2026 102
44 3300049744 Ga0501083_0167049 Ga0501083_0167049_170_508 102
45 3300049822 Ga0501035_0042357 Ga0501035_0042357_2597_2935 102
46 3300049822 Ga0501035_0268415 Ga0501035_0268415_174_512 102
47 3300049823 Ga0501044_0003840 Ga0501044_0003840_9483_9821 102
48 3300049823 Ga0501044_0254571 Ga0501044_0254571_346_684 102
49 3300049823 Ga0501044_1117906 Ga0501044_1117906_181_519 102
50 3300060353 Ga0501082_1560461 Ga0501082_1560461_50_388 102
51 3300061719 Ga0466962_0143964 Ga0466962_0143964_678_1016 102
52 3300061719 Ga0466962_0398271 Ga0466962_0398271_37_375 102
53 3300050490 nmdc:mga03n38_669542_c1 nmdc:mga03n38_669542_c1_208_546 103
54 3300049588 Ga0501072_0877308 Ga0501072_0877308_158_496 104
55 3300049741 Ga0501079_0358559 Ga0501079_0358559_308_646 104
56 3300039438 Ga0436360_0649702 Ga0436360_0649702_1729_2067 105
57 3300044719 Ga0466971_0064306 Ga0466971_0064306_14_352 105
58 3300045836 Ga0466958_0035124 Ga0466958_0035124_157_495 105
59 3300049570 Ga0501033_0152461 Ga0501033_0152461_1217_1555 105
60 3300049586 Ga0501070_0494311 Ga0501070_0494311_299_637 105
61 3300061719 Ga0466962_0013071 Ga0466962_0013071_1216_1554 105
62 3300047320 Ga0495672_0036052 Ga0495672_0036052_1606_1935 106
63 3300005614 Ga0068856_101572041 Ga0068856_1015720412 107
64 3300006051 Ga0075364_10136411 Ga0075364_101364112 107
65 3300006051 Ga0075364_10506659 Ga0075364_105066591 107
66 3300006177 Ga0075362_10188123 Ga0075362_101881232 107
67 3300006177 Ga0075362_10241029 Ga0075362_102410292 107
68 3300006353 Ga0075370_10135133 Ga0075370_101351332 107
69 3300009148 Ga0105243_10000749 Ga0105243_1000074924 107
70 3300025935 Ga0207709_10002277 Ga0207709_100022777 107
71 3300032002 Ga0307416_100569940 Ga0307416_1005699402 107
72 3300046531 Ga0495665_0010315 Ga0495665_0010315_510_848 107
73 3300046615 Ga0495656_0157325 Ga0495656_0157325_471_809 107
74 3300046616 Ga0495668_0000573 Ga0495668_0000573_12129_12467 107
75 3300046674 Ga0495588_0015106 Ga0495588_0015106_554_892 107
76 3300048911 Ga0496108_0160235 Ga0496108_0160235_64_402 107
77 3300048928 Ga0496125_0040854 Ga0496125_0040854_96_434 107
78 3300048929 Ga0496126_0190455 Ga0496126_0190455_892_1230 107
79 3300050489 nmdc:mga03683_157540_c1 nmdc:mga03683_157540_c1_359_697 107
80 3300050490 nmdc:mga03n38_57573_c1 nmdc:mga03n38_57573_c1_891_1229 107
81 3300050491 nmdc:mga00v17_371485_c1 nmdc:mga00v17_371485_c1_147_485 107
82 3300050496 nmdc:mga07m45_24220_c1 nmdc:mga07m45_24220_c1_1568_1906 107
83 iso_pu_bacteria 2551306166 2552109529 108
84 iso_pu_bacteria 2558860112 2558910891 108
85 iso_pu_bacteria 2558860112 2558910893 108
86 iso_pu_bacteria 2643221567 2643850802 108
87 iso_pu_bacteria 2643221576 2643893149 108
88 iso_pu_bacteria 2643221590 2643961792 108
89 iso_pu_bacteria 2643221604 2644034124 108
90 iso_pu_bacteria 2643221624 2644134542 108
91 iso_pu_bacteria 2643221687 2644486471 108
92 iso_pu_bacteria 2643221692 2644513027 108
93 iso_pu_bacteria 2643221715 2644634990 108
94 iso_pu_bacteria 2687453341 2688395227 108
95 iso_pu_bacteria 2738541264 2738667470 108
96 iso_pu_bacteria 2738541305 2738871335 108
97 iso_pu_bacteria 2738541356 2739146540 108
98 iso_pu_bacteria 2791354901 2791915377 108
99 iso_pu_bacteria 2795385470 2795783489 108
100 iso_pu_bacteria 2795385472 2795795808 108
101 iso_pu_bacteria 2842134933 2842138485 108
102 iso_pu_bacteria 2870782633 2870784867 108
103 iso_pu_bacteria 2870782633 2870784869 108
104 iso_pu_bacteria 2902792274 2902798393 108
105 iso_pu_bacteria 2902810491 2902816954 108
106 iso_pu_bacteria 2902837492 2902840112 108
107 iso_pu_bacteria 2904765812 2904770118 108
108 iso_pu_bacteria 2904770941 2904771033 108
109 iso_pu_bacteria 2908811453 2908815077 108
110 iso_pu_bacteria 2915358134 2915362406 108
111 iso_pu_bacteria 2919420072 2919424440 108
112 iso_pu_bacteria 2919432681 2919436833 108
113 iso_pu_bacteria 2919446982 2919449708 108
114 iso_pu_bacteria 2939582691 2939587236 108
115 iso_pu_bacteria 8054472261 8054474310 108
116 3300045976 Ga0466967_0367220 Ga0466967_0367220_1024_1356 110
117 3300001977 JGI24746J21847_1009137 JGI24746J21847_10091372 112
118 3300001990 JGI24737J22298_10091536 JGI24737J22298_100915361 112
119 3300001990 JGI24737J22298_10130260 JGI24737J22298_101302601 112
120 3300001991 JGI24743J22301_10000740 JGI24743J22301_100007402 112
121 3300001991 JGI24743J22301_10078436 JGI24743J22301_100784361 112
122 3300002067 JGI24735J21928_10055529 JGI24735J21928_100555292 112
123 3300002067 JGI24735J21928_10187667 JGI24735J21928_101876672 112
124 3300002070 JGI24750J21931_1001661 JGI24750J21931_10016611 112
125 3300002070 JGI24750J21931_1056839 JGI24750J21931_10568391 112
126 3300002073 JGI24745J21846_1000717 JGI24745J21846_10007173 112
127 3300002073 JGI24745J21846_1009308 JGI24745J21846_10093082 112
128 3300002073 JGI24745J21846_1024120 JGI24745J21846_10241201 112
129 3300002074 JGI24748J21848_1028065 JGI24748J21848_10280652 112
130 3300002076 JGI24749J21850_1002988 JGI24749J21850_10029882 112
131 3300002076 JGI24749J21850_1022394 JGI24749J21850_10223942 112
132 3300002077 JGI24744J21845_10038317 JGI24744J21845_100383171 112
133 3300002239 JGI24034J26672_10008321 JGI24034J26672_100083211 112
134 3300002239 JGI24034J26672_10077401 JGI24034J26672_100774012 112
135 3300002244 JGI24742J22300_10001093 JGI24742J22300_100010932 112
136 3300002244 JGI24742J22300_10004381 JGI24742J22300_100043812 112
137 3300002459 JGI24751J29686_10004169 JGI24751J29686_100041692 112
138 3300003568 Ga0006781J51513_1014724 Ga0006781J51513_10147242 112
139 3300003790 Ga0055528_1038670 Ga0055528_10386702 112
140 3300003792 Ga0055540_1003109 Ga0055540_10031093 112
141 3300003792 Ga0055540_1015249 Ga0055540_10152492 112
142 3300003792 Ga0055540_1025290 Ga0055540_10252902 112
143 3300004800 Ga0058861_11637123 Ga0058861_116371231 112
144 3300004801 Ga0058860_11736522 Ga0058860_117365222 112
145 3300004801 Ga0058860_12078576 Ga0058860_120785762 112
146 3300004801 Ga0058860_12084339 Ga0058860_120843392 112
147 3300005289 Ga0065704_10149048 Ga0065704_101490481 112
148 3300005295 Ga0065707_10434809 Ga0065707_104348091 112
149 3300005295 Ga0065707_10451764 Ga0065707_104517641 112
150 3300005327 Ga0070658_10361823 Ga0070658_103618232 112
151 3300005327 Ga0070658_10732481 Ga0070658_107324812 112
152 3300005328 Ga0070676_10005073 Ga0070676_100050733 112
153 3300005328 Ga0070676_10063008 Ga0070676_100630082 112
154 3300005328 Ga0070676_10427437 Ga0070676_104274372 112
155 3300005328 Ga0070676_10767904 Ga0070676_107679042 112
156 3300005329 Ga0070683_100003739 Ga0070683_1000037395 112
157 3300005329 Ga0070683_100112312 Ga0070683_1001123122 112
158 3300005329 Ga0070683_100410969 Ga0070683_1004109691 112
159 3300005329 Ga0070683_100502378 Ga0070683_1005023782 112
160 3300005330 Ga0070690_100001844 Ga0070690_1000018448 112
161 3300005330 Ga0070690_101010682 Ga0070690_1010106822 112
162 3300005331 Ga0070670_100063968 Ga0070670_1000639683 112
163 3300005331 Ga0070670_101022416 Ga0070670_1010224161 112
164 3300005333 Ga0070677_10153815 Ga0070677_101538151 112
165 3300005333 Ga0070677_10765178 Ga0070677_107651781 112
166 3300005334 Ga0068869_100091366 Ga0068869_1000913662 112
167 3300005334 Ga0068869_100109361 Ga0068869_1001093611 112
168 3300005334 Ga0068869_100334752 Ga0068869_1003347522 112
169 3300005334 Ga0068869_100695175 Ga0068869_1006951752 112
170 3300005335 Ga0070666_10023477 Ga0070666_100234773 112
171 3300005335 Ga0070666_10096059 Ga0070666_100960593 112
172 3300005335 Ga0070666_10449288 Ga0070666_104492882 112
173 3300005337 Ga0070682_100009670 Ga0070682_1000096704 112
174 3300005337 Ga0070682_100047304 Ga0070682_1000473041 112
175 3300005337 Ga0070682_100207174 Ga0070682_1002071742 112
176 3300005337 Ga0070682_100230040 Ga0070682_1002300402 112
177 3300005338 Ga0068868_100000294 Ga0068868_10000029428 112
178 3300005338 Ga0068868_100209754 Ga0068868_1002097543 112
179 3300005338 Ga0068868_100362969 Ga0068868_1003629692 112
180 3300005338 Ga0068868_100380424 Ga0068868_1003804241 112
181 3300005338 Ga0068868_100878939 Ga0068868_1008789392 112
182 3300005338 Ga0068868_101026527 Ga0068868_1010265271 112
183 3300005338 Ga0068868_101409946 Ga0068868_1014099462 112
184 3300005338 Ga0068868_101753688 Ga0068868_1017536881 112
185 3300005339 Ga0070660_100487677 Ga0070660_1004876772 112
186 3300005339 Ga0070660_100915166 Ga0070660_1009151662 112
187 3300005340 Ga0070689_100192857 Ga0070689_1001928572 112
188 3300005340 Ga0070689_100365195 Ga0070689_1003651951 112
189 3300005341 Ga0070691_10019240 Ga0070691_100192402 112
190 3300005341 Ga0070691_10028158 Ga0070691_100281583 112
191 3300005341 Ga0070691_10675366 Ga0070691_106753661 112
192 3300005343 Ga0070687_100485089 Ga0070687_1004850892 112
193 3300005343 Ga0070687_100711481 Ga0070687_1007114811 112
194 3300005344 Ga0070661_100101221 Ga0070661_1001012213 112
195 3300005344 Ga0070661_100227148 Ga0070661_1002271482 112
196 3300005345 Ga0070692_10043035 Ga0070692_100430352 112
197 3300005345 Ga0070692_10059450 Ga0070692_100594502 112
198 3300005347 Ga0070668_100001698 Ga0070668_10000169814 112
199 3300005347 Ga0070668_100007254 Ga0070668_1000072542 112
200 3300005347 Ga0070668_100057428 Ga0070668_1000574282 112
201 3300005347 Ga0070668_101339257 Ga0070668_1013392571 112
202 3300005353 Ga0070669_100043136 Ga0070669_1000431362 112
203 3300005353 Ga0070669_100132378 Ga0070669_1001323782 112
204 3300005353 Ga0070669_100810711 Ga0070669_1008107112 112
205 3300005354 Ga0070675_100061047 Ga0070675_1000610473 112
206 3300005354 Ga0070675_100222890 Ga0070675_1002228902 112
207 3300005355 Ga0070671_100031066 Ga0070671_1000310661 112
208 3300005355 Ga0070671_100057589 Ga0070671_1000575892 112
209 3300005355 Ga0070671_100093840 Ga0070671_1000938402 112
210 3300005355 Ga0070671_100226080 Ga0070671_1002260802 112
211 3300005355 Ga0070671_100365493 Ga0070671_1003654932 112
212 3300005355 Ga0070671_100601033 Ga0070671_1006010332 112
213 3300005355 Ga0070671_101079674 Ga0070671_1010796741 112
214 3300005356 Ga0070674_100000432 Ga0070674_10000043210 112
215 3300005356 Ga0070674_100016186 Ga0070674_1000161863 112
216 3300005356 Ga0070674_100027176 Ga0070674_1000271763 112
217 3300005356 Ga0070674_100050015 Ga0070674_1000500153 112
218 3300005356 Ga0070674_100971694 Ga0070674_1009716941 112
219 3300005356 Ga0070674_101325492 Ga0070674_1013254921 112
220 3300005364 Ga0070673_100060410 Ga0070673_1000604103 112
221 3300005365 Ga0070688_100497703 Ga0070688_1004977031 112
222 3300005365 Ga0070688_100557456 Ga0070688_1005574562 112
223 3300005366 Ga0070659_100030040 Ga0070659_1000300403 112
224 3300005366 Ga0070659_100193188 Ga0070659_1001931882 112
225 3300005366 Ga0070659_100623279 Ga0070659_1006232792 112
226 3300005367 Ga0070667_100000063 Ga0070667_100000063112 112
227 3300005367 Ga0070667_100000727 Ga0070667_10000072727 112
228 3300005367 Ga0070667_100007584 Ga0070667_1000075843 112
229 3300005367 Ga0070667_100043232 Ga0070667_1000432322 112
230 3300005367 Ga0070667_100222334 Ga0070667_1002223342 112
231 3300005367 Ga0070667_100280985 Ga0070667_1002809852 112
232 3300005367 Ga0070667_100329283 Ga0070667_1003292832 112
233 3300005367 Ga0070667_101219759 Ga0070667_1012197592 112
234 3300005434 Ga0070709_10331032 Ga0070709_103310321 112
235 3300005434 Ga0070709_11688647 Ga0070709_116886472 112
236 3300005435 Ga0070714_100741965 Ga0070714_1007419652 112
237 3300005436 Ga0070713_100608299 Ga0070713_1006082992 112
238 3300005436 Ga0070713_100852676 Ga0070713_1008526762 112
239 3300005437 Ga0070710_10000157 Ga0070710_1000015724 112
240 3300005437 Ga0070710_10001774 Ga0070710_100017742 112
241 3300005437 Ga0070710_10002188 Ga0070710_100021885 112
242 3300005437 Ga0070710_10317361 Ga0070710_103173612 112
243 3300005437 Ga0070710_11168060 Ga0070710_111680601 112
244 3300005438 Ga0070701_10003543 Ga0070701_100035433 112
245 3300005438 Ga0070701_10052055 Ga0070701_100520552 112
246 3300005438 Ga0070701_10363302 Ga0070701_103633022 112
247 3300005439 Ga0070711_100001192 Ga0070711_10000119214 112
248 3300005439 Ga0070711_100119406 Ga0070711_1001194061 112
249 3300005439 Ga0070711_101816995 Ga0070711_1018169951 112
250 3300005440 Ga0070705_100005561 Ga0070705_1000055613 112
251 3300005440 Ga0070705_100080888 Ga0070705_1000808882 112
252 3300005441 Ga0070700_100006361 Ga0070700_1000063613 112
253 3300005441 Ga0070700_100265158 Ga0070700_1002651581 112
254 3300005441 Ga0070700_100271430 Ga0070700_1002714302 112
255 3300005444 Ga0070694_100030276 Ga0070694_1000302762 112
256 3300005455 Ga0070663_100002103 Ga0070663_10000210310 112
257 3300005455 Ga0070663_100095066 Ga0070663_1000950661 112
258 3300005455 Ga0070663_100095802 Ga0070663_1000958022 112
259 3300005455 Ga0070663_100226358 Ga0070663_1002263582 112
260 3300005455 Ga0070663_100348934 Ga0070663_1003489342 112
261 3300005455 Ga0070663_100388781 Ga0070663_1003887812 112
262 3300005455 Ga0070663_101271169 Ga0070663_1012711691 112
263 3300005455 Ga0070663_101688641 Ga0070663_1016886411 112
264 3300005456 Ga0070678_100000565 Ga0070678_1000005657 112
265 3300005456 Ga0070678_100088255 Ga0070678_1000882553 112
266 3300005456 Ga0070678_100236406 Ga0070678_1002364062 112
267 3300005456 Ga0070678_100373980 Ga0070678_1003739802 112
268 3300005457 Ga0070662_100049566 Ga0070662_1000495662 112
269 3300005457 Ga0070662_100082643 Ga0070662_1000826433 112
270 3300005457 Ga0070662_100984334 Ga0070662_1009843342 112
271 3300005458 Ga0070681_10891414 Ga0070681_108914141 112
272 3300005458 Ga0070681_10937231 Ga0070681_109372311 112
273 3300005459 Ga0068867_100001406 Ga0068867_1000014068 112
274 3300005459 Ga0068867_100020147 Ga0068867_1000201472 112
275 3300005466 Ga0070685_10026757 Ga0070685_100267573 112
276 3300005466 Ga0070685_10056035 Ga0070685_100560353 112
277 3300005466 Ga0070685_10210577 Ga0070685_102105771 112
278 3300005466 Ga0070685_10375141 Ga0070685_103751412 112
279 3300005466 Ga0070685_10876491 Ga0070685_108764911 112
280 3300005467 Ga0070706_100137399 Ga0070706_1001373992 112
281 3300005471 Ga0070698_100239605 Ga0070698_1002396052 112
282 3300005471 Ga0070698_101813556 Ga0070698_1018135562 112
283 3300005530 Ga0070679_100855217 Ga0070679_1008552172 112
284 3300005530 Ga0070679_102055450 Ga0070679_1020554502 112
285 3300005535 Ga0070684_100007186 Ga0070684_1000071868 112
286 3300005535 Ga0070684_100153537 Ga0070684_1001535372 112
287 3300005535 Ga0070684_100338808 Ga0070684_1003388081 112
288 3300005535 Ga0070684_100375848 Ga0070684_1003758481 112
289 3300005539 Ga0068853_100000008 Ga0068853_100000008131 112
290 3300005539 Ga0068853_100004306 Ga0068853_1000043066 112
291 3300005539 Ga0068853_100128710 Ga0068853_1001287102 112
292 3300005539 Ga0068853_100208390 Ga0068853_1002083902 112
293 3300005543 Ga0070672_100159286 Ga0070672_1001592862 112
294 3300005543 Ga0070672_100357713 Ga0070672_1003577132 112
295 3300005543 Ga0070672_101818115 Ga0070672_1018181151 112
296 3300005544 Ga0070686_100192328 Ga0070686_1001923282 112
297 3300005544 Ga0070686_100481462 Ga0070686_1004814622 112
298 3300005545 Ga0070695_100031005 Ga0070695_1000310052 112
299 3300005545 Ga0070695_100073069 Ga0070695_1000730691 112
300 3300005546 Ga0070696_100034464 Ga0070696_1000344643 112
301 3300005546 Ga0070696_100097805 Ga0070696_1000978052 112
302 3300005547 Ga0070693_100194527 Ga0070693_1001945272 112
303 3300005547 Ga0070693_100301734 Ga0070693_1003017342 112
304 3300005547 Ga0070693_100342553 Ga0070693_1003425532 112
305 3300005547 Ga0070693_100374315 Ga0070693_1003743151 112
306 3300005548 Ga0070665_100000854 Ga0070665_10000085420 112
307 3300005548 Ga0070665_100001944 Ga0070665_10000194424 112
308 3300005548 Ga0070665_100006611 Ga0070665_1000066113 112
309 3300005548 Ga0070665_100008241 Ga0070665_1000082418 112
310 3300005548 Ga0070665_100072202 Ga0070665_1000722022 112
311 3300005548 Ga0070665_100170001 Ga0070665_1001700012 112
312 3300005548 Ga0070665_100285516 Ga0070665_1002855163 112
313 3300005548 Ga0070665_100336606 Ga0070665_1003366062 112
314 3300005548 Ga0070665_100366289 Ga0070665_1003662892 112
315 3300005549 Ga0070704_100000118 Ga0070704_10000011825 112
316 3300005549 Ga0070704_100143690 Ga0070704_1001436902 112
317 3300005549 Ga0070704_100468465 Ga0070704_1004684652 112
318 3300005563 Ga0068855_100123877 Ga0068855_1001238772 112
319 3300005563 Ga0068855_100129340 Ga0068855_1001293402 112
320 3300005563 Ga0068855_100232433 Ga0068855_1002324332 112
321 3300005564 Ga0070664_100316735 Ga0070664_1003167352 112
322 3300005564 Ga0070664_100612565 Ga0070664_1006125652 112
323 3300005564 Ga0070664_101006070 Ga0070664_1010060702 112
324 3300005564 Ga0070664_101967956 Ga0070664_1019679561 112
325 3300005577 Ga0068857_100207673 Ga0068857_1002076732 112
326 3300005577 Ga0068857_100758154 Ga0068857_1007581542 112
327 3300005577 Ga0068857_101171325 Ga0068857_1011713252 112
328 3300005577 Ga0068857_101779070 Ga0068857_1017790702 112
329 3300005578 Ga0068854_100001658 Ga0068854_1000016587 112
330 3300005578 Ga0068854_100042027 Ga0068854_1000420273 112
331 3300005578 Ga0068854_100101383 Ga0068854_1001013832 112
332 3300005578 Ga0068854_100104853 Ga0068854_1001048532 112
333 3300005578 Ga0068854_100132218 Ga0068854_1001322183 112
334 3300005578 Ga0068854_100487552 Ga0068854_1004875522 112
335 3300005614 Ga0068856_100421669 Ga0068856_1004216692 112
336 3300005614 Ga0068856_101093158 Ga0068856_1010931582 112
337 3300005615 Ga0070702_100082083 Ga0070702_1000820832 112
338 3300005616 Ga0068852_100069750 Ga0068852_1000697503 112
339 3300005616 Ga0068852_100278464 Ga0068852_1002784642 112
340 3300005616 Ga0068852_100436574 Ga0068852_1004365742 112
341 3300005617 Ga0068859_100001738 Ga0068859_10000173812 112
342 3300005617 Ga0068859_100014581 Ga0068859_1000145812 112
343 3300005617 Ga0068859_100348979 Ga0068859_1003489792 112
344 3300005617 Ga0068859_101219890 Ga0068859_1012198902 112
345 3300005618 Ga0068864_100253264 Ga0068864_1002532643 112
346 3300005618 Ga0068864_100621331 Ga0068864_1006213312 112
347 3300005618 Ga0068864_102417676 Ga0068864_1024176761 112
348 3300005718 Ga0068866_10000223 Ga0068866_1000022325 112
349 3300005718 Ga0068866_10045191 Ga0068866_100451913 112
350 3300005719 Ga0068861_100000102 Ga0068861_10000010233 112
351 3300005719 Ga0068861_100112552 Ga0068861_1001125523 112
352 3300005719 Ga0068861_100435364 Ga0068861_1004353642 112
353 3300005719 Ga0068861_100717759 Ga0068861_1007177592 112
354 3300005834 Ga0068851_10111846 Ga0068851_101118463 112
355 3300005834 Ga0068851_10154750 Ga0068851_101547502 112
356 3300005834 Ga0068851_10525642 Ga0068851_105256421 112
357 3300005840 Ga0068870_10033046 Ga0068870_100330463 112
358 3300005840 Ga0068870_10152647 Ga0068870_101526472 112
359 3300005840 Ga0068870_10631137 Ga0068870_106311372 112
360 3300005841 Ga0068863_100000159 Ga0068863_10000015953 112
361 3300005841 Ga0068863_100020326 Ga0068863_1000203262 112
362 3300005841 Ga0068863_100191508 Ga0068863_1001915083 112
363 3300005841 Ga0068863_100240230 Ga0068863_1002402302 112
364 3300005841 Ga0068863_100546886 Ga0068863_1005468862 112
365 3300005841 Ga0068863_100683808 Ga0068863_1006838081 112
366 3300005841 Ga0068863_102444463 Ga0068863_1024444631 112
367 3300005842 Ga0068858_100003537 Ga0068858_10000353712 112
368 3300005842 Ga0068858_100014324 Ga0068858_1000143244 112
369 3300005842 Ga0068858_100136283 Ga0068858_1001362833 112
370 3300005842 Ga0068858_100202471 Ga0068858_1002024712 112
371 3300005842 Ga0068858_100355007 Ga0068858_1003550072 112
372 3300005842 Ga0068858_100519699 Ga0068858_1005196991 112
373 3300005842 Ga0068858_100586177 Ga0068858_1005861772 112
374 3300005842 Ga0068858_100755424 Ga0068858_1007554242 112
375 3300005842 Ga0068858_101048492 Ga0068858_1010484921 112
376 3300005842 Ga0068858_101489854 Ga0068858_1014898541 112
377 3300005843 Ga0068860_100000065 Ga0068860_100000065112 112
378 3300005843 Ga0068860_100004391 Ga0068860_1000043915 112
379 3300005843 Ga0068860_100049951 Ga0068860_1000499513 112
380 3300005843 Ga0068860_100103246 Ga0068860_1001032463 112
381 3300005843 Ga0068860_100384941 Ga0068860_1003849412 112
382 3300005843 Ga0068860_100387280 Ga0068860_1003872802 112
383 3300005843 Ga0068860_100939655 Ga0068860_1009396552 112
384 3300005843 Ga0068860_102501168 Ga0068860_1025011682 112
385 3300005844 Ga0068862_100000028 Ga0068862_100000028131 112
386 3300005844 Ga0068862_100004645 Ga0068862_1000046453 112
387 3300005844 Ga0068862_100175587 Ga0068862_1001755872 112
388 3300005844 Ga0068862_100329293 Ga0068862_1003292931 112
389 3300005844 Ga0068862_100369665 Ga0068862_1003696652 112
390 3300005844 Ga0068862_100940534 Ga0068862_1009405342 112
391 3300005844 Ga0068862_100991210 Ga0068862_1009912101 112
392 3300005844 Ga0068862_101507088 Ga0068862_1015070882 112
393 3300005937 Ga0081455_10034938 Ga0081455_100349382 112
394 3300005937 Ga0081455_10038480 Ga0081455_100384803 112
395 3300005937 Ga0081455_10039799 Ga0081455_100397994 112
396 3300005937 Ga0081455_10266434 Ga0081455_102664342 112
397 3300005981 Ga0081538_10087521 Ga0081538_100875212 112
398 3300005981 Ga0081538_10184231 Ga0081538_101842312 112
399 3300005983 Ga0081540_1231623 Ga0081540_12316231 112
400 3300005985 Ga0081539_10256095 Ga0081539_102560951 112
401 3300005985 Ga0081539_10483318 Ga0081539_104833181 112
402 3300006028 Ga0070717_10420158 Ga0070717_104201582 112
403 3300006028 Ga0070717_10540826 Ga0070717_105408262 112
404 3300006028 Ga0070717_11364882 Ga0070717_113648822 112
405 3300006038 Ga0075365_10004975 Ga0075365_100049752 112
406 3300006038 Ga0075365_10010381 Ga0075365_100103814 112
407 3300006038 Ga0075365_10018458 Ga0075365_100184583 112
408 3300006038 Ga0075365_10019045 Ga0075365_100190452 112
409 3300006038 Ga0075365_10037041 Ga0075365_100370412 112
410 3300006038 Ga0075365_10052552 Ga0075365_100525522 112
411 3300006038 Ga0075365_10186545 Ga0075365_101865452 112
412 3300006038 Ga0075365_10646549 Ga0075365_106465491 112
413 3300006038 Ga0075365_10706787 Ga0075365_107067872 112
414 3300006038 Ga0075365_10771655 Ga0075365_107716552 112
415 3300006042 Ga0075368_10015071 Ga0075368_100150712 112
416 3300006042 Ga0075368_10189310 Ga0075368_101893102 112
417 3300006048 Ga0075363_100001992 Ga0075363_1000019926 112
418 3300006048 Ga0075363_100003443 Ga0075363_1000034432 112
419 3300006048 Ga0075363_100004128 Ga0075363_1000041284 112
420 3300006048 Ga0075363_100005632 Ga0075363_1000056323 112
421 3300006048 Ga0075363_100034798 Ga0075363_1000347983 112
422 3300006048 Ga0075363_100171281 Ga0075363_1001712812 112
423 3300006048 Ga0075363_100320646 Ga0075363_1003206461 112
424 3300006048 Ga0075363_100329524 Ga0075363_1003295243 112
425 3300006048 Ga0075363_100339771 Ga0075363_1003397711 112
426 3300006048 Ga0075363_100431636 Ga0075363_1004316362 112
427 3300006048 Ga0075363_100670715 Ga0075363_1006707152 112
428 3300006048 Ga0075363_100785272 Ga0075363_1007852721 112
429 3300006048 Ga0075363_100822956 Ga0075363_1008229562 112
430 3300006051 Ga0075364_10002164 Ga0075364_1000216412 112
431 3300006051 Ga0075364_10004549 Ga0075364_100045495 112
432 3300006051 Ga0075364_10010132 Ga0075364_100101322 112
433 3300006051 Ga0075364_10011838 Ga0075364_100118384 112
434 3300006051 Ga0075364_10019526 Ga0075364_100195263 112
435 3300006051 Ga0075364_10044433 Ga0075364_100444332 112
436 3300006051 Ga0075364_10092800 Ga0075364_100928002 112
437 3300006051 Ga0075364_10120350 Ga0075364_101203502 112
438 3300006051 Ga0075364_10127492 Ga0075364_101274922 112
439 3300006051 Ga0075364_10188732 Ga0075364_101887322 112
440 3300006051 Ga0075364_10258905 Ga0075364_102589052 112
441 3300006051 Ga0075364_10403700 Ga0075364_104037002 112
442 3300006051 Ga0075364_10575400 Ga0075364_105754002 112
443 3300006051 Ga0075364_10816427 Ga0075364_108164271 112
444 3300006051 Ga0075364_10823038 Ga0075364_108230382 112
445 3300006163 Ga0070715_10054198 Ga0070715_100541982 112
446 3300006173 Ga0070716_100044004 Ga0070716_1000440042 112
447 3300006173 Ga0070716_100086412 Ga0070716_1000864122 112
448 3300006173 Ga0070716_101749793 Ga0070716_1017497931 112
449 3300006175 Ga0070712_100028928 Ga0070712_1000289283 112
450 3300006175 Ga0070712_100129203 Ga0070712_1001292032 112
451 3300006177 Ga0075362_10019058 Ga0075362_100190581 112
452 3300006177 Ga0075362_10059605 Ga0075362_100596052 112
453 3300006177 Ga0075362_10091074 Ga0075362_100910742 112
454 3300006177 Ga0075362_10173371 Ga0075362_101733711 112
455 3300006177 Ga0075362_10176475 Ga0075362_101764752 112
456 3300006177 Ga0075362_10177547 Ga0075362_101775472 112
457 3300006178 Ga0075367_10143767 Ga0075367_101437672 112
458 3300006178 Ga0075367_10237878 Ga0075367_102378782 112
459 3300006178 Ga0075367_10480168 Ga0075367_104801682 112
460 3300006186 Ga0075369_10001294 Ga0075369_100012942 112
461 3300006186 Ga0075369_10004421 Ga0075369_100044213 112
462 3300006186 Ga0075369_10021270 Ga0075369_100212702 112
463 3300006186 Ga0075369_10026351 Ga0075369_100263512 112
464 3300006186 Ga0075369_10028754 Ga0075369_100287542 112
465 3300006186 Ga0075369_10057719 Ga0075369_100577192 112
466 3300006186 Ga0075369_10084915 Ga0075369_100849152 112
467 3300006186 Ga0075369_10175267 Ga0075369_101752672 112
468 3300006186 Ga0075369_10185186 Ga0075369_101851862 112
469 3300006186 Ga0075369_10192127 Ga0075369_101921272 112
470 3300006186 Ga0075369_10193525 Ga0075369_101935252 112
471 3300006186 Ga0075369_10231155 Ga0075369_102311552 112
472 3300006195 Ga0075366_10266048 Ga0075366_102660482 112
473 3300006237 Ga0097621_100090017 Ga0097621_1000900172 112
474 3300006237 Ga0097621_100200313 Ga0097621_1002003132 112
475 3300006237 Ga0097621_100307108 Ga0097621_1003071081 112
476 3300006353 Ga0075370_10018360 Ga0075370_100183603 112
477 3300006353 Ga0075370_10022193 Ga0075370_100221932 112
478 3300006353 Ga0075370_10048410 Ga0075370_100484102 112
479 3300006353 Ga0075370_10123434 Ga0075370_101234342 112
480 3300006353 Ga0075370_10141422 Ga0075370_101414222 112
481 3300006353 Ga0075370_10216582 Ga0075370_102165822 112
482 3300006353 Ga0075370_10577153 Ga0075370_105771531 112
483 3300006353 Ga0075370_10881793 Ga0075370_108817932 112
484 3300006353 Ga0075370_10891840 Ga0075370_108918402 112
485 3300006358 Ga0068871_100036299 Ga0068871_1000362992 112
486 3300006844 Ga0075428_100001045 Ga0075428_10000104532 112
487 3300006844 Ga0075428_100382501 Ga0075428_1003825013 112
488 3300006846 Ga0075430_100000584 Ga0075430_1000005849 112
489 3300006846 Ga0075430_100013583 Ga0075430_1000135832 112
490 3300006846 Ga0075430_100351367 Ga0075430_1003513671 112
491 3300006846 Ga0075430_101583642 Ga0075430_1015836422 112
492 3300006847 Ga0075431_100005079 Ga0075431_1000050792 112
493 3300006847 Ga0075431_100166352 Ga0075431_1001663522 112
494 3300006847 Ga0075431_100746827 Ga0075431_1007468272 112
495 3300006852 Ga0075433_10829303 Ga0075433_108293032 112
496 3300006871 Ga0075434_102379697 Ga0075434_1023796972 112
497 3300006871 Ga0075434_102479628 Ga0075434_1024796282 112
498 3300006880 Ga0075429_100000239 Ga0075429_10000023918 112
499 3300006880 Ga0075429_100078813 Ga0075429_1000788133 112
500 3300006880 Ga0075429_100547908 Ga0075429_1005479082 112
501 3300006881 Ga0068865_100021459 Ga0068865_1000214593 112
502 3300006881 Ga0068865_100047317 Ga0068865_1000473174 112
503 3300006881 Ga0068865_100077509 Ga0068865_1000775092 112
504 3300006931 Ga0097620_100001738 Ga0097620_10000173812 112
505 3300006931 Ga0097620_100014581 Ga0097620_1000145812 112
506 3300006931 Ga0097620_100348981 Ga0097620_1003489812 112
507 3300006931 Ga0097620_101219883 Ga0097620_1012198832 112
508 3300007788 Ga0099795_10072995 Ga0099795_100729952 112
509 3300009011 Ga0105251_10130464 Ga0105251_101304642 112
510 3300009011 Ga0105251_10231878 Ga0105251_102318781 112
511 3300009036 Ga0105244_10188843 Ga0105244_101888432 112
512 3300009036 Ga0105244_10286329 Ga0105244_102863292 112
513 3300009093 Ga0105240_11790938 Ga0105240_117909382 112
514 3300009093 Ga0105240_12392781 Ga0105240_123927811 112
515 3300009094 Ga0111539_11012605 Ga0111539_110126051 112
516 3300009094 Ga0111539_11035932 Ga0111539_110359322 112
517 3300009094 Ga0111539_12626146 Ga0111539_126261462 112
518 3300009098 Ga0105245_10002148 Ga0105245_1000214815 112
519 3300009098 Ga0105245_10023039 Ga0105245_100230395 112
520 3300009098 Ga0105245_10094083 Ga0105245_100940832 112
521 3300009098 Ga0105245_10125055 Ga0105245_101250552 112
522 3300009098 Ga0105245_10292460 Ga0105245_102924603 112
523 3300009098 Ga0105245_10329873 Ga0105245_103298732 112
524 3300009098 Ga0105245_10453784 Ga0105245_104537842 112
525 3300009098 Ga0105245_12359924 Ga0105245_123599241 112
526 3300009098 Ga0105245_13201277 Ga0105245_132012771 112
527 3300009101 Ga0105247_10000910 Ga0105247_1000091014 112
528 3300009101 Ga0105247_10001417 Ga0105247_1000141710 112
529 3300009101 Ga0105247_10041632 Ga0105247_100416323 112
530 3300009101 Ga0105247_10549785 Ga0105247_105497852 112
531 3300009147 Ga0114129_10000630 Ga0114129_1000063019 112
532 3300009147 Ga0114129_10015455 Ga0114129_100154552 112
533 3300009147 Ga0114129_10447398 Ga0114129_104473982 112
534 3300009147 Ga0114129_11391354 Ga0114129_113913542 112
535 3300009148 Ga0105243_10001698 Ga0105243_100016982 112
536 3300009148 Ga0105243_10173179 Ga0105243_101731792 112
537 3300009148 Ga0105243_10188246 Ga0105243_101882462 112
538 3300009148 Ga0105243_10857420 Ga0105243_108574202 112
539 3300009148 Ga0105243_10994948 Ga0105243_109949481 112
540 3300009174 Ga0105241_10110243 Ga0105241_101102432 112
541 3300009174 Ga0105241_11308274 Ga0105241_113082741 112
542 3300009176 Ga0105242_10001751 Ga0105242_100017515 112
543 3300009176 Ga0105242_10025438 Ga0105242_100254385 112
544 3300009176 Ga0105242_10617550 Ga0105242_106175501 112
545 3300009176 Ga0105242_10620977 Ga0105242_106209772 112
546 3300009176 Ga0105242_11130143 Ga0105242_111301432 112
547 3300009176 Ga0105242_11319185 Ga0105242_113191852 112
548 3300009177 Ga0105248_10000074 Ga0105248_1000007484 112
549 3300009177 Ga0105248_10000866 Ga0105248_1000086622 112
550 3300009177 Ga0105248_10002067 Ga0105248_1000206718 112
551 3300009177 Ga0105248_10086446 Ga0105248_100864463 112
552 3300009177 Ga0105248_10974345 Ga0105248_109743452 112
553 3300009177 Ga0105248_11077002 Ga0105248_110770021 112
554 3300009545 Ga0105237_10008588 Ga0105237_100085885 112
555 3300009545 Ga0105237_10022604 Ga0105237_100226042 112
556 3300009545 Ga0105237_10047568 Ga0105237_100475682 112
557 3300009545 Ga0105237_10181051 Ga0105237_101810512 112
558 3300009545 Ga0105237_10553168 Ga0105237_105531682 112
559 3300009551 Ga0105238_10115132 Ga0105238_101151322 112
560 3300009551 Ga0105238_10146536 Ga0105238_101465363 112
561 3300009551 Ga0105238_10617448 Ga0105238_106174482 112
562 3300009551 Ga0105238_10819260 Ga0105238_108192602 112
563 3300009551 Ga0105238_11383414 Ga0105238_113834141 112
564 3300009553 Ga0105249_10000011 Ga0105249_10000011221 112
565 3300009553 Ga0105249_10087908 Ga0105249_100879082 112
566 3300009553 Ga0105249_10843870 Ga0105249_108438702 112
567 3300009553 Ga0105249_10928112 Ga0105249_109281122 112
568 3300009553 Ga0105249_11173766 Ga0105249_111737662 112
569 3300009982 Ga0105147_107378 Ga0105147_1073782 112
570 3300010159 Ga0099796_10067410 Ga0099796_100674101 112
571 3300010375 Ga0105239_10004818 Ga0105239_100048184 112
572 3300010375 Ga0105239_10104944 Ga0105239_101049442 112
573 3300010375 Ga0105239_10164146 Ga0105239_101641462 112
574 3300010375 Ga0105239_10279132 Ga0105239_102791322 112
575 3300010375 Ga0105239_10307743 Ga0105239_103077432 112
576 3300010375 Ga0105239_10420470 Ga0105239_104204702 112
577 3300010375 Ga0105239_12366326 Ga0105239_123663262 112
578 3300011119 Ga0105246_10086450 Ga0105246_100864502 112
579 3300011119 Ga0105246_10295793 Ga0105246_102957932 112
580 3300011119 Ga0105246_10413595 Ga0105246_104135952 112
581 3300011119 Ga0105246_10635357 Ga0105246_106353572 112
582 3300011119 Ga0105246_10700431 Ga0105246_107004312 112
583 3300011119 Ga0105246_11978218 Ga0105246_119782182 112
584 3300012481 Ga0157320_1005717 Ga0157320_10057172 112
585 3300012482 Ga0157318_1018289 Ga0157318_10182892 112
586 3300012482 Ga0157318_1026463 Ga0157318_10264631 112
587 3300012490 Ga0157322_1008065 Ga0157322_10080652 112
588 3300012502 Ga0157347_1008962 Ga0157347_10089622 112
589 3300012502 Ga0157347_1024943 Ga0157347_10249431 112
590 3300012503 Ga0157313_1002533 Ga0157313_10025332 112
591 3300012507 Ga0157342_1067772 Ga0157342_10677722 112
592 3300012508 Ga0157315_1004046 Ga0157315_10040463 112
593 3300012510 Ga0157316_1021982 Ga0157316_10219822 112
594 3300012512 Ga0157327_1053083 Ga0157327_10530832 112
595 3300012515 Ga0157338_1077613 Ga0157338_10776132 112
596 3300013102 Ga0157371_10102336 Ga0157371_101023362 112
597 3300013102 Ga0157371_10344503 Ga0157371_103445032 112
598 3300013105 Ga0157369_10220113 Ga0157369_102201131 112
599 3300013105 Ga0157369_10302992 Ga0157369_103029922 112
600 3300013105 Ga0157369_10408074 Ga0157369_104080742 112
601 3300013105 Ga0157369_10414438 Ga0157369_104144382 112
602 3300013296 Ga0157374_10390538 Ga0157374_103905382 112
603 3300013296 Ga0157374_12613147 Ga0157374_126131472 112
604 3300013297 Ga0157378_10003428 Ga0157378_100034285 112
605 3300013297 Ga0157378_10044356 Ga0157378_100443562 112
606 3300013297 Ga0157378_10101291 Ga0157378_101012913 112
607 3300013297 Ga0157378_10383218 Ga0157378_103832182 112
608 3300013297 Ga0157378_10406819 Ga0157378_104068192 112
609 3300013297 Ga0157378_11529488 Ga0157378_115294882 112
610 3300013306 Ga0163162_10028193 Ga0163162_100281932 112
611 3300013306 Ga0163162_10109815 Ga0163162_101098152 112
612 3300013306 Ga0163162_10116452 Ga0163162_101164522 112
613 3300013306 Ga0163162_10127076 Ga0163162_101270763 112
614 3300013306 Ga0163162_10494571 Ga0163162_104945712 112
615 3300013306 Ga0163162_11284467 Ga0163162_112844672 112
616 3300013306 Ga0163162_11467082 Ga0163162_114670822 112
617 3300013306 Ga0163162_13040623 Ga0163162_130406231 112
618 3300013307 Ga0157372_10004262 Ga0157372_100042624 112
619 3300013307 Ga0157372_10489765 Ga0157372_104897652 112
620 3300013307 Ga0157372_10652866 Ga0157372_106528663 112
621 3300013307 Ga0157372_11433589 Ga0157372_114335891 112
622 3300013308 Ga0157375_10005386 Ga0157375_1000538610 112
623 3300013308 Ga0157375_10256587 Ga0157375_102565872 112
624 3300013308 Ga0157375_10324202 Ga0157375_103242022 112
625 3300013308 Ga0157375_10579032 Ga0157375_105790322 112
626 3300013308 Ga0157375_10630115 Ga0157375_106301152 112
627 3300013308 Ga0157375_10880256 Ga0157375_108802561 112
628 3300013308 Ga0157375_11101865 Ga0157375_111018652 112
629 3300013308 Ga0157375_11159459 Ga0157375_111594592 112
630 3300013308 Ga0157375_11255987 Ga0157375_112559871 112
631 3300013308 Ga0157375_11944175 Ga0157375_119441752 112
632 3300014325 Ga0163163_10023167 Ga0163163_100231674 112
633 3300014325 Ga0163163_10087543 Ga0163163_100875432 112
634 3300014325 Ga0163163_10122780 Ga0163163_101227802 112
635 3300014325 Ga0163163_10347754 Ga0163163_103477542 112
636 3300014325 Ga0163163_11293184 Ga0163163_112931842 112
637 3300014325 Ga0163163_11861827 Ga0163163_118618272 112
638 3300014326 Ga0157380_10000237 Ga0157380_1000023732 112
639 3300014326 Ga0157380_10075401 Ga0157380_100754012 112
640 3300014326 Ga0157380_10366619 Ga0157380_103666193 112
641 3300014326 Ga0157380_11730448 Ga0157380_117304482 112
642 3300014497 Ga0182008_10077616 Ga0182008_100776161 112
643 3300014497 Ga0182008_10148238 Ga0182008_101482382 112
644 3300014497 Ga0182008_10182726 Ga0182008_101827262 112
645 3300014497 Ga0182008_10385361 Ga0182008_103853612 112
646 3300014745 Ga0157377_10112781 Ga0157377_101127812 112
647 3300014745 Ga0157377_10192958 Ga0157377_101929582 112
648 3300014745 Ga0157377_11611190 Ga0157377_116111901 112
649 3300014968 Ga0157379_10007925 Ga0157379_100079252 112
650 3300014968 Ga0157379_10074991 Ga0157379_100749912 112
651 3300014968 Ga0157379_10144817 Ga0157379_101448173 112
652 3300014968 Ga0157379_10409500 Ga0157379_104095002 112
653 3300014969 Ga0157376_10188605 Ga0157376_101886052 112
654 3300014969 Ga0157376_11133278 Ga0157376_111332781 112
655 3300014969 Ga0157376_11866897 Ga0157376_118668971 112
656 3300015265 Ga0182005_1256412 Ga0182005_12564122 112
657 3300017792 Ga0163161_10065853 Ga0163161_100658532 112
658 3300017792 Ga0163161_10142806 Ga0163161_101428062 112
659 3300017792 Ga0163161_10404017 Ga0163161_104040172 112
660 3300017792 Ga0163161_11023095 Ga0163161_110230952 112
661 3300017792 Ga0163161_11557081 Ga0163161_115570811 112
662 3300020069 Ga0197907_11426222 Ga0197907_114262222 112
663 3300020070 Ga0206356_10240197 Ga0206356_102401972 112
664 3300020075 Ga0206349_1178622 Ga0206349_11786222 112
665 3300020077 Ga0206351_10681403 Ga0206351_106814032 112
666 3300020078 Ga0206352_11063218 Ga0206352_110632181 112
667 3300020080 Ga0206350_11033110 Ga0206350_110331101 112
668 3300020081 Ga0206354_10335322 Ga0206354_103353221 112
669 3300020082 Ga0206353_11291616 Ga0206353_112916162 112
670 3300020082 Ga0206353_11308277 Ga0206353_113082772 112
671 3300021361 Ga0213872_10459463 Ga0213872_104594631 112
672 3300021384 Ga0213876_10021975 Ga0213876_100219752 112
673 3300021384 Ga0213876_10026469 Ga0213876_100264692 112
674 3300021388 Ga0213875_10018987 Ga0213875_100189872 112
675 3300021388 Ga0213875_10024212 Ga0213875_100242122 112
676 3300022467 Ga0224712_10518931 Ga0224712_105189311 112
677 3300025273 Ga0209673_1004406 Ga0209673_10044065 112
678 3300025303 Ga0209051_1000075 Ga0209051_100007557 112
679 3300025303 Ga0209051_1001588 Ga0209051_10015884 112
680 3300025303 Ga0209051_1002744 Ga0209051_10027444 112
681 3300025303 Ga0209051_1004012 Ga0209051_10040122 112
682 3300025303 Ga0209051_1025031 Ga0209051_10250312 112
683 3300025321 Ga0207656_10118256 Ga0207656_101182562 112
684 3300025321 Ga0207656_10291560 Ga0207656_102915602 112
685 3300025321 Ga0207656_10304253 Ga0207656_103042532 112
686 3300025735 Ga0207713_1247300 Ga0207713_12473001 112
687 3300025893 Ga0207682_10202389 Ga0207682_102023892 112
688 3300025898 Ga0207692_10000317 Ga0207692_100003173 112
689 3300025898 Ga0207692_10000331 Ga0207692_1000033110 112
690 3300025898 Ga0207692_10074299 Ga0207692_100742991 112
691 3300025898 Ga0207692_10297822 Ga0207692_102978222 112
692 3300025898 Ga0207692_10614552 Ga0207692_106145521 112
693 3300025899 Ga0207642_10000160 Ga0207642_1000016010 112
694 3300025899 Ga0207642_10110363 Ga0207642_101103632 112
695 3300025900 Ga0207710_10000014 Ga0207710_100000144 112
696 3300025900 Ga0207710_10041076 Ga0207710_100410762 112
697 3300025900 Ga0207710_10063619 Ga0207710_100636192 112
698 3300025900 Ga0207710_10607791 Ga0207710_106077911 112
699 3300025901 Ga0207688_10000631 Ga0207688_1000063117 112
700 3300025901 Ga0207688_10006546 Ga0207688_100065462 112
701 3300025901 Ga0207688_10222871 Ga0207688_102228712 112
702 3300025901 Ga0207688_10769766 Ga0207688_107697661 112
703 3300025903 Ga0207680_10026510 Ga0207680_100265103 112
704 3300025903 Ga0207680_10120901 Ga0207680_101209012 112
705 3300025903 Ga0207680_10479348 Ga0207680_104793482 112
706 3300025903 Ga0207680_11176577 Ga0207680_111765771 112
707 3300025904 Ga0207647_10017510 Ga0207647_100175103 112
708 3300025904 Ga0207647_10086228 Ga0207647_100862282 112
709 3300025905 Ga0207685_10004014 Ga0207685_100040143 112
710 3300025905 Ga0207685_10109333 Ga0207685_101093332 112
711 3300025905 Ga0207685_10843237 Ga0207685_108432372 112
712 3300025906 Ga0207699_10065031 Ga0207699_100650312 112
713 3300025907 Ga0207645_10017899 Ga0207645_100178993 112
714 3300025907 Ga0207645_10021140 Ga0207645_100211403 112
715 3300025907 Ga0207645_10049724 Ga0207645_100497241 112
716 3300025908 Ga0207643_10045122 Ga0207643_100451222 112
717 3300025908 Ga0207643_10051420 Ga0207643_100514203 112
718 3300025908 Ga0207643_10746686 Ga0207643_107466862 112
719 3300025909 Ga0207705_10072083 Ga0207705_100720831 112
720 3300025910 Ga0207684_10198488 Ga0207684_101984882 112
721 3300025911 Ga0207654_10136085 Ga0207654_101360853 112
722 3300025911 Ga0207654_11135893 Ga0207654_111358931 112
723 3300025912 Ga0207707_10135543 Ga0207707_101355431 112
724 3300025914 Ga0207671_10010740 Ga0207671_100107404 112
725 3300025914 Ga0207671_10013353 Ga0207671_100133532 112
726 3300025914 Ga0207671_10028935 Ga0207671_100289352 112
727 3300025914 Ga0207671_10088374 Ga0207671_100883742 112
728 3300025914 Ga0207671_10166969 Ga0207671_101669692 112
729 3300025915 Ga0207693_10000049 Ga0207693_1000004996 112
730 3300025915 Ga0207693_10002617 Ga0207693_100026179 112
731 3300025915 Ga0207693_11176874 Ga0207693_111768741 112
732 3300025916 Ga0207663_10001494 Ga0207663_100014942 112
733 3300025916 Ga0207663_10035053 Ga0207663_100350532 112
734 3300025916 Ga0207663_11083633 Ga0207663_110836332 112
735 3300025917 Ga0207660_10702816 Ga0207660_107028162 112
736 3300025917 Ga0207660_10870080 Ga0207660_108700802 112
737 3300025918 Ga0207662_10260711 Ga0207662_102607112 112
738 3300025918 Ga0207662_10260758 Ga0207662_102607582 112
739 3300025919 Ga0207657_10350824 Ga0207657_103508242 112
740 3300025920 Ga0207649_10066837 Ga0207649_100668372 112
741 3300025920 Ga0207649_10140923 Ga0207649_101409232 112
742 3300025920 Ga0207649_10522217 Ga0207649_105222172 112
743 3300025920 Ga0207649_11230732 Ga0207649_112307321 112
744 3300025921 Ga0207652_10403971 Ga0207652_104039712 112
745 3300025922 Ga0207646_10400379 Ga0207646_104003792 112
746 3300025923 Ga0207681_10028077 Ga0207681_100280773 112
747 3300025923 Ga0207681_10035110 Ga0207681_100351103 112
748 3300025923 Ga0207681_10050022 Ga0207681_100500222 112
749 3300025923 Ga0207681_10121637 Ga0207681_101216372 112
750 3300025923 Ga0207681_10667987 Ga0207681_106679871 112
751 3300025924 Ga0207694_10215270 Ga0207694_102152702 112
752 3300025924 Ga0207694_10955787 Ga0207694_109557871 112
753 3300025924 Ga0207694_11105258 Ga0207694_111052582 112
754 3300025925 Ga0207650_10163822 Ga0207650_101638222 112
755 3300025925 Ga0207650_10325514 Ga0207650_103255142 112
756 3300025925 Ga0207650_10402537 Ga0207650_104025372 112
757 3300025925 Ga0207650_11365842 Ga0207650_113658422 112
758 3300025926 Ga0207659_10009210 Ga0207659_100092104 112
759 3300025926 Ga0207659_10715109 Ga0207659_107151092 112
760 3300025926 Ga0207659_10851646 Ga0207659_108516462 112
761 3300025927 Ga0207687_10001708 Ga0207687_100017082 112
762 3300025927 Ga0207687_10026892 Ga0207687_100268922 112
763 3300025927 Ga0207687_10080102 Ga0207687_100801022 112
764 3300025927 Ga0207687_10212439 Ga0207687_102124392 112
765 3300025927 Ga0207687_11526881 Ga0207687_115268811 112
766 3300025928 Ga0207700_10609805 Ga0207700_106098052 112
767 3300025928 Ga0207700_11037360 Ga0207700_110373602 112
768 3300025928 Ga0207700_11056046 Ga0207700_110560462 112
769 3300025929 Ga0207664_10306627 Ga0207664_103066272 112
770 3300025931 Ga0207644_10053801 Ga0207644_100538012 112
771 3300025931 Ga0207644_10056619 Ga0207644_100566193 112
772 3300025931 Ga0207644_10096839 Ga0207644_100968392 112
773 3300025931 Ga0207644_10191945 Ga0207644_101919451 112
774 3300025931 Ga0207644_10314359 Ga0207644_103143592 112
775 3300025931 Ga0207644_11006581 Ga0207644_110065812 112
776 3300025932 Ga0207690_10011725 Ga0207690_100117252 112
777 3300025932 Ga0207690_10048262 Ga0207690_100482623 112
778 3300025932 Ga0207690_10150184 Ga0207690_101501842 112
779 3300025932 Ga0207690_11318502 Ga0207690_113185022 112
780 3300025933 Ga0207706_10002210 Ga0207706_1000221010 112
781 3300025933 Ga0207706_10009194 Ga0207706_100091943 112
782 3300025933 Ga0207706_10031561 Ga0207706_100315612 112
783 3300025933 Ga0207706_10049657 Ga0207706_100496573 112
784 3300025934 Ga0207686_10020608 Ga0207686_100206083 112
785 3300025935 Ga0207709_10017986 Ga0207709_100179863 112
786 3300025935 Ga0207709_10033999 Ga0207709_100339992 112
787 3300025935 Ga0207709_10372371 Ga0207709_103723712 112
788 3300025935 Ga0207709_10434132 Ga0207709_104341322 112
789 3300025935 Ga0207709_10723642 Ga0207709_107236421 112
790 3300025936 Ga0207670_10181052 Ga0207670_101810522 112
791 3300025936 Ga0207670_10336751 Ga0207670_103367511 112
792 3300025937 Ga0207669_10001461 Ga0207669_1000146110 112
793 3300025937 Ga0207669_10158704 Ga0207669_101587042 112
794 3300025937 Ga0207669_10675941 Ga0207669_106759411 112
795 3300025937 Ga0207669_11203348 Ga0207669_112033482 112
796 3300025937 Ga0207669_11861913 Ga0207669_118619132 112
797 3300025938 Ga0207704_10008232 Ga0207704_100082322 112
798 3300025938 Ga0207704_10083613 Ga0207704_100836132 112
799 3300025938 Ga0207704_10155925 Ga0207704_101559252 112
800 3300025938 Ga0207704_10812929 Ga0207704_108129292 112
801 3300025938 Ga0207704_11888374 Ga0207704_118883741 112
802 3300025939 Ga0207665_10002483 Ga0207665_1000248310 112
803 3300025939 Ga0207665_10458147 Ga0207665_104581472 112
804 3300025940 Ga0207691_10021497 Ga0207691_100214973 112
805 3300025940 Ga0207691_10336033 Ga0207691_103360332 112
806 3300025941 Ga0207711_10000149 Ga0207711_1000014949 112
807 3300025941 Ga0207711_10000293 Ga0207711_1000029342 112
808 3300025941 Ga0207711_10034977 Ga0207711_100349772 112
809 3300025941 Ga0207711_10112403 Ga0207711_101124031 112
810 3300025941 Ga0207711_10707092 Ga0207711_107070922 112
811 3300025942 Ga0207689_10003988 Ga0207689_100039888 112
812 3300025942 Ga0207689_10010644 Ga0207689_100106445 112
813 3300025942 Ga0207689_10104793 Ga0207689_101047932 112
814 3300025942 Ga0207689_10395664 Ga0207689_103956643 112
815 3300025944 Ga0207661_10013648 Ga0207661_100136482 112
816 3300025944 Ga0207661_10265296 Ga0207661_102652963 112
817 3300025944 Ga0207661_10882081 Ga0207661_108820811 112
818 3300025944 Ga0207661_11022736 Ga0207661_110227362 112
819 3300025945 Ga0207679_10003180 Ga0207679_100031802 112
820 3300025945 Ga0207679_10984840 Ga0207679_109848402 112
821 3300025949 Ga0207667_10095620 Ga0207667_100956202 112
822 3300025949 Ga0207667_10344719 Ga0207667_103447192 112
823 3300025949 Ga0207667_10374246 Ga0207667_103742463 112
824 3300025960 Ga0207651_10413748 Ga0207651_104137482 112
825 3300025961 Ga0207712_10000020 Ga0207712_1000002058 112
826 3300025961 Ga0207712_10015240 Ga0207712_100152404 112
827 3300025961 Ga0207712_10024663 Ga0207712_100246634 112
828 3300025961 Ga0207712_10154120 Ga0207712_101541202 112
829 3300025961 Ga0207712_10550596 Ga0207712_105505962 112
830 3300025961 Ga0207712_10613393 Ga0207712_106133931 112
831 3300025961 Ga0207712_10761901 Ga0207712_107619011 112
832 3300025961 Ga0207712_11157655 Ga0207712_111576551 112
833 3300025961 Ga0207712_11163672 Ga0207712_111636722 112
834 3300025961 Ga0207712_11285413 Ga0207712_112854132 112
835 3300025972 Ga0207668_10001701 Ga0207668_1000170112 112
836 3300025972 Ga0207668_10025323 Ga0207668_100253232 112
837 3300025972 Ga0207668_10106388 Ga0207668_101063882 112
838 3300025972 Ga0207668_10130949 Ga0207668_101309493 112
839 3300025972 Ga0207668_11860640 Ga0207668_118606401 112
840 3300025981 Ga0207640_10002719 Ga0207640_100027195 112
841 3300025981 Ga0207640_10033289 Ga0207640_100332892 112
842 3300025981 Ga0207640_10093104 Ga0207640_100931042 112
843 3300025981 Ga0207640_10198158 Ga0207640_101981582 112
844 3300025981 Ga0207640_10435098 Ga0207640_104350982 112
845 3300025981 Ga0207640_10487843 Ga0207640_104878432 112
846 3300025986 Ga0207658_10000705 Ga0207658_1000070522 112
847 3300025986 Ga0207658_10002382 Ga0207658_100023824 112
848 3300025986 Ga0207658_10030696 Ga0207658_100306962 112
849 3300025986 Ga0207658_10098757 Ga0207658_100987572 112
850 3300025986 Ga0207658_10265555 Ga0207658_102655552 112
851 3300025986 Ga0207658_10382966 Ga0207658_103829661 112
852 3300026023 Ga0207677_10001547 Ga0207677_100015473 112
853 3300026023 Ga0207677_10005497 Ga0207677_100054973 112
854 3300026023 Ga0207677_10045643 Ga0207677_100456432 112
855 3300026023 Ga0207677_10086991 Ga0207677_100869911 112
856 3300026023 Ga0207677_12144642 Ga0207677_121446421 112
857 3300026035 Ga0207703_10009826 Ga0207703_100098264 112
858 3300026035 Ga0207703_10103837 Ga0207703_101038371 112
859 3300026035 Ga0207703_10140370 Ga0207703_101403703 112
860 3300026035 Ga0207703_10852250 Ga0207703_108522501 112
861 3300026035 Ga0207703_11137834 Ga0207703_111378341 112
862 3300026035 Ga0207703_11318081 Ga0207703_113180811 112
863 3300026041 Ga0207639_10000014 Ga0207639_1000001458 112
864 3300026041 Ga0207639_10182147 Ga0207639_101821472 112
865 3300026041 Ga0207639_10315920 Ga0207639_103159202 112
866 3300026041 Ga0207639_10359625 Ga0207639_103596252 112
867 3300026041 Ga0207639_11162585 Ga0207639_111625852 112
868 3300026067 Ga0207678_10004946 Ga0207678_100049462 112
869 3300026067 Ga0207678_10005360 Ga0207678_100053603 112
870 3300026067 Ga0207678_10006947 Ga0207678_100069477 112
871 3300026067 Ga0207678_10008339 Ga0207678_100083395 112
872 3300026067 Ga0207678_10016548 Ga0207678_100165486 112
873 3300026067 Ga0207678_10040316 Ga0207678_100403163 112
874 3300026067 Ga0207678_10256724 Ga0207678_102567241 112
875 3300026067 Ga0207678_10345147 Ga0207678_103451471 112
876 3300026067 Ga0207678_11214864 Ga0207678_112148642 112
877 3300026067 Ga0207678_11604696 Ga0207678_116046962 112
878 3300026075 Ga0207708_10000411 Ga0207708_1000041130 112
879 3300026075 Ga0207708_10009167 Ga0207708_100091674 112
880 3300026075 Ga0207708_10051450 Ga0207708_100514503 112
881 3300026075 Ga0207708_10287701 Ga0207708_102877012 112
882 3300026075 Ga0207708_10399738 Ga0207708_103997382 112
883 3300026075 Ga0207708_11559991 Ga0207708_115599912 112
884 3300026078 Ga0207702_10088248 Ga0207702_100882482 112
885 3300026078 Ga0207702_10333492 Ga0207702_103334922 112
886 3300026078 Ga0207702_11874663 Ga0207702_118746631 112
887 3300026078 Ga0207702_12007634 Ga0207702_120076342 112
888 3300026088 Ga0207641_10000156 Ga0207641_1000015666 112
889 3300026088 Ga0207641_10005640 Ga0207641_100056402 112
890 3300026088 Ga0207641_10074251 Ga0207641_100742512 112
891 3300026088 Ga0207641_10388903 Ga0207641_103889032 112
892 3300026088 Ga0207641_10447763 Ga0207641_104477631 112
893 3300026088 Ga0207641_10510873 Ga0207641_105108732 112
894 3300026088 Ga0207641_10811149 Ga0207641_108111491 112
895 3300026089 Ga0207648_10000187 Ga0207648_1000018734 112
896 3300026089 Ga0207648_10021171 Ga0207648_100211712 112
897 3300026089 Ga0207648_10412054 Ga0207648_104120542 112
898 3300026089 Ga0207648_11410953 Ga0207648_114109532 112
899 3300026095 Ga0207676_10119057 Ga0207676_101190572 112
900 3300026095 Ga0207676_10257388 Ga0207676_102573882 112
901 3300026095 Ga0207676_10289527 Ga0207676_102895272 112
902 3300026095 Ga0207676_10453416 Ga0207676_104534161 112
903 3300026095 Ga0207676_10523843 Ga0207676_105238432 112
904 3300026116 Ga0207674_10157842 Ga0207674_101578423 112
905 3300026116 Ga0207674_10491455 Ga0207674_104914552 112
906 3300026116 Ga0207674_11351235 Ga0207674_113512352 112
907 3300026118 Ga0207675_100007266 Ga0207675_1000072662 112
908 3300026118 Ga0207675_100037100 Ga0207675_1000371003 112
909 3300026118 Ga0207675_100040821 Ga0207675_1000408213 112
910 3300026118 Ga0207675_100112620 Ga0207675_1001126203 112
911 3300026118 Ga0207675_100271099 Ga0207675_1002710992 112
912 3300026118 Ga0207675_100763740 Ga0207675_1007637402 112
913 3300026118 Ga0207675_102284424 Ga0207675_1022844241 112
914 3300026121 Ga0207683_10000197 Ga0207683_1000019738 112
915 3300026121 Ga0207683_10018813 Ga0207683_100188132 112
916 3300026121 Ga0207683_10044768 Ga0207683_100447682 112
917 3300026121 Ga0207683_10491606 Ga0207683_104916062 112
918 3300026121 Ga0207683_10715564 Ga0207683_107155642 112
919 3300026121 Ga0207683_10737800 Ga0207683_107378002 112
920 3300026121 Ga0207683_11255125 Ga0207683_112551252 112
921 3300026142 Ga0207698_10052130 Ga0207698_100521302 112
922 3300026142 Ga0207698_10882532 Ga0207698_108825321 112
923 3300027512 Ga0209179_1042011 Ga0209179_10420112 112
924 3300027866 Ga0209813_10022207 Ga0209813_100222072 112
925 3300027866 Ga0209813_10085630 Ga0209813_100856302 112
926 3300027866 Ga0209813_10092942 Ga0209813_100929422 112
927 3300027907 Ga0207428_10214819 Ga0207428_102148192 112
928 3300027907 Ga0207428_11004476 Ga0207428_110044761 112
929 3300028379 Ga0268266_10000790 Ga0268266_1000079022 112
930 3300028379 Ga0268266_10004113 Ga0268266_100041137 112
931 3300028379 Ga0268266_10005771 Ga0268266_1000577110 112
932 3300028379 Ga0268266_10010049 Ga0268266_100100495 112
933 3300028379 Ga0268266_10039707 Ga0268266_100397074 112
934 3300028379 Ga0268266_10088855 Ga0268266_100888552 112
935 3300028379 Ga0268266_10163125 Ga0268266_101631252 112
936 3300028379 Ga0268266_10217416 Ga0268266_102174162 112
937 3300028379 Ga0268266_10293212 Ga0268266_102932122 112
938 3300028379 Ga0268266_10293327 Ga0268266_102933272 112
939 3300028379 Ga0268266_10473582 Ga0268266_104735821 112
940 3300028380 Ga0268265_10000004 Ga0268265_10000004397 112
941 3300028380 Ga0268265_10002855 Ga0268265_1000285510 112
942 3300028380 Ga0268265_10016518 Ga0268265_100165182 112
943 3300028380 Ga0268265_10396222 Ga0268265_103962222 112
944 3300028380 Ga0268265_10493407 Ga0268265_104934072 112
945 3300028380 Ga0268265_10987079 Ga0268265_109870792 112
946 3300028380 Ga0268265_11299897 Ga0268265_112998971 112
947 3300028381 Ga0268264_10000024 Ga0268264_10000024382 112
948 3300028381 Ga0268264_10016896 Ga0268264_100168962 112
949 3300028381 Ga0268264_10024451 Ga0268264_100244513 112
950 3300028381 Ga0268264_10029708 Ga0268264_100297083 112
951 3300028381 Ga0268264_10163812 Ga0268264_101638122 112
952 3300028381 Ga0268264_10294835 Ga0268264_102948352 112
953 3300028381 Ga0268264_10298094 Ga0268264_102980942 112
954 3300028381 Ga0268264_10371595 Ga0268264_103715952 112
955 3300028794 Ga0307515_10204607 Ga0307515_102046071 112
956 3300031240 Ga0265320_10048049 Ga0265320_100480493 112
957 3300031251 Ga0265327_10002454 Ga0265327_1000245416 112
958 3300031456 Ga0307513_10037955 Ga0307513_100379555 112
959 3300031456 Ga0307513_10055057 Ga0307513_100550572 112
960 3300031548 Ga0307408_101961418 Ga0307408_1019614181 112
961 3300031595 Ga0265313_10098090 Ga0265313_100980901 112
962 3300031616 Ga0307508_10156965 Ga0307508_101569652 112
963 3300031616 Ga0307508_10703720 Ga0307508_107037202 112
964 3300031665 Ga0316575_10007335 Ga0316575_100073353 112
965 3300031665 Ga0316575_10007876 Ga0316575_100078763 112
966 3300031691 Ga0316579_10008965 Ga0316579_100089653 112
967 3300031691 Ga0316579_10031451 Ga0316579_100314512 112
968 3300031691 Ga0316579_10043581 Ga0316579_100435812 112
969 3300031691 Ga0316579_10061252 Ga0316579_100612523 112
970 3300031711 Ga0265314_10169200 Ga0265314_101692003 112
971 3300031727 Ga0316576_10000398 Ga0316576_100003982 112
972 3300031727 Ga0316576_10029666 Ga0316576_100296662 112
973 3300031728 Ga0316578_10058753 Ga0316578_100587532 112
974 3300031728 Ga0316578_10132299 Ga0316578_101322992 112
975 3300031728 Ga0316578_10253691 Ga0316578_102536912 112
976 3300031733 Ga0316577_10001959 Ga0316577_100019594 112
977 3300031733 Ga0316577_10049367 Ga0316577_100493672 112
978 3300031733 Ga0316577_10054599 Ga0316577_100545991 112
979 3300031733 Ga0316577_10249605 Ga0316577_102496052 112
980 3300031733 Ga0316577_10426598 Ga0316577_104265981 112
981 3300031733 Ga0316577_10524821 Ga0316577_105248211 112
982 3300031824 Ga0307413_10052519 Ga0307413_100525192 112
983 3300031824 Ga0307413_10116419 Ga0307413_101164192 112
984 3300031824 Ga0307413_10365562 Ga0307413_103655622 112
985 3300031824 Ga0307413_10466053 Ga0307413_104660532 112
986 3300031824 Ga0307413_11255222 Ga0307413_112552222 112
987 3300031852 Ga0307410_10016305 Ga0307410_100163052 112
988 3300031852 Ga0307410_10624192 Ga0307410_106241922 112
989 3300031852 Ga0307410_11018881 Ga0307410_110188812 112
990 3300031852 Ga0307410_11380185 Ga0307410_113801851 112
991 3300031852 Ga0307410_11800009 Ga0307410_118000091 112
992 3300031889 Ga0326468_10011879 Ga0326468_100118792 112
993 3300031889 Ga0326468_10016670 Ga0326468_100166702 112
994 3300031901 Ga0307406_10353254 Ga0307406_103532542 112
995 3300031901 Ga0307406_12072545 Ga0307406_120725452 112
996 3300031903 Ga0307407_10048718 Ga0307407_100487182 112
997 3300031903 Ga0307407_10415751 Ga0307407_104157512 112
998 3300031903 Ga0307407_11407658 Ga0307407_114076581 112
999 3300031911 Ga0307412_10811513 Ga0307412_108115132 112
1000 3300031911 Ga0307412_11859020 Ga0307412_118590201 112
1001 3300031995 Ga0307409_100032570 Ga0307409_1000325702 112
1002 3300031995 Ga0307409_100441735 Ga0307409_1004417351 112
1003 3300031995 Ga0307409_100774939 Ga0307409_1007749392 112
1004 3300031995 Ga0307409_101183221 Ga0307409_1011832212 112
1005 3300031995 Ga0307409_102325683 Ga0307409_1023256832 112
1006 3300032002 Ga0307416_100390565 Ga0307416_1003905652 112
1007 3300032002 Ga0307416_100746841 Ga0307416_1007468412 112
1008 3300032002 Ga0307416_101262981 Ga0307416_1012629812 112
1009 3300032002 Ga0307416_101331958 Ga0307416_1013319581 112
1010 3300032004 Ga0307414_10214447 Ga0307414_102144472 112
1011 3300032004 Ga0307414_10743877 Ga0307414_107438771 112
1012 3300032004 Ga0307414_11012852 Ga0307414_110128522 112
1013 3300032004 Ga0307414_11391166 Ga0307414_113911662 112
1014 3300032004 Ga0307414_11899485 Ga0307414_118994852 112
1015 3300032005 Ga0307411_10442897 Ga0307411_104428972 112
1016 3300032005 Ga0307411_10811491 Ga0307411_108114911 112
1017 3300032126 Ga0307415_100045746 Ga0307415_1000457462 112
1018 3300032126 Ga0307415_100163448 Ga0307415_1001634481 112
1019 3300032126 Ga0307415_100374808 Ga0307415_1003748082 112
1020 3300032126 Ga0307415_100392103 Ga0307415_1003921032 112
1021 3300032126 Ga0307415_100486258 Ga0307415_1004862582 112
1022 3300032126 Ga0307415_101306970 Ga0307415_1013069701 112
1023 3300032133 Ga0316583_10069374 Ga0316583_100693741 112
1024 3300032137 Ga0316585_10000902 Ga0316585_100009022 112
1025 3300032137 Ga0316585_10020401 Ga0316585_100204013 112
1026 3300032137 Ga0316585_10038286 Ga0316585_100382861 112
1027 3300032139 Ga0316580_10002058 Ga0316580_100020583 112
1028 3300032139 Ga0316580_10284596 Ga0316580_102845961 112
1029 3300033524 Ga0316592_1008409 Ga0316592_10084092 112
1030 3300033524 Ga0316592_1036293 Ga0316592_10362931 112
1031 3300034817 Ga0373948_0073184 Ga0373948_0073184_255_602 112
1032 3300035084 Ga0373928_0042360 Ga0373928_0042360_363_710 112
1033 3300035091 Ga0373951_0042569 Ga0373951_0042569_418_765 112
1034 3300035112 Ga0373932_0010605 Ga0373932_0010605_1185_1526 112
1035 3300035115 Ga0373941_0093946 Ga0373941_0093946_421_768 112
1036 3300035119 Ga0373956_0002594 Ga0373956_0002594_3761_4099 112
1037 3300035119 Ga0373956_0058148 Ga0373956_0058148_93_431 112
1038 3300035120 Ga0373957_0013160 Ga0373957_0013160_781_1119 112
1039 3300035171 Ga0373946_0071724 Ga0373946_0071724_17_355 112
1040 3300035207 Ga0373942_0035245 Ga0373942_0035245_941_1279 112
1041 3300035242 Ga0373962_0015861 Ga0373962_0015861_31_378 112
1042 3300035242 Ga0373962_0023794 Ga0373962_0023794_128_475 112
1043 3300035242 Ga0373962_0082484 Ga0373962_0082484_388_726 112
1044 3300035398 Ga0316574_0024519 Ga0316574_0024519_303_641 112
1045 3300035398 Ga0316574_0044952 Ga0316574_0044952_2238_2576 112
1046 3300035398 Ga0316574_0095991 Ga0316574_0095991_859_1197 112
1047 3300035691 Ga0373931_0000708 Ga0373931_0000708_8905_9246 112
1048 3300035691 Ga0373931_0019136 Ga0373931_0019136_2606_2953 112
1049 3300035691 Ga0373931_0073314 Ga0373931_0073314_217_555 112
1050 3300035691 Ga0373931_0211085 Ga0373931_0211085_129_467 112
1051 3300036647 Ga0316582_0001228 Ga0316582_0001228_8932_9270 112
1052 3300036647 Ga0316582_0024357 Ga0316582_0024357_878_1216 112
1053 3300036647 Ga0316582_0050531 Ga0316582_0050531_1550_1888 112
1054 3300036647 Ga0316582_0315653 Ga0316582_0315653_338_676 112
1055 3300036647 Ga0316582_0317346 Ga0316582_0317346_538_876 112
1056 3300036647 Ga0316582_0525276 Ga0316582_0525276_455_793 112
1057 3300036712 Ga0316584_0000275 Ga0316584_0000275_24021_24359 112
1058 3300036712 Ga0316584_0057027 Ga0316584_0057027_1139_1477 112
1059 3300036712 Ga0316584_0181441 Ga0316584_0181441_833_1171 112
1060 3300036712 Ga0316584_0235187 Ga0316584_0235187_193_531 112
1061 3300037471 Ga0395905_0194145 Ga0395905_0194145_1323_1667 112
1062 3300037588 Ga0316581_0007185 Ga0316581_0007185_566_904 112
1063 3300037588 Ga0316581_0044900 Ga0316581_0044900_748_1086 112
1064 3300037588 Ga0316581_0223521 Ga0316581_0223521_230_568 112
1065 3300037853 Ga0436364_0845355 Ga0436364_0845355_5261_5599 112
1066 3300037853 Ga0436364_1364710 Ga0436364_1364710_10228_10566 112
1067 3300038443 Ga0395901_1189580 Ga0395901_1189580_170_517 112
1068 3300038726 Ga0400490_36568 Ga0400490_36568_496_879 112
1069 3300039093 Ga0400489_06127 Ga0400489_06127_29402_29746 112
1070 3300039437 Ga0436365_0273886 Ga0436365_0273886_47_385 112
1071 3300039437 Ga0436365_0479579 Ga0436365_0479579_2916_3254 112
1072 3300039437 Ga0436365_0491830 Ga0436365_0491830_1955_2293 112
1073 3300039437 Ga0436365_1610385 Ga0436365_1610385_161_499 112
1074 3300039438 Ga0436360_0784050 Ga0436360_0784050_122_460 112
1075 3300039447 Ga0436361_0647117 Ga0436361_0647117_686_1024 112
1076 3300039450 Ga0436363_0646025 Ga0436363_0646025_18_356 112
1077 3300039450 Ga0436363_0709857 Ga0436363_0709857_607_945 112
1078 3300041410 Ga0439461_0001461 Ga0439461_0001461_2359_2697 112
1079 3300041410 Ga0439461_0012367 Ga0439461_0012367_840_1178 112
1080 3300041411 Ga0439466_0001133 Ga0439466_0001133_8763_9101 112
1081 3300041411 Ga0439466_0002368 Ga0439466_0002368_1243_1581 112
1082 3300041411 Ga0439466_0003153 Ga0439466_0003153_3857_4195 112
1083 3300041411 Ga0439466_0125687 Ga0439466_0125687_370_708 112
1084 3300041413 Ga0439465_0003067 Ga0439465_0003067_2577_2915 112
1085 3300041413 Ga0439465_0017485 Ga0439465_0017485_814_1152 112
1086 3300041413 Ga0439465_0023712 Ga0439465_0023712_168_506 112
1087 3300041413 Ga0439465_0027037 Ga0439465_0027037_88_426 112
1088 3300041413 Ga0439465_0108002 Ga0439465_0108002_467_805 112
1089 3300041413 Ga0439465_0109394 Ga0439465_0109394_208_546 112
1090 3300041413 Ga0439465_0432978 Ga0439465_0432978_131_469 112
1091 3300041451 Ga0451791_0802285 Ga0451791_0802285_45_383 112
1092 3300041452 Ga0451793_0498716 Ga0451793_0498716_1004_1342 112
1093 3300041452 Ga0451793_1359655 Ga0451793_1359655_229_567 112
1094 3300041453 Ga0451797_1349284 Ga0451797_1349284_78_416 112
1095 3300041456 Ga0451795_0233023 Ga0451795_0233023_205_543 112
1096 3300041456 Ga0451795_0796965 Ga0451795_0796965_1562_1900 112
1097 3300041456 Ga0451795_1668447 Ga0451795_1668447_372_710 112
1098 3300041460 Ga0451802_0010223 Ga0451802_0010223_80_418 112
1099 3300041460 Ga0451802_1569976 Ga0451802_1569976_96_452 112
1100 3300041460 Ga0451802_2096868 Ga0451802_2096868_267_605 112
1101 3300041463 Ga0451804_0358484 Ga0451804_0358484_175_516 112
1102 3300041486 Ga0451807_1978118 Ga0451807_1978118_425_763 112
1103 3300041491 Ga0451833_1185815 Ga0451833_1185815_30_368 112
1104 3300041498 Ga0451841_0562277 Ga0451841_0562277_265_603 112
1105 3300041498 Ga0451841_1380544 Ga0451841_1380544_87_425 112
1106 3300041501 Ga0451845_0708748 Ga0451845_0708748_105_443 112
1107 3300041505 Ga0451849_0162247 Ga0451849_0162247_52_390 112
1108 3300041507 Ga0451851_0045888 Ga0451851_0045888_12_350 112
1109 3300041507 Ga0451851_0380025 Ga0451851_0380025_335_673 112
1110 3300041511 Ga0451855_1824859 Ga0451855_1824859_180_518 112
1111 3300041512 Ga0451853_3405597 Ga0451853_3405597_777_1115 112
1112 3300041512 Ga0451853_3529090 Ga0451853_3529090_114_455 112
1113 3300041512 Ga0451853_3781773 Ga0451853_3781773_70_408 112
1114 3300041997 Ga0439431_0005209 Ga0439431_0005209_195_533 112
1115 3300041997 Ga0439431_0040675 Ga0439431_0040675_440_778 112
1116 3300042002 Ga0439442_013160 Ga0439442_013160_342_680 112
1117 3300042004 Ga0439445_0079224 Ga0439445_0079224_446_784 112
1118 3300042004 Ga0439445_0096996 Ga0439445_0096996_305_643 112
1119 3300042008 Ga0439450_202910 Ga0439450_202910_30_368 112
1120 3300042435 Ga0439434_0008501 Ga0439434_0008501_1704_2042 112
1121 3300042438 Ga0439459_0009839 Ga0439459_0009839_182_520 112
1122 3300042438 Ga0439459_0092127 Ga0439459_0092127_303_641 112
1123 3300042438 Ga0439459_0157966 Ga0439459_0157966_55_393 112
1124 3300042438 Ga0439459_0203983 Ga0439459_0203983_160_498 112
1125 3300042438 Ga0439459_0228813 Ga0439459_0228813_102_440 112
1126 3300042876 Ga0451577_0000214 Ga0451577_0000214_3598_3936 112
1127 3300042876 Ga0451577_0000245 Ga0451577_0000245_102131_102469 112
1128 3300042876 Ga0451577_0000397 Ga0451577_0000397_1693_2031 112
1129 3300042876 Ga0451577_0000657 Ga0451577_0000657_15566_15904 112
1130 3300042876 Ga0451577_0032106 Ga0451577_0032106_1020_1358 112
1131 3300042876 Ga0451577_0189510 Ga0451577_0189510_234_572 112
1132 3300042876 Ga0451577_0280691 Ga0451577_0280691_704_1042 112
1133 3300042993 Ga0439440_0244442 Ga0439440_0244442_192_530 112
1134 3300044656 Ga0466969_0543469 Ga0466969_0543469_27_368 112
1135 3300044658 Ga0466972_0001217 Ga0466972_0001217_5725_6063 112
1136 3300044658 Ga0466972_0019024 Ga0466972_0019024_2259_2597 112
1137 3300044658 Ga0466972_0053985 Ga0466972_0053985_436_783 112
1138 3300044658 Ga0466972_0122085 Ga0466972_0122085_121_468 112
1139 3300044658 Ga0466972_0260525 Ga0466972_0260525_419_757 112
1140 3300044658 Ga0466972_0628351 Ga0466972_0628351_13_351 112
1141 3300044673 Ga0453683_0206420 Ga0453683_0206420_256_594 112
1142 3300044673 Ga0453683_0215620 Ga0453683_0215620_598_1038 112
1143 3300044673 Ga0453683_0409559 Ga0453683_0409559_437_775 112
1144 3300044683 Ga0466965_0001800 Ga0466965_0001800_6092_6430 112
1145 3300044683 Ga0466965_0005062 Ga0466965_0005062_3820_4158 112
1146 3300044683 Ga0466965_0048842 Ga0466965_0048842_75_413 112
1147 3300044683 Ga0466965_0366997 Ga0466965_0366997_131_469 112
1148 3300044683 Ga0466965_0554676 Ga0466965_0554676_287_625 112
1149 3300044684 Ga0466966_0056643 Ga0466966_0056643_390_728 112
1150 3300044684 Ga0466966_0074289 Ga0466966_0074289_339_680 112
1151 3300044684 Ga0466966_0217687 Ga0466966_0217687_180_518 112
1152 3300044693 Ga0466961_0070508 Ga0466961_0070508_426_767 112
1153 3300044693 Ga0466961_0169903 Ga0466961_0169903_973_1311 112
1154 3300044693 Ga0466961_0219010 Ga0466961_0219010_97_435 112
1155 3300044693 Ga0466961_0753639 Ga0466961_0753639_70_408 112
1156 3300044694 Ga0466963_0134891 Ga0466963_0134891_912_1250 112
1157 3300044694 Ga0466963_0139193 Ga0466963_0139193_489_827 112
1158 3300044694 Ga0466963_0246334 Ga0466963_0246334_246_584 112
1159 3300044694 Ga0466963_0364648 Ga0466963_0364648_133_471 112
1160 3300044694 Ga0466963_1099214 Ga0466963_1099214_40_378 112
1161 3300044694 Ga0466963_1319599 Ga0466963_1319599_30_377 112
1162 3300044706 Ga0466964_0304563 Ga0466964_0304563_112_450 112
1163 3300044706 Ga0466964_0884824 Ga0466964_0884824_123_461 112
1164 3300044712 Ga0453684_0000775 Ga0453684_0000775_35631_35969 112
1165 3300044712 Ga0453684_0000807 Ga0453684_0000807_4356_4694 112
1166 3300044712 Ga0453684_0001237 Ga0453684_0001237_7255_7593 112
1167 3300044712 Ga0453684_0087225 Ga0453684_0087225_412_750 112
1168 3300044712 Ga0453684_0130803 Ga0453684_0130803_981_1319 112
1169 3300044712 Ga0453684_0184801 Ga0453684_0184801_1638_1976 112
1170 3300044712 Ga0453684_0319074 Ga0453684_0319074_695_1033 112
1171 3300044712 Ga0453684_1143054 Ga0453684_1143054_127_465 112
1172 3300044719 Ga0466971_0013676 Ga0466971_0013676_2534_2881 112
1173 3300044735 Ga0466968_0003111 Ga0466968_0003111_1957_2295 112
1174 3300044735 Ga0466968_0018075 Ga0466968_0018075_909_1247 112
1175 3300044735 Ga0466968_0054323 Ga0466968_0054323_1060_1407 112
1176 3300044765 Ga0466970_0014253 Ga0466970_0014253_2376_2714 112
1177 3300044765 Ga0466970_0109875 Ga0466970_0109875_875_1222 112
1178 3300044765 Ga0466970_0361068 Ga0466970_0361068_245_583 112
1179 3300044765 Ga0466970_0405261 Ga0466970_0405261_270_608 112
1180 3300044842 Ga0466957_0009531 Ga0466957_0009531_3756_4094 112
1181 3300044842 Ga0466957_0303998 Ga0466957_0303998_553_891 112
1182 3300044842 Ga0466957_0909134 Ga0466957_0909134_45_383 112
1183 3300044901 Ga0466960_0002863 Ga0466960_0002863_2000_2338 112
1184 3300044901 Ga0466960_1045688 Ga0466960_1045688_92_439 112
1185 3300045049 Ga0466959_0002679 Ga0466959_0002679_6105_6443 112
1186 3300045049 Ga0466959_0005845 Ga0466959_0005845_5118_5456 112
1187 3300045049 Ga0466959_0006544 Ga0466959_0006544_7009_7356 112
1188 3300045049 Ga0466959_0033448 Ga0466959_0033448_709_1050 112
1189 3300045049 Ga0466959_0078991 Ga0466959_0078991_1894_2232 112
1190 3300045051 Ga0451576_0001761 Ga0451576_0001761_33225_33563 112
1191 3300045051 Ga0451576_0159560 Ga0451576_0159560_1570_1908 112
1192 3300045051 Ga0451576_0806743 Ga0451576_0806743_253_591 112
1193 3300045836 Ga0466958_0005851 Ga0466958_0005851_3174_3512 112
1194 3300045836 Ga0466958_0098648 Ga0466958_0098648_905_1243 112
1195 3300045836 Ga0466958_0106464 Ga0466958_0106464_522_860 112
1196 3300045976 Ga0466967_0004120 Ga0466967_0004120_7902_8240 112
1197 3300045976 Ga0466967_0007601 Ga0466967_0007601_4418_4756 112
1198 3300045976 Ga0466967_0009446 Ga0466967_0009446_2721_3059 112
1199 3300045976 Ga0466967_0087539 Ga0466967_0087539_70_408 112
1200 3300045976 Ga0466967_0109847 Ga0466967_0109847_1877_2215 112
1201 3300045976 Ga0466967_0218303 Ga0466967_0218303_971_1318 112
1202 3300045976 Ga0466967_0389064 Ga0466967_0389064_399_737 112
1203 3300045976 Ga0466967_1009710 Ga0466967_1009710_434_772 112
1204 3300045976 Ga0466967_1185461 Ga0466967_1185461_263_601 112
1205 3300045976 Ga0466967_1322294 Ga0466967_1322294_261_599 112
1206 3300045976 Ga0466967_1346771 Ga0466967_1346771_39_377 112
1207 3300046454 Ga0495592_0366934 Ga0495592_0366934_138_476 112
1208 3300046459 Ga0495629_0011150 Ga0495629_0011150_341_679 112
1209 3300046460 Ga0495638_0000853 Ga0495638_0000853_17768_18106 112
1210 3300046462 Ga0495651_0017427 Ga0495651_0017427_1070_1408 112
1211 3300046463 Ga0495653_0098942 Ga0495653_0098942_916_1254 112
1212 3300046473 Ga0495582_0034319 Ga0495582_0034319_2059_2397 112
1213 3300046474 Ga0495605_0456587 Ga0495605_0456587_74_412 112
1214 3300046475 Ga0495639_0635570 Ga0495639_0635570_76_414 112
1215 3300046491 Ga0495584_0325212 Ga0495584_0325212_214_552 112
1216 3300046499 Ga0495594_0013700 Ga0495594_0013700_309_647 112
1217 3300046499 Ga0495594_0032693 Ga0495594_0032693_1073_1417 112
1218 3300046500 Ga0495596_0277045 Ga0495596_0277045_76_414 112
1219 3300046507 Ga0495606_0015475 Ga0495606_0015475_2449_2787 112
1220 3300046507 Ga0495606_0249002 Ga0495606_0249002_488_826 112
1221 3300046511 Ga0495608_0087367 Ga0495608_0087367_473_811 112
1222 3300046512 Ga0495610_0405807 Ga0495610_0405807_33_371 112
1223 3300046516 Ga0495628_0559545 Ga0495628_0559545_437_775 112
1224 3300046524 Ga0495648_0044914 Ga0495648_0044914_615_953 112
1225 3300046524 Ga0495648_0051495 Ga0495648_0051495_2103_2444 112
1226 3300046531 Ga0495665_0032820 Ga0495665_0032820_79_417 112
1227 3300046535 Ga0495586_0458260 Ga0495586_0458260_58_396 112
1228 3300046536 Ga0495587_0024379 Ga0495587_0024379_2515_2853 112
1229 3300046543 Ga0495645_0462818 Ga0495645_0462818_100_438 112
1230 3300046559 Ga0495667_0013000 Ga0495667_0013000_2287_2625 112
1231 3300046559 Ga0495667_0131885 Ga0495667_0131885_598_936 112
1232 3300046616 Ga0495668_0050024 Ga0495668_0050024_1536_1874 112
1233 3300046642 Ga0495634_0242373 Ga0495634_0242373_446_784 112
1234 3300046660 Ga0495625_0721381 Ga0495625_0721381_157_495 112
1235 3300046663 Ga0495635_0140501 Ga0495635_0140501_1187_1525 112
1236 3300046663 Ga0495635_0346880 Ga0495635_0346880_77_415 112
1237 3300046678 Ga0495599_0201415 Ga0495599_0201415_554_892 112
1238 3300046679 Ga0495623_0489509 Ga0495623_0489509_15_353 112
1239 3300046683 Ga0495658_0490892 Ga0495658_0490892_277_615 112
1240 3300046689 Ga0495613_0868840 Ga0495613_0868840_57_395 112
1241 3300046690 Ga0495624_0047468 Ga0495624_0047468_654_992 112
1242 3300046694 Ga0495649_0319500 Ga0495649_0319500_414_752 112
1243 3300046694 Ga0495649_0364153 Ga0495649_0364153_334_672 112
1244 3300046694 Ga0495649_0495193 Ga0495649_0495193_72_419 112
1245 3300046694 Ga0495649_0599615 Ga0495649_0599615_35_382 112
1246 3300046809 Ga0495600_0016103 Ga0495600_0016103_3372_3710 112
1247 3300047319 Ga0495674_1049464 Ga0495674_1049464_267_605 112
1248 3300047320 Ga0495672_0090161 Ga0495672_0090161_1022_1360 112
1249 3300047322 Ga0495680_0013487 Ga0495680_0013487_5680_6018 112
1250 3300047323 Ga0495683_0000600 Ga0495683_0000600_23003_23350 112
1251 3300047444 Ga0495675_0048468 Ga0495675_0048468_464_802 112
1252 3300047469 Ga0495673_0001120 Ga0495673_0001120_11896_12234 112
1253 3300047471 Ga0495684_0085947 Ga0495684_0085947_1672_2010 112
1254 3300047472 Ga0495686_0006863 Ga0495686_0006863_8047_8385 112
1255 3300047673 Ga0495593_0002902 Ga0495593_0002902_5793_6131 112
1256 3300048088 Ga0495602_0105727 Ga0495602_0105727_1850_2188 112
1257 3300048088 Ga0495602_0443573 Ga0495602_0443573_89_427 112
1258 3300048088 Ga0495602_0573010 Ga0495602_0573010_88_426 112
1259 3300048091 Ga0495626_0221263 Ga0495626_0221263_60_398 112
1260 3300048903 Ga0496100_0000009 Ga0496100_0000009_92079_92417 112
1261 3300048903 Ga0496100_0002407 Ga0496100_0002407_7266_7613 112
1262 3300048903 Ga0496100_0007381 Ga0496100_0007381_5008_5346 112
1263 3300048903 Ga0496100_0026882 Ga0496100_0026882_408_746 112
1264 3300048903 Ga0496100_0191492 Ga0496100_0191492_37_375 112
1265 3300048903 Ga0496100_0518948 Ga0496100_0518948_366_704 112
1266 3300048903 Ga0496100_1540379 Ga0496100_1540379_48_386 112
1267 3300048904 Ga0496101_0000018 Ga0496101_0000018_153820_154158 112
1268 3300048904 Ga0496101_0000102 Ga0496101_0000102_59586_59924 112
1269 3300048904 Ga0496101_0000432 Ga0496101_0000432_5208_5546 112
1270 3300048904 Ga0496101_0003436 Ga0496101_0003436_5600_5947 112
1271 3300048904 Ga0496101_0005964 Ga0496101_0005964_1328_1666 112
1272 3300048904 Ga0496101_0228082 Ga0496101_0228082_1050_1388 112
1273 3300048904 Ga0496101_0710255 Ga0496101_0710255_170_508 112
1274 3300048905 Ga0496102_0000037 Ga0496102_0000037_28895_29233 112
1275 3300048905 Ga0496102_0000780 Ga0496102_0000780_1911_2249 112
1276 3300048905 Ga0496102_0001298 Ga0496102_0001298_9115_9462 112
1277 3300048905 Ga0496102_0001336 Ga0496102_0001336_4240_4587 112
1278 3300048905 Ga0496102_0092889 Ga0496102_0092889_917_1264 112
1279 3300048905 Ga0496102_0114549 Ga0496102_0114549_1839_2177 112
1280 3300048905 Ga0496102_0137965 Ga0496102_0137965_1308_1655 112
1281 3300048905 Ga0496102_0545922 Ga0496102_0545922_607_945 112
1282 3300048905 Ga0496102_0833969 Ga0496102_0833969_95_433 112
1283 3300048905 Ga0496102_0968251 Ga0496102_0968251_339_677 112
1284 3300048905 Ga0496102_1002108 Ga0496102_1002108_41_379 112
1285 3300048905 Ga0496102_1131243 Ga0496102_1131243_349_687 112
1286 3300048906 Ga0496103_0000004 Ga0496103_0000004_339607_339945 112
1287 3300048906 Ga0496103_0000596 Ga0496103_0000596_10065_10403 112
1288 3300048906 Ga0496103_0001397 Ga0496103_0001397_10828_11175 112
1289 3300048906 Ga0496103_0002679 Ga0496103_0002679_3756_4094 112
1290 3300048906 Ga0496103_0039196 Ga0496103_0039196_1120_1467 112
1291 3300048906 Ga0496103_0182369 Ga0496103_0182369_90_428 112
1292 3300048906 Ga0496103_0973489 Ga0496103_0973489_95_448 112
1293 3300048907 Ga0496104_0013710 Ga0496104_0013710_2892_3239 112
1294 3300048907 Ga0496104_0032236 Ga0496104_0032236_1896_2234 112
1295 3300048907 Ga0496104_0336251 Ga0496104_0336251_631_978 112
1296 3300048907 Ga0496104_0588700 Ga0496104_0588700_528_866 112
1297 3300048907 Ga0496104_0835641 Ga0496104_0835641_151_489 112
1298 3300048908 Ga0496105_0003385 Ga0496105_0003385_9840_10178 112
1299 3300048908 Ga0496105_0094088 Ga0496105_0094088_29_367 112
1300 3300048908 Ga0496105_0911050 Ga0496105_0911050_119_466 112
1301 3300048909 Ga0496106_0001347 Ga0496106_0001347_9580_9927 112
1302 3300048909 Ga0496106_0003543 Ga0496106_0003543_3334_3672 112
1303 3300048909 Ga0496106_0010681 Ga0496106_0010681_5362_5700 112
1304 3300048909 Ga0496106_0031383 Ga0496106_0031383_1722_2060 112
1305 3300048909 Ga0496106_0076031 Ga0496106_0076031_1757_2095 112
1306 3300048909 Ga0496106_0183651 Ga0496106_0183651_90_437 112
1307 3300048909 Ga0496106_0384494 Ga0496106_0384494_72_410 112
1308 3300048909 Ga0496106_0865511 Ga0496106_0865511_338_676 112
1309 3300048909 Ga0496106_1541725 Ga0496106_1541725_122_460 112
1310 3300048910 Ga0496107_0000160 Ga0496107_0000160_33043_33381 112
1311 3300048910 Ga0496107_0000421 Ga0496107_0000421_21504_21842 112
1312 3300048910 Ga0496107_0000619 Ga0496107_0000619_7612_7959 112
1313 3300048910 Ga0496107_0007417 Ga0496107_0007417_5625_5963 112
1314 3300048910 Ga0496107_0103306 Ga0496107_0103306_1687_2025 112
1315 3300048910 Ga0496107_0473956 Ga0496107_0473956_341_688 112
1316 3300048910 Ga0496107_0610868 Ga0496107_0610868_176_514 112
1317 3300048910 Ga0496107_1111027 Ga0496107_1111027_221_559 112
1318 3300048910 Ga0496107_1136263 Ga0496107_1136263_153_491 112
1319 3300048911 Ga0496108_0000503 Ga0496108_0000503_12151_12498 112
1320 3300048911 Ga0496108_0001938 Ga0496108_0001938_1378_1716 112
1321 3300048911 Ga0496108_0002821 Ga0496108_0002821_11392_11730 112
1322 3300048911 Ga0496108_0074152 Ga0496108_0074152_2485_2823 112
1323 3300048911 Ga0496108_0203985 Ga0496108_0203985_1212_1550 112
1324 3300048911 Ga0496108_0281978 Ga0496108_0281978_648_986 112
1325 3300048911 Ga0496108_0303752 Ga0496108_0303752_509_847 112
1326 3300048911 Ga0496108_0968988 Ga0496108_0968988_19_357 112
1327 3300048912 Ga0496109_0000136 Ga0496109_0000136_30799_31137 112
1328 3300048912 Ga0496109_0005195 Ga0496109_0005195_5289_5627 112
1329 3300048912 Ga0496109_0015193 Ga0496109_0015193_6173_6520 112
1330 3300048912 Ga0496109_0118649 Ga0496109_0118649_566_904 112
1331 3300048912 Ga0496109_0152932 Ga0496109_0152932_159_497 112
1332 3300048912 Ga0496109_0447116 Ga0496109_0447116_789_1127 112
1333 3300048912 Ga0496109_0758146 Ga0496109_0758146_160_498 112
1334 3300048912 Ga0496109_0858100 Ga0496109_0858100_380_718 112
1335 3300048912 Ga0496109_0882504 Ga0496109_0882504_417_755 112
1336 3300048912 Ga0496109_1448369 Ga0496109_1448369_103_441 112
1337 3300048913 Ga0496110_0000175 Ga0496110_0000175_5349_5687 112
1338 3300048913 Ga0496110_0015920 Ga0496110_0015920_4722_5069 112
1339 3300048913 Ga0496110_0119399 Ga0496110_0119399_479_817 112
1340 3300048913 Ga0496110_0226937 Ga0496110_0226937_748_1086 112
1341 3300048913 Ga0496110_0606456 Ga0496110_0606456_250_588 112
1342 3300048913 Ga0496110_0713701 Ga0496110_0713701_361_699 112
1343 3300048913 Ga0496110_1157961 Ga0496110_1157961_312_650 112
1344 3300048914 Ga0496111_0163113 Ga0496111_0163113_1256_1603 112
1345 3300048914 Ga0496111_0207170 Ga0496111_0207170_723_1061 112
1346 3300048914 Ga0496111_0237690 Ga0496111_0237690_193_531 112
1347 3300048915 Ga0496112_0010429 Ga0496112_0010429_7532_7870 112
1348 3300048915 Ga0496112_0014667 Ga0496112_0014667_2834_3172 112
1349 3300048915 Ga0496112_0099681 Ga0496112_0099681_2046_2393 112
1350 3300048915 Ga0496112_0163989 Ga0496112_0163989_342_680 112
1351 3300048915 Ga0496112_0658322 Ga0496112_0658322_495_839 112
1352 3300048916 Ga0496113_0029506 Ga0496113_0029506_1602_1940 112
1353 3300048916 Ga0496113_0054586 Ga0496113_0054586_1047_1385 112
1354 3300048916 Ga0496113_0558612 Ga0496113_0558612_94_432 112
1355 3300048916 Ga0496113_0634836 Ga0496113_0634836_405_752 112
1356 3300048916 Ga0496113_0723947 Ga0496113_0723947_348_686 112
1357 3300048916 Ga0496113_1069928 Ga0496113_1069928_172_510 112
1358 3300048916 Ga0496113_1077254 Ga0496113_1077254_247_585 112
1359 3300048916 Ga0496113_1106036 Ga0496113_1106036_233_571 112
1360 3300048917 Ga0496114_0000108 Ga0496114_0000108_13137_13484 112
1361 3300048917 Ga0496114_0002178 Ga0496114_0002178_8444_8782 112
1362 3300048917 Ga0496114_0008558 Ga0496114_0008558_7017_7355 112
1363 3300048917 Ga0496114_0103287 Ga0496114_0103287_1414_1761 112
1364 3300048917 Ga0496114_0150460 Ga0496114_0150460_1600_1938 112
1365 3300048917 Ga0496114_0311774 Ga0496114_0311774_1037_1375 112
1366 3300048918 Ga0496115_0002120 Ga0496115_0002120_13707_14054 112
1367 3300048918 Ga0496115_0003879 Ga0496115_0003879_5413_5751 112
1368 3300048918 Ga0496115_0164525 Ga0496115_0164525_983_1321 112
1369 3300048918 Ga0496115_0207774 Ga0496115_0207774_511_849 112
1370 3300048918 Ga0496115_0520494 Ga0496115_0520494_545_883 112
1371 3300048919 Ga0496116_0000276 Ga0496116_0000276_28869_29207 112
1372 3300048919 Ga0496116_0006980 Ga0496116_0006980_8658_8996 112
1373 3300048919 Ga0496116_0008066 Ga0496116_0008066_2543_2881 112
1374 3300048920 Ga0496117_0000003 Ga0496117_0000003_1538010_1538348 112
1375 3300048920 Ga0496117_0001470 Ga0496117_0001470_24665_25003 112
1376 3300048920 Ga0496117_0008421 Ga0496117_0008421_7750_8088 112
1377 3300048920 Ga0496117_0303302 Ga0496117_0303302_246_587 112
1378 3300048921 Ga0496118_0000001 Ga0496118_0000001_1538013_1538351 112
1379 3300048921 Ga0496118_0000275 Ga0496118_0000275_73832_74170 112
1380 3300048921 Ga0496118_0026151 Ga0496118_0026151_1300_1641 112
1381 3300048921 Ga0496118_0146119 Ga0496118_0146119_211_549 112
1382 3300048922 Ga0496119_0008565 Ga0496119_0008565_5489_5827 112
1383 3300048922 Ga0496119_0023844 Ga0496119_0023844_2389_2727 112
1384 3300048922 Ga0496119_0041498 Ga0496119_0041498_1641_1979 112
1385 3300048923 Ga0496120_0041051 Ga0496120_0041051_2238_2576 112
1386 3300048923 Ga0496120_0109134 Ga0496120_0109134_525_863 112
1387 3300048924 Ga0496121_0000023 Ga0496121_0000023_299347_299685 112
1388 3300048924 Ga0496121_0000338 Ga0496121_0000338_37780_38118 112
1389 3300048924 Ga0496121_0007403 Ga0496121_0007403_5304_5642 112
1390 3300048925 Ga0496122_0000164 Ga0496122_0000164_3684_4022 112
1391 3300048925 Ga0496122_0009281 Ga0496122_0009281_2245_2583 112
1392 3300048926 Ga0496123_0010653 Ga0496123_0010653_1592_1930 112
1393 3300048926 Ga0496123_0043624 Ga0496123_0043624_1749_2087 112
1394 3300048927 Ga0496124_0000014 Ga0496124_0000014_299347_299685 112
1395 3300048927 Ga0496124_0564792 Ga0496124_0564792_246_584 112
1396 3300048927 Ga0496124_0578178 Ga0496124_0578178_361_699 112
1397 3300048928 Ga0496125_0000020 Ga0496125_0000020_163764_164102 112
1398 3300048928 Ga0496125_0029379 Ga0496125_0029379_2764_3102 112
1399 3300048928 Ga0496125_0200100 Ga0496125_0200100_237_575 112
1400 3300048929 Ga0496126_0000023 Ga0496126_0000023_299347_299685 112
1401 3300048929 Ga0496126_0000551 Ga0496126_0000551_11423_11761 112
1402 3300048929 Ga0496126_0023801 Ga0496126_0023801_2413_2751 112
1403 3300048929 Ga0496126_0059158 Ga0496126_0059158_1165_1503 112
1404 3300048929 Ga0496126_0158692 Ga0496126_0158692_748_1086 112
1405 3300049568 Ga0501031_0003702 Ga0501031_0003702_1553_1891 112
1406 3300049569 Ga0501032_0001621 Ga0501032_0001621_3453_3791 112
1407 3300049569 Ga0501032_0119942 Ga0501032_0119942_1185_1523 112
1408 3300049570 Ga0501033_0086401 Ga0501033_0086401_316_654 112
1409 3300049571 Ga0501034_0029751 Ga0501034_0029751_2002_2340 112
1410 3300049571 Ga0501034_0099925 Ga0501034_0099925_1909_2247 112
1411 3300049571 Ga0501034_0216930 Ga0501034_0216930_1505_1843 112
1412 3300049572 Ga0501036_0010498 Ga0501036_0010498_4332_4670 112
1413 3300049572 Ga0501036_0125427 Ga0501036_0125427_304_642 112
1414 3300049572 Ga0501036_0303405 Ga0501036_0303405_36_374 112
1415 3300049573 Ga0501037_0006173 Ga0501037_0006173_5335_5673 112
1416 3300049573 Ga0501037_0046066 Ga0501037_0046066_2636_2974 112
1417 3300049574 Ga0501038_0004812 Ga0501038_0004812_5089_5427 112
1418 3300049574 Ga0501038_0018526 Ga0501038_0018526_77_415 112
1419 3300049575 Ga0501039_0000288 Ga0501039_0000288_31419_31757 112
1420 3300049575 Ga0501039_1242759 Ga0501039_1242759_119_457 112
1421 3300049575 Ga0501039_1518099 Ga0501039_1518099_129_467 112
1422 3300049576 Ga0501040_0009730 Ga0501040_0009730_110_448 112
1423 3300049576 Ga0501040_0362908 Ga0501040_0362908_415_753 112
1424 3300049577 Ga0501041_0021864 Ga0501041_0021864_111_449 112
1425 3300049577 Ga0501041_0317519 Ga0501041_0317519_221_559 112
1426 3300049578 Ga0501042_0006845 Ga0501042_0006845_7009_7347 112
1427 3300049578 Ga0501042_0509395 Ga0501042_0509395_119_457 112
1428 3300049579 Ga0501043_0000411 Ga0501043_0000411_23466_23804 112
1429 3300049580 Ga0501046_0080819 Ga0501046_0080819_653_991 112
1430 3300049582 Ga0501048_0013403 Ga0501048_0013403_5663_6001 112
1431 3300049584 Ga0501068_0105440 Ga0501068_0105440_1368_1706 112
1432 3300049586 Ga0501070_0000614 Ga0501070_0000614_14623_14961 112
1433 3300049586 Ga0501070_0360846 Ga0501070_0360846_243_581 112
1434 3300049587 Ga0501071_0025791 Ga0501071_0025791_3761_4099 112
1435 3300049587 Ga0501071_0238186 Ga0501071_0238186_244_582 112
1436 3300049587 Ga0501071_0783669 Ga0501071_0783669_15_353 112
1437 3300049587 Ga0501071_1084832 Ga0501071_1084832_44_382 112
1438 3300049588 Ga0501072_0051976 Ga0501072_0051976_782_1120 112
1439 3300049589 Ga0501073_0143935 Ga0501073_0143935_33_371 112
1440 3300049589 Ga0501073_0368147 Ga0501073_0368147_100_447 112
1441 3300049590 Ga0501074_0080367 Ga0501074_0080367_1954_2292 112
1442 3300049590 Ga0501074_0700742 Ga0501074_0700742_60_398 112
1443 3300049591 Ga0501075_0047180 Ga0501075_0047180_1866_2204 112
1444 3300049592 Ga0501076_0018055 Ga0501076_0018055_1506_1844 112
1445 3300049593 Ga0501077_0034363 Ga0501077_0034363_70_408 112
1446 3300049741 Ga0501079_0013376 Ga0501079_0013376_5840_6178 112
1447 3300049743 Ga0501081_0061314 Ga0501081_0061314_57_395 112
1448 3300049744 Ga0501083_0090351 Ga0501083_0090351_1636_1974 112
1449 3300049822 Ga0501035_0313828 Ga0501035_0313828_71_409 112
1450 3300049823 Ga0501044_0028044 Ga0501044_0028044_5351_5689 112
1451 3300049823 Ga0501044_0206920 Ga0501044_0206920_1292_1630 112
1452 3300049823 Ga0501044_1224326 Ga0501044_1224326_202_540 112
1453 3300049824 Ga0501045_0001109 Ga0501045_0001109_9450_9788 112
1454 3300049824 Ga0501045_0438708 Ga0501045_0438708_580_918 112
1455 3300049824 Ga0501045_0770583 Ga0501045_0770583_237_575 112
1456 3300050489 nmdc:mga03683_106176_c1 nmdc:mga03683_106176_c1_727_1065 112
1457 3300050489 nmdc:mga03683_145329_c1 nmdc:mga03683_145329_c1_493_831 112
1458 3300050489 nmdc:mga03683_149341_c1 nmdc:mga03683_149341_c1_635_973 112
1459 3300050489 nmdc:mga03683_18271_c1 nmdc:mga03683_18271_c1_741_1079 112
1460 3300050489 nmdc:mga03683_246717_c1 nmdc:mga03683_246717_c1_461_799 112
1461 3300050489 nmdc:mga03683_81237_c1 nmdc:mga03683_81237_c1_722_1069 112
1462 3300050489 nmdc:mga03683_97128_c1 nmdc:mga03683_97128_c1_360_707 112
1463 3300050489 nmdc:mga03683_99291_c1 nmdc:mga03683_99291_c1_645_983 112
1464 3300050490 nmdc:mga03n38_172110_c1 nmdc:mga03n38_172110_c1_216_554 112
1465 3300050490 nmdc:mga03n38_179110_c1 nmdc:mga03n38_179110_c1_248_586 112
1466 3300050490 nmdc:mga03n38_25072_c1 nmdc:mga03n38_25072_c1_1807_2145 112
1467 3300050490 nmdc:mga03n38_373_c1 nmdc:mga03n38_373_c1_474_812 112
1468 3300050490 nmdc:mga03n38_39017_c1 nmdc:mga03n38_39017_c1_868_1206 112
1469 3300050490 nmdc:mga03n38_4813_c1 nmdc:mga03n38_4813_c1_60_407 112
1470 3300050490 nmdc:mga03n38_64317_c1 nmdc:mga03n38_64317_c1_653_991 112
1471 3300050490 nmdc:mga03n38_754669_c1 nmdc:mga03n38_754669_c1_172_513 112
1472 3300050491 nmdc:mga00v17_107222_c1 nmdc:mga00v17_107222_c1_146_484 112
1473 3300050491 nmdc:mga00v17_112128_c1 nmdc:mga00v17_112128_c1_1366_1704 112
1474 3300050491 nmdc:mga00v17_145703_c1 nmdc:mga00v17_145703_c1_827_1165 112
1475 3300050491 nmdc:mga00v17_14672_c1 nmdc:mga00v17_14672_c1_1717_2055 112
1476 3300050491 nmdc:mga00v17_15818_c1 nmdc:mga00v17_15818_c1_1835_2173 112
1477 3300050491 nmdc:mga00v17_163030_c1 nmdc:mga00v17_163030_c1_445_783 112
1478 3300050491 nmdc:mga00v17_171862_c1 nmdc:mga00v17_171862_c1_824_1162 112
1479 3300050491 nmdc:mga00v17_24548_c1 nmdc:mga00v17_24548_c1_1123_1464 112
1480 3300050491 nmdc:mga00v17_259078_c1 nmdc:mga00v17_259078_c1_777_1115 112
1481 3300050491 nmdc:mga00v17_31938_c1 nmdc:mga00v17_31938_c1_2477_2815 112
1482 3300050491 nmdc:mga00v17_321294_c1 nmdc:mga00v17_321294_c1_154_492 112
1483 3300050491 nmdc:mga00v17_44498_c1 nmdc:mga00v17_44498_c1_1654_1992 112
1484 3300050491 nmdc:mga00v17_48101_c1 nmdc:mga00v17_48101_c1_707_1045 112
1485 3300050491 nmdc:mga00v17_72702_c1 nmdc:mga00v17_72702_c1_534_872 112
1486 3300050491 nmdc:mga00v17_828239_c1 nmdc:mga00v17_828239_c1_58_396 112
1487 3300050491 nmdc:mga00v17_8314_c1 nmdc:mga00v17_8314_c1_2946_3287 112
1488 3300050491 nmdc:mga00v17_88659_c1 nmdc:mga00v17_88659_c1_1057_1395 112
1489 3300050491 nmdc:mga00v17_915332_c1 nmdc:mga00v17_915332_c1_70_408 112
1490 3300050491 nmdc:mga00v17_939_c2 nmdc:mga00v17_939_c2_198_545 112
1491 3300050492 nmdc:mga0yw44_1011118_c1 nmdc:mga0yw44_1011118_c1_204_542 112
1492 3300050492 nmdc:mga0yw44_10139_c1 nmdc:mga0yw44_10139_c1_1943_2284 112
1493 3300050492 nmdc:mga0yw44_11473_c1 nmdc:mga0yw44_11473_c1_2222_2560 112
1494 3300050492 nmdc:mga0yw44_1238278_c1 nmdc:mga0yw44_1238278_c1_10_348 112
1495 3300050492 nmdc:mga0yw44_1244897_c1 nmdc:mga0yw44_1244897_c1_16_354 112
1496 3300050492 nmdc:mga0yw44_137849_c1 nmdc:mga0yw44_137849_c1_584_922 112
1497 3300050492 nmdc:mga0yw44_197652_c1 nmdc:mga0yw44_197652_c1_245_583 112
1498 3300050492 nmdc:mga0yw44_197807_c1 nmdc:mga0yw44_197807_c1_873_1220 112
1499 3300050492 nmdc:mga0yw44_209043_c2 nmdc:mga0yw44_209043_c2_207_545 112
1500 3300050492 nmdc:mga0yw44_212467_c1 nmdc:mga0yw44_212467_c1_799_1146 112
1501 3300050492 nmdc:mga0yw44_4800_c1 nmdc:mga0yw44_4800_c1_3041_3382 112
1502 3300050492 nmdc:mga0yw44_563269_c1 nmdc:mga0yw44_563269_c1_141_479 112
1503 3300050492 nmdc:mga0yw44_623801_c1 nmdc:mga0yw44_623801_c1_19_357 112
1504 3300050492 nmdc:mga0yw44_757020_c1 nmdc:mga0yw44_757020_c1_154_492 112
1505 3300050493 nmdc:mga0k408_127449_c1 nmdc:mga0k408_127449_c1_314_652 112
1506 3300050493 nmdc:mga0k408_269814_c1 nmdc:mga0k408_269814_c1_357_695 112
1507 3300050494 nmdc:mga06z11_114540_c1 nmdc:mga06z11_114540_c1_961_1299 112
1508 3300050494 nmdc:mga06z11_376919_c1 nmdc:mga06z11_376919_c1_42_389 112
1509 3300050494 nmdc:mga06z11_4204_c1 nmdc:mga06z11_4204_c1_2429_2767 112
1510 3300050494 nmdc:mga06z11_529606_c1 nmdc:mga06z11_529606_c1_33_380 112
1511 3300050495 nmdc:mga04h51_101730_c1 nmdc:mga04h51_101730_c1_515_853 112
1512 3300050495 nmdc:mga04h51_13989_c1 nmdc:mga04h51_13989_c1_738_1076 112
1513 3300050495 nmdc:mga04h51_87934_c1 nmdc:mga04h51_87934_c1_28_366 112
1514 3300050496 nmdc:mga07m45_115229_c1 nmdc:mga07m45_115229_c1_93_431 112
1515 3300050496 nmdc:mga07m45_161133_c1 nmdc:mga07m45_161133_c1_923_1261 112
1516 3300050496 nmdc:mga07m45_207132_c1 nmdc:mga07m45_207132_c1_246_584 112
1517 3300050496 nmdc:mga07m45_247687_c1 nmdc:mga07m45_247687_c1_421_759 112
1518 3300050496 nmdc:mga07m45_36730_c1 nmdc:mga07m45_36730_c1_445_783 112
1519 3300050496 nmdc:mga07m45_47279_c1 nmdc:mga07m45_47279_c1_1463_1801 112
1520 3300050496 nmdc:mga07m45_9033_c1 nmdc:mga07m45_9033_c1_4244_4582 112
1521 3300050496 nmdc:mga07m45_920710_c1 nmdc:mga07m45_920710_c1_65_403 112
1522 3300050507 nmdc:mga05p37_1396971_c1 nmdc:mga05p37_1396971_c1_337_675 112
1523 3300050507 nmdc:mga05p37_2880_c1 nmdc:mga05p37_2880_c1_18439_18777 112
1524 3300050507 nmdc:mga05p37_485785_c1 nmdc:mga05p37_485785_c1_181_519 112
1525 3300050507 nmdc:mga05p37_50868_c1 nmdc:mga05p37_50868_c1_208_546 112
1526 3300050508 nmdc:mga09592_1018_c1 nmdc:mga09592_1018_c1_2743_3081 112
1527 3300050508 nmdc:mga09592_216798_c1 nmdc:mga09592_216798_c1_1129_1467 112
1528 3300050508 nmdc:mga09592_764472_c1 nmdc:mga09592_764472_c1_177_515 112
1529 3300050509 nmdc:mga0qj67_20833_c1 nmdc:mga0qj67_20833_c1_2068_2406 112
1530 3300050510 nmdc:mga06r32_35717_c1 nmdc:mga06r32_35717_c1_2746_3084 112
1531 3300050510 nmdc:mga06r32_41498_c1 nmdc:mga06r32_41498_c1_1443_1781 112
1532 3300050510 nmdc:mga06r32_619661_c1 nmdc:mga06r32_619661_c1_360_698 112
1533 3300050511 nmdc:mga08y16_348176_c1 nmdc:mga08y16_348176_c1_770_1108 112
1534 3300050511 nmdc:mga08y16_38223_c1 nmdc:mga08y16_38223_c1_2650_3003 112
1535 3300050512 nmdc:mga0n895_2169642_c1 nmdc:mga0n895_2169642_c1_71_409 112
1536 3300050515 nmdc:mga0a205_827423_c1 nmdc:mga0a205_827423_c1_169_516 112
1537 3300050516 nmdc:mga0sz30_123819_c1 nmdc:mga0sz30_123819_c1_706_1044 112
1538 3300050516 nmdc:mga0sz30_13617_c1 nmdc:mga0sz30_13617_c1_1460_1807 112
1539 3300050516 nmdc:mga0sz30_144402_c2 nmdc:mga0sz30_144402_c2_165_503 112
1540 3300050516 nmdc:mga0sz30_166905_c1 nmdc:mga0sz30_166905_c1_144_482 112
1541 3300050516 nmdc:mga0sz30_1775_c1 nmdc:mga0sz30_1775_c1_3969_4316 112
1542 3300050516 nmdc:mga0sz30_186679_c1 nmdc:mga0sz30_186679_c1_385_723 112
1543 3300050516 nmdc:mga0sz30_202324_c1 nmdc:mga0sz30_202324_c1_326_664 112
1544 3300050516 nmdc:mga0sz30_218474_c1 nmdc:mga0sz30_218474_c1_334_672 112
1545 3300050516 nmdc:mga0sz30_275279_c1 nmdc:mga0sz30_275279_c1_11_349 112
1546 3300050516 nmdc:mga0sz30_340264_c1 nmdc:mga0sz30_340264_c1_51_389 112
1547 3300050516 nmdc:mga0sz30_34285_c1 nmdc:mga0sz30_34285_c1_689_1036 112
1548 3300050516 nmdc:mga0sz30_421837_c1 nmdc:mga0sz30_421837_c1_232_570 112
1549 3300050516 nmdc:mga0sz30_471171_c1 nmdc:mga0sz30_471171_c1_170_508 112
1550 3300050516 nmdc:mga0sz30_488380_c1 nmdc:mga0sz30_488380_c1_56_394 112
1551 3300050516 nmdc:mga0sz30_77563_c1 nmdc:mga0sz30_77563_c1_443_781 112
1552 3300053084 Ga0495595_0051342 Ga0495595_0051342_1197_1535 112
1553 3300053087 Ga0500643_018937 Ga0500643_018937_1802_2140 112
1554 3300053087 Ga0500643_121135 Ga0500643_121135_54_392 112
1555 3300053104 Ga0500556_0007787 Ga0500556_0007787_248_586 112
1556 3300053108 Ga0500562_037974 Ga0500562_037974_815_1153 112
1557 3300053147 Ga0500589_350845 Ga0500589_350845_26_364 112
1558 3300053151 Ga0500604_0288738 Ga0500604_0288738_161_499 112
1559 3300053153 Ga0500616_0066511 Ga0500616_0066511_476_814 112
1560 3300054114 Ga0501084_0009555 Ga0501084_0009555_853_1191 112
1561 3300059423 Ga0590074_054935 Ga0590074_054935_67_405 112
1562 3300059491 Ga0587070_236075 Ga0587070_236075_26_370 112
1563 3300059492 Ga0587073_0129148 Ga0587073_0129148_27_365 112
1564 3300059504 Ga0587082_045256 Ga0587082_045256_24_368 112
1565 3300059504 Ga0587082_114522 Ga0587082_114522_237_575 112
1566 3300059643 Ga0587072_035935 Ga0587072_035935_376_714 112
1567 3300059647 Ga0587079_142822 Ga0587079_142822_234_572 112
1568 3300059647 Ga0587079_152893 Ga0587079_152893_118_456 112
1569 3300059658 Ga0587119_049619 Ga0587119_049619_263_601 112
1570 3300060353 Ga0501082_0016287 Ga0501082_0016287_56_394 112
1571 3300060353 Ga0501082_0688152 Ga0501082_0688152_354_692 112
1572 3300061719 Ga0466962_0012558 Ga0466962_0012558_3616_3954 112
1573 3300061719 Ga0466962_0208426 Ga0466962_0208426_562_900 112
1574 3300061734 Ga0530510_0031591 Ga0530510_0031591_88_426 112
1575 3300061734 Ga0530510_0522075 Ga0530510_0522075_530_868 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

16

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9925 1 112
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9915 1 108
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9892 2 112
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.9875 1 108
4c3m-assembly1.cif.gz_B structure of wildtype pii from s. elongatus at medium resolution 0.9849 1 106
ID Description Score Start End Superfamily
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9746 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9516 1 111 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9448 2 108 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9419 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9365 2 112 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A2U1T6E6-F1-model_v4 P-II family nitrogen regulator 0.9589 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9539 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1Q4DS82-F1-model_v4 Transcriptional regulator 0.9494 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9465 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A424YGZ9-F1-model_v4 deleted 0.9425 1 108

Feature Viewer

pLDDT pTM Quality
88.11 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map