F494781

General Info

Members Datasets Scaffolds Average Seq Length
1563 511 1562 135

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10860747|Ga0207681_108607472
Length 155
Sequence LNADGDYSLFATHYSLDCMATFHFDLVSPEKLVFSGEVDQVDIPGTEGDFGVLAGHAPTVSALRPGIMTVYVNGQAQRMIVLGGFAEVSADGKLTVLADLADSVEDFDRAVLAERIAAQEEKVKAIEPGSEFDRAIERLDHFRQVDSHLQGTGMH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
27 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
28 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
152 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
153 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
154 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
155 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
156 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
259 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
265 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
266 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
269 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
270 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
271 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
272 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
273 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
274 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
275 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
276 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
277 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
278 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
279 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
280 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
281 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
282 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
283 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
284 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
285 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
286 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
287 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
291 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
293 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
294 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
295 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
296 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
297 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
298 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
299 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
300 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
301 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
302 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
303 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
304 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
305 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
306 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
307 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
309 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
311 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
312 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
313 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
314 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
315 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
316 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
317 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
318 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
319 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
320 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
321 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
322 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
323 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
324 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
338 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
341 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
342 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
343 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
344 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
345 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
346 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
347 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
348 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
349 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
350 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
351 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
352 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
353 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
356 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
357 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
360 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
369 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
370 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
371 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
372 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
373 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
374 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
375 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
376 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
377 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
379 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
380 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
381 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
382 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
383 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
384 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
385 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
386 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
387 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
388 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
389 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
392 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
393 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
394 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
398 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
399 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
400 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
401 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
410 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
413 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
414 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
415 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
418 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
421 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
422 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
441 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
458 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
459 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
460 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
461 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
462 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
463 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
464 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
465 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
466 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
467 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
468 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
469 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
472 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
473 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
480 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
481 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
482 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
483 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
484 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
485 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
486 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
489 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
490 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
491 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
492 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
493 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
494 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
495 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
496 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
497 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
498 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
499 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
500 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
501 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
502 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
503 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
504 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
505 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
506 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
507 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
508 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
509 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
510 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
511 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.19
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 5.76
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3045067 2162886007 Bacteria 1094
2 2214772984 2209111006 Bacteria 12351
3 ARSoilYngRDRAFT_c00377 3300000042 Bacteria 6077
4 ARcpr5yngRDRAFT_c000358 3300000043 Bacteria 6071
5 ARSoilOldRDRAFT_c000321 3300000044 Bacteria 6329
6 ARCol0oldRDRAFT_c00150 3300000045 Bacteria 6281
7 ARCol0yngRDRAFT_1000371 3300000652 Bacteria 6274
8 JGI24746J21847_1001703 3300001977 Bacteria 3519
9 JGI24739J22299_10036647 3300001989 Bacteria 1656
10 JGI24737J22298_10004265 3300001990 Bacteria 4993
11 JGI24743J22301_10049499 3300001991 Bacteria 854
12 JGI24743J22301_10132025 3300001991 Bacteria 552
13 JGI24735J21928_10196898 3300002067 Bacteria 584
14 JGI24750J21931_1000505 3300002070 Bacteria 6123
15 JGI24745J21846_1001173 3300002073 Bacteria 2506
16 JGI24748J21848_1000728 3300002074 Bacteria 3562
17 JGI24738J21930_10000064 3300002075 Bacteria 22266
18 JGI24749J21850_1000745 3300002076 Bacteria 4699
19 JGI24749J21850_1060149 3300002076 Bacteria 576
20 JGI24744J21845_10000737 3300002077 Bacteria 6071
21 JGI24744J21845_10027143 3300002077 Bacteria 1108
22 JGI24035J26624_1001283 3300002126 Bacteria 2383
23 JGI24033J26618_1001199 3300002155 Bacteria 2534
24 JGI24034J26672_10000317 3300002239 Bacteria 6267
25 JGI24742J22300_10000416 3300002244 Bacteria 6311
26 JGI24751J29686_10007027 3300002459 Bacteria 2299
27 JGI24751J29686_10019620 3300002459 Bacteria 1400
28 JGI24751J29686_10036080 3300002459 Bacteria 1025
29 JGI25406J46586_10007262 3300003203 Bacteria 5067
30 JGI26129J50193_1007271 3300003349 Bacteria 799
31 JGI26145J50221_1008244 3300003371 Bacteria 892
32 Ga0065717_1002482 3300005276 Bacteria 1907
33 Ga0065714_10184423 3300005288 Bacteria 908
34 Ga0065704_10132316 3300005289 Bacteria 1608
35 Ga0065712_10005081 3300005290 Bacteria 4890
36 Ga0065712_10013426 3300005290 Bacteria 2076
37 Ga0065712_10070998 3300005290 Bacteria 5527
38 Ga0065715_10004000 3300005293 Bacteria 6148
39 Ga0065715_10105191 3300005293 Bacteria 2899
40 Ga0065715_10454817 3300005293 Bacteria 822
41 Ga0065707_10010312 3300005295 Bacteria 2878
42 Ga0065707_10026407 3300005295 Bacteria 1378
43 Ga0065707_10104099 3300005295 Bacteria 2713
44 Ga0065707_10253804 3300005295 Bacteria 1117
45 Ga0070658_10013752 3300005327 Bacteria 6495
46 Ga0070658_10733898 3300005327 Bacteria 858
47 Ga0070676_10011938 3300005328 Bacteria 4735
48 Ga0070676_10038007 3300005328 Bacteria 2779
49 Ga0070676_10080414 3300005328 Bacteria 1976
50 Ga0070676_10536298 3300005328 Bacteria 836
51 Ga0070676_10852539 3300005328 Bacteria 676
52 Ga0070683_100005169 3300005329 Bacteria 10858
53 Ga0070683_100093341 3300005329 Bacteria 2827
54 Ga0070690_100007790 3300005330 Bacteria 6138
55 Ga0070690_100008910 3300005330 Bacteria 5794
56 Ga0070690_100374273 3300005330 Bacteria 1040
57 Ga0070690_101090994 3300005330 Bacteria 633
58 Ga0070670_100057070 3300005331 Bacteria 3352
59 Ga0070670_100088659 3300005331 Bacteria 2659
60 Ga0070670_100214371 3300005331 Bacteria 1674
61 Ga0070670_100214373 3300005331 Bacteria 1674
62 Ga0070670_100343477 3300005331 Bacteria 1311
63 Ga0070670_100824356 3300005331 Bacteria 839
64 Ga0070677_10010930 3300005333 Bacteria 3117
65 Ga0070677_10017988 3300005333 Bacteria 2540
66 Ga0070677_10019778 3300005333 Bacteria 2443
67 Ga0068869_100100178 3300005334 Bacteria 2190
68 Ga0068869_100135127 3300005334 Bacteria 1899
69 Ga0068869_100242448 3300005334 Bacteria 1436
70 Ga0068869_100999718 3300005334 Bacteria 728
71 Ga0070666_10010052 3300005335 Bacteria 5907
72 Ga0070666_10078662 3300005335 Bacteria 2251
73 Ga0070666_10130987 3300005335 Bacteria 1743
74 Ga0070666_10209716 3300005335 Bacteria 1372
75 Ga0070666_10577990 3300005335 Bacteria 819
76 Ga0070680_100044795 3300005336 Bacteria 3595
77 Ga0070680_100045280 3300005336 Bacteria 3576
78 Ga0070680_100046429 3300005336 Bacteria 3533
79 Ga0070680_100079124 3300005336 Bacteria 2709
80 Ga0070680_100434488 3300005336 Bacteria 1121
81 Ga0070682_100009542 3300005337 Bacteria 5492
82 Ga0070682_100056461 3300005337 Bacteria 2469
83 Ga0070682_101065601 3300005337 Bacteria 675
84 Ga0068868_100117597 3300005338 Bacteria 2166
85 Ga0068868_100168843 3300005338 Bacteria 1810
86 Ga0068868_101174520 3300005338 Bacteria 709
87 Ga0070660_100057387 3300005339 Bacteria 3015
88 Ga0070660_100076560 3300005339 Bacteria 2620
89 Ga0070660_100087365 3300005339 Bacteria 2454
90 Ga0070660_100174872 3300005339 Bacteria 1736
91 Ga0070689_100014470 3300005340 Bacteria 5731
92 Ga0070689_100035242 3300005340 Bacteria 3823
93 Ga0070689_100053207 3300005340 Bacteria 3132
94 Ga0070689_100089507 3300005340 Bacteria 2424
95 Ga0070689_100256000 3300005340 Bacteria 1446
96 Ga0070689_100284490 3300005340 Bacteria 1372
97 Ga0070689_100480999 3300005340 Bacteria 1061
98 Ga0070689_100597562 3300005340 Bacteria 955
99 Ga0070689_100874874 3300005340 Bacteria 794
100 Ga0070691_10007611 3300005341 Bacteria 4965
101 Ga0070687_100012602 3300005343 Bacteria 3739
102 Ga0070687_100255747 3300005343 Bacteria 1090
103 Ga0070687_100681600 3300005343 Bacteria 716
104 Ga0070661_100015266 3300005344 Bacteria 5420
105 Ga0070661_100090140 3300005344 Bacteria 2271
106 Ga0070661_100328633 3300005344 Bacteria 1195
107 Ga0070661_101577273 3300005344 Bacteria 555
108 Ga0070692_10000468 3300005345 Bacteria 12374
109 Ga0070692_10026545 3300005345 Bacteria 2864
110 Ga0070692_10569300 3300005345 Bacteria 745
111 Ga0070692_10731102 3300005345 Bacteria 669
112 Ga0070668_100074575 3300005347 Bacteria 2647
113 Ga0070668_100220906 3300005347 Bacteria 1563
114 Ga0070668_100625646 3300005347 Bacteria 944
115 Ga0070668_101591110 3300005347 Unclassified 599
116 Ga0070668_102100177 3300005347 Bacteria 522
117 Ga0070669_100011957 3300005353 Bacteria 6160
118 Ga0070669_100355211 3300005353 Bacteria 1190
119 Ga0070669_100759958 3300005353 Bacteria 822
120 Ga0070669_101104453 3300005353 Bacteria 683
121 Ga0070675_100098935 3300005354 Bacteria 2454
122 Ga0070675_100223958 3300005354 Bacteria 1639
123 Ga0070675_100675786 3300005354 Bacteria 939
124 Ga0070671_100002503 3300005355 Bacteria 14229
125 Ga0070671_100085472 3300005355 Bacteria 2639
126 Ga0070671_100240236 3300005355 Bacteria 1537
127 Ga0070671_100615863 3300005355 Bacteria 939
128 Ga0070674_100001688 3300005356 Bacteria 11952
129 Ga0070674_100007283 3300005356 Bacteria 6516
130 Ga0070674_100057019 3300005356 Bacteria 2710
131 Ga0070674_100130401 3300005356 Bacteria 1873
132 Ga0070674_100511718 3300005356 Bacteria 1001
133 Ga0070674_100828308 3300005356 Unclassified 801
134 Ga0070674_101268761 3300005356 Bacteria 656
135 Ga0070673_100001494 3300005364 Bacteria 13725
136 Ga0070673_100008376 3300005364 Bacteria 6873
137 Ga0070673_100127120 3300005364 Bacteria 2134
138 Ga0070673_100156689 3300005364 Bacteria 1933
139 Ga0070673_100723620 3300005364 Bacteria 915
140 Ga0070688_100009533 3300005365 Bacteria 5317
141 Ga0070688_100019522 3300005365 Bacteria 3927
142 Ga0070688_100034590 3300005365 Bacteria 3062
143 Ga0070688_100070872 3300005365 Bacteria 2230
144 Ga0070688_100308368 3300005365 Bacteria 1146
145 Ga0070659_100036242 3300005366 Bacteria 3844
146 Ga0070659_100046147 3300005366 Bacteria 3415
147 Ga0070659_100439163 3300005366 Bacteria 1105
148 Ga0070659_101303853 3300005366 Bacteria 644
149 Ga0070659_101622729 3300005366 Unclassified 578
150 Ga0070667_100009726 3300005367 Bacteria 7971
151 Ga0070667_100075256 3300005367 Bacteria 2882
152 Ga0070667_100076055 3300005367 Bacteria 2866
153 Ga0070667_100295123 3300005367 Bacteria 1458
154 Ga0070667_101938822 3300005367 Bacteria 555
155 Ga0070667_102060032 3300005367 Unclassified 538
156 Ga0070709_10013606 3300005434 Bacteria 4578
157 Ga0070709_10020245 3300005434 Bacteria 3857
158 Ga0070709_10136412 3300005434 Bacteria 1681
159 Ga0070714_100283485 3300005435 Bacteria 1540
160 Ga0070714_100284036 3300005435 Bacteria 1538
161 Ga0070714_100286935 3300005435 Bacteria 1531
162 Ga0070714_101321526 3300005435 Unclassified 704
163 Ga0070714_101682833 3300005435 Unclassified 620
164 Ga0070713_100006436 3300005436 Bacteria 8144
165 Ga0070713_100051416 3300005436 Bacteria 3407
166 Ga0070713_101964658 3300005436 Unclassified 567
167 Ga0070710_10007070 3300005437 Bacteria 5418
168 Ga0070710_10014307 3300005437 Bacteria 3992
169 Ga0070710_10022863 3300005437 Bacteria 3277
170 Ga0070710_10449250 3300005437 Bacteria 873
171 Ga0070710_10627333 3300005437 Bacteria 751
172 Ga0070701_10041877 3300005438 Bacteria 2335
173 Ga0070701_10247041 3300005438 Bacteria 1076
174 Ga0070701_10890411 3300005438 Bacteria 614
175 Ga0070711_100022460 3300005439 Bacteria 4090
176 Ga0070711_100022906 3300005439 Bacteria 4055
177 Ga0070711_100064500 3300005439 Bacteria 2560
178 Ga0070711_100154504 3300005439 Bacteria 1733
179 Ga0070711_101725379 3300005439 Bacteria 549
180 Ga0070705_100008212 3300005440 Bacteria 5166
181 Ga0070705_100202163 3300005440 Bacteria 1363
182 Ga0070700_100009342 3300005441 Bacteria 5375
183 Ga0070700_100812954 3300005441 Unclassified 754
184 Ga0070694_100019047 3300005444 Bacteria 4362
185 Ga0070694_100052810 3300005444 Bacteria 2748
186 Ga0070708_100380081 3300005445 Bacteria 1332
187 Ga0070708_100542021 3300005445 Bacteria 1098
188 Ga0070663_100088807 3300005455 Bacteria 2286
189 Ga0070663_100256405 3300005455 Bacteria 1386
190 Ga0070663_100471614 3300005455 Bacteria 1038
191 Ga0070663_101093804 3300005455 Bacteria 697
192 Ga0070678_100027153 3300005456 Bacteria 3883
193 Ga0070678_100031223 3300005456 Bacteria 3672
194 Ga0070678_100104169 3300005456 Bacteria 2206
195 Ga0070678_100322047 3300005456 Bacteria 1320
196 Ga0070662_100149122 3300005457 Bacteria 1819
197 Ga0070662_100238406 3300005457 Bacteria 1458
198 Ga0070662_100282943 3300005457 Bacteria 1343
199 Ga0070662_100463066 3300005457 Bacteria 1054
200 Ga0070662_100897995 3300005457 Bacteria 756
201 Ga0070662_101464359 3300005457 Bacteria 589
202 Ga0070681_10086218 3300005458 Bacteria 3093
203 Ga0070681_10129619 3300005458 Bacteria 2454
204 Ga0070681_10204760 3300005458 Bacteria 1891
205 Ga0070681_10400011 3300005458 Bacteria 1285
206 Ga0068867_100049797 3300005459 Bacteria 3084
207 Ga0070685_10001432 3300005466 Bacteria 12514
208 Ga0070685_10047415 3300005466 Bacteria 2471
209 Ga0070685_10105614 3300005466 Bacteria 1726
210 Ga0070685_10908406 3300005466 Bacteria 656
211 Ga0070685_11081771 3300005466 Bacteria 605
212 Ga0070706_100893195 3300005467 Bacteria 821
213 Ga0074259_11045692 3300005507 Bacteria 848
214 Ga0070699_100433672 3300005518 Bacteria 1190
215 Ga0070699_101891822 3300005518 Bacteria 546
216 Ga0070679_100030767 3300005530 Bacteria 5302
217 Ga0070679_100080411 3300005530 Bacteria 3248
218 Ga0070679_100291370 3300005530 Bacteria 1584
219 Ga0070679_100500846 3300005530 Bacteria 1159
220 Ga0070679_100805647 3300005530 Bacteria 882
221 Ga0070679_100991625 3300005530 Bacteria 784
222 Ga0070679_101266935 3300005530 Bacteria 683
223 Ga0070684_100003138 3300005535 Bacteria 12335
224 Ga0070684_100177999 3300005535 Bacteria 1933
225 Ga0070684_100237189 3300005535 Bacteria 1666
226 Ga0070684_100316534 3300005535 Bacteria 1433
227 Ga0070684_101356513 3300005535 Unclassified 669
228 Ga0070684_101661276 3300005535 Bacteria 603
229 Ga0068853_100040979 3300005539 Bacteria 3953
230 Ga0068853_100859941 3300005539 Bacteria 870
231 Ga0070672_100003940 3300005543 Bacteria 9678
232 Ga0070672_100040390 3300005543 Bacteria 3579
233 Ga0070672_100190413 3300005543 Bacteria 1713
234 Ga0070672_100278400 3300005543 Bacteria 1414
235 Ga0070672_100937772 3300005543 Bacteria 766
236 Ga0070672_101503759 3300005543 Bacteria 603
237 Ga0070686_100002212 3300005544 Bacteria 10746
238 Ga0070686_100008334 3300005544 Bacteria 5803
239 Ga0070686_100275441 3300005544 Bacteria 1239
240 Ga0070686_100384232 3300005544 Bacteria 1064
241 Ga0070686_100738121 3300005544 Bacteria 789
242 Ga0070695_100007770 3300005545 Bacteria 6353
243 Ga0070695_101036180 3300005545 Bacteria 669
244 Ga0070696_100037457 3300005546 Bacteria 3346
245 Ga0070696_100160619 3300005546 Bacteria 1655
246 Ga0070693_100310241 3300005547 Bacteria 1067
247 Ga0070693_100333475 3300005547 Bacteria 1033
248 Ga0070693_100889223 3300005547 Bacteria 667
249 Ga0070693_100995939 3300005547 Bacteria 634
250 Ga0070665_100151970 3300005548 Bacteria 2318
251 Ga0070665_100521701 3300005548 Bacteria 1199
252 Ga0070665_100649865 3300005548 Bacteria 1068
253 Ga0070665_100732957 3300005548 Bacteria 1001
254 Ga0070665_101528515 3300005548 Bacteria 676
255 Ga0070665_101581138 3300005548 Bacteria 664
256 Ga0070665_101678704 3300005548 Bacteria 643
257 Ga0070704_100018120 3300005549 Bacteria 4493
258 Ga0068855_100077562 3300005563 Bacteria 3855
259 Ga0068855_100103562 3300005563 Bacteria 3274
260 Ga0068855_101069223 3300005563 Bacteria 845
261 Ga0068855_101076541 3300005563 Bacteria 841
262 Ga0068855_101348547 3300005563 Bacteria 737
263 Ga0070664_100167787 3300005564 Bacteria 1946
264 Ga0070664_100349578 3300005564 Bacteria 1344
265 Ga0070664_100508503 3300005564 Bacteria 1111
266 Ga0070664_101863571 3300005564 Unclassified 570
267 Ga0070664_101888896 3300005564 Unclassified 566
268 Ga0068857_100001961 3300005577 Bacteria 16625
269 Ga0068857_100166413 3300005577 Bacteria 2002
270 Ga0068857_100589513 3300005577 Bacteria 1050
271 Ga0068857_100628233 3300005577 Bacteria 1017
272 Ga0068857_101575533 3300005577 Bacteria 641
273 Ga0068854_100015429 3300005578 Bacteria 5060
274 Ga0068854_100105691 3300005578 Bacteria 2117
275 Ga0068854_100546679 3300005578 Bacteria 982
276 Ga0068856_100004763 3300005614 Bacteria 13455
277 Ga0068856_100167797 3300005614 Bacteria 2206
278 Ga0068856_100315398 3300005614 Bacteria 1581
279 Ga0068856_100368091 3300005614 Bacteria 1456
280 Ga0070702_100018099 3300005615 Bacteria 3647
281 Ga0070702_100034821 3300005615 Bacteria 2778
282 Ga0070702_100201150 3300005615 Bacteria 1319
283 Ga0068852_100019958 3300005616 Bacteria 5320
284 Ga0068859_100009749 3300005617 Bacteria 9700
285 Ga0068859_100033024 3300005617 Bacteria 5198
286 Ga0068859_100116519 3300005617 Bacteria 2736
287 Ga0068859_100141732 3300005617 Bacteria 2477
288 Ga0068859_100163260 3300005617 Bacteria 2307
289 Ga0068864_100030957 3300005618 Bacteria 4537
290 Ga0068864_100063837 3300005618 Bacteria 3192
291 Ga0068864_100127763 3300005618 Bacteria 2279
292 Ga0068864_100231142 3300005618 Bacteria 1710
293 Ga0068864_100476731 3300005618 Bacteria 1197
294 Ga0068866_10007402 3300005718 Bacteria 4593
295 Ga0068866_10043422 3300005718 Bacteria 2244
296 Ga0068866_10181186 3300005718 Bacteria 1244
297 Ga0068866_10191618 3300005718 Bacteria 1215
298 Ga0068866_10202541 3300005718 Bacteria 1187
299 Ga0068861_100080566 3300005719 Bacteria 2547
300 Ga0068861_100104928 3300005719 Bacteria 2256
301 Ga0068861_100241361 3300005719 Bacteria 1537
302 Ga0068861_100349439 3300005719 Bacteria 1297
303 Ga0068851_10108339 3300005834 Bacteria 1481
304 Ga0068870_10043436 3300005840 Bacteria 2344
305 Ga0068870_10089221 3300005840 Bacteria 1720
306 Ga0068870_10252491 3300005840 Bacteria 1094
307 Ga0068863_100054829 3300005841 Bacteria 3776
308 Ga0068863_100178169 3300005841 Bacteria 2040
309 Ga0068863_100638333 3300005841 Bacteria 1055
310 Ga0068858_100021010 3300005842 Bacteria 6099
311 Ga0068858_100046684 3300005842 Bacteria 4015
312 Ga0068858_100058578 3300005842 Bacteria 3562
313 Ga0068858_100145373 3300005842 Bacteria 2226
314 Ga0068858_100572956 3300005842 Bacteria 1094
315 Ga0068858_101495902 3300005842 Bacteria 666
316 Ga0068860_100035725 3300005843 Bacteria 4765
317 Ga0068860_100119160 3300005843 Bacteria 2527
318 Ga0068860_100567708 3300005843 Bacteria 1138
319 Ga0068860_100809128 3300005843 Bacteria 950
320 Ga0068860_101019850 3300005843 Bacteria 846
321 Ga0068862_100023266 3300005844 Bacteria 5190
322 Ga0068862_100040043 3300005844 Bacteria 3982
323 Ga0068862_100420603 3300005844 Bacteria 1254
324 Ga0081455_10000002 3300005937 Bacteria 460472
325 Ga0081455_10019940 3300005937 Bacteria 6330
326 Ga0081455_10029167 3300005937 Bacteria 5033
327 Ga0081540_1008535 3300005983 Bacteria 7149
328 Ga0081539_10001145 3300005985 Bacteria 48039
329 Ga0070717_10042689 3300006028 Bacteria 3699
330 Ga0075365_10385346 3300006038 Bacteria 989
331 Ga0075368_10195978 3300006042 Bacteria 854
332 Ga0075363_100051109 3300006048 Bacteria 2203
333 Ga0075363_100651469 3300006048 Bacteria 634
334 Ga0075363_100657297 3300006048 Bacteria 631
335 Ga0075363_101046821 3300006048 Bacteria 504
336 Ga0075364_10036843 3300006051 Bacteria 3164
337 Ga0075364_10485140 3300006051 Bacteria 845
338 Ga0075432_10002588 3300006058 Bacteria 6041
339 Ga0070715_10131819 3300006163 Bacteria 1204
340 Ga0070716_100016548 3300006173 Bacteria 3809
341 Ga0070716_100210847 3300006173 Bacteria 1298
342 Ga0070716_100634231 3300006173 Bacteria 808
343 Ga0070712_100057506 3300006175 Bacteria 2732
344 Ga0070712_100190284 3300006175 Bacteria 1605
345 Ga0070712_100208477 3300006175 Bacteria 1540
346 Ga0070712_101453058 3300006175 Bacteria 599
347 Ga0075362_10148581 3300006177 Bacteria 1123
348 Ga0075362_10187155 3300006177 Bacteria 1005
349 Ga0075367_10084751 3300006178 Bacteria 1922
350 Ga0075367_10633506 3300006178 Bacteria 680
351 Ga0075367_10760172 3300006178 Bacteria 617
352 Ga0075427_10001340 3300006194 Bacteria 3158
353 Ga0075366_10044141 3300006195 Bacteria 2641
354 Ga0075366_10047333 3300006195 Bacteria 2549
355 Ga0075366_10393432 3300006195 Bacteria 853
356 Ga0075366_10493541 3300006195 Bacteria 757
357 Ga0075366_10584670 3300006195 Bacteria 692
358 Ga0097621_100007980 3300006237 Bacteria 7596
359 Ga0097621_100041982 3300006237 Bacteria 3683
360 Ga0097621_100894498 3300006237 Bacteria 827
361 Ga0097621_102018666 3300006237 Bacteria 551
362 Ga0075370_10122430 3300006353 Bacteria 1515
363 Ga0075370_10134183 3300006353 Bacteria 1445
364 Ga0075370_10544330 3300006353 Bacteria 702
365 Ga0068871_100073528 3300006358 Bacteria 2818
366 Ga0068871_100107394 3300006358 Bacteria 2344
367 Ga0068871_100244036 3300006358 Bacteria 1563
368 Ga0075428_100001993 3300006844 Bacteria 22014
369 Ga0075428_102569227 3300006844 Unclassified 521
370 Ga0075430_100001212 3300006846 Bacteria 20739
371 Ga0075430_101075291 3300006846 Bacteria 663
372 Ga0075431_100001346 3300006847 Bacteria 22490
373 Ga0075431_100322801 3300006847 Bacteria 1557
374 Ga0075433_10000231 3300006852 Bacteria 31958
375 Ga0075433_10069149 3300006852 Bacteria 3100
376 Ga0075433_10192270 3300006852 Bacteria 1815
377 Ga0075433_10591644 3300006852 Unclassified 974
378 Ga0075434_100000271 3300006871 Bacteria 36857
379 Ga0075434_100002891 3300006871 Bacteria 15241
380 Ga0075434_100033175 3300006871 Bacteria 5093
381 Ga0075434_100382237 3300006871 Bacteria 1429
382 Ga0075434_100568011 3300006871 Bacteria 1154
383 Ga0075429_100011789 3300006880 Bacteria 7579
384 Ga0075429_101909791 3300006880 Bacteria 514
385 Ga0068865_100002668 3300006881 Bacteria 10591
386 Ga0068865_100144664 3300006881 Bacteria 1796
387 Ga0068865_100348727 3300006881 Bacteria 1199
388 Ga0068865_100457384 3300006881 Bacteria 1057
389 Ga0075436_100205070 3300006914 Bacteria 1397
390 Ga0097620_100009749 3300006931 Bacteria 9700
391 Ga0097620_100033023 3300006931 Bacteria 5198
392 Ga0097620_100116529 3300006931 Bacteria 2736
393 Ga0097620_100141729 3300006931 Bacteria 2477
394 Ga0097620_100163263 3300006931 Bacteria 2307
395 Ga0075435_100042621 3300007076 Bacteria 3631
396 Ga0075435_100130523 3300007076 Bacteria 2102
397 Ga0075435_100377910 3300007076 Bacteria 1217
398 Ga0075435_100761052 3300007076 Bacteria 843
399 Ga0105251_10008273 3300009011 Bacteria 6285
400 Ga0105251_10062902 3300009011 Bacteria 1742
401 Ga0105250_10137138 3300009092 Bacteria 1012
402 Ga0105240_10083366 3300009093 Bacteria 3923
403 Ga0105240_10102700 3300009093 Bacteria 3474
404 Ga0105240_10393027 3300009093 Bacteria 1564
405 Ga0105240_11980649 3300009093 Bacteria 605
406 Ga0111539_10001391 3300009094 Bacteria 32180
407 Ga0111539_10002666 3300009094 Bacteria 23636
408 Ga0111539_10180804 3300009094 Bacteria 2463
409 Ga0111539_10738288 3300009094 Bacteria 1146
410 Ga0111539_10886316 3300009094 Bacteria 1038
411 Ga0105245_10005838 3300009098 Bacteria 10807
412 Ga0105245_10163071 3300009098 Bacteria 2116
413 Ga0105245_10246712 3300009098 Bacteria 1733
414 Ga0105245_10339459 3300009098 Bacteria 1485
415 Ga0105245_10780139 3300009098 Bacteria 993
416 Ga0105245_10873253 3300009098 Bacteria 940
417 Ga0105245_11376852 3300009098 Bacteria 755
418 Ga0105245_12283640 3300009098 Unclassified 595
419 Ga0105247_10018150 3300009101 Bacteria 4219
420 Ga0105247_10042054 3300009101 Bacteria 2797
421 Ga0105247_10044647 3300009101 Bacteria 2718
422 Ga0105247_10077139 3300009101 Bacteria 2094
423 Ga0105247_10708601 3300009101 Bacteria 758
424 Ga0105247_10708801 3300009101 Bacteria 758
425 Ga0114129_10006834 3300009147 Bacteria 16211
426 Ga0114129_10036823 3300009147 Bacteria 6909
427 Ga0114129_11373971 3300009147 Bacteria 872
428 Ga0105243_10009397 3300009148 Bacteria 7452
429 Ga0105243_10010661 3300009148 Bacteria 6970
430 Ga0105243_10031006 3300009148 Bacteria 4121
431 Ga0105243_10250602 3300009148 Bacteria 1581
432 Ga0105243_10332414 3300009148 Bacteria 1388
433 Ga0105243_10457157 3300009148 Bacteria 1199
434 Ga0105243_10595515 3300009148 Bacteria 1064
435 Ga0105241_10039056 3300009174 Bacteria 3580
436 Ga0105241_10062361 3300009174 Bacteria 2874
437 Ga0105241_10585908 3300009174 Bacteria 1006
438 Ga0105241_11242333 3300009174 Unclassified 707
439 Ga0105241_12611110 3300009174 Unclassified 507
440 Ga0105242_10003276 3300009176 Bacteria 12623
441 Ga0105242_10005721 3300009176 Bacteria 9585
442 Ga0105242_10341076 3300009176 Bacteria 1381
443 Ga0105242_10393608 3300009176 Bacteria 1291
444 Ga0105242_10762867 3300009176 Bacteria 954
445 Ga0105242_12107298 3300009176 Unclassified 608
446 Ga0105242_12542501 3300009176 Bacteria 561
447 Ga0105248_10029352 3300009177 Bacteria 6136
448 Ga0105248_10079139 3300009177 Bacteria 3694
449 Ga0105248_10157605 3300009177 Bacteria 2561
450 Ga0105248_10235505 3300009177 Bacteria 2061
451 Ga0105248_10452519 3300009177 Bacteria 1447
452 Ga0105248_10473530 3300009177 Bacteria 1412
453 Ga0105248_11367092 3300009177 Unclassified 801
454 Ga0105237_10026078 3300009545 Bacteria 5973
455 Ga0105237_10073011 3300009545 Bacteria 3424
456 Ga0105237_10130802 3300009545 Bacteria 2504
457 Ga0105237_10618425 3300009545 Bacteria 1090
458 Ga0105238_10189552 3300009551 Bacteria 2033
459 Ga0105238_10205250 3300009551 Bacteria 1946
460 Ga0105238_10490090 3300009551 Bacteria 1229
461 Ga0105238_10943893 3300009551 Bacteria 882
462 Ga0105249_10003707 3300009553 Bacteria 13173
463 Ga0105249_10014965 3300009553 Bacteria 6861
464 Ga0105249_10073413 3300009553 Bacteria 3165
465 Ga0105249_10267297 3300009553 Bacteria 1702
466 Ga0105249_10351380 3300009553 Bacteria 1494
467 Ga0105239_10133814 3300010375 Bacteria 2759
468 Ga0105239_10656541 3300010375 Bacteria 1198
469 Ga0105239_10712688 3300010375 Bacteria 1148
470 Ga0105239_11396563 3300010375 Bacteria 808
471 Ga0105239_11442052 3300010375 Bacteria 795
472 Ga0105246_10048292 3300011119 Bacteria 2909
473 Ga0105246_10081786 3300011119 Bacteria 2303
474 Ga0105246_10492719 3300011119 Bacteria 1039
475 Ga0105246_11395800 3300011119 Bacteria 653
476 Ga0105246_11893924 3300011119 Bacteria 572
477 Ga0105246_11944648 3300011119 Bacteria 566
478 Ga0157320_1006350 3300012481 Unclassified 816
479 Ga0157335_1008294 3300012492 Unclassified 794
480 Ga0157314_1005362 3300012500 Bacteria 971
481 Ga0157342_1003016 3300012507 Bacteria 1416
482 Ga0157342_1021216 3300012507 Unclassified 756
483 Ga0157316_1024435 3300012510 Unclassified 687
484 Ga0157338_1002194 3300012515 Bacteria 1510
485 Ga0157373_10143510 3300013100 Bacteria 1679
486 Ga0157373_11015290 3300013100 Bacteria 619
487 Ga0157371_10106981 3300013102 Bacteria 1985
488 Ga0157371_10378349 3300013102 Bacteria 1033
489 Ga0157371_11326895 3300013102 Bacteria 557
490 Ga0157370_10059670 3300013104 Bacteria 3624
491 Ga0157369_10612662 3300013105 Bacteria 1123
492 Ga0157369_11399298 3300013105 Bacteria 712
493 Ga0157374_10045399 3300013296 Bacteria 4067
494 Ga0157374_10223145 3300013296 Bacteria 1850
495 Ga0157374_11774130 3300013296 Bacteria 642
496 Ga0157378_10082090 3300013297 Bacteria 2914
497 Ga0157378_10330926 3300013297 Bacteria 1482
498 Ga0157378_10334752 3300013297 Bacteria 1474
499 Ga0157378_10364052 3300013297 Bacteria 1416
500 Ga0157378_10423049 3300013297 Bacteria 1317
501 Ga0157378_10598655 3300013297 Bacteria 1113
502 Ga0157378_10806015 3300013297 Bacteria 965
503 Ga0157378_10911881 3300013297 Bacteria 910
504 Ga0157378_11317773 3300013297 Bacteria 763
505 Ga0157378_11415936 3300013297 Bacteria 738
506 Ga0157378_11745722 3300013297 Bacteria 670
507 Ga0163162_10035395 3300013306 Bacteria 4974
508 Ga0163162_10124566 3300013306 Bacteria 2683
509 Ga0163162_10128488 3300013306 Bacteria 2642
510 Ga0163162_10168250 3300013306 Bacteria 2316
511 Ga0163162_10238191 3300013306 Bacteria 1950
512 Ga0163162_10353065 3300013306 Bacteria 1603
513 Ga0163162_10633137 3300013306 Bacteria 1194
514 Ga0163162_11188430 3300013306 Bacteria 865
515 Ga0163162_11811566 3300013306 Bacteria 698
516 Ga0163162_11963185 3300013306 Unclassified 670
517 Ga0157372_10236574 3300013307 Bacteria 2118
518 Ga0157372_10387219 3300013307 Bacteria 1629
519 Ga0157372_10849130 3300013307 Bacteria 1060
520 Ga0157372_12685608 3300013307 Bacteria 571
521 Ga0157375_10005918 3300013308 Bacteria 10659
522 Ga0157375_10089973 3300013308 Bacteria 3127
523 Ga0157375_10224963 3300013308 Bacteria 2035
524 Ga0157375_11020280 3300013308 Bacteria 966
525 Ga0157375_11079265 3300013308 Bacteria 939
526 Ga0157375_11521651 3300013308 Bacteria 790
527 Ga0157375_12093632 3300013308 Unclassified 673
528 Ga0163163_10004653 3300014325 Bacteria 11731
529 Ga0163163_10052605 3300014325 Bacteria 4018
530 Ga0163163_10299506 3300014325 Bacteria 1661
531 Ga0163163_10384875 3300014325 Bacteria 1460
532 Ga0163163_10406742 3300014325 Bacteria 1419
533 Ga0163163_10562337 3300014325 Bacteria 1203
534 Ga0163163_11487493 3300014325 Bacteria 739
535 Ga0163163_11837751 3300014325 Bacteria 666
536 Ga0157380_10058175 3300014326 Bacteria 3081
537 Ga0157380_10074370 3300014326 Bacteria 2758
538 Ga0157380_10084337 3300014326 Bacteria 2605
539 Ga0157380_10318436 3300014326 Bacteria 1441
540 Ga0157380_10792133 3300014326 Bacteria 964
541 Ga0157380_11040351 3300014326 Bacteria 854
542 Ga0157380_11130091 3300014326 Bacteria 824
543 Ga0157380_11210180 3300014326 Bacteria 799
544 Ga0182008_10171732 3300014497 Bacteria 1095
545 Ga0157377_10008866 3300014745 Bacteria 4920
546 Ga0157377_10207502 3300014745 Bacteria 1247
547 Ga0157377_10532078 3300014745 Bacteria 827
548 Ga0157377_10594649 3300014745 Bacteria 788
549 Ga0157379_10002897 3300014968 Bacteria 14477
550 Ga0157379_10282818 3300014968 Bacteria 1510
551 Ga0157379_10663087 3300014968 Bacteria 977
552 Ga0157379_10772029 3300014968 Bacteria 906
553 Ga0157379_11049507 3300014968 Bacteria 779
554 Ga0157376_10010022 3300014969 Bacteria 6913
555 Ga0157376_10112470 3300014969 Bacteria 2399
556 Ga0157376_10449437 3300014969 Bacteria 1257
557 Ga0157376_10462213 3300014969 Bacteria 1240
558 Ga0157376_10809146 3300014969 Bacteria 950
559 Ga0157376_11115914 3300014969 Unclassified 815
560 Ga0163161_10110481 3300017792 Bacteria 2055
561 Ga0163161_10116831 3300017792 Bacteria 2000
562 Ga0163161_10218255 3300017792 Bacteria 1476
563 Ga0163161_10954155 3300017792 Bacteria 730
564 Ga0206356_10579931 3300020070 Bacteria 981
565 Ga0206353_11558917 3300020082 Bacteria 1027
566 Ga0207666_1000393 3300025271 Bacteria 5770
567 Ga0207666_1001518 3300025271 Bacteria 2736
568 Ga0207673_1002171 3300025290 Bacteria 2212
569 Ga0207697_10001423 3300025315 Bacteria 13083
570 Ga0207697_10021843 3300025315 Bacteria 2622
571 Ga0207697_10055430 3300025315 Bacteria 1643
572 Ga0207697_10167306 3300025315 Bacteria 961
573 Ga0207697_10313426 3300025315 Unclassified 696
574 Ga0207656_10273420 3300025321 Bacteria 832
575 Ga0207696_1052248 3300025711 Bacteria 1165
576 Ga0207713_1099262 3300025735 Bacteria 1008
577 Ga0207653_10035308 3300025885 Bacteria 1626
578 Ga0207682_10000011 3300025893 Bacteria 85533
579 Ga0207682_10041920 3300025893 Bacteria 1869
580 Ga0207682_10111283 3300025893 Bacteria 1206
581 Ga0207682_10411705 3300025893 Bacteria 639
582 Ga0207692_10007288 3300025898 Bacteria 4527
583 Ga0207692_10101974 3300025898 Bacteria 1577
584 Ga0207642_10064016 3300025899 Bacteria 1722
585 Ga0207642_10075287 3300025899 Bacteria 1621
586 Ga0207642_10124091 3300025899 Bacteria 1337
587 Ga0207642_10300547 3300025899 Bacteria 930
588 Ga0207710_10016430 3300025900 Bacteria 3131
589 Ga0207710_10023260 3300025900 Bacteria 2663
590 Ga0207710_10100784 3300025900 Bacteria 1362
591 Ga0207710_10618379 3300025900 Bacteria 566
592 Ga0207688_10001874 3300025901 Bacteria 11255
593 Ga0207688_10082057 3300025901 Bacteria 1842
594 Ga0207688_10475585 3300025901 Bacteria 781
595 Ga0207680_10031008 3300025903 Bacteria 3024
596 Ga0207680_10049820 3300025903 Bacteria 2495
597 Ga0207680_10097247 3300025903 Bacteria 1885
598 Ga0207647_10004915 3300025904 Bacteria 9863
599 Ga0207685_10018827 3300025905 Bacteria 2263
600 Ga0207699_10139950 3300025906 Bacteria 1590
601 Ga0207699_10630297 3300025906 Bacteria 782
602 Ga0207645_10002566 3300025907 Bacteria 14176
603 Ga0207645_10029800 3300025907 Bacteria 3517
604 Ga0207645_10039229 3300025907 Bacteria 3034
605 Ga0207643_10000475 3300025908 Bacteria 25958
606 Ga0207643_10063428 3300025908 Bacteria 2113
607 Ga0207643_10082391 3300025908 Bacteria 1865
608 Ga0207643_10138084 3300025908 Bacteria 1454
609 Ga0207643_10255255 3300025908 Bacteria 1081
610 Ga0207643_11150140 3300025908 Bacteria 500
611 Ga0207705_10082314 3300025909 Bacteria 2347
612 Ga0207654_10069113 3300025911 Bacteria 2092
613 Ga0207654_10329719 3300025911 Bacteria 1046
614 Ga0207707_10046478 3300025912 Bacteria 3781
615 Ga0207707_10127082 3300025912 Bacteria 2229
616 Ga0207707_10176082 3300025912 Bacteria 1869
617 Ga0207707_10194568 3300025912 Bacteria 1769
618 Ga0207707_10715453 3300025912 Bacteria 840
619 Ga0207695_10337156 3300025913 Bacteria 1396
620 Ga0207671_10039663 3300025914 Bacteria 3487
621 Ga0207671_11122096 3300025914 Bacteria 617
622 Ga0207693_10003988 3300025915 Bacteria 12543
623 Ga0207693_10064296 3300025915 Bacteria 2873
624 Ga0207693_10067631 3300025915 Bacteria 2797
625 Ga0207693_10137058 3300025915 Bacteria 1924
626 Ga0207693_10879009 3300025915 Unclassified 688
627 Ga0207693_11124506 3300025915 Bacteria 596
628 Ga0207663_10005887 3300025916 Bacteria 6219
629 Ga0207663_10040868 3300025916 Bacteria 2822
630 Ga0207663_10133043 3300025916 Bacteria 1721
631 Ga0207663_10149495 3300025916 Bacteria 1637
632 Ga0207663_10282049 3300025916 Bacteria 1234
633 Ga0207660_10007573 3300025917 Bacteria 7028
634 Ga0207660_10027932 3300025917 Bacteria 3856
635 Ga0207660_10525137 3300025917 Bacteria 961
636 Ga0207662_10149256 3300025918 Bacteria 1486
637 Ga0207662_10278471 3300025918 Bacteria 1106
638 Ga0207657_10006965 3300025919 Bacteria 11645
639 Ga0207657_10013146 3300025919 Bacteria 8129
640 Ga0207657_10079346 3300025919 Bacteria 2762
641 Ga0207657_10080003 3300025919 Bacteria 2748
642 Ga0207649_10015935 3300025920 Bacteria 4230
643 Ga0207652_10018065 3300025921 Bacteria 5782
644 Ga0207652_10294926 3300025921 Bacteria 1463
645 Ga0207652_10349033 3300025921 Bacteria 1335
646 Ga0207652_11321439 3300025921 Bacteria 624
647 Ga0207681_10008142 3300025923 Bacteria 6411
648 Ga0207681_10012993 3300025923 Bacteria 5147
649 Ga0207681_10046407 3300025923 Bacteria 2922
650 Ga0207681_10305061 3300025923 Bacteria 1261
651 Ga0207681_10661911 3300025923 Bacteria 866
652 Ga0207681_10860747 3300025923 Bacteria 758
653 Ga0207681_10971434 3300025923 Bacteria 712
654 Ga0207681_11306276 3300025923 Bacteria 609
655 Ga0207681_11312348 3300025923 Bacteria 608
656 Ga0207694_10130079 3300025924 Bacteria 2017
657 Ga0207694_10442199 3300025924 Bacteria 1085
658 Ga0207694_10526370 3300025924 Bacteria 991
659 Ga0207694_10787548 3300025924 Bacteria 803
660 Ga0207694_10876204 3300025924 Bacteria 759
661 Ga0207650_10044585 3300025925 Bacteria 3260
662 Ga0207650_10046166 3300025925 Bacteria 3207
663 Ga0207650_10245093 3300025925 Bacteria 1449
664 Ga0207650_10264018 3300025925 Bacteria 1397
665 Ga0207650_10293432 3300025925 Bacteria 1326
666 Ga0207659_10007130 3300025926 Bacteria 6859
667 Ga0207659_10032306 3300025926 Bacteria 3591
668 Ga0207659_10069004 3300025926 Bacteria 2573
669 Ga0207659_10250594 3300025926 Bacteria 1437
670 Ga0207659_10720247 3300025926 Bacteria 855
671 Ga0207659_10938573 3300025926 Bacteria 744
672 Ga0207687_10023979 3300025927 Bacteria 4071
673 Ga0207687_10368044 3300025927 Bacteria 1175
674 Ga0207687_10446436 3300025927 Bacteria 1072
675 Ga0207700_10000590 3300025928 Bacteria 21178
676 Ga0207700_10344997 3300025928 Bacteria 1295
677 Ga0207700_10637659 3300025928 Bacteria 949
678 Ga0207664_10176503 3300025929 Bacteria 1832
679 Ga0207664_10401290 3300025929 Bacteria 1219
680 Ga0207644_10055847 3300025931 Bacteria 2847
681 Ga0207644_10169004 3300025931 Bacteria 1705
682 Ga0207644_10380382 3300025931 Bacteria 1151
683 Ga0207644_10624295 3300025931 Bacteria 896
684 Ga0207690_10029129 3300025932 Bacteria 3507
685 Ga0207690_10030597 3300025932 Bacteria 3436
686 Ga0207690_10133527 3300025932 Bacteria 1820
687 Ga0207690_10624646 3300025932 Bacteria 881
688 Ga0207690_10720406 3300025932 Bacteria 821
689 Ga0207706_10003321 3300025933 Bacteria 15400
690 Ga0207706_10006855 3300025933 Bacteria 10533
691 Ga0207706_10020645 3300025933 Bacteria 5920
692 Ga0207706_10265779 3300025933 Bacteria 1497
693 Ga0207706_10304272 3300025933 Bacteria 1389
694 Ga0207706_10366346 3300025933 Bacteria 1252
695 Ga0207706_10510400 3300025933 Bacteria 1037
696 Ga0207686_10002829 3300025934 Bacteria 9373
697 Ga0207686_10039069 3300025934 Bacteria 2877
698 Ga0207686_10717609 3300025934 Bacteria 796
699 Ga0207686_11029285 3300025934 Bacteria 669
700 Ga0207709_10029372 3300025935 Bacteria 3188
701 Ga0207709_10031125 3300025935 Bacteria 3113
702 Ga0207709_10160865 3300025935 Bacteria 1566
703 Ga0207709_10661990 3300025935 Bacteria 832
704 Ga0207670_10001929 3300025936 Bacteria 10858
705 Ga0207670_10009328 3300025936 Bacteria 5596
706 Ga0207670_10191362 3300025936 Bacteria 1548
707 Ga0207670_10345542 3300025936 Bacteria 1177
708 Ga0207670_10429860 3300025936 Bacteria 1061
709 Ga0207670_10609770 3300025936 Bacteria 897
710 Ga0207670_11073078 3300025936 Bacteria 679
711 Ga0207670_11135889 3300025936 Bacteria 660
712 Ga0207669_10019856 3300025937 Bacteria 3508
713 Ga0207669_10054461 3300025937 Bacteria 2416
714 Ga0207669_10069191 3300025937 Bacteria 2207
715 Ga0207669_10475707 3300025937 Bacteria 995
716 Ga0207669_10907219 3300025937 Unclassified 736
717 Ga0207669_11664353 3300025937 Bacteria 545
718 Ga0207704_10021370 3300025938 Bacteria 3445
719 Ga0207704_10029365 3300025938 Bacteria 3065
720 Ga0207704_10065962 3300025938 Bacteria 2269
721 Ga0207704_10312800 3300025938 Bacteria 1208
722 Ga0207704_10683634 3300025938 Unclassified 848
723 Ga0207704_11276465 3300025938 Bacteria 627
724 Ga0207665_10004273 3300025939 Bacteria 9495
725 Ga0207665_10075711 3300025939 Bacteria 2306
726 Ga0207665_10276765 3300025939 Bacteria 1248
727 Ga0207665_10705855 3300025939 Bacteria 793
728 Ga0207691_10001529 3300025940 Bacteria 23010
729 Ga0207691_10006103 3300025940 Bacteria 11645
730 Ga0207691_10177416 3300025940 Bacteria 1863
731 Ga0207711_10024459 3300025941 Bacteria 5061
732 Ga0207711_10033714 3300025941 Bacteria 4334
733 Ga0207711_10101789 3300025941 Bacteria 2542
734 Ga0207711_10191867 3300025941 Bacteria 1862
735 Ga0207711_10590610 3300025941 Bacteria 1036
736 Ga0207689_10010443 3300025942 Bacteria 7995
737 Ga0207689_10035385 3300025942 Bacteria 4149
738 Ga0207689_10185638 3300025942 Bacteria 1715
739 Ga0207689_10686310 3300025942 Bacteria 863
740 Ga0207689_10823118 3300025942 Bacteria 784
741 Ga0207689_10884844 3300025942 Bacteria 754
742 Ga0207661_10034548 3300025944 Bacteria 3933
743 Ga0207661_10580356 3300025944 Bacteria 1028
744 Ga0207679_10000026 3300025945 Bacteria 200073
745 Ga0207679_10185234 3300025945 Bacteria 1725
746 Ga0207679_10306409 3300025945 Bacteria 1371
747 Ga0207679_10312475 3300025945 Bacteria 1358
748 Ga0207667_10140896 3300025949 Bacteria 2483
749 Ga0207667_10174568 3300025949 Bacteria 2208
750 Ga0207667_11513924 3300025949 Bacteria 642
751 Ga0207651_10048116 3300025960 Bacteria 2880
752 Ga0207651_10059622 3300025960 Bacteria 2645
753 Ga0207651_10512418 3300025960 Bacteria 1039
754 Ga0207651_10700372 3300025960 Bacteria 892
755 Ga0207712_10066659 3300025961 Bacteria 2574
756 Ga0207712_10082112 3300025961 Bacteria 2349
757 Ga0207712_10194674 3300025961 Bacteria 1603
758 Ga0207712_10534378 3300025961 Bacteria 1007
759 Ga0207712_10568255 3300025961 Bacteria 977
760 Ga0207668_10033737 3300025972 Bacteria 3392
761 Ga0207668_10232065 3300025972 Bacteria 1488
762 Ga0207668_10360607 3300025972 Bacteria 1218
763 Ga0207668_10556512 3300025972 Bacteria 994
764 Ga0207668_10712145 3300025972 Bacteria 883
765 Ga0207640_10012026 3300025981 Bacteria 4920
766 Ga0207640_10035916 3300025981 Bacteria 3106
767 Ga0207640_10683339 3300025981 Bacteria 878
768 Ga0207640_10946681 3300025981 Bacteria 755
769 Ga0207640_11048021 3300025981 Bacteria 719
770 Ga0207658_10005999 3300025986 Bacteria 8304
771 Ga0207658_10034072 3300025986 Bacteria 3636
772 Ga0207658_10115156 3300025986 Bacteria 2133
773 Ga0207658_10252118 3300025986 Bacteria 1500
774 Ga0207677_10021431 3300026023 Bacteria 3948
775 Ga0207677_10112586 3300026023 Bacteria 2030
776 Ga0207677_10422746 3300026023 Bacteria 1135
777 Ga0207677_10883150 3300026023 Bacteria 805
778 Ga0207677_11255219 3300026023 Bacteria 679
779 Ga0207703_10007676 3300026035 Bacteria 8549
780 Ga0207703_10048609 3300026035 Bacteria 3425
781 Ga0207703_10139494 3300026035 Bacteria 2103
782 Ga0207703_10198411 3300026035 Bacteria 1782
783 Ga0207639_10022654 3300026041 Bacteria 4526
784 Ga0207639_11194774 3300026041 Bacteria 714
785 Ga0207678_10010041 3300026067 Bacteria 8309
786 Ga0207678_10017622 3300026067 Bacteria 6269
787 Ga0207678_10035632 3300026067 Bacteria 4332
788 Ga0207678_10091110 3300026067 Bacteria 2606
789 Ga0207708_10021489 3300026075 Bacteria 4867
790 Ga0207708_10032885 3300026075 Bacteria 3938
791 Ga0207708_10479810 3300026075 Bacteria 1039
792 Ga0207708_10554968 3300026075 Bacteria 969
793 Ga0207708_11749911 3300026075 Bacteria 546
794 Ga0207702_10041304 3300026078 Bacteria 3867
795 Ga0207702_10050509 3300026078 Bacteria 3511
796 Ga0207702_10283080 3300026078 Bacteria 1568
797 Ga0207702_10292993 3300026078 Bacteria 1542
798 Ga0207702_10893975 3300026078 Bacteria 880
799 Ga0207641_10049153 3300026088 Bacteria 3562
800 Ga0207641_10253445 3300026088 Bacteria 1644
801 Ga0207641_10257253 3300026088 Bacteria 1633
802 Ga0207641_10311368 3300026088 Bacteria 1490
803 Ga0207648_10012087 3300026089 Bacteria 8097
804 Ga0207648_10040492 3300026089 Bacteria 4094
805 Ga0207648_10225793 3300026089 Bacteria 1665
806 Ga0207676_10035528 3300026095 Bacteria 3783
807 Ga0207676_10068453 3300026095 Bacteria 2839
808 Ga0207676_10092759 3300026095 Bacteria 2484
809 Ga0207676_10446306 3300026095 Bacteria 1218
810 Ga0207676_11453693 3300026095 Bacteria 682
811 Ga0207674_10003206 3300026116 Bacteria 20153
812 Ga0207674_10190439 3300026116 Bacteria 2001
813 Ga0207674_10823980 3300026116 Bacteria 895
814 Ga0207674_11404071 3300026116 Bacteria 667
815 Ga0207675_100008845 3300026118 Bacteria 9448
816 Ga0207675_100011363 3300026118 Bacteria 8332
817 Ga0207675_100083027 3300026118 Bacteria 3005
818 Ga0207675_100456736 3300026118 Bacteria 1266
819 Ga0207675_100535287 3300026118 Bacteria 1169
820 Ga0207683_10001717 3300026121 Bacteria 19589
821 Ga0207683_10004174 3300026121 Bacteria 12505
822 Ga0207683_10039179 3300026121 Bacteria 4134
823 Ga0207683_10053626 3300026121 Bacteria 3536
824 Ga0207698_10188576 3300026142 Bacteria 1834
825 Ga0207698_10659413 3300026142 Bacteria 1037
826 Ga0209973_1008986 3300027252 Bacteria 1153
827 Ga0209967_1012317 3300027364 Bacteria 1207
828 Ga0209984_1001182 3300027424 Bacteria 2800
829 Ga0210000_1005857 3300027462 Bacteria 1787
830 Ga0209995_1028367 3300027471 Bacteria 935
831 Ga0209968_1018157 3300027526 Bacteria 1125
832 Ga0209999_1025956 3300027543 Bacteria 1082
833 Ga0209982_1002993 3300027552 Bacteria 2387
834 Ga0210002_1001290 3300027617 Bacteria 3500
835 Ga0209983_1004354 3300027665 Bacteria 2977
836 Ga0209971_1007432 3300027682 Bacteria 2600
837 Ga0209966_1001108 3300027695 Bacteria 4850
838 Ga0209998_10023943 3300027717 Bacteria 1323
839 Ga0209813_10049118 3300027866 Bacteria 1312
840 Ga0209974_10122607 3300027876 Bacteria 922
841 Ga0207428_10000082 3300027907 Bacteria 133684
842 Ga0207428_10000851 3300027907 Bacteria 34354
843 Ga0207428_10003417 3300027907 Bacteria 15429
844 Ga0207428_10047756 3300027907 Bacteria 3437
845 Ga0207428_10749768 3300027907 Unclassified 696
846 Ga0207428_10865681 3300027907 Bacteria 640
847 Ga0207428_11184320 3300027907 Bacteria 532
848 Ga0268266_10074102 3300028379 Bacteria 2955
849 Ga0268266_10097469 3300028379 Bacteria 2586
850 Ga0268266_10500292 3300028379 Bacteria 1160
851 Ga0268266_10633142 3300028379 Bacteria 1029
852 Ga0268266_10756019 3300028379 Bacteria 938
853 Ga0268266_12161329 3300028379 Bacteria 529
854 Ga0268265_10006616 3300028380 Bacteria 7845
855 Ga0268265_10257066 3300028380 Bacteria 1551
856 Ga0268265_10489154 3300028380 Bacteria 1157
857 Ga0268265_10506826 3300028380 Bacteria 1138
858 Ga0268265_10610338 3300028380 Bacteria 1044
859 Ga0268265_11821433 3300028380 Bacteria 615
860 Ga0268264_10073734 3300028381 Bacteria 2898
861 Ga0268264_10577436 3300028381 Bacteria 1105
862 Ga0268264_11923867 3300028381 Bacteria 601
863 Ga0265337_1000345 3300028556 Bacteria 24838
864 Ga0265319_1173838 3300028563 Bacteria 664
865 Ga0265318_10044752 3300028577 Bacteria 1674
866 Ga0265338_10029171 3300028800 Bacteria 5478
867 Ga0265338_10336927 3300028800 Bacteria 1088
868 Ga0265338_10394638 3300028800 Bacteria 987
869 Ga0265338_10466405 3300028800 Bacteria 893
870 Ga0265330_10011405 3300031235 Bacteria 4169
871 Ga0265330_10016486 3300031235 Bacteria 3408
872 Ga0265332_10127991 3300031238 Bacteria 1065
873 Ga0265332_10232371 3300031238 Bacteria 764
874 Ga0265328_10129840 3300031239 Bacteria 943
875 Ga0265320_10006100 3300031240 Bacteria 7643
876 Ga0265320_10117184 3300031240 Bacteria 1217
877 Ga0265325_10000043 3300031241 Bacteria 89158
878 Ga0265325_10001294 3300031241 Bacteria 17719
879 Ga0265325_10002112 3300031241 Bacteria 13571
880 Ga0265325_10012366 3300031241 Bacteria 4884
881 Ga0265325_10040986 3300031241 Bacteria 2429
882 Ga0265325_10142364 3300031241 Bacteria 1139
883 Ga0265325_10154031 3300031241 Bacteria 1085
884 Ga0265325_10173059 3300031241 Bacteria 1009
885 Ga0265329_10014517 3300031242 Bacteria 2778
886 Ga0265340_10085252 3300031247 Bacteria 1482
887 Ga0265340_10145012 3300031247 Bacteria 1084
888 Ga0265340_10145643 3300031247 Bacteria 1082
889 Ga0265339_10013004 3300031249 Bacteria 5059
890 Ga0265339_10048152 3300031249 Bacteria 2338
891 Ga0265339_10059579 3300031249 Bacteria 2059
892 Ga0265339_10118125 3300031249 Bacteria 1365
893 Ga0265339_10417828 3300031249 Bacteria 625
894 Ga0265331_10110089 3300031250 Bacteria 1263
895 Ga0265316_10044636 3300031344 Bacteria 3523
896 Ga0265316_10045794 3300031344 Bacteria 3471
897 Ga0265316_10127976 3300031344 Bacteria 1914
898 Ga0265316_10218705 3300031344 Bacteria 1406
899 Ga0265316_10228147 3300031344 Bacteria 1372
900 Ga0265316_10442037 3300031344 Bacteria 933
901 Ga0307513_10112226 3300031456 Bacteria 2717
902 Ga0307513_10263332 3300031456 Bacteria 1512
903 Ga0307509_10515605 3300031507 Bacteria 878
904 Ga0265313_10004856 3300031595 Bacteria 10101
905 Ga0265313_10010603 3300031595 Bacteria 5805
906 Ga0265313_10020231 3300031595 Bacteria 3677
907 Ga0265313_10080603 3300031595 Bacteria 1479
908 Ga0265313_10085514 3300031595 Bacteria 1425
909 Ga0265313_10148776 3300031595 Bacteria 1002
910 Ga0265313_10321987 3300031595 Unclassified 617
911 Ga0316575_10051176 3300031665 Bacteria 1645
912 Ga0316579_10001828 3300031691 Bacteria 7860
913 Ga0265314_10004593 3300031711 Bacteria 12745
914 Ga0265314_10005498 3300031711 Bacteria 11415
915 Ga0265314_10154504 3300031711 Bacteria 1403
916 Ga0265342_10005370 3300031712 Bacteria 9787
917 Ga0265342_10007969 3300031712 Bacteria 7669
918 Ga0265342_10052475 3300031712 Bacteria 2430
919 Ga0307405_10315655 3300031731 Bacteria 1192
920 Ga0307413_11236719 3300031824 Bacteria 651
921 Ga0307410_10211707 3300031852 Bacteria 1486
922 Ga0307416_101163610 3300032002 Bacteria 877
923 Ga0307416_101928945 3300032002 Bacteria 694
924 Ga0307414_10332939 3300032004 Bacteria 1297
925 Ga0316583_10112386 3300032133 Bacteria 949
926 Ga0316593_10118353 3300032168 Bacteria 950
927 Ga0373930_0006379 3300034816 Bacteria 1993
928 Ga0373930_0035685 3300034816 Bacteria 1040
929 Ga0373948_0000025 3300034817 Bacteria 18190
930 Ga0373948_0073196 3300034817 Bacteria 771
931 Ga0373950_0000146 3300034818 Bacteria 11191
932 Ga0373950_0093051 3300034818 Unclassified 642
933 Ga0373958_0000142 3300034819 Bacteria 8033
934 Ga0373958_0191005 3300034819 Bacteria 532
935 Ga0373959_0000072 3300034820 Bacteria 22681
936 Ga0373938_0006570 3300034957 Bacteria 2015
937 Ga0373938_0016484 3300034957 Bacteria 1444
938 Ga0373926_0125881 3300035083 Bacteria 968
939 Ga0373928_0000402 3300035084 Bacteria 8604
940 Ga0373928_0006979 3300035084 Bacteria 2177
941 Ga0373928_0008517 3300035084 Bacteria 1992
942 Ga0373928_0133423 3300035084 Unclassified 675
943 Ga0373929_0000222 3300035085 Bacteria 10370
944 Ga0373934_0070008 3300035086 Bacteria 1402
945 Ga0373940_0000232 3300035088 Bacteria 7934
946 Ga0373940_0024278 3300035088 Bacteria 1571
947 Ga0373940_0038039 3300035088 Bacteria 1312
948 Ga0373940_0108095 3300035088 Bacteria 851
949 Ga0373944_0023114 3300035089 Unclassified 1811
950 Ga0373949_0006489 3300035090 Bacteria 2571
951 Ga0373949_0218374 3300035090 Bacteria 579
952 Ga0373951_0000275 3300035091 Bacteria 16405
953 Ga0373951_0009495 3300035091 Bacteria 2190
954 Ga0373952_0014498 3300035092 Bacteria 1578
955 Ga0373923_0102399 3300035111 Bacteria 1264
956 Ga0373923_0109019 3300035111 Bacteria 1228
957 Ga0373923_0182167 3300035111 Unclassified 965
958 Ga0373923_0530276 3300035111 Unclassified 576
959 Ga0373932_0000059 3300035112 Bacteria 27206
960 Ga0373932_0004242 3300035112 Bacteria 3404
961 Ga0373932_0350916 3300035112 Unclassified 561
962 Ga0373932_0360780 3300035112 Bacteria 555
963 Ga0373936_0012745 3300035113 Bacteria 3202
964 Ga0373939_0000508 3300035114 Bacteria 9753
965 Ga0373939_0201381 3300035114 Bacteria 753
966 Ga0373939_0240503 3300035114 Unclassified 701
967 Ga0373939_0254491 3300035114 Bacteria 685
968 Ga0373941_0000727 3300035115 Bacteria 6760
969 Ga0373941_0001448 3300035115 Bacteria 5011
970 Ga0373941_0016442 3300035115 Bacteria 2011
971 Ga0373941_0026510 3300035115 Bacteria 1684
972 Ga0373945_0065523 3300035116 Unclassified 1364
973 Ga0373945_0190185 3300035116 Unclassified 848
974 Ga0373953_0000709 3300035117 Bacteria 9221
975 Ga0373953_0014506 3300035117 Bacteria 2836
976 Ga0373953_0074111 3300035117 Bacteria 1408
977 Ga0373953_0121077 3300035117 Bacteria 1111
978 Ga0373953_0304984 3300035117 Unclassified 695
979 Ga0373954_0009893 3300035118 Bacteria 4199
980 Ga0373954_0030337 3300035118 Bacteria 2493
981 Ga0373954_0115666 3300035118 Bacteria 1299
982 Ga0373956_0113264 3300035119 Bacteria 1264
983 Ga0373956_0155098 3300035119 Bacteria 1078
984 Ga0373957_0000730 3300035120 Bacteria 8552
985 Ga0373957_0000821 3300035120 Bacteria 8119
986 Ga0373957_0007761 3300035120 Bacteria 3446
987 Ga0373957_0148954 3300035120 Bacteria 960
988 Ga0373960_0000038 3300035121 Bacteria 16959
989 Ga0373960_0017899 3300035121 Bacteria 1841
990 Ga0373960_0031290 3300035121 Bacteria 1488
991 Ga0373960_0152479 3300035121 Bacteria 790
992 Ga0373960_0192189 3300035121 Unclassified 718
993 Ga0373943_0004287 3300035170 Bacteria 6477
994 Ga0373943_0155733 3300035170 Bacteria 1241
995 Ga0373943_0592717 3300035170 Unclassified 652
996 Ga0373946_0024180 3300035171 Bacteria 2378
997 Ga0373955_0001042 3300035172 Bacteria 11787
998 Ga0373955_0024013 3300035172 Bacteria 3112
999 Ga0373955_0047645 3300035172 Bacteria 2321
1000 Ga0373955_0264092 3300035172 Bacteria 1034
1001 Ga0373942_0001035 3300035207 Bacteria 7543
1002 Ga0373942_0004535 3300035207 Bacteria 3220
1003 Ga0373942_0025907 3300035207 Bacteria 1515
1004 Ga0373961_0000773 3300035241 Bacteria 10979
1005 Ga0373961_0025541 3300035241 Bacteria 1607
1006 Ga0373962_0000191 3300035242 Bacteria 12940
1007 Ga0373962_0001541 3300035242 Bacteria 5452
1008 Ga0373962_0035196 3300035242 Bacteria 1390
1009 Ga0373962_0039599 3300035242 Bacteria 1323
1010 Ga0373962_0052504 3300035242 Bacteria 1178
1011 Ga0373924_0012208 3300035410 Bacteria 3207
1012 Ga0373924_0108152 3300035410 Bacteria 1200
1013 Ga0373931_0001217 3300035691 Bacteria 11011
1014 Ga0373931_0005504 3300035691 Bacteria 5865
1015 Ga0373931_0014417 3300035691 Bacteria 3863
1016 Ga0373931_0036617 3300035691 Bacteria 2558
1017 Ga0373931_0274885 3300035691 Bacteria 1032
1018 Ga0373931_0415136 3300035691 Bacteria 855
1019 Ga0373935_0001775 3300035692 Bacteria 12130
1020 Ga0373935_0034187 3300035692 Bacteria 3168
1021 Ga0373935_0063163 3300035692 Bacteria 2373
1022 Ga0373935_0619573 3300035692 Bacteria 792
1023 Ga0373927_0002763 3300035695 Bacteria 12815
1024 Ga0373927_0009671 3300035695 Bacteria 6464
1025 Ga0373933_0001719 3300035724 Bacteria 12704
1026 Ga0373933_0005248 3300035724 Bacteria 7063
1027 Ga0373947_0006573 3300035725 Bacteria 6744
1028 Ga0373937_0001701 3300036401 Bacteria 18497
1029 Ga0373937_0003774 3300036401 Bacteria 12809
1030 Ga0373937_0028836 3300036401 Bacteria 5025
1031 Ga0373937_0945749 3300036401 Unclassified 810
1032 Ga0373925_0007244 3300037068 Bacteria 8110
1033 Ga0373925_0666618 3300037068 Bacteria 857
1034 Ga0373925_1401951 3300037068 Unclassified 572
1035 Ga0395899_0015836 3300037312 Bacteria 5749
1036 Ga0395899_0301753 3300037312 Bacteria 1083
1037 Ga0395900_0012905 3300037418 Bacteria 8533
1038 Ga0395900_0021294 3300037418 Bacteria 6628
1039 Ga0395900_0702410 3300037418 Bacteria 945
1040 Ga0395898_0004061 3300037466 Bacteria 16077
1041 Ga0395898_0009509 3300037466 Bacteria 10204
1042 Ga0436364_1155778 3300037853 Bacteria 599
1043 Ga0395901_0063437 3300038443 Bacteria 3845
1044 Ga0395901_0075702 3300038443 Bacteria 3511
1045 Ga0395901_0320091 3300038443 Bacteria 1605
1046 Ga0242420_048831 3300038996 Bacteria 823
1047 Ga0436365_0127823 3300039437 Bacteria 753
1048 Ga0436365_0885430 3300039437 Bacteria 1290
1049 Ga0436365_0961715 3300039437 Bacteria 2142
1050 Ga0436363_0631040 3300039450 Bacteria 1395
1051 Ga0436362_0527489 3300039453 Bacteria 2266
1052 Ga0439453_0023953 3300041408 Bacteria 1117
1053 Ga0439443_006764 3300042003 Bacteria 1577
1054 Ga0439448_0017401 3300042005 Bacteria 2195
1055 Ga0439450_137972 3300042008 Bacteria 635
1056 Ga0439455_0010687 3300042012 Bacteria 2025
1057 Ga0450905_048606 3300042142 Unclassified 687
1058 Ga0439446_0094832 3300042156 Bacteria 938
1059 Ga0439458_0068000 3300042157 Bacteria 897
1060 Ga0439435_0032725 3300042436 Bacteria 1420
1061 Ga0439435_0124355 3300042436 Bacteria 810
1062 Ga0439464_0008011 3300042439 Bacteria 2771
1063 Ga0439460_0019136 3300042461 Bacteria 1851
1064 Ga0439460_0026548 3300042461 Bacteria 1621
1065 Ga0439440_0145867 3300042993 Bacteria 675
1066 Ga0453683_0081209 3300044673 Bacteria 2031
1067 Ga0466963_0004913 3300044694 Bacteria 7794
1068 Ga0466957_0084755 3300044842 Bacteria 1978
1069 Ga0466957_0635420 3300044842 Bacteria 749
1070 Ga0451576_0078873 3300045051 Bacteria 3426
1071 Ga0466958_0532119 3300045836 Bacteria 763
1072 Ga0466958_0557420 3300045836 Bacteria 745
1073 Ga0466967_0004481 3300045976 Bacteria 9428
1074 Ga0495617_116259 3300046452 Bacteria 863
1075 Ga0495592_0001738 3300046454 Bacteria 15296
1076 Ga0495592_0002150 3300046454 Bacteria 13878
1077 Ga0495592_0431274 3300046454 Bacteria 829
1078 Ga0495603_0001287 3300046455 Bacteria 14623
1079 Ga0495591_046063 3300046458 Bacteria 1213
1080 Ga0495629_0000062 3300046459 Bacteria 97169
1081 Ga0495638_0008519 3300046460 Bacteria 7263
1082 Ga0495638_0017103 3300046460 Bacteria 4843
1083 Ga0495638_0287345 3300046460 Bacteria 891
1084 Ga0495641_0045456 3300046461 Bacteria 2022
1085 Ga0495651_0002729 3300046462 Bacteria 13687
1086 Ga0495651_0069543 3300046462 Bacteria 2681
1087 Ga0495651_0377413 3300046462 Unclassified 930
1088 Ga0495653_0062762 3300046463 Bacteria 2806
1089 Ga0495580_0132036 3300046472 Bacteria 1732
1090 Ga0495582_0196235 3300046473 Bacteria 1152
1091 Ga0495605_0035610 3300046474 Bacteria 2515
1092 Ga0495639_0126471 3300046475 Bacteria 1222
1093 Ga0495662_0000578 3300046476 Bacteria 16874
1094 Ga0495664_0007653 3300046477 Bacteria 6007
1095 Ga0495664_0132450 3300046477 Bacteria 1510
1096 Ga0495584_0021760 3300046491 Bacteria 3256
1097 Ga0495584_0033241 3300046491 Bacteria 2609
1098 Ga0495584_0222577 3300046491 Bacteria 959
1099 Ga0495584_0415312 3300046491 Bacteria 684
1100 Ga0495585_0011808 3300046492 Bacteria 5159
1101 Ga0495594_0014612 3300046499 Bacteria 4117
1102 Ga0495607_0026320 3300046501 Bacteria 3609
1103 Ga0495608_0000943 3300046511 Bacteria 20472
1104 Ga0495608_0006924 3300046511 Bacteria 8029
1105 Ga0495608_0200615 3300046511 Bacteria 1257
1106 Ga0495618_0001029 3300046514 Bacteria 19114
1107 Ga0495618_0435702 3300046514 Unclassified 797
1108 Ga0495618_0922310 3300046514 Bacteria 503
1109 Ga0495628_0003985 3300046516 Bacteria 13155
1110 Ga0495628_0013284 3300046516 Bacteria 6927
1111 Ga0495628_0117608 3300046516 Bacteria 2041
1112 Ga0495630_0020549 3300046517 Bacteria 4868
1113 Ga0495637_0103561 3300046520 Bacteria 1110
1114 Ga0495643_0119249 3300046522 Bacteria 1335
1115 Ga0495644_0000776 3300046523 Bacteria 13153
1116 Ga0495644_0430542 3300046523 Unclassified 524
1117 Ga0495663_0096683 3300046525 Bacteria 968
1118 Ga0495652_0011331 3300046529 Bacteria 8065
1119 Ga0495652_0018893 3300046529 Bacteria 6144
1120 Ga0495665_0046969 3300046531 Bacteria 2291
1121 Ga0495640_0012379 3300046533 Bacteria 6520
1122 Ga0495640_0097940 3300046533 Bacteria 1928
1123 Ga0495586_0003355 3300046535 Bacteria 8583
1124 Ga0495586_0029328 3300046535 Bacteria 2944
1125 Ga0495587_0001771 3300046536 Bacteria 14440
1126 Ga0495587_0053582 3300046536 Bacteria 2378
1127 Ga0495587_0193482 3300046536 Bacteria 1151
1128 Ga0495598_0061653 3300046537 Bacteria 1158
1129 Ga0495598_0070152 3300046537 Bacteria 1102
1130 Ga0495609_0057651 3300046538 Bacteria 1719
1131 Ga0495609_0097414 3300046538 Bacteria 1276
1132 Ga0495621_0019593 3300046539 Bacteria 2211
1133 Ga0495645_0002821 3300046543 Bacteria 11789
1134 Ga0495645_0073187 3300046543 Bacteria 2468
1135 Ga0495645_0349376 3300046543 Bacteria 953
1136 Ga0495645_0661472 3300046543 Unclassified 637
1137 Ga0495633_0005403 3300046558 Bacteria 7825
1138 Ga0495667_0005482 3300046559 Bacteria 8572
1139 Ga0495667_0061496 3300046559 Bacteria 2462
1140 Ga0495667_0082836 3300046559 Bacteria 2084
1141 Ga0495667_0180832 3300046559 Bacteria 1353
1142 Ga0495656_0000457 3300046615 Bacteria 13306
1143 Ga0495656_0737225 3300046615 Bacteria 531
1144 Ga0495634_0128754 3300046642 Bacteria 1615
1145 Ga0495634_0388505 3300046642 Bacteria 831
1146 Ga0495611_0001107 3300046648 Bacteria 14194
1147 Ga0495635_0030151 3300046663 Bacteria 3770
1148 Ga0495635_0089696 3300046663 Bacteria 2104
1149 Ga0495635_0397249 3300046663 Bacteria 916
1150 Ga0495659_0002978 3300046664 Bacteria 5432
1151 Ga0495661_0044082 3300046665 Bacteria 2737
1152 Ga0495588_0001852 3300046674 Bacteria 9006
1153 Ga0495588_0045850 3300046674 Bacteria 2242
1154 Ga0495588_0427382 3300046674 Bacteria 695
1155 Ga0495657_0046829 3300046675 Bacteria 2926
1156 Ga0495657_0058083 3300046675 Bacteria 2570
1157 Ga0495657_0186745 3300046675 Bacteria 1268
1158 Ga0495599_0015430 3300046678 Bacteria 4740
1159 Ga0495623_0000055 3300046679 Bacteria 69548
1160 Ga0495623_0048476 3300046679 Bacteria 2694
1161 Ga0495647_0003621 3300046681 Bacteria 4958
1162 Ga0495658_0002781 3300046683 Bacteria 8783
1163 Ga0495658_0201967 3300046683 Bacteria 1239
1164 Ga0495669_0116493 3300046684 Bacteria 1250
1165 Ga0495613_0012460 3300046689 Bacteria 6319
1166 Ga0495613_0027248 3300046689 Bacteria 4252
1167 Ga0495613_0261347 3300046689 Bacteria 1206
1168 Ga0495670_0000732 3300046691 Bacteria 15674
1169 Ga0495600_0003351 3300046809 Bacteria 9420
1170 Ga0495600_0072897 3300046809 Bacteria 2242
1171 Ga0495600_0118616 3300046809 Bacteria 1721
1172 Ga0495581_0319038 3300047315 Unclassified 908
1173 Ga0495581_0470469 3300047315 Bacteria 731
1174 Ga0495604_0001634 3300047317 Bacteria 18463
1175 Ga0495604_0053300 3300047317 Bacteria 3127
1176 Ga0495604_0181676 3300047317 Bacteria 1471
1177 Ga0495674_0006479 3300047319 Bacteria 11224
1178 Ga0495680_0001836 3300047322 Bacteria 22387
1179 Ga0495680_0021036 3300047322 Bacteria 5467
1180 Ga0495680_0081554 3300047322 Bacteria 2442
1181 Ga0495683_0248240 3300047323 Bacteria 782
1182 Ga0495675_0002106 3300047444 Bacteria 11865
1183 Ga0495675_0041837 3300047444 Bacteria 2920
1184 Ga0495675_0340827 3300047444 Bacteria 883
1185 Ga0495684_0015714 3300047471 Bacteria 5825
1186 Ga0495684_0051598 3300047471 Bacteria 3139
1187 Ga0495684_0110670 3300047471 Bacteria 2073
1188 Ga0495684_0240391 3300047471 Bacteria 1321
1189 Ga0495684_0274011 3300047471 Bacteria 1220
1190 Ga0495593_0024144 3300047673 Bacteria 3372
1191 Ga0495593_0054865 3300047673 Bacteria 2099
1192 Ga0495602_0006837 3300048088 Bacteria 11980
1193 Ga0495602_0033732 3300048088 Bacteria 4798
1194 Ga0495602_0068235 3300048088 Bacteria 3054
1195 Ga0495602_0391394 3300048088 Unclassified 993
1196 Ga0496100_0009926 3300048903 Bacteria 5369
1197 Ga0496100_0022202 3300048903 Bacteria 3837
1198 Ga0496100_0099905 3300048903 Bacteria 1997
1199 Ga0496100_0148148 3300048903 Bacteria 1671
1200 Ga0496100_0310403 3300048903 Bacteria 1182
1201 Ga0496101_0003602 3300048904 Bacteria 9669
1202 Ga0496101_0020914 3300048904 Bacteria 4489
1203 Ga0496101_1222811 3300048904 Bacteria 588
1204 Ga0496101_1237817 3300048904 Bacteria 584
1205 Ga0496102_0053554 3300048905 Bacteria 3677
1206 Ga0496102_0075563 3300048905 Bacteria 3097
1207 Ga0496102_0234358 3300048905 Bacteria 1730
1208 Ga0496102_0757770 3300048905 Bacteria 893
1209 Ga0496103_0013538 3300048906 Bacteria 4837
1210 Ga0496103_0016090 3300048906 Bacteria 4462
1211 Ga0496103_0033766 3300048906 Bacteria 3126
1212 Ga0496104_0029690 3300048907 Bacteria 5073
1213 Ga0496104_0035743 3300048907 Bacteria 4640
1214 Ga0496104_0131011 3300048907 Bacteria 2408
1215 Ga0496104_0139728 3300048907 Bacteria 2327
1216 Ga0496104_0178743 3300048907 Bacteria 2032
1217 Ga0496104_0385651 3300048907 Bacteria 1313
1218 Ga0496105_0000246 3300048908 Bacteria 36588
1219 Ga0496105_0023856 3300048908 Bacteria 4967
1220 Ga0496105_0047769 3300048908 Bacteria 3532
1221 Ga0496105_0059856 3300048908 Bacteria 3142
1222 Ga0496105_0190745 3300048908 Bacteria 1676
1223 Ga0496105_0241119 3300048908 Bacteria 1467
1224 Ga0496105_0557134 3300048908 Bacteria 894
1225 Ga0496105_0582174 3300048908 Bacteria 870
1226 Ga0496106_0025546 3300048909 Bacteria 4396
1227 Ga0496106_0028393 3300048909 Bacteria 4168
1228 Ga0496106_0035468 3300048909 Bacteria 3729
1229 Ga0496106_0042856 3300048909 Bacteria 3394
1230 Ga0496106_0640714 3300048909 Bacteria 849
1231 Ga0496106_0808883 3300048909 Bacteria 743
1232 Ga0496106_0879301 3300048909 Bacteria 708
1233 Ga0496107_0006223 3300048910 Bacteria 8206
1234 Ga0496107_0020388 3300048910 Bacteria 4682
1235 Ga0496107_0066391 3300048910 Bacteria 2615
1236 Ga0496107_0072574 3300048910 Bacteria 2502
1237 Ga0496107_0609942 3300048910 Bacteria 806
1238 Ga0496107_1257812 3300048910 Bacteria 530
1239 Ga0496108_0004639 3300048911 Bacteria 11079
1240 Ga0496108_0040568 3300048911 Bacteria 3881
1241 Ga0496108_0043176 3300048911 Bacteria 3766
1242 Ga0496108_0073444 3300048911 Bacteria 2887
1243 Ga0496108_0086761 3300048911 Bacteria 2657
1244 Ga0496108_0189209 3300048911 Bacteria 1784
1245 Ga0496108_0318726 3300048911 Bacteria 1355
1246 Ga0496108_1666307 3300048911 Bacteria 526
1247 Ga0496109_0003538 3300048912 Bacteria 13036
1248 Ga0496109_0006194 3300048912 Bacteria 10055
1249 Ga0496109_0007275 3300048912 Bacteria 9359
1250 Ga0496109_0028458 3300048912 Bacteria 4998
1251 Ga0496109_0109427 3300048912 Bacteria 2568
1252 Ga0496109_0213983 3300048912 Bacteria 1812
1253 Ga0496109_0438954 3300048912 Bacteria 1233
1254 Ga0496109_0631663 3300048912 Bacteria 1007
1255 Ga0496110_0020766 3300048913 Bacteria 5545
1256 Ga0496110_0041064 3300048913 Bacteria 4035
1257 Ga0496110_0050483 3300048913 Bacteria 3652
1258 Ga0496110_0124450 3300048913 Bacteria 2325
1259 Ga0496110_0129917 3300048913 Bacteria 2274
1260 Ga0496110_0138545 3300048913 Bacteria 2200
1261 Ga0496110_0618103 3300048913 Bacteria 982
1262 Ga0496110_0711097 3300048913 Bacteria 906
1263 Ga0496110_1714813 3300048913 Bacteria 538
1264 Ga0496111_0024597 3300048914 Bacteria 4243
1265 Ga0496111_0064785 3300048914 Bacteria 2651
1266 Ga0496111_0550990 3300048914 Bacteria 847
1267 Ga0496112_0011049 3300048915 Bacteria 8226
1268 Ga0496112_0129321 3300048915 Bacteria 2496
1269 Ga0496112_0156432 3300048915 Bacteria 2246
1270 Ga0496112_0284931 3300048915 Bacteria 1598
1271 Ga0496112_0898799 3300048915 Bacteria 808
1272 Ga0496112_1849220 3300048915 Bacteria 515
1273 Ga0496113_0002940 3300048916 Bacteria 10064
1274 Ga0496113_0017669 3300048916 Bacteria 4957
1275 Ga0496113_0097856 3300048916 Bacteria 2270
1276 Ga0496113_0453440 3300048916 Bacteria 1030
1277 Ga0496113_1106083 3300048916 Bacteria 621
1278 Ga0496114_0045584 3300048917 Bacteria 3643
1279 Ga0496114_0060812 3300048917 Bacteria 3157
1280 Ga0496115_0117213 3300048918 Bacteria 2190
1281 Ga0496115_0124987 3300048918 Bacteria 2118
1282 Ga0496115_0187667 3300048918 Bacteria 1708
1283 Ga0496115_0257731 3300048918 Bacteria 1435
1284 Ga0496115_0795624 3300048918 Bacteria 736
1285 Ga0496115_0968086 3300048918 Bacteria 652
1286 Ga0496119_0328430 3300048922 Unclassified 747
1287 Ga0496121_0335612 3300048924 Bacteria 1012
1288 Ga0496125_0306648 3300048928 Bacteria 970
1289 Ga0501031_0051993 3300049568 Bacteria 2669
1290 Ga0501031_0055410 3300049568 Bacteria 2583
1291 Ga0501031_0094393 3300049568 Bacteria 1952
1292 Ga0501032_0030967 3300049569 Bacteria 3669
1293 Ga0501032_0040655 3300049569 Bacteria 3160
1294 Ga0501032_0068079 3300049569 Bacteria 2377
1295 Ga0501032_0118758 3300049569 Bacteria 1748
1296 Ga0501032_0123310 3300049569 Bacteria 1712
1297 Ga0501032_0151865 3300049569 Bacteria 1522
1298 Ga0501032_0231564 3300049569 Bacteria 1201
1299 Ga0501032_0450987 3300049569 Bacteria 824
1300 Ga0501033_0028700 3300049570 Bacteria 4180
1301 Ga0501033_0048181 3300049570 Bacteria 3165
1302 Ga0501033_0059979 3300049570 Bacteria 2808
1303 Ga0501033_0071155 3300049570 Bacteria 2555
1304 Ga0501033_0654419 3300049570 Bacteria 717
1305 Ga0501033_0809797 3300049570 Bacteria 633
1306 Ga0501034_0000673 3300049571 Bacteria 51868
1307 Ga0501034_0023496 3300049571 Bacteria 6282
1308 Ga0501034_0049412 3300049571 Bacteria 4243
1309 Ga0501034_0052903 3300049571 Bacteria 4090
1310 Ga0501034_0197290 3300049571 Bacteria 1972
1311 Ga0501034_0216590 3300049571 Bacteria 1868
1312 Ga0501034_0229335 3300049571 Bacteria 1806
1313 Ga0501034_0450220 3300049571 Bacteria 1205
1314 Ga0501034_0544421 3300049571 Bacteria 1070
1315 Ga0501034_0675931 3300049571 Bacteria 932
1316 Ga0501034_1260964 3300049571 Bacteria 617
1317 Ga0501034_1270826 3300049571 Bacteria 613
1318 Ga0501034_1448405 3300049571 Bacteria 561
1319 Ga0501036_0005575 3300049572 Bacteria 10208
1320 Ga0501036_0033364 3300049572 Bacteria 4353
1321 Ga0501036_0055522 3300049572 Bacteria 3355
1322 Ga0501036_0127120 3300049572 Bacteria 2152
1323 Ga0501036_0229897 3300049572 Bacteria 1556
1324 Ga0501036_0252595 3300049572 Bacteria 1477
1325 Ga0501036_0272533 3300049572 Bacteria 1417
1326 Ga0501036_1004110 3300049572 Bacteria 683
1327 Ga0501037_0033859 3300049573 Bacteria 3772
1328 Ga0501037_0052803 3300049573 Bacteria 2972
1329 Ga0501037_0060837 3300049573 Bacteria 2754
1330 Ga0501037_0071301 3300049573 Bacteria 2527
1331 Ga0501037_0162150 3300049573 Bacteria 1593
1332 Ga0501037_0189288 3300049573 Bacteria 1457
1333 Ga0501037_0195540 3300049573 Bacteria 1431
1334 Ga0501038_0041190 3300049574 Bacteria 4028
1335 Ga0501038_0102566 3300049574 Bacteria 2381
1336 Ga0501038_0190682 3300049574 Bacteria 1649
1337 Ga0501038_0228294 3300049574 Bacteria 1482
1338 Ga0501038_0289949 3300049574 Bacteria 1286
1339 Ga0501038_0301081 3300049574 Bacteria 1258
1340 Ga0501038_0825961 3300049574 Bacteria 687
1341 Ga0501039_0028239 3300049575 Bacteria 4317
1342 Ga0501039_0090029 3300049575 Bacteria 2391
1343 Ga0501039_0477886 3300049575 Bacteria 978
1344 Ga0501039_0637503 3300049575 Bacteria 834
1345 Ga0501040_0063114 3300049576 Bacteria 2549
1346 Ga0501042_1122757 3300049578 Bacteria 573
1347 Ga0501043_0022122 3300049579 Bacteria 4988
1348 Ga0501043_0059478 3300049579 Bacteria 2999
1349 Ga0501043_0065878 3300049579 Bacteria 2844
1350 Ga0501043_0194480 3300049579 Bacteria 1576
1351 Ga0501043_0281106 3300049579 Bacteria 1276
1352 Ga0501043_0357778 3300049579 Bacteria 1108
1353 Ga0501046_0011862 3300049580 Bacteria 7437
1354 Ga0501046_0142149 3300049580 Bacteria 1815
1355 Ga0501046_0217673 3300049580 Bacteria 1415
1356 Ga0501046_0252886 3300049580 Bacteria 1296
1357 Ga0501046_0838724 3300049580 Bacteria 643
1358 Ga0501047_0000073 3300049581 Bacteria 125990
1359 Ga0501047_0054456 3300049581 Bacteria 3869
1360 Ga0501047_0063808 3300049581 Bacteria 3553
1361 Ga0501047_0112672 3300049581 Bacteria 2602
1362 Ga0501047_0192126 3300049581 Bacteria 1904
1363 Ga0501047_0197429 3300049581 Bacteria 1874
1364 Ga0501047_0224972 3300049581 Bacteria 1731
1365 Ga0501047_0226979 3300049581 Bacteria 1722
1366 Ga0501047_0306781 3300049581 Bacteria 1428
1367 Ga0501047_0317033 3300049581 Bacteria 1399
1368 Ga0501047_0874936 3300049581 Bacteria 712
1369 Ga0501047_0998669 3300049581 Unclassified 650
1370 Ga0501047_1343275 3300049581 Bacteria 529
1371 Ga0501048_0000014 3300049582 Bacteria 75001
1372 Ga0501048_0078388 3300049582 Bacteria 2331
1373 Ga0501048_0521452 3300049582 Bacteria 852
1374 Ga0501048_1085819 3300049582 Bacteria 576
1375 Ga0501067_0045679 3300049583 Bacteria 2431
1376 Ga0501067_0060994 3300049583 Bacteria 2087
1377 Ga0501067_0267129 3300049583 Bacteria 952
1378 Ga0501067_0276021 3300049583 Bacteria 936
1379 Ga0501068_0032470 3300049584 Bacteria 3105
1380 Ga0501068_0098619 3300049584 Bacteria 1809
1381 Ga0501068_0167569 3300049584 Bacteria 1385
1382 Ga0501068_0411222 3300049584 Bacteria 873
1383 Ga0501068_0436046 3300049584 Bacteria 847
1384 Ga0501069_0031686 3300049585 Bacteria 2909
1385 Ga0501069_0174648 3300049585 Bacteria 1240
1386 Ga0501069_0242868 3300049585 Bacteria 1049
1387 Ga0501070_0002742 3300049586 Bacteria 15368
1388 Ga0501070_0002868 3300049586 Bacteria 15015
1389 Ga0501070_0057373 3300049586 Bacteria 3227
1390 Ga0501070_0062734 3300049586 Bacteria 3078
1391 Ga0501070_0063961 3300049586 Bacteria 3047
1392 Ga0501070_0064428 3300049586 Bacteria 3035
1393 Ga0501070_0073103 3300049586 Bacteria 2837
1394 Ga0501070_0192585 3300049586 Bacteria 1675
1395 Ga0501070_0243148 3300049586 Bacteria 1473
1396 Ga0501070_0288308 3300049586 Bacteria 1338
1397 Ga0501070_0446630 3300049586 Bacteria 1043
1398 Ga0501070_0567321 3300049586 Bacteria 907
1399 Ga0501071_0087284 3300049587 Bacteria 2288
1400 Ga0501071_0134108 3300049587 Bacteria 1841
1401 Ga0501071_0236218 3300049587 Bacteria 1378
1402 Ga0501071_0690254 3300049587 Bacteria 786
1403 Ga0501071_1201777 3300049587 Bacteria 586
1404 Ga0501072_0001175 3300049588 Bacteria 19481
1405 Ga0501072_0483669 3300049588 Bacteria 979
1406 Ga0501072_0720709 3300049588 Bacteria 783
1407 Ga0501072_0839063 3300049588 Unclassified 719
1408 Ga0501073_0058212 3300049589 Bacteria 2701
1409 Ga0501073_0105791 3300049589 Bacteria 1952
1410 Ga0501073_0159784 3300049589 Bacteria 1561
1411 Ga0501073_0177268 3300049589 Bacteria 1475
1412 Ga0501073_1051988 3300049589 Bacteria 560
1413 Ga0501074_0019510 3300049590 Bacteria 4923
1414 Ga0501074_0035820 3300049590 Bacteria 3595
1415 Ga0501074_0130040 3300049590 Bacteria 1801
1416 Ga0501074_0231763 3300049590 Bacteria 1314
1417 Ga0501074_0358667 3300049590 Bacteria 1034
1418 Ga0501076_0200324 3300049592 Bacteria 1630
1419 Ga0501077_0028997 3300049593 Bacteria 3518
1420 Ga0501079_0071314 3300049741 Bacteria 2684
1421 Ga0501079_0213719 3300049741 Bacteria 1506
1422 Ga0501079_0338208 3300049741 Bacteria 1179
1423 Ga0501080_0000351 3300049742 Bacteria 35352
1424 Ga0501080_0044957 3300049742 Bacteria 4110
1425 Ga0501080_0055389 3300049742 Bacteria 3693
1426 Ga0501080_0092687 3300049742 Bacteria 2805
1427 Ga0501080_0102549 3300049742 Bacteria 2654
1428 Ga0501080_0174110 3300049742 Bacteria 1983
1429 Ga0501080_0334275 3300049742 Bacteria 1369
1430 Ga0501081_0758655 3300049743 Bacteria 729
1431 Ga0501083_0000901 3300049744 Bacteria 19671
1432 Ga0501083_0141334 3300049744 Bacteria 1576
1433 Ga0501083_0144510 3300049744 Bacteria 1557
1434 Ga0501083_0155246 3300049744 Bacteria 1498
1435 Ga0501083_0242423 3300049744 Bacteria 1174
1436 Ga0501083_0443778 3300049744 Bacteria 844
1437 Ga0501083_0558532 3300049744 Bacteria 745
1438 Ga0501083_0678524 3300049744 Bacteria 670
1439 Ga0501083_0909881 3300049744 Unclassified 572
1440 Ga0501035_0000197 3300049822 Bacteria 73618
1441 Ga0501035_0023751 3300049822 Bacteria 5625
1442 Ga0501035_0140241 3300049822 Bacteria 2102
1443 Ga0501035_0148957 3300049822 Bacteria 2031
1444 Ga0501035_0153544 3300049822 Bacteria 1996
1445 Ga0501035_0162634 3300049822 Bacteria 1931
1446 Ga0501035_1092321 3300049822 Bacteria 623
1447 Ga0501044_0015464 3300049823 Bacteria 8219
1448 Ga0501044_0031825 3300049823 Bacteria 5548
1449 Ga0501044_0053999 3300049823 Bacteria 4131
1450 Ga0501044_0139160 3300049823 Bacteria 2416
1451 Ga0501044_0145445 3300049823 Bacteria 2356
1452 Ga0501044_0148064 3300049823 Bacteria 2331
1453 Ga0501044_0165530 3300049823 Bacteria 2185
1454 Ga0501044_0250186 3300049823 Bacteria 1713
1455 Ga0501044_0259316 3300049823 Bacteria 1677
1456 Ga0501044_0267705 3300049823 Bacteria 1645
1457 Ga0501044_0287826 3300049823 Bacteria 1575
1458 Ga0501044_0317059 3300049823 Bacteria 1484
1459 Ga0501044_0721061 3300049823 Bacteria 881
1460 Ga0501045_0331771 3300049824 Bacteria 1132
1461 Ga0501045_0621710 3300049824 Bacteria 799
1462 nmdc:mga03683_69915_c1 3300050489 Bacteria 1499
1463 nmdc:mga03n38_145053_c1 3300050490 Bacteria 1189
1464 nmdc:mga03n38_42433_c1 3300050490 Bacteria 1988
1465 nmdc:mga03n38_93720_c1 3300050490 Bacteria 1435
1466 nmdc:mga03n38_958394_c1 3300050490 Bacteria 505
1467 nmdc:mga0k408_107883_c1 3300050493 Bacteria 1645
1468 nmdc:mga0k408_165038_c1 3300050493 Bacteria 1320
1469 nmdc:mga06z11_1029062_c1 3300050494 Bacteria 502
1470 nmdc:mga06z11_299303_c1 3300050494 Bacteria 956
1471 nmdc:mga06z11_448214_c1 3300050494 Bacteria 780
1472 nmdc:mga06z11_639954_c1 3300050494 Bacteria 647
1473 nmdc:mga04h51_257938_c1 3300050495 Bacteria 700
1474 nmdc:mga04h51_68343_c1 3300050495 Bacteria 1234
1475 nmdc:mga07m45_124540_c1 3300050496 Bacteria 1490
1476 nmdc:mga07m45_40742_c2 3300050496 Bacteria 2164
1477 nmdc:mga05p37_1120143_c1 3300050507 Bacteria 822
1478 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
1479 nmdc:mga09592_5913_c1 3300050508 Bacteria 9979
1480 nmdc:mga0qj67_1208994_c1 3300050509 Bacteria 588
1481 nmdc:mga0qj67_351_c1 3300050509 Bacteria 31725
1482 nmdc:mga06r32_641_c1 3300050510 Bacteria 30442
1483 nmdc:mga06r32_731115_c1 3300050510 Bacteria 954
1484 nmdc:mga08y16_1043213_c1 3300050511 Bacteria 795
1485 nmdc:mga08y16_1530442_c1 3300050511 Bacteria 627
1486 nmdc:mga08y16_17011_c1 3300050511 Bacteria 7658
1487 nmdc:mga08y16_1859028_c1 3300050511 Bacteria 554
1488 nmdc:mga08y16_4379_c1 3300050511 Bacteria 14755
1489 nmdc:mga08y16_76513_c1 3300050511 Bacteria 3489
1490 nmdc:mga08y16_995027_c1 3300050511 Bacteria 819
1491 nmdc:mga0n895_2066906_c1 3300050512 Unclassified 527
1492 nmdc:mga0n895_217896_c1 3300050512 Bacteria 1938
1493 nmdc:mga0n895_28041_c1 3300050512 Bacteria 5354
1494 nmdc:mga0n895_666_c1 3300050512 Bacteria 24033
1495 nmdc:mga0rr50_108616_c1 3300050513 Bacteria 2192
1496 nmdc:mga0rr50_109323_c1 3300050513 Bacteria 2185
1497 nmdc:mga0rr50_11285_c1 3300050513 Bacteria 5712
1498 nmdc:mga0rr50_40426_c1 3300050513 Bacteria 3391
1499 nmdc:mga0rr50_689608_c1 3300050513 Bacteria 872
1500 nmdc:mga0rr50_7632_c1 3300050513 Bacteria 6688
1501 nmdc:mga08x19_152741_c1 3300050514 Bacteria 1564
1502 nmdc:mga08x19_382435_c1 3300050514 Bacteria 986
1503 nmdc:mga0a205_14489_c1 3300050515 Bacteria 7355
1504 nmdc:mga0a205_1663_c1 3300050515 Bacteria 19148
1505 nmdc:mga0a205_247191_c1 3300050515 Bacteria 1664
1506 nmdc:mga0a205_588071_c1 3300050515 Unclassified 967
1507 nmdc:mga0a205_681_c1 3300050515 Bacteria 27171
1508 nmdc:mga0sz30_579860_c1 3300050516 Bacteria 507
1509 nmdc:mga0sz30_97741_c1 3300050516 Bacteria 1281
1510 Ga0495601_0004198 3300053077 Bacteria 8307
1511 Ga0495601_0006640 3300053077 Bacteria 6770
1512 Ga0495601_0014969 3300053077 Bacteria 4683
1513 Ga0495601_0023546 3300053077 Bacteria 3784
1514 Ga0495601_0109737 3300053077 Bacteria 1786
1515 Ga0495612_0003202 3300053078 Bacteria 6784
1516 Ga0495612_0103558 3300053078 Unclassified 1213
1517 Ga0495655_0097709 3300053083 Bacteria 865
1518 Ga0495595_0000235 3300053084 Bacteria 21997
1519 Ga0495595_0001396 3300053084 Bacteria 9378
1520 Ga0495595_0022045 3300053084 Bacteria 2791
1521 Ga0495595_0066035 3300053084 Bacteria 1702
1522 Ga0495595_0085805 3300053084 Bacteria 1505
1523 Ga0495595_0272198 3300053084 Bacteria 849
1524 Ga0495619_0000052 3300053085 Bacteria 98882
1525 Ga0495619_0000078 3300053085 Bacteria 72749
1526 Ga0495619_0000414 3300053085 Bacteria 29022
1527 Ga0495619_0013659 3300053085 Bacteria 5118
1528 Ga0495619_0036570 3300053085 Bacteria 3197
1529 Ga0495619_0699103 3300053085 Bacteria 689
1530 Ga0500643_004390 3300053087 Bacteria 6400
1531 Ga0500644_0021428 3300053088 Bacteria 1936
1532 Ga0500644_0244057 3300053088 Bacteria 755
1533 Ga0500646_0009102 3300053090 Bacteria 2543
1534 Ga0500646_0137266 3300053090 Bacteria 800
1535 Ga0500566_0019905 3300053094 Bacteria 3940
1536 Ga0500641_0002930 3300053096 Bacteria 6049
1537 Ga0500641_0285114 3300053096 Bacteria 683
1538 Ga0500650_0133578 3300053098 Bacteria 1153
1539 Ga0500595_000001 3300053119 Bacteria 1088438
1540 Ga0500618_164735 3300053125 Unclassified 507
1541 Ga0500642_0229953 3300053130 Bacteria 857
1542 Ga0500655_086098 3300053133 Bacteria 650
1543 Ga0500658_0072923 3300053134 Bacteria 1453
1544 Ga0500568_0342722 3300053139 Bacteria 542
1545 Ga0500588_0243917 3300053146 Bacteria 673
1546 Ga0500604_0054341 3300053151 Bacteria 1243
1547 Ga0500616_0000001 3300053153 Bacteria 1986011
1548 Ga0500616_0032543 3300053153 Bacteria 2850
1549 Ga0500645_010737 3300053730 Bacteria 3013
1550 Ga0501084_0226000 3300054114 Bacteria 1579
1551 Ga0501084_0896959 3300054114 Bacteria 746
1552 Ga0501084_1207883 3300054114 Bacteria 634
1553 Ga0501082_0110740 3300060353 Bacteria 2376
1554 Ga0501082_0170580 3300060353 Bacteria 1891
1555 Ga0501082_0186118 3300060353 Bacteria 1807
1556 Ga0501082_0193832 3300060353 Bacteria 1767
1557 Ga0501082_0266612 3300060353 Bacteria 1490
1558 Ga0501082_0346424 3300060353 Bacteria 1295
1559 Ga0501082_0415525 3300060353 Bacteria 1174
1560 Ga0501082_0802038 3300060353 Bacteria 824
1561 Ga0501082_0967257 3300060353 Bacteria 744
1562 Ga0530510_0318277 3300061734 Bacteria 1166

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100657297 Ga0075363_1006572972 109
2 3300006051 Ga0075364_10485140 Ga0075364_104851402 109
3 3300006195 Ga0075366_10044141 Ga0075366_100441412 109
4 3300005330 Ga0070690_100374273 Ga0070690_1003742731 110
5 3300005340 Ga0070689_100256000 Ga0070689_1002560002 110
6 3300005344 Ga0070661_101577273 Ga0070661_1015772731 110
7 3300005544 Ga0070686_100275441 Ga0070686_1002754411 110
8 3300005843 Ga0068860_101019850 Ga0068860_1010198502 110
9 3300025315 Ga0207697_10055430 Ga0207697_100554302 110
10 3300025901 Ga0207688_10475585 Ga0207688_104755852 110
11 3300025972 Ga0207668_10232065 Ga0207668_102320652 110
12 3300035692 Ga0373935_0034187 Ga0373935_0034187_629_1036 110
13 3300046454 Ga0495592_0431274 Ga0495592_0431274_86_493 110
14 3300046516 Ga0495628_0117608 Ga0495628_0117608_16_423 110
15 3300046543 Ga0495645_0349376 Ga0495645_0349376_524_931 110
16 3300046642 Ga0495634_0388505 Ga0495634_0388505_210_617 110
17 3300053077 Ga0495601_0109737 Ga0495601_0109737_355_762 110
18 3300053084 Ga0495595_0085805 Ga0495595_0085805_244_651 110
19 3300005353 Ga0070669_101104453 Ga0070669_1011044532 111
20 3300005355 Ga0070671_100240236 Ga0070671_1002402362 111
21 3300005365 Ga0070688_100308368 Ga0070688_1003083681 111
22 3300005455 Ga0070663_101093804 Ga0070663_1010938042 111
23 3300005466 Ga0070685_11081771 Ga0070685_110817711 111
24 3300005548 Ga0070665_100649865 Ga0070665_1006498652 111
25 3300013306 Ga0163162_11188430 Ga0163162_111884301 111
26 3300025908 Ga0207643_10255255 Ga0207643_102552552 111
27 3300025923 Ga0207681_11312348 Ga0207681_113123482 111
28 3300026095 Ga0207676_11453693 Ga0207676_114536931 111
29 3300027866 Ga0209813_10049118 Ga0209813_100491182 111
30 3300028380 Ga0268265_11821433 Ga0268265_118214331 111
31 3300050490 nmdc:mga03n38_145053_c1 nmdc:mga03n38_145053_c1_117_527 111
32 3300050493 nmdc:mga0k408_165038_c1 nmdc:mga0k408_165038_c1_16_426 111
33 3300050494 nmdc:mga06z11_299303_c1 nmdc:mga06z11_299303_c1_243_653 111
34 3300050516 nmdc:mga0sz30_579860_c1 nmdc:mga0sz30_579860_c1_42_452 111
35 3300005367 Ga0070667_101938822 Ga0070667_1019388221 112
36 3300005457 Ga0070662_100149122 Ga0070662_1001491222 112
37 3300006881 Ga0068865_100144664 Ga0068865_1001446642 112
38 3300009098 Ga0105245_10339459 Ga0105245_103394592 112
39 3300009101 Ga0105247_10077139 Ga0105247_100771392 112
40 3300009148 Ga0105243_10595515 Ga0105243_105955151 112
41 3300009176 Ga0105242_10762867 Ga0105242_107628672 112
42 3300013297 Ga0157378_10598655 Ga0157378_105986552 112
43 3300013306 Ga0163162_10124566 Ga0163162_101245663 112
44 3300013308 Ga0157375_10089973 Ga0157375_100899733 112
45 3300014325 Ga0163163_10562337 Ga0163163_105623372 112
46 3300014969 Ga0157376_10462213 Ga0157376_104622132 112
47 3300025923 Ga0207681_10305061 Ga0207681_103050612 112
48 3300025927 Ga0207687_10446436 Ga0207687_104464362 112
49 3300025931 Ga0207644_10380382 Ga0207644_103803822 112
50 3300025938 Ga0207704_10065962 Ga0207704_100659622 112
51 3300025941 Ga0207711_10024459 Ga0207711_100244592 112
52 3300034817 Ga0373948_0073196 Ga0373948_0073196_40_447 112
53 3300034819 Ga0373958_0191005 Ga0373958_0191005_21_428 112
54 3300035088 Ga0373940_0024278 Ga0373940_0024278_191_598 112
55 3300035115 Ga0373941_0026510 Ga0373941_0026510_526_933 112
56 3300035121 Ga0373960_0152479 Ga0373960_0152479_345_752 112
57 3300035207 Ga0373942_0025907 Ga0373942_0025907_743_1150 112
58 3300035241 Ga0373961_0025541 Ga0373961_0025541_775_1182 112
59 3300035691 Ga0373931_0036617 Ga0373931_0036617_1944_2351 112
60 3300048903 Ga0496100_0009926 Ga0496100_0009926_1212_1619 112
61 3300048904 Ga0496101_0020914 Ga0496101_0020914_1216_1623 112
62 3300048907 Ga0496104_0139728 Ga0496104_0139728_738_1145 112
63 3300048908 Ga0496105_0023856 Ga0496105_0023856_833_1240 112
64 3300048909 Ga0496106_0028393 Ga0496106_0028393_3550_3957 112
65 3300048910 Ga0496107_0072574 Ga0496107_0072574_1115_1522 112
66 3300048911 Ga0496108_0040568 Ga0496108_0040568_1833_2240 112
67 3300048912 Ga0496109_0007275 Ga0496109_0007275_4358_4765 112
68 3300048913 Ga0496110_0020766 Ga0496110_0020766_1356_1763 112
69 3300048914 Ga0496111_0024597 Ga0496111_0024597_2058_2465 112
70 3300048917 Ga0496114_0045584 Ga0496114_0045584_212_619 112
71 3300009098 Ga0105245_11376852 Ga0105245_113768521 113
72 3300013297 Ga0157378_11317773 Ga0157378_113177732 113
73 3300048905 Ga0496102_0234358 Ga0496102_0234358_1202_1609 114
74 3300048915 Ga0496112_0156432 Ga0496112_0156432_837_1244 114
75 3300005458 Ga0070681_10400011 Ga0070681_104000112 116
76 3300013296 Ga0157374_11774130 Ga0157374_117741301 122
77 3300013308 Ga0157375_11079265 Ga0157375_110792651 122
78 3300048918 Ga0496115_0968086 Ga0496115_0968086_261_632 123
79 3300035170 Ga0373943_0155733 Ga0373943_0155733_739_1134 125
80 3300046531 Ga0495665_0046969 Ga0495665_0046969_1612_2007 125
81 3300005548 Ga0070665_100521701 Ga0070665_1005217012 126
82 3300028379 Ga0268266_10500292 Ga0268266_105002922 128
83 3300028563 Ga0265319_1173838 Ga0265319_11738381 128
84 3300005356 Ga0070674_101268761 Ga0070674_1012687611 129
85 3300025923 Ga0207681_11306276 Ga0207681_113062762 130
86 3300042436 Ga0439435_0124355 Ga0439435_0124355_296_706 130
87 3300035083 Ga0373926_0125881 Ga0373926_0125881_432_827 131
88 3300035695 Ga0373927_0002763 Ga0373927_0002763_2577_2972 131
89 3300037068 Ga0373925_0666618 Ga0373925_0666618_320_715 131
90 3300046460 Ga0495638_0008519 Ga0495638_0008519_1497_1892 131
91 3300046473 Ga0495582_0196235 Ga0495582_0196235_206_601 131
92 3300046475 Ga0495639_0126471 Ga0495639_0126471_138_533 131
93 3300046491 Ga0495584_0021760 Ga0495584_0021760_2118_2513 131
94 3300046523 Ga0495644_0430542 Ga0495644_0430542_50_445 131
95 3300046538 Ga0495609_0097414 Ga0495609_0097414_31_426 131
96 3300046689 Ga0495613_0261347 Ga0495613_0261347_560_955 131
97 iso_pu_bacteria 2643221547 2643758273 131
98 3300014326 Ga0157380_11040351 Ga0157380_110403512 134
99 3300048914 Ga0496111_0550990 Ga0496111_0550990_193_600 134
100 3300002076 JGI24749J21850_1060149 JGI24749J21850_10601491 135
101 3300005327 Ga0070658_10013752 Ga0070658_100137522 135
102 3300005328 Ga0070676_10038007 Ga0070676_100380072 135
103 3300005328 Ga0070676_10852539 Ga0070676_108525391 135
104 3300005329 Ga0070683_100093341 Ga0070683_1000933413 135
105 3300005330 Ga0070690_100008910 Ga0070690_1000089105 135
106 3300005330 Ga0070690_101090994 Ga0070690_1010909942 135
107 3300005331 Ga0070670_100214373 Ga0070670_1002143732 135
108 3300005331 Ga0070670_100824356 Ga0070670_1008243562 135
109 3300005333 Ga0070677_10010930 Ga0070677_100109304 135
110 3300005333 Ga0070677_10017988 Ga0070677_100179884 135
111 3300005334 Ga0068869_100999718 Ga0068869_1009997182 135
112 3300005335 Ga0070666_10209716 Ga0070666_102097162 135
113 3300005336 Ga0070680_100045280 Ga0070680_1000452802 135
114 3300005336 Ga0070680_100046429 Ga0070680_1000464292 135
115 3300005336 Ga0070680_100434488 Ga0070680_1004344881 135
116 3300005338 Ga0068868_101174520 Ga0068868_1011745201 135
117 3300005339 Ga0070660_100174872 Ga0070660_1001748723 135
118 3300005340 Ga0070689_100035242 Ga0070689_1000352423 135
119 3300005340 Ga0070689_100089507 Ga0070689_1000895074 135
120 3300005340 Ga0070689_100597562 Ga0070689_1005975622 135
121 3300005345 Ga0070692_10731102 Ga0070692_107311021 135
122 3300005347 Ga0070668_100220906 Ga0070668_1002209062 135
123 3300005353 Ga0070669_100759958 Ga0070669_1007599582 135
124 3300005356 Ga0070674_100057019 Ga0070674_1000570193 135
125 3300005356 Ga0070674_100130401 Ga0070674_1001304012 135
126 3300005364 Ga0070673_100127120 Ga0070673_1001271204 135
127 3300005365 Ga0070688_100009533 Ga0070688_1000095332 135
128 3300005366 Ga0070659_100439163 Ga0070659_1004391631 135
129 3300005367 Ga0070667_100295123 Ga0070667_1002951232 135
130 3300005434 Ga0070709_10020245 Ga0070709_100202452 135
131 3300005435 Ga0070714_100284036 Ga0070714_1002840363 135
132 3300005435 Ga0070714_100286935 Ga0070714_1002869352 135
133 3300005437 Ga0070710_10449250 Ga0070710_104492502 135
134 3300005438 Ga0070701_10247041 Ga0070701_102470411 135
135 3300005455 Ga0070663_100471614 Ga0070663_1004716142 135
136 3300005456 Ga0070678_100031223 Ga0070678_1000312235 135
137 3300005456 Ga0070678_100322047 Ga0070678_1003220472 135
138 3300005457 Ga0070662_100282943 Ga0070662_1002829432 135
139 3300005457 Ga0070662_100463066 Ga0070662_1004630662 135
140 3300005457 Ga0070662_100897995 Ga0070662_1008979951 135
141 3300005458 Ga0070681_10129619 Ga0070681_101296193 135
142 3300005466 Ga0070685_10105614 Ga0070685_101056142 135
143 3300005530 Ga0070679_100080411 Ga0070679_1000804112 135
144 3300005530 Ga0070679_100500846 Ga0070679_1005008462 135
145 3300005535 Ga0070684_100316534 Ga0070684_1003165341 135
146 3300005535 Ga0070684_101661276 Ga0070684_1016612762 135
147 3300005543 Ga0070672_100040390 Ga0070672_1000403903 135
148 3300005544 Ga0070686_100738121 Ga0070686_1007381211 135
149 3300005547 Ga0070693_100995939 Ga0070693_1009959391 135
150 3300005548 Ga0070665_101581138 Ga0070665_1015811381 135
151 3300005563 Ga0068855_100077562 Ga0068855_1000775622 135
152 3300005563 Ga0068855_100103562 Ga0068855_1001035623 135
153 3300005563 Ga0068855_101069223 Ga0068855_1010692232 135
154 3300005564 Ga0070664_100508503 Ga0070664_1005085033 135
155 3300005577 Ga0068857_100628233 Ga0068857_1006282332 135
156 3300005578 Ga0068854_100105691 Ga0068854_1001056912 135
157 3300005578 Ga0068854_100546679 Ga0068854_1005466791 135
158 3300005614 Ga0068856_100167797 Ga0068856_1001677974 135
159 3300005614 Ga0068856_100315398 Ga0068856_1003153982 135
160 3300005617 Ga0068859_100116519 Ga0068859_1001165193 135
161 3300005618 Ga0068864_100127763 Ga0068864_1001277632 135
162 3300005718 Ga0068866_10202541 Ga0068866_102025411 135
163 3300005719 Ga0068861_100241361 Ga0068861_1002413612 135
164 3300005842 Ga0068858_101495902 Ga0068858_1014959021 135
165 3300005843 Ga0068860_100567708 Ga0068860_1005677082 135
166 3300005843 Ga0068860_100809128 Ga0068860_1008091281 135
167 3300006038 Ga0075365_10385346 Ga0075365_103853462 135
168 3300006042 Ga0075368_10195978 Ga0075368_101959782 135
169 3300006048 Ga0075363_100051109 Ga0075363_1000511092 135
170 3300006173 Ga0070716_100634231 Ga0070716_1006342312 135
171 3300006175 Ga0070712_100190284 Ga0070712_1001902842 135
172 3300006177 Ga0075362_10187155 Ga0075362_101871552 135
173 3300006178 Ga0075367_10633506 Ga0075367_106335062 135
174 3300006237 Ga0097621_100894498 Ga0097621_1008944982 135
175 3300006353 Ga0075370_10134183 Ga0075370_101341832 135
176 3300006353 Ga0075370_10544330 Ga0075370_105443302 135
177 3300006881 Ga0068865_100457384 Ga0068865_1004573841 135
178 3300006931 Ga0097620_100116529 Ga0097620_1001165293 135
179 3300009093 Ga0105240_10102700 Ga0105240_101027002 135
180 3300009093 Ga0105240_10393027 Ga0105240_103930272 135
181 3300009148 Ga0105243_10332414 Ga0105243_103324142 135
182 3300009174 Ga0105241_10585908 Ga0105241_105859082 135
183 3300009176 Ga0105242_10341076 Ga0105242_103410762 135
184 3300009176 Ga0105242_10393608 Ga0105242_103936082 135
185 3300009177 Ga0105248_10235505 Ga0105248_102355052 135
186 3300009177 Ga0105248_10473530 Ga0105248_104735302 135
187 3300009553 Ga0105249_10351380 Ga0105249_103513802 135
188 3300010375 Ga0105239_11442052 Ga0105239_114420521 135
189 3300011119 Ga0105246_11395800 Ga0105246_113958002 135
190 3300011119 Ga0105246_11944648 Ga0105246_119446481 135
191 3300013102 Ga0157371_10378349 Ga0157371_103783491 135
192 3300013104 Ga0157370_10059670 Ga0157370_100596704 135
193 3300013105 Ga0157369_11399298 Ga0157369_113992982 135
194 3300013297 Ga0157378_10423049 Ga0157378_104230493 135
195 3300013297 Ga0157378_11415936 Ga0157378_114159362 135
196 3300013306 Ga0163162_10353065 Ga0163162_103530653 135
197 3300013307 Ga0157372_10236574 Ga0157372_102365743 135
198 3300013307 Ga0157372_12685608 Ga0157372_126856082 135
199 3300013308 Ga0157375_11521651 Ga0157375_115216512 135
200 3300014325 Ga0163163_10299506 Ga0163163_102995062 135
201 3300014325 Ga0163163_11487493 Ga0163163_114874931 135
202 3300014326 Ga0157380_10318436 Ga0157380_103184362 135
203 3300014326 Ga0157380_11210180 Ga0157380_112101802 135
204 3300014745 Ga0157377_10532078 Ga0157377_105320782 135
205 3300014745 Ga0157377_10594649 Ga0157377_105946492 135
206 3300017792 Ga0163161_10954155 Ga0163161_109541552 135
207 3300020070 Ga0206356_10579931 Ga0206356_105799311 135
208 3300020082 Ga0206353_11558917 Ga0206353_115589172 135
209 3300025315 Ga0207697_10167306 Ga0207697_101673061 135
210 3300025893 Ga0207682_10041920 Ga0207682_100419203 135
211 3300025893 Ga0207682_10111283 Ga0207682_101112832 135
212 3300025893 Ga0207682_10411705 Ga0207682_104117052 135
213 3300025899 Ga0207642_10124091 Ga0207642_101240912 135
214 3300025901 Ga0207688_10082057 Ga0207688_100820573 135
215 3300025903 Ga0207680_10097247 Ga0207680_100972472 135
216 3300025906 Ga0207699_10630297 Ga0207699_106302971 135
217 3300025907 Ga0207645_10029800 Ga0207645_100298005 135
218 3300025907 Ga0207645_10039229 Ga0207645_100392292 135
219 3300025908 Ga0207643_10082391 Ga0207643_100823912 135
220 3300025909 Ga0207705_10082314 Ga0207705_100823142 135
221 3300025912 Ga0207707_10127082 Ga0207707_101270822 135
222 3300025915 Ga0207693_10064296 Ga0207693_100642962 135
223 3300025915 Ga0207693_10137058 Ga0207693_101370583 135
224 3300025917 Ga0207660_10525137 Ga0207660_105251372 135
225 3300025918 Ga0207662_10149256 Ga0207662_101492562 135
226 3300025919 Ga0207657_10080003 Ga0207657_100800033 135
227 3300025921 Ga0207652_10294926 Ga0207652_102949262 135
228 3300025923 Ga0207681_10046407 Ga0207681_100464072 135
229 3300025923 Ga0207681_10661911 Ga0207681_106619111 135
230 3300025925 Ga0207650_10264018 Ga0207650_102640182 135
231 3300025926 Ga0207659_10938573 Ga0207659_109385731 135
232 3300025927 Ga0207687_10368044 Ga0207687_103680441 135
233 3300025928 Ga0207700_10637659 Ga0207700_106376591 135
234 3300025929 Ga0207664_10176503 Ga0207664_101765032 135
235 3300025932 Ga0207690_10133527 Ga0207690_101335272 135
236 3300025932 Ga0207690_10720406 Ga0207690_107204062 135
237 3300025933 Ga0207706_10304272 Ga0207706_103042722 135
238 3300025933 Ga0207706_10366346 Ga0207706_103663462 135
239 3300025933 Ga0207706_10510400 Ga0207706_105104001 135
240 3300025934 Ga0207686_10717609 Ga0207686_107176092 135
241 3300025934 Ga0207686_11029285 Ga0207686_110292851 135
242 3300025935 Ga0207709_10160865 Ga0207709_101608652 135
243 3300025936 Ga0207670_10001929 Ga0207670_100019298 135
244 3300025936 Ga0207670_10429860 Ga0207670_104298602 135
245 3300025936 Ga0207670_11073078 Ga0207670_110730781 135
246 3300025937 Ga0207669_10054461 Ga0207669_100544613 135
247 3300025937 Ga0207669_10475707 Ga0207669_104757071 135
248 3300025938 Ga0207704_11276465 Ga0207704_112764652 135
249 3300025939 Ga0207665_10276765 Ga0207665_102767652 135
250 3300025939 Ga0207665_10705855 Ga0207665_107058551 135
251 3300025940 Ga0207691_10001529 Ga0207691_1000152922 135
252 3300025941 Ga0207711_10191867 Ga0207711_101918673 135
253 3300025941 Ga0207711_10590610 Ga0207711_105906102 135
254 3300025942 Ga0207689_10686310 Ga0207689_106863102 135
255 3300025942 Ga0207689_10884844 Ga0207689_108848442 135
256 3300025945 Ga0207679_10306409 Ga0207679_103064092 135
257 3300025949 Ga0207667_10140896 Ga0207667_101408963 135
258 3300025949 Ga0207667_10174568 Ga0207667_101745682 135
259 3300025960 Ga0207651_10048116 Ga0207651_100481162 135
260 3300025960 Ga0207651_10059622 Ga0207651_100596223 135
261 3300025961 Ga0207712_10568255 Ga0207712_105682552 135
262 3300025972 Ga0207668_10556512 Ga0207668_105565122 135
263 3300025981 Ga0207640_10683339 Ga0207640_106833392 135
264 3300025981 Ga0207640_10946681 Ga0207640_109466811 135
265 3300025986 Ga0207658_10252118 Ga0207658_102521182 135
266 3300026023 Ga0207677_10883150 Ga0207677_108831502 135
267 3300026067 Ga0207678_10091110 Ga0207678_100911102 135
268 3300026078 Ga0207702_10283080 Ga0207702_102830804 135
269 3300026088 Ga0207641_10257253 Ga0207641_102572532 135
270 3300026089 Ga0207648_10040492 Ga0207648_100404922 135
271 3300026089 Ga0207648_10225793 Ga0207648_102257932 135
272 3300026095 Ga0207676_10092759 Ga0207676_100927593 135
273 3300026116 Ga0207674_10823980 Ga0207674_108239802 135
274 3300026118 Ga0207675_100535287 Ga0207675_1005352872 135
275 3300026121 Ga0207683_10039179 Ga0207683_100391792 135
276 3300026121 Ga0207683_10053626 Ga0207683_100536262 135
277 3300028379 Ga0268266_10633142 Ga0268266_106331422 135
278 3300028379 Ga0268266_10756019 Ga0268266_107560192 135
279 3300028380 Ga0268265_10257066 Ga0268265_102570662 135
280 3300028380 Ga0268265_10610338 Ga0268265_106103381 135
281 3300028381 Ga0268264_10577436 Ga0268264_105774362 135
282 3300028800 Ga0265338_10029171 Ga0265338_100291715 135
283 3300031235 Ga0265330_10011405 Ga0265330_100114051 135
284 3300031241 Ga0265325_10001294 Ga0265325_100012944 135
285 3300031249 Ga0265339_10118125 Ga0265339_101181252 135
286 3300031595 Ga0265313_10004856 Ga0265313_100048565 135
287 3300031665 Ga0316575_10051176 Ga0316575_100511762 135
288 3300031691 Ga0316579_10001828 Ga0316579_100018282 135
289 3300031712 Ga0265342_10005370 Ga0265342_100053701 135
290 3300031731 Ga0307405_10315655 Ga0307405_103156551 135
291 3300031824 Ga0307413_11236719 Ga0307413_112367191 135
292 3300031852 Ga0307410_10211707 Ga0307410_102117073 135
293 3300032002 Ga0307416_101163610 Ga0307416_1011636103 135
294 3300032002 Ga0307416_101928945 Ga0307416_1019289452 135
295 3300032004 Ga0307414_10332939 Ga0307414_103329393 135
296 3300032133 Ga0316583_10112386 Ga0316583_101123862 135
297 3300032168 Ga0316593_10118353 Ga0316593_101183531 135
298 3300035088 Ga0373940_0108095 Ga0373940_0108095_231_638 135
299 3300035112 Ga0373932_0360780 Ga0373932_0360780_34_444 135
300 3300035114 Ga0373939_0201381 Ga0373939_0201381_162_569 135
301 3300035114 Ga0373939_0254491 Ga0373939_0254491_61_468 135
302 3300035115 Ga0373941_0001448 Ga0373941_0001448_4398_4805 135
303 3300035691 Ga0373931_0014417 Ga0373931_0014417_1791_2198 135
304 3300035692 Ga0373935_0619573 Ga0373935_0619573_47_454 135
305 3300037312 Ga0395899_0015836 Ga0395899_0015836_18_425 135
306 3300037312 Ga0395899_0301753 Ga0395899_0301753_391_798 135
307 3300037418 Ga0395900_0012905 Ga0395900_0012905_3756_4163 135
308 3300037418 Ga0395900_0021294 Ga0395900_0021294_2851_3258 135
309 3300037418 Ga0395900_0702410 Ga0395900_0702410_151_558 135
310 3300037466 Ga0395898_0004061 Ga0395898_0004061_3754_4161 135
311 3300037466 Ga0395898_0009509 Ga0395898_0009509_7546_7953 135
312 3300038443 Ga0395901_0063437 Ga0395901_0063437_2946_3353 135
313 3300038443 Ga0395901_0075702 Ga0395901_0075702_408_815 135
314 3300038443 Ga0395901_0320091 Ga0395901_0320091_1012_1419 135
315 3300039437 Ga0436365_0885430 Ga0436365_0885430_108_515 135
316 3300039437 Ga0436365_0961715 Ga0436365_0961715_1275_1682 135
317 3300039453 Ga0436362_0527489 Ga0436362_0527489_405_812 135
318 3300042156 Ga0439446_0094832 Ga0439446_0094832_482_892 135
319 3300044694 Ga0466963_0004913 Ga0466963_0004913_6920_7327 135
320 3300044842 Ga0466957_0084755 Ga0466957_0084755_310_717 135
321 3300044842 Ga0466957_0635420 Ga0466957_0635420_182_589 135
322 3300045836 Ga0466958_0532119 Ga0466958_0532119_262_669 135
323 3300045836 Ga0466958_0557420 Ga0466958_0557420_242_649 135
324 3300045976 Ga0466967_0004481 Ga0466967_0004481_1731_2138 135
325 3300046525 Ga0495663_0096683 Ga0495663_0096683_207_617 135
326 3300046537 Ga0495598_0061653 Ga0495598_0061653_593_1003 135
327 3300046539 Ga0495621_0019593 Ga0495621_0019593_1049_1459 135
328 3300046674 Ga0495588_0427382 Ga0495588_0427382_225_635 135
329 3300048903 Ga0496100_0148148 Ga0496100_0148148_429_839 135
330 3300048911 Ga0496108_1666307 Ga0496108_1666307_57_467 135
331 3300048912 Ga0496109_0438954 Ga0496109_0438954_630_1037 135
332 3300048913 Ga0496110_1714813 Ga0496110_1714813_35_445 135
333 3300048916 Ga0496113_1106083 Ga0496113_1106083_90_497 135
334 3300049568 Ga0501031_0055410 Ga0501031_0055410_370_777 135
335 3300049568 Ga0501031_0094393 Ga0501031_0094393_991_1398 135
336 3300049569 Ga0501032_0030967 Ga0501032_0030967_973_1380 135
337 3300049569 Ga0501032_0040655 Ga0501032_0040655_2045_2452 135
338 3300049569 Ga0501032_0068079 Ga0501032_0068079_203_610 135
339 3300049569 Ga0501032_0123310 Ga0501032_0123310_758_1165 135
340 3300049569 Ga0501032_0151865 Ga0501032_0151865_230_637 135
341 3300049570 Ga0501033_0028700 Ga0501033_0028700_3253_3660 135
342 3300049570 Ga0501033_0059979 Ga0501033_0059979_2053_2460 135
343 3300049571 Ga0501034_0000673 Ga0501034_0000673_1768_2175 135
344 3300049571 Ga0501034_0023496 Ga0501034_0023496_1656_2063 135
345 3300049571 Ga0501034_0049412 Ga0501034_0049412_1609_2016 135
346 3300049571 Ga0501034_0216590 Ga0501034_0216590_420_827 135
347 3300049571 Ga0501034_0229335 Ga0501034_0229335_1039_1446 135
348 3300049571 Ga0501034_0450220 Ga0501034_0450220_273_680 135
349 3300049571 Ga0501034_0544421 Ga0501034_0544421_300_707 135
350 3300049571 Ga0501034_1260964 Ga0501034_1260964_55_462 135
351 3300049571 Ga0501034_1270826 Ga0501034_1270826_91_498 135
352 3300049572 Ga0501036_0005575 Ga0501036_0005575_2648_3055 135
353 3300049572 Ga0501036_0033364 Ga0501036_0033364_3038_3445 135
354 3300049572 Ga0501036_0055522 Ga0501036_0055522_2248_2655 135
355 3300049572 Ga0501036_0229897 Ga0501036_0229897_948_1355 135
356 3300049572 Ga0501036_0252595 Ga0501036_0252595_784_1191 135
357 3300049573 Ga0501037_0052803 Ga0501037_0052803_498_905 135
358 3300049573 Ga0501037_0060837 Ga0501037_0060837_516_923 135
359 3300049573 Ga0501037_0071301 Ga0501037_0071301_230_637 135
360 3300049573 Ga0501037_0162150 Ga0501037_0162150_950_1357 135
361 3300049573 Ga0501037_0189288 Ga0501037_0189288_440_847 135
362 3300049574 Ga0501038_0041190 Ga0501038_0041190_3327_3734 135
363 3300049574 Ga0501038_0190682 Ga0501038_0190682_1162_1569 135
364 3300049574 Ga0501038_0228294 Ga0501038_0228294_684_1091 135
365 3300049575 Ga0501039_0028239 Ga0501039_0028239_3207_3614 135
366 3300049575 Ga0501039_0477886 Ga0501039_0477886_42_449 135
367 3300049575 Ga0501039_0637503 Ga0501039_0637503_382_789 135
368 3300049576 Ga0501040_0063114 Ga0501040_0063114_1768_2175 135
369 3300049578 Ga0501042_1122757 Ga0501042_1122757_62_469 135
370 3300049579 Ga0501043_0022122 Ga0501043_0022122_3403_3810 135
371 3300049579 Ga0501043_0059478 Ga0501043_0059478_2118_2525 135
372 3300049579 Ga0501043_0065878 Ga0501043_0065878_631_1038 135
373 3300049579 Ga0501043_0194480 Ga0501043_0194480_535_942 135
374 3300049579 Ga0501043_0281106 Ga0501043_0281106_785_1192 135
375 3300049580 Ga0501046_0011862 Ga0501046_0011862_170_577 135
376 3300049580 Ga0501046_0142149 Ga0501046_0142149_392_799 135
377 3300049580 Ga0501046_0217673 Ga0501046_0217673_351_758 135
378 3300049580 Ga0501046_0252886 Ga0501046_0252886_70_477 135
379 3300049580 Ga0501046_0838724 Ga0501046_0838724_63_470 135
380 3300049581 Ga0501047_0000073 Ga0501047_0000073_90377_90784 135
381 3300049581 Ga0501047_0054456 Ga0501047_0054456_2269_2676 135
382 3300049581 Ga0501047_0112672 Ga0501047_0112672_1525_1932 135
383 3300049581 Ga0501047_0224972 Ga0501047_0224972_447_854 135
384 3300049581 Ga0501047_0306781 Ga0501047_0306781_915_1322 135
385 3300049581 Ga0501047_0317033 Ga0501047_0317033_44_451 135
386 3300049581 Ga0501047_0998669 Ga0501047_0998669_222_629 135
387 3300049582 Ga0501048_0000014 Ga0501048_0000014_2639_3046 135
388 3300049582 Ga0501048_0078388 Ga0501048_0078388_1295_1702 135
389 3300049582 Ga0501048_1085819 Ga0501048_1085819_58_465 135
390 3300049583 Ga0501067_0045679 Ga0501067_0045679_1642_2049 135
391 3300049583 Ga0501067_0060994 Ga0501067_0060994_686_1093 135
392 3300049583 Ga0501067_0267129 Ga0501067_0267129_411_818 135
393 3300049583 Ga0501067_0276021 Ga0501067_0276021_57_464 135
394 3300049584 Ga0501068_0032470 Ga0501068_0032470_693_1100 135
395 3300049584 Ga0501068_0098619 Ga0501068_0098619_1265_1672 135
396 3300049584 Ga0501068_0167569 Ga0501068_0167569_870_1277 135
397 3300049584 Ga0501068_0411222 Ga0501068_0411222_340_747 135
398 3300049585 Ga0501069_0031686 Ga0501069_0031686_355_762 135
399 3300049585 Ga0501069_0174648 Ga0501069_0174648_239_646 135
400 3300049585 Ga0501069_0242868 Ga0501069_0242868_37_444 135
401 3300049586 Ga0501070_0002742 Ga0501070_0002742_717_1124 135
402 3300049586 Ga0501070_0002868 Ga0501070_0002868_13600_14007 135
403 3300049586 Ga0501070_0057373 Ga0501070_0057373_2750_3157 135
404 3300049586 Ga0501070_0062734 Ga0501070_0062734_140_547 135
405 3300049586 Ga0501070_0073103 Ga0501070_0073103_203_610 135
406 3300049586 Ga0501070_0192585 Ga0501070_0192585_1086_1493 135
407 3300049586 Ga0501070_0243148 Ga0501070_0243148_1010_1417 135
408 3300049586 Ga0501070_0446630 Ga0501070_0446630_280_687 135
409 3300049586 Ga0501070_0567321 Ga0501070_0567321_202_609 135
410 3300049587 Ga0501071_0087284 Ga0501071_0087284_202_609 135
411 3300049587 Ga0501071_0134108 Ga0501071_0134108_518_925 135
412 3300049587 Ga0501071_0690254 Ga0501071_0690254_209_616 135
413 3300049587 Ga0501071_1201777 Ga0501071_1201777_39_446 135
414 3300049588 Ga0501072_0483669 Ga0501072_0483669_303_710 135
415 3300049588 Ga0501072_0720709 Ga0501072_0720709_183_590 135
416 3300049588 Ga0501072_0839063 Ga0501072_0839063_37_444 135
417 3300049589 Ga0501073_0058212 Ga0501073_0058212_107_514 135
418 3300049589 Ga0501073_0105791 Ga0501073_0105791_327_734 135
419 3300049589 Ga0501073_0159784 Ga0501073_0159784_178_585 135
420 3300049589 Ga0501073_1051988 Ga0501073_1051988_42_449 135
421 3300049590 Ga0501074_0019510 Ga0501074_0019510_392_799 135
422 3300049590 Ga0501074_0035820 Ga0501074_0035820_1108_1515 135
423 3300049590 Ga0501074_0130040 Ga0501074_0130040_875_1282 135
424 3300049590 Ga0501074_0231763 Ga0501074_0231763_526_933 135
425 3300049590 Ga0501074_0358667 Ga0501074_0358667_615_1022 135
426 3300049592 Ga0501076_0200324 Ga0501076_0200324_391_798 135
427 3300049741 Ga0501079_0071314 Ga0501079_0071314_1560_1967 135
428 3300049741 Ga0501079_0213719 Ga0501079_0213719_485_892 135
429 3300049741 Ga0501079_0338208 Ga0501079_0338208_225_632 135
430 3300049742 Ga0501080_0000351 Ga0501080_0000351_31589_31996 135
431 3300049742 Ga0501080_0044957 Ga0501080_0044957_483_890 135
432 3300049742 Ga0501080_0055389 Ga0501080_0055389_3084_3491 135
433 3300049742 Ga0501080_0092687 Ga0501080_0092687_2301_2708 135
434 3300049742 Ga0501080_0102549 Ga0501080_0102549_1667_2074 135
435 3300049742 Ga0501080_0174110 Ga0501080_0174110_994_1401 135
436 3300049742 Ga0501080_0334275 Ga0501080_0334275_760_1167 135
437 3300049744 Ga0501083_0000901 Ga0501083_0000901_541_948 135
438 3300049744 Ga0501083_0141334 Ga0501083_0141334_237_644 135
439 3300049744 Ga0501083_0144510 Ga0501083_0144510_80_487 135
440 3300049744 Ga0501083_0443778 Ga0501083_0443778_37_444 135
441 3300049744 Ga0501083_0558532 Ga0501083_0558532_122_529 135
442 3300049744 Ga0501083_0678524 Ga0501083_0678524_188_595 135
443 3300049822 Ga0501035_0000197 Ga0501035_0000197_49965_50372 135
444 3300049822 Ga0501035_0148957 Ga0501035_0148957_345_752 135
445 3300049822 Ga0501035_0153544 Ga0501035_0153544_977_1384 135
446 3300049822 Ga0501035_0162634 Ga0501035_0162634_832_1239 135
447 3300049823 Ga0501044_0015464 Ga0501044_0015464_4860_5267 135
448 3300049823 Ga0501044_0031825 Ga0501044_0031825_5003_5410 135
449 3300049823 Ga0501044_0053999 Ga0501044_0053999_2683_3090 135
450 3300049823 Ga0501044_0139160 Ga0501044_0139160_203_610 135
451 3300049823 Ga0501044_0145445 Ga0501044_0145445_392_799 135
452 3300049823 Ga0501044_0165530 Ga0501044_0165530_1448_1855 135
453 3300049823 Ga0501044_0259316 Ga0501044_0259316_566_973 135
454 3300049824 Ga0501045_0331771 Ga0501045_0331771_606_1013 135
455 3300049824 Ga0501045_0621710 Ga0501045_0621710_212_619 135
456 3300050490 nmdc:mga03n38_93720_c1 nmdc:mga03n38_93720_c1_730_1137 135
457 3300050495 nmdc:mga04h51_68343_c1 nmdc:mga04h51_68343_c1_79_486 135
458 3300050496 nmdc:mga07m45_124540_c1 nmdc:mga07m45_124540_c1_698_1105 135
459 3300050514 nmdc:mga08x19_152741_c1 nmdc:mga08x19_152741_c1_966_1373 135
460 3300054114 Ga0501084_0226000 Ga0501084_0226000_874_1281 135
461 3300054114 Ga0501084_1207883 Ga0501084_1207883_213_620 135
462 3300060353 Ga0501082_0110740 Ga0501082_0110740_1278_1685 135
463 3300060353 Ga0501082_0186118 Ga0501082_0186118_430_837 135
464 3300060353 Ga0501082_0193832 Ga0501082_0193832_1088_1495 135
465 3300060353 Ga0501082_0346424 Ga0501082_0346424_431_838 135
466 3300060353 Ga0501082_0415525 Ga0501082_0415525_93_500 135
467 2162886007 SwRhRL2b_contig_3045067 SwRhRL2b_1000.00006220 136
468 2209111006 2214772984 2213792898 136
469 3300000042 ARSoilYngRDRAFT_c00377 ARSoilYngRDRAFT_003773 136
470 3300000043 ARcpr5yngRDRAFT_c000358 ARcpr5yngRDRAFT_0003583 136
471 3300000044 ARSoilOldRDRAFT_c000321 ARSoilOldRDRAFT_0003213 136
472 3300000045 ARCol0oldRDRAFT_c00150 ARCol0oldRDRAFT_001505 136
473 3300000652 ARCol0yngRDRAFT_1000371 ARCol0yngRDRAFT_10003713 136
474 3300001977 JGI24746J21847_1001703 JGI24746J21847_10017033 136
475 3300001989 JGI24739J22299_10036647 JGI24739J22299_100366472 136
476 3300001990 JGI24737J22298_10004265 JGI24737J22298_100042654 136
477 3300001991 JGI24743J22301_10049499 JGI24743J22301_100494992 136
478 3300001991 JGI24743J22301_10132025 JGI24743J22301_101320251 136
479 3300002067 JGI24735J21928_10196898 JGI24735J21928_101968981 136
480 3300002070 JGI24750J21931_1000505 JGI24750J21931_10005053 136
481 3300002073 JGI24745J21846_1001173 JGI24745J21846_10011732 136
482 3300002074 JGI24748J21848_1000728 JGI24748J21848_10007283 136
483 3300002075 JGI24738J21930_10000064 JGI24738J21930_100000643 136
484 3300002076 JGI24749J21850_1000745 JGI24749J21850_10007452 136
485 3300002077 JGI24744J21845_10000737 JGI24744J21845_100007372 136
486 3300002077 JGI24744J21845_10027143 JGI24744J21845_100271432 136
487 3300002126 JGI24035J26624_1001283 JGI24035J26624_10012832 136
488 3300002155 JGI24033J26618_1001199 JGI24033J26618_10011992 136
489 3300002239 JGI24034J26672_10000317 JGI24034J26672_100003176 136
490 3300002244 JGI24742J22300_10000416 JGI24742J22300_100004165 136
491 3300002459 JGI24751J29686_10007027 JGI24751J29686_100070273 136
492 3300002459 JGI24751J29686_10019620 JGI24751J29686_100196202 136
493 3300002459 JGI24751J29686_10036080 JGI24751J29686_100360802 136
494 3300003203 JGI25406J46586_10007262 JGI25406J46586_100072624 136
495 3300003349 JGI26129J50193_1007271 JGI26129J50193_10072712 136
496 3300003371 JGI26145J50221_1008244 JGI26145J50221_10082442 136
497 3300005276 Ga0065717_1002482 Ga0065717_10024823 136
498 3300005288 Ga0065714_10184423 Ga0065714_101844232 136
499 3300005289 Ga0065704_10132316 Ga0065704_101323162 136
500 3300005290 Ga0065712_10005081 Ga0065712_100050814 136
501 3300005290 Ga0065712_10013426 Ga0065712_100134262 136
502 3300005290 Ga0065712_10070998 Ga0065712_100709983 136
503 3300005293 Ga0065715_10004000 Ga0065715_100040003 136
504 3300005293 Ga0065715_10105191 Ga0065715_101051912 136
505 3300005293 Ga0065715_10454817 Ga0065715_104548171 136
506 3300005295 Ga0065707_10010312 Ga0065707_100103123 136
507 3300005295 Ga0065707_10026407 Ga0065707_100264072 136
508 3300005295 Ga0065707_10104099 Ga0065707_101040992 136
509 3300005295 Ga0065707_10253804 Ga0065707_102538043 136
510 3300005327 Ga0070658_10733898 Ga0070658_107338981 136
511 3300005328 Ga0070676_10011938 Ga0070676_100119384 136
512 3300005328 Ga0070676_10080414 Ga0070676_100804142 136
513 3300005328 Ga0070676_10536298 Ga0070676_105362982 136
514 3300005329 Ga0070683_100005169 Ga0070683_1000051696 136
515 3300005330 Ga0070690_100007790 Ga0070690_1000077904 136
516 3300005331 Ga0070670_100057070 Ga0070670_1000570703 136
517 3300005331 Ga0070670_100088659 Ga0070670_1000886594 136
518 3300005331 Ga0070670_100214371 Ga0070670_1002143713 136
519 3300005331 Ga0070670_100343477 Ga0070670_1003434772 136
520 3300005333 Ga0070677_10019778 Ga0070677_100197782 136
521 3300005334 Ga0068869_100100178 Ga0068869_1001001784 136
522 3300005334 Ga0068869_100135127 Ga0068869_1001351271 136
523 3300005334 Ga0068869_100242448 Ga0068869_1002424481 136
524 3300005335 Ga0070666_10010052 Ga0070666_100100524 136
525 3300005335 Ga0070666_10078662 Ga0070666_100786621 136
526 3300005335 Ga0070666_10130987 Ga0070666_101309872 136
527 3300005335 Ga0070666_10577990 Ga0070666_105779902 136
528 3300005336 Ga0070680_100044795 Ga0070680_1000447954 136
529 3300005336 Ga0070680_100079124 Ga0070680_1000791242 136
530 3300005337 Ga0070682_100009542 Ga0070682_1000095424 136
531 3300005337 Ga0070682_100056461 Ga0070682_1000564612 136
532 3300005337 Ga0070682_101065601 Ga0070682_1010656012 136
533 3300005338 Ga0068868_100117597 Ga0068868_1001175972 136
534 3300005338 Ga0068868_100168843 Ga0068868_1001688433 136
535 3300005339 Ga0070660_100057387 Ga0070660_1000573872 136
536 3300005339 Ga0070660_100076560 Ga0070660_1000765601 136
537 3300005339 Ga0070660_100087365 Ga0070660_1000873652 136
538 3300005340 Ga0070689_100014470 Ga0070689_1000144702 136
539 3300005340 Ga0070689_100053207 Ga0070689_1000532073 136
540 3300005340 Ga0070689_100284490 Ga0070689_1002844903 136
541 3300005340 Ga0070689_100480999 Ga0070689_1004809991 136
542 3300005340 Ga0070689_100874874 Ga0070689_1008748742 136
543 3300005341 Ga0070691_10007611 Ga0070691_100076114 136
544 3300005343 Ga0070687_100012602 Ga0070687_1000126024 136
545 3300005343 Ga0070687_100255747 Ga0070687_1002557472 136
546 3300005343 Ga0070687_100681600 Ga0070687_1006816001 136
547 3300005344 Ga0070661_100015266 Ga0070661_1000152664 136
548 3300005344 Ga0070661_100090140 Ga0070661_1000901402 136
549 3300005344 Ga0070661_100328633 Ga0070661_1003286331 136
550 3300005345 Ga0070692_10000468 Ga0070692_1000046811 136
551 3300005345 Ga0070692_10026545 Ga0070692_100265451 136
552 3300005345 Ga0070692_10569300 Ga0070692_105693002 136
553 3300005347 Ga0070668_100074575 Ga0070668_1000745752 136
554 3300005347 Ga0070668_100625646 Ga0070668_1006256461 136
555 3300005347 Ga0070668_101591110 Ga0070668_1015911101 136
556 3300005347 Ga0070668_102100177 Ga0070668_1021001771 136
557 3300005353 Ga0070669_100011957 Ga0070669_1000119575 136
558 3300005353 Ga0070669_100355211 Ga0070669_1003552112 136
559 3300005354 Ga0070675_100098935 Ga0070675_1000989352 136
560 3300005354 Ga0070675_100223958 Ga0070675_1002239583 136
561 3300005354 Ga0070675_100675786 Ga0070675_1006757862 136
562 3300005355 Ga0070671_100002503 Ga0070671_1000025033 136
563 3300005355 Ga0070671_100085472 Ga0070671_1000854724 136
564 3300005355 Ga0070671_100615863 Ga0070671_1006158631 136
565 3300005356 Ga0070674_100001688 Ga0070674_1000016885 136
566 3300005356 Ga0070674_100007283 Ga0070674_1000072833 136
567 3300005356 Ga0070674_100511718 Ga0070674_1005117181 136
568 3300005356 Ga0070674_100828308 Ga0070674_1008283081 136
569 3300005364 Ga0070673_100001494 Ga0070673_1000014944 136
570 3300005364 Ga0070673_100008376 Ga0070673_1000083761 136
571 3300005364 Ga0070673_100156689 Ga0070673_1001566893 136
572 3300005364 Ga0070673_100723620 Ga0070673_1007236202 136
573 3300005365 Ga0070688_100019522 Ga0070688_1000195225 136
574 3300005365 Ga0070688_100034590 Ga0070688_1000345903 136
575 3300005365 Ga0070688_100070872 Ga0070688_1000708722 136
576 3300005366 Ga0070659_100036242 Ga0070659_1000362422 136
577 3300005366 Ga0070659_100046147 Ga0070659_1000461472 136
578 3300005366 Ga0070659_101303853 Ga0070659_1013038531 136
579 3300005366 Ga0070659_101622729 Ga0070659_1016227292 136
580 3300005367 Ga0070667_100009726 Ga0070667_1000097266 136
581 3300005367 Ga0070667_100075256 Ga0070667_1000752564 136
582 3300005367 Ga0070667_100076055 Ga0070667_1000760553 136
583 3300005367 Ga0070667_102060032 Ga0070667_1020600321 136
584 3300005434 Ga0070709_10013606 Ga0070709_100136065 136
585 3300005434 Ga0070709_10136412 Ga0070709_101364123 136
586 3300005435 Ga0070714_100283485 Ga0070714_1002834852 136
587 3300005435 Ga0070714_101321526 Ga0070714_1013215261 136
588 3300005435 Ga0070714_101682833 Ga0070714_1016828332 136
589 3300005436 Ga0070713_100006436 Ga0070713_1000064369 136
590 3300005436 Ga0070713_100051416 Ga0070713_1000514163 136
591 3300005436 Ga0070713_101964658 Ga0070713_1019646581 136
592 3300005437 Ga0070710_10007070 Ga0070710_100070706 136
593 3300005437 Ga0070710_10014307 Ga0070710_100143073 136
594 3300005437 Ga0070710_10022863 Ga0070710_100228634 136
595 3300005437 Ga0070710_10627333 Ga0070710_106273331 136
596 3300005438 Ga0070701_10041877 Ga0070701_100418773 136
597 3300005438 Ga0070701_10890411 Ga0070701_108904112 136
598 3300005439 Ga0070711_100022460 Ga0070711_1000224604 136
599 3300005439 Ga0070711_100022906 Ga0070711_1000229063 136
600 3300005439 Ga0070711_100064500 Ga0070711_1000645001 136
601 3300005439 Ga0070711_100154504 Ga0070711_1001545042 136
602 3300005439 Ga0070711_101725379 Ga0070711_1017253791 136
603 3300005440 Ga0070705_100008212 Ga0070705_1000082123 136
604 3300005440 Ga0070705_100202163 Ga0070705_1002021632 136
605 3300005441 Ga0070700_100009342 Ga0070700_1000093423 136
606 3300005441 Ga0070700_100812954 Ga0070700_1008129542 136
607 3300005444 Ga0070694_100019047 Ga0070694_1000190472 136
608 3300005444 Ga0070694_100052810 Ga0070694_1000528103 136
609 3300005445 Ga0070708_100380081 Ga0070708_1003800812 136
610 3300005445 Ga0070708_100542021 Ga0070708_1005420212 136
611 3300005455 Ga0070663_100088807 Ga0070663_1000888071 136
612 3300005455 Ga0070663_100256405 Ga0070663_1002564053 136
613 3300005456 Ga0070678_100027153 Ga0070678_1000271534 136
614 3300005456 Ga0070678_100104169 Ga0070678_1001041693 136
615 3300005457 Ga0070662_100238406 Ga0070662_1002384062 136
616 3300005457 Ga0070662_101464359 Ga0070662_1014643591 136
617 3300005458 Ga0070681_10086218 Ga0070681_100862183 136
618 3300005458 Ga0070681_10204760 Ga0070681_102047602 136
619 3300005459 Ga0068867_100049797 Ga0068867_1000497971 136
620 3300005466 Ga0070685_10001432 Ga0070685_100014324 136
621 3300005466 Ga0070685_10047415 Ga0070685_100474154 136
622 3300005466 Ga0070685_10908406 Ga0070685_109084061 136
623 3300005467 Ga0070706_100893195 Ga0070706_1008931952 136
624 3300005507 Ga0074259_11045692 Ga0074259_110456921 136
625 3300005518 Ga0070699_100433672 Ga0070699_1004336722 136
626 3300005518 Ga0070699_101891822 Ga0070699_1018918221 136
627 3300005530 Ga0070679_100030767 Ga0070679_1000307671 136
628 3300005530 Ga0070679_100291370 Ga0070679_1002913702 136
629 3300005530 Ga0070679_100805647 Ga0070679_1008056471 136
630 3300005530 Ga0070679_100991625 Ga0070679_1009916251 136
631 3300005530 Ga0070679_101266935 Ga0070679_1012669351 136
632 3300005535 Ga0070684_100003138 Ga0070684_1000031383 136
633 3300005535 Ga0070684_100177999 Ga0070684_1001779991 136
634 3300005535 Ga0070684_100237189 Ga0070684_1002371892 136
635 3300005535 Ga0070684_101356513 Ga0070684_1013565132 136
636 3300005539 Ga0068853_100040979 Ga0068853_1000409792 136
637 3300005539 Ga0068853_100859941 Ga0068853_1008599411 136
638 3300005543 Ga0070672_100003940 Ga0070672_1000039404 136
639 3300005543 Ga0070672_100190413 Ga0070672_1001904131 136
640 3300005543 Ga0070672_100278400 Ga0070672_1002784003 136
641 3300005543 Ga0070672_100937772 Ga0070672_1009377721 136
642 3300005543 Ga0070672_101503759 Ga0070672_1015037591 136
643 3300005544 Ga0070686_100002212 Ga0070686_10000221211 136
644 3300005544 Ga0070686_100008334 Ga0070686_1000083346 136
645 3300005544 Ga0070686_100384232 Ga0070686_1003842322 136
646 3300005545 Ga0070695_100007770 Ga0070695_1000077702 136
647 3300005545 Ga0070695_101036180 Ga0070695_1010361801 136
648 3300005546 Ga0070696_100037457 Ga0070696_1000374573 136
649 3300005546 Ga0070696_100160619 Ga0070696_1001606192 136
650 3300005547 Ga0070693_100310241 Ga0070693_1003102412 136
651 3300005547 Ga0070693_100333475 Ga0070693_1003334751 136
652 3300005547 Ga0070693_100889223 Ga0070693_1008892232 136
653 3300005548 Ga0070665_100151970 Ga0070665_1001519702 136
654 3300005548 Ga0070665_100732957 Ga0070665_1007329573 136
655 3300005548 Ga0070665_101528515 Ga0070665_1015285152 136
656 3300005548 Ga0070665_101678704 Ga0070665_1016787041 136
657 3300005549 Ga0070704_100018120 Ga0070704_1000181203 136
658 3300005563 Ga0068855_101076541 Ga0068855_1010765411 136
659 3300005563 Ga0068855_101348547 Ga0068855_1013485471 136
660 3300005564 Ga0070664_100167787 Ga0070664_1001677872 136
661 3300005564 Ga0070664_100349578 Ga0070664_1003495782 136
662 3300005564 Ga0070664_101863571 Ga0070664_1018635711 136
663 3300005564 Ga0070664_101888896 Ga0070664_1018888961 136
664 3300005577 Ga0068857_100001961 Ga0068857_10000196111 136
665 3300005577 Ga0068857_100166413 Ga0068857_1001664132 136
666 3300005577 Ga0068857_100589513 Ga0068857_1005895131 136
667 3300005577 Ga0068857_101575533 Ga0068857_1015755331 136
668 3300005578 Ga0068854_100015429 Ga0068854_1000154294 136
669 3300005614 Ga0068856_100004763 Ga0068856_1000047638 136
670 3300005614 Ga0068856_100368091 Ga0068856_1003680912 136
671 3300005615 Ga0070702_100018099 Ga0070702_1000180993 136
672 3300005615 Ga0070702_100034821 Ga0070702_1000348213 136
673 3300005615 Ga0070702_100201150 Ga0070702_1002011503 136
674 3300005616 Ga0068852_100019958 Ga0068852_1000199581 136
675 3300005617 Ga0068859_100009749 Ga0068859_1000097498 136
676 3300005617 Ga0068859_100033024 Ga0068859_1000330242 136
677 3300005617 Ga0068859_100141732 Ga0068859_1001417323 136
678 3300005617 Ga0068859_100163260 Ga0068859_1001632603 136
679 3300005618 Ga0068864_100030957 Ga0068864_1000309572 136
680 3300005618 Ga0068864_100063837 Ga0068864_1000638374 136
681 3300005618 Ga0068864_100231142 Ga0068864_1002311421 136
682 3300005618 Ga0068864_100476731 Ga0068864_1004767312 136
683 3300005718 Ga0068866_10007402 Ga0068866_100074021 136
684 3300005718 Ga0068866_10043422 Ga0068866_100434223 136
685 3300005718 Ga0068866_10181186 Ga0068866_101811861 136
686 3300005718 Ga0068866_10191618 Ga0068866_101916181 136
687 3300005719 Ga0068861_100080566 Ga0068861_1000805662 136
688 3300005719 Ga0068861_100104928 Ga0068861_1001049283 136
689 3300005719 Ga0068861_100349439 Ga0068861_1003494392 136
690 3300005834 Ga0068851_10108339 Ga0068851_101083392 136
691 3300005840 Ga0068870_10043436 Ga0068870_100434362 136
692 3300005840 Ga0068870_10089221 Ga0068870_100892213 136
693 3300005840 Ga0068870_10252491 Ga0068870_102524912 136
694 3300005841 Ga0068863_100054829 Ga0068863_1000548293 136
695 3300005841 Ga0068863_100178169 Ga0068863_1001781693 136
696 3300005841 Ga0068863_100638333 Ga0068863_1006383332 136
697 3300005842 Ga0068858_100021010 Ga0068858_1000210104 136
698 3300005842 Ga0068858_100046684 Ga0068858_1000466844 136
699 3300005842 Ga0068858_100058578 Ga0068858_1000585784 136
700 3300005842 Ga0068858_100145373 Ga0068858_1001453732 136
701 3300005842 Ga0068858_100572956 Ga0068858_1005729562 136
702 3300005843 Ga0068860_100035725 Ga0068860_1000357253 136
703 3300005843 Ga0068860_100119160 Ga0068860_1001191603 136
704 3300005844 Ga0068862_100023266 Ga0068862_1000232662 136
705 3300005844 Ga0068862_100040043 Ga0068862_1000400433 136
706 3300005844 Ga0068862_100420603 Ga0068862_1004206032 136
707 3300005937 Ga0081455_10000002 Ga0081455_10000002460 136
708 3300005937 Ga0081455_10019940 Ga0081455_100199403 136
709 3300005937 Ga0081455_10029167 Ga0081455_100291675 136
710 3300005983 Ga0081540_1008535 Ga0081540_10085355 136
711 3300005985 Ga0081539_10001145 Ga0081539_100011458 136
712 3300006028 Ga0070717_10042689 Ga0070717_100426893 136
713 3300006048 Ga0075363_100651469 Ga0075363_1006514692 136
714 3300006048 Ga0075363_101046821 Ga0075363_1010468211 136
715 3300006051 Ga0075364_10036843 Ga0075364_100368435 136
716 3300006058 Ga0075432_10002588 Ga0075432_100025883 136
717 3300006163 Ga0070715_10131819 Ga0070715_101318191 136
718 3300006173 Ga0070716_100016548 Ga0070716_1000165483 136
719 3300006173 Ga0070716_100210847 Ga0070716_1002108473 136
720 3300006175 Ga0070712_100057506 Ga0070712_1000575063 136
721 3300006175 Ga0070712_100208477 Ga0070712_1002084772 136
722 3300006175 Ga0070712_101453058 Ga0070712_1014530582 136
723 3300006177 Ga0075362_10148581 Ga0075362_101485812 136
724 3300006178 Ga0075367_10084751 Ga0075367_100847512 136
725 3300006178 Ga0075367_10760172 Ga0075367_107601721 136
726 3300006194 Ga0075427_10001340 Ga0075427_100013403 136
727 3300006195 Ga0075366_10047333 Ga0075366_100473334 136
728 3300006195 Ga0075366_10393432 Ga0075366_103934321 136
729 3300006195 Ga0075366_10493541 Ga0075366_104935412 136
730 3300006195 Ga0075366_10584670 Ga0075366_105846701 136
731 3300006237 Ga0097621_100007980 Ga0097621_1000079803 136
732 3300006237 Ga0097621_100041982 Ga0097621_1000419823 136
733 3300006237 Ga0097621_102018666 Ga0097621_1020186661 136
734 3300006353 Ga0075370_10122430 Ga0075370_101224302 136
735 3300006358 Ga0068871_100073528 Ga0068871_1000735283 136
736 3300006358 Ga0068871_100107394 Ga0068871_1001073942 136
737 3300006358 Ga0068871_100244036 Ga0068871_1002440362 136
738 3300006844 Ga0075428_100001993 Ga0075428_10000199320 136
739 3300006844 Ga0075428_102569227 Ga0075428_1025692271 136
740 3300006846 Ga0075430_100001212 Ga0075430_10000121217 136
741 3300006846 Ga0075430_101075291 Ga0075430_1010752911 136
742 3300006847 Ga0075431_100001346 Ga0075431_1000013468 136
743 3300006847 Ga0075431_100322801 Ga0075431_1003228012 136
744 3300006852 Ga0075433_10000231 Ga0075433_100002314 136
745 3300006852 Ga0075433_10069149 Ga0075433_100691492 136
746 3300006852 Ga0075433_10192270 Ga0075433_101922704 136
747 3300006852 Ga0075433_10591644 Ga0075433_105916442 136
748 3300006871 Ga0075434_100000271 Ga0075434_1000002714 136
749 3300006871 Ga0075434_100002891 Ga0075434_1000028915 136
750 3300006871 Ga0075434_100033175 Ga0075434_1000331755 136
751 3300006871 Ga0075434_100382237 Ga0075434_1003822373 136
752 3300006871 Ga0075434_100568011 Ga0075434_1005680112 136
753 3300006880 Ga0075429_100011789 Ga0075429_1000117897 136
754 3300006880 Ga0075429_101909791 Ga0075429_1019097911 136
755 3300006881 Ga0068865_100002668 Ga0068865_1000026682 136
756 3300006881 Ga0068865_100348727 Ga0068865_1003487273 136
757 3300006914 Ga0075436_100205070 Ga0075436_1002050702 136
758 3300006931 Ga0097620_100009749 Ga0097620_1000097494 136
759 3300006931 Ga0097620_100033023 Ga0097620_1000330232 136
760 3300006931 Ga0097620_100141729 Ga0097620_1001417293 136
761 3300006931 Ga0097620_100163263 Ga0097620_1001632632 136
762 3300007076 Ga0075435_100042621 Ga0075435_1000426213 136
763 3300007076 Ga0075435_100130523 Ga0075435_1001305232 136
764 3300007076 Ga0075435_100377910 Ga0075435_1003779102 136
765 3300007076 Ga0075435_100761052 Ga0075435_1007610522 136
766 3300009011 Ga0105251_10008273 Ga0105251_100082735 136
767 3300009011 Ga0105251_10062902 Ga0105251_100629022 136
768 3300009092 Ga0105250_10137138 Ga0105250_101371382 136
769 3300009093 Ga0105240_10083366 Ga0105240_100833664 136
770 3300009093 Ga0105240_11980649 Ga0105240_119806491 136
771 3300009094 Ga0111539_10001391 Ga0111539_1000139113 136
772 3300009094 Ga0111539_10002666 Ga0111539_1000266613 136
773 3300009094 Ga0111539_10180804 Ga0111539_101808042 136
774 3300009094 Ga0111539_10738288 Ga0111539_107382882 136
775 3300009094 Ga0111539_10886316 Ga0111539_108863161 136
776 3300009098 Ga0105245_10005838 Ga0105245_100058387 136
777 3300009098 Ga0105245_10163071 Ga0105245_101630714 136
778 3300009098 Ga0105245_10246712 Ga0105245_102467122 136
779 3300009098 Ga0105245_10780139 Ga0105245_107801392 136
780 3300009098 Ga0105245_10873253 Ga0105245_108732532 136
781 3300009098 Ga0105245_12283640 Ga0105245_122836401 136
782 3300009101 Ga0105247_10018150 Ga0105247_100181504 136
783 3300009101 Ga0105247_10042054 Ga0105247_100420542 136
784 3300009101 Ga0105247_10044647 Ga0105247_100446472 136
785 3300009101 Ga0105247_10708601 Ga0105247_107086011 136
786 3300009101 Ga0105247_10708801 Ga0105247_107088011 136
787 3300009147 Ga0114129_10006834 Ga0114129_100068343 136
788 3300009147 Ga0114129_10036823 Ga0114129_100368234 136
789 3300009147 Ga0114129_11373971 Ga0114129_113739712 136
790 3300009148 Ga0105243_10009397 Ga0105243_100093972 136
791 3300009148 Ga0105243_10010661 Ga0105243_100106614 136
792 3300009148 Ga0105243_10031006 Ga0105243_100310063 136
793 3300009148 Ga0105243_10250602 Ga0105243_102506022 136
794 3300009148 Ga0105243_10457157 Ga0105243_104571572 136
795 3300009174 Ga0105241_10039056 Ga0105241_100390563 136
796 3300009174 Ga0105241_10062361 Ga0105241_100623612 136
797 3300009174 Ga0105241_11242333 Ga0105241_112423332 136
798 3300009174 Ga0105241_12611110 Ga0105241_126111101 136
799 3300009176 Ga0105242_10003276 Ga0105242_100032768 136
800 3300009176 Ga0105242_10005721 Ga0105242_100057219 136
801 3300009176 Ga0105242_12107298 Ga0105242_121072982 136
802 3300009176 Ga0105242_12542501 Ga0105242_125425012 136
803 3300009177 Ga0105248_10029352 Ga0105248_100293525 136
804 3300009177 Ga0105248_10079139 Ga0105248_100791393 136
805 3300009177 Ga0105248_10157605 Ga0105248_101576053 136
806 3300009177 Ga0105248_10452519 Ga0105248_104525191 136
807 3300009177 Ga0105248_11367092 Ga0105248_113670921 136
808 3300009545 Ga0105237_10026078 Ga0105237_100260783 136
809 3300009545 Ga0105237_10073011 Ga0105237_100730114 136
810 3300009545 Ga0105237_10130802 Ga0105237_101308023 136
811 3300009545 Ga0105237_10618425 Ga0105237_106184252 136
812 3300009551 Ga0105238_10189552 Ga0105238_101895523 136
813 3300009551 Ga0105238_10205250 Ga0105238_102052502 136
814 3300009551 Ga0105238_10490090 Ga0105238_104900902 136
815 3300009551 Ga0105238_10943893 Ga0105238_109438932 136
816 3300009553 Ga0105249_10003707 Ga0105249_1000370711 136
817 3300009553 Ga0105249_10014965 Ga0105249_100149652 136
818 3300009553 Ga0105249_10073413 Ga0105249_100734134 136
819 3300009553 Ga0105249_10267297 Ga0105249_102672972 136
820 3300010375 Ga0105239_10133814 Ga0105239_101338143 136
821 3300010375 Ga0105239_10656541 Ga0105239_106565411 136
822 3300010375 Ga0105239_10712688 Ga0105239_107126882 136
823 3300010375 Ga0105239_11396563 Ga0105239_113965632 136
824 3300011119 Ga0105246_10048292 Ga0105246_100482924 136
825 3300011119 Ga0105246_10081786 Ga0105246_100817863 136
826 3300011119 Ga0105246_10492719 Ga0105246_104927193 136
827 3300011119 Ga0105246_11893924 Ga0105246_118939241 136
828 3300012481 Ga0157320_1006350 Ga0157320_10063502 136
829 3300012492 Ga0157335_1008294 Ga0157335_10082942 136
830 3300012500 Ga0157314_1005362 Ga0157314_10053622 136
831 3300012507 Ga0157342_1003016 Ga0157342_10030162 136
832 3300012507 Ga0157342_1021216 Ga0157342_10212161 136
833 3300012510 Ga0157316_1024435 Ga0157316_10244351 136
834 3300012515 Ga0157338_1002194 Ga0157338_10021942 136
835 3300013100 Ga0157373_10143510 Ga0157373_101435102 136
836 3300013100 Ga0157373_11015290 Ga0157373_110152902 136
837 3300013102 Ga0157371_10106981 Ga0157371_101069812 136
838 3300013102 Ga0157371_11326895 Ga0157371_113268952 136
839 3300013105 Ga0157369_10612662 Ga0157369_106126622 136
840 3300013296 Ga0157374_10045399 Ga0157374_100453994 136
841 3300013296 Ga0157374_10223145 Ga0157374_102231452 136
842 3300013297 Ga0157378_10082090 Ga0157378_100820903 136
843 3300013297 Ga0157378_10330926 Ga0157378_103309262 136
844 3300013297 Ga0157378_10334752 Ga0157378_103347523 136
845 3300013297 Ga0157378_10364052 Ga0157378_103640523 136
846 3300013297 Ga0157378_10806015 Ga0157378_108060151 136
847 3300013297 Ga0157378_10911881 Ga0157378_109118812 136
848 3300013297 Ga0157378_11745722 Ga0157378_117457222 136
849 3300013306 Ga0163162_10035395 Ga0163162_100353955 136
850 3300013306 Ga0163162_10128488 Ga0163162_101284883 136
851 3300013306 Ga0163162_10168250 Ga0163162_101682502 136
852 3300013306 Ga0163162_10238191 Ga0163162_102381912 136
853 3300013306 Ga0163162_10633137 Ga0163162_106331371 136
854 3300013306 Ga0163162_11811566 Ga0163162_118115661 136
855 3300013306 Ga0163162_11963185 Ga0163162_119631852 136
856 3300013307 Ga0157372_10387219 Ga0157372_103872192 136
857 3300013307 Ga0157372_10849130 Ga0157372_108491302 136
858 3300013308 Ga0157375_10005918 Ga0157375_1000591810 136
859 3300013308 Ga0157375_10224963 Ga0157375_102249633 136
860 3300013308 Ga0157375_11020280 Ga0157375_110202802 136
861 3300013308 Ga0157375_12093632 Ga0157375_120936322 136
862 3300014325 Ga0163163_10004653 Ga0163163_100046534 136
863 3300014325 Ga0163163_10052605 Ga0163163_100526054 136
864 3300014325 Ga0163163_10384875 Ga0163163_103848753 136
865 3300014325 Ga0163163_10406742 Ga0163163_104067423 136
866 3300014325 Ga0163163_11837751 Ga0163163_118377511 136
867 3300014326 Ga0157380_10058175 Ga0157380_100581752 136
868 3300014326 Ga0157380_10074370 Ga0157380_100743702 136
869 3300014326 Ga0157380_10084337 Ga0157380_100843372 136
870 3300014326 Ga0157380_10792133 Ga0157380_107921332 136
871 3300014326 Ga0157380_11130091 Ga0157380_111300912 136
872 3300014497 Ga0182008_10171732 Ga0182008_101717322 136
873 3300014745 Ga0157377_10008866 Ga0157377_100088664 136
874 3300014745 Ga0157377_10207502 Ga0157377_102075022 136
875 3300014968 Ga0157379_10002897 Ga0157379_1000289713 136
876 3300014968 Ga0157379_10282818 Ga0157379_102828182 136
877 3300014968 Ga0157379_10663087 Ga0157379_106630872 136
878 3300014968 Ga0157379_10772029 Ga0157379_107720292 136
879 3300014968 Ga0157379_11049507 Ga0157379_110495072 136
880 3300014969 Ga0157376_10010022 Ga0157376_100100228 136
881 3300014969 Ga0157376_10112470 Ga0157376_101124704 136
882 3300014969 Ga0157376_10449437 Ga0157376_104494372 136
883 3300014969 Ga0157376_10809146 Ga0157376_108091462 136
884 3300014969 Ga0157376_11115914 Ga0157376_111159141 136
885 3300017792 Ga0163161_10110481 Ga0163161_101104813 136
886 3300017792 Ga0163161_10116831 Ga0163161_101168312 136
887 3300017792 Ga0163161_10218255 Ga0163161_102182552 136
888 3300025271 Ga0207666_1000393 Ga0207666_10003935 136
889 3300025271 Ga0207666_1001518 Ga0207666_10015183 136
890 3300025290 Ga0207673_1002171 Ga0207673_10021713 136
891 3300025315 Ga0207697_10001423 Ga0207697_100014235 136
892 3300025315 Ga0207697_10021843 Ga0207697_100218433 136
893 3300025315 Ga0207697_10313426 Ga0207697_103134261 136
894 3300025321 Ga0207656_10273420 Ga0207656_102734201 136
895 3300025711 Ga0207696_1052248 Ga0207696_10522482 136
896 3300025735 Ga0207713_1099262 Ga0207713_10992622 136
897 3300025885 Ga0207653_10035308 Ga0207653_100353082 136
898 3300025893 Ga0207682_10000011 Ga0207682_100000118 136
899 3300025898 Ga0207692_10007288 Ga0207692_100072884 136
900 3300025898 Ga0207692_10101974 Ga0207692_101019743 136
901 3300025899 Ga0207642_10064016 Ga0207642_100640162 136
902 3300025899 Ga0207642_10075287 Ga0207642_100752873 136
903 3300025899 Ga0207642_10300547 Ga0207642_103005472 136
904 3300025900 Ga0207710_10016430 Ga0207710_100164302 136
905 3300025900 Ga0207710_10023260 Ga0207710_100232602 136
906 3300025900 Ga0207710_10100784 Ga0207710_101007841 136
907 3300025900 Ga0207710_10618379 Ga0207710_106183791 136
908 3300025901 Ga0207688_10001874 Ga0207688_100018749 136
909 3300025903 Ga0207680_10031008 Ga0207680_100310084 136
910 3300025903 Ga0207680_10049820 Ga0207680_100498203 136
911 3300025904 Ga0207647_10004915 Ga0207647_100049156 136
912 3300025905 Ga0207685_10018827 Ga0207685_100188273 136
913 3300025906 Ga0207699_10139950 Ga0207699_101399503 136
914 3300025907 Ga0207645_10002566 Ga0207645_100025668 136
915 3300025908 Ga0207643_10000475 Ga0207643_100004755 136
916 3300025908 Ga0207643_10063428 Ga0207643_100634284 136
917 3300025908 Ga0207643_10138084 Ga0207643_101380842 136
918 3300025908 Ga0207643_11150140 Ga0207643_111501401 136
919 3300025911 Ga0207654_10069113 Ga0207654_100691133 136
920 3300025911 Ga0207654_10329719 Ga0207654_103297192 136
921 3300025912 Ga0207707_10046478 Ga0207707_100464782 136
922 3300025912 Ga0207707_10176082 Ga0207707_101760823 136
923 3300025912 Ga0207707_10194568 Ga0207707_101945682 136
924 3300025912 Ga0207707_10715453 Ga0207707_107154532 136
925 3300025913 Ga0207695_10337156 Ga0207695_103371562 136
926 3300025914 Ga0207671_10039663 Ga0207671_100396632 136
927 3300025914 Ga0207671_11122096 Ga0207671_111220961 136
928 3300025915 Ga0207693_10003988 Ga0207693_100039885 136
929 3300025915 Ga0207693_10067631 Ga0207693_100676313 136
930 3300025915 Ga0207693_10879009 Ga0207693_108790092 136
931 3300025915 Ga0207693_11124506 Ga0207693_111245061 136
932 3300025916 Ga0207663_10005887 Ga0207663_100058873 136
933 3300025916 Ga0207663_10040868 Ga0207663_100408682 136
934 3300025916 Ga0207663_10133043 Ga0207663_101330432 136
935 3300025916 Ga0207663_10149495 Ga0207663_101494953 136
936 3300025916 Ga0207663_10282049 Ga0207663_102820491 136
937 3300025917 Ga0207660_10007573 Ga0207660_100075734 136
938 3300025917 Ga0207660_10027932 Ga0207660_100279323 136
939 3300025918 Ga0207662_10278471 Ga0207662_102784712 136
940 3300025919 Ga0207657_10006965 Ga0207657_100069659 136
941 3300025919 Ga0207657_10013146 Ga0207657_100131465 136
942 3300025919 Ga0207657_10079346 Ga0207657_100793464 136
943 3300025920 Ga0207649_10015935 Ga0207649_100159354 136
944 3300025921 Ga0207652_10018065 Ga0207652_100180654 136
945 3300025921 Ga0207652_10349033 Ga0207652_103490332 136
946 3300025921 Ga0207652_11321439 Ga0207652_113214392 136
947 3300025923 Ga0207681_10008142 Ga0207681_100081422 136
948 3300025923 Ga0207681_10012993 Ga0207681_100129934 136
949 3300025923 Ga0207681_10860747 Ga0207681_108607472 136
950 3300025923 Ga0207681_10971434 Ga0207681_109714341 136
951 3300025924 Ga0207694_10130079 Ga0207694_101300793 136
952 3300025924 Ga0207694_10442199 Ga0207694_104421991 136
953 3300025924 Ga0207694_10526370 Ga0207694_105263702 136
954 3300025924 Ga0207694_10787548 Ga0207694_107875482 136
955 3300025924 Ga0207694_10876204 Ga0207694_108762041 136
956 3300025925 Ga0207650_10044585 Ga0207650_100445852 136
957 3300025925 Ga0207650_10046166 Ga0207650_100461663 136
958 3300025925 Ga0207650_10245093 Ga0207650_102450932 136
959 3300025925 Ga0207650_10293432 Ga0207650_102934323 136
960 3300025926 Ga0207659_10007130 Ga0207659_100071307 136
961 3300025926 Ga0207659_10032306 Ga0207659_100323064 136
962 3300025926 Ga0207659_10069004 Ga0207659_100690043 136
963 3300025926 Ga0207659_10250594 Ga0207659_102505942 136
964 3300025926 Ga0207659_10720247 Ga0207659_107202472 136
965 3300025927 Ga0207687_10023979 Ga0207687_100239795 136
966 3300025928 Ga0207700_10000590 Ga0207700_100005903 136
967 3300025928 Ga0207700_10344997 Ga0207700_103449971 136
968 3300025929 Ga0207664_10401290 Ga0207664_104012903 136
969 3300025931 Ga0207644_10055847 Ga0207644_100558472 136
970 3300025931 Ga0207644_10169004 Ga0207644_101690042 136
971 3300025931 Ga0207644_10624295 Ga0207644_106242951 136
972 3300025932 Ga0207690_10029129 Ga0207690_100291293 136
973 3300025932 Ga0207690_10030597 Ga0207690_100305973 136
974 3300025932 Ga0207690_10624646 Ga0207690_106246462 136
975 3300025933 Ga0207706_10003321 Ga0207706_100033215 136
976 3300025933 Ga0207706_10006855 Ga0207706_100068557 136
977 3300025933 Ga0207706_10020645 Ga0207706_100206454 136
978 3300025933 Ga0207706_10265779 Ga0207706_102657791 136
979 3300025934 Ga0207686_10002829 Ga0207686_100028293 136
980 3300025934 Ga0207686_10039069 Ga0207686_100390693 136
981 3300025935 Ga0207709_10029372 Ga0207709_100293723 136
982 3300025935 Ga0207709_10031125 Ga0207709_100311252 136
983 3300025935 Ga0207709_10661990 Ga0207709_106619902 136
984 3300025936 Ga0207670_10009328 Ga0207670_100093284 136
985 3300025936 Ga0207670_10191362 Ga0207670_101913623 136
986 3300025936 Ga0207670_10345542 Ga0207670_103455422 136
987 3300025936 Ga0207670_10609770 Ga0207670_106097702 136
988 3300025936 Ga0207670_11135889 Ga0207670_111358892 136
989 3300025937 Ga0207669_10019856 Ga0207669_100198562 136
990 3300025937 Ga0207669_10069191 Ga0207669_100691913 136
991 3300025937 Ga0207669_10907219 Ga0207669_109072192 136
992 3300025937 Ga0207669_11664353 Ga0207669_116643531 136
993 3300025938 Ga0207704_10021370 Ga0207704_100213703 136
994 3300025938 Ga0207704_10029365 Ga0207704_100293653 136
995 3300025938 Ga0207704_10312800 Ga0207704_103128001 136
996 3300025938 Ga0207704_10683634 Ga0207704_106836342 136
997 3300025939 Ga0207665_10004273 Ga0207665_100042733 136
998 3300025939 Ga0207665_10075711 Ga0207665_100757113 136
999 3300025940 Ga0207691_10006103 Ga0207691_100061034 136
1000 3300025940 Ga0207691_10177416 Ga0207691_101774162 136
1001 3300025941 Ga0207711_10033714 Ga0207711_100337143 136
1002 3300025941 Ga0207711_10101789 Ga0207711_101017893 136
1003 3300025942 Ga0207689_10010443 Ga0207689_100104434 136
1004 3300025942 Ga0207689_10035385 Ga0207689_100353852 136
1005 3300025942 Ga0207689_10185638 Ga0207689_101856383 136
1006 3300025942 Ga0207689_10823118 Ga0207689_108231181 136
1007 3300025944 Ga0207661_10034548 Ga0207661_100345483 136
1008 3300025944 Ga0207661_10580356 Ga0207661_105803562 136
1009 3300025945 Ga0207679_10000026 Ga0207679_10000026206 136
1010 3300025945 Ga0207679_10185234 Ga0207679_101852343 136
1011 3300025945 Ga0207679_10312475 Ga0207679_103124752 136
1012 3300025949 Ga0207667_11513924 Ga0207667_115139242 136
1013 3300025960 Ga0207651_10512418 Ga0207651_105124182 136
1014 3300025960 Ga0207651_10700372 Ga0207651_107003722 136
1015 3300025961 Ga0207712_10066659 Ga0207712_100666593 136
1016 3300025961 Ga0207712_10082112 Ga0207712_100821122 136
1017 3300025961 Ga0207712_10194674 Ga0207712_101946742 136
1018 3300025961 Ga0207712_10534378 Ga0207712_105343782 136
1019 3300025972 Ga0207668_10033737 Ga0207668_100337373 136
1020 3300025972 Ga0207668_10360607 Ga0207668_103606072 136
1021 3300025972 Ga0207668_10712145 Ga0207668_107121452 136
1022 3300025981 Ga0207640_10012026 Ga0207640_100120262 136
1023 3300025981 Ga0207640_10035916 Ga0207640_100359163 136
1024 3300025981 Ga0207640_11048021 Ga0207640_110480212 136
1025 3300025986 Ga0207658_10005999 Ga0207658_100059999 136
1026 3300025986 Ga0207658_10034072 Ga0207658_100340723 136
1027 3300025986 Ga0207658_10115156 Ga0207658_101151562 136
1028 3300026023 Ga0207677_10021431 Ga0207677_100214313 136
1029 3300026023 Ga0207677_10112586 Ga0207677_101125863 136
1030 3300026023 Ga0207677_10422746 Ga0207677_104227461 136
1031 3300026023 Ga0207677_11255219 Ga0207677_112552192 136
1032 3300026035 Ga0207703_10007676 Ga0207703_100076768 136
1033 3300026035 Ga0207703_10048609 Ga0207703_100486093 136
1034 3300026035 Ga0207703_10139494 Ga0207703_101394942 136
1035 3300026035 Ga0207703_10198411 Ga0207703_101984113 136
1036 3300026041 Ga0207639_10022654 Ga0207639_100226543 136
1037 3300026041 Ga0207639_11194774 Ga0207639_111947742 136
1038 3300026067 Ga0207678_10010041 Ga0207678_100100419 136
1039 3300026067 Ga0207678_10017622 Ga0207678_100176222 136
1040 3300026067 Ga0207678_10035632 Ga0207678_100356324 136
1041 3300026075 Ga0207708_10021489 Ga0207708_100214894 136
1042 3300026075 Ga0207708_10032885 Ga0207708_100328854 136
1043 3300026075 Ga0207708_10479810 Ga0207708_104798101 136
1044 3300026075 Ga0207708_10554968 Ga0207708_105549682 136
1045 3300026075 Ga0207708_11749911 Ga0207708_117499112 136
1046 3300026078 Ga0207702_10041304 Ga0207702_100413041 136
1047 3300026078 Ga0207702_10050509 Ga0207702_100505094 136
1048 3300026078 Ga0207702_10292993 Ga0207702_102929933 136
1049 3300026078 Ga0207702_10893975 Ga0207702_108939751 136
1050 3300026088 Ga0207641_10049153 Ga0207641_100491533 136
1051 3300026088 Ga0207641_10253445 Ga0207641_102534452 136
1052 3300026088 Ga0207641_10311368 Ga0207641_103113681 136
1053 3300026089 Ga0207648_10012087 Ga0207648_100120874 136
1054 3300026095 Ga0207676_10035528 Ga0207676_100355282 136
1055 3300026095 Ga0207676_10068453 Ga0207676_100684533 136
1056 3300026095 Ga0207676_10446306 Ga0207676_104463062 136
1057 3300026116 Ga0207674_10003206 Ga0207674_1000320619 136
1058 3300026116 Ga0207674_10190439 Ga0207674_101904392 136
1059 3300026116 Ga0207674_11404071 Ga0207674_114040711 136
1060 3300026118 Ga0207675_100008845 Ga0207675_1000088457 136
1061 3300026118 Ga0207675_100011363 Ga0207675_1000113635 136
1062 3300026118 Ga0207675_100083027 Ga0207675_1000830272 136
1063 3300026118 Ga0207675_100456736 Ga0207675_1004567362 136
1064 3300026121 Ga0207683_10001717 Ga0207683_1000171712 136
1065 3300026121 Ga0207683_10004174 Ga0207683_100041745 136
1066 3300026142 Ga0207698_10188576 Ga0207698_101885762 136
1067 3300026142 Ga0207698_10659413 Ga0207698_106594132 136
1068 3300027252 Ga0209973_1008986 Ga0209973_10089862 136
1069 3300027364 Ga0209967_1012317 Ga0209967_10123172 136
1070 3300027424 Ga0209984_1001182 Ga0209984_10011823 136
1071 3300027462 Ga0210000_1005857 Ga0210000_10058573 136
1072 3300027471 Ga0209995_1028367 Ga0209995_10283672 136
1073 3300027526 Ga0209968_1018157 Ga0209968_10181572 136
1074 3300027543 Ga0209999_1025956 Ga0209999_10259562 136
1075 3300027552 Ga0209982_1002993 Ga0209982_10029933 136
1076 3300027617 Ga0210002_1001290 Ga0210002_10012902 136
1077 3300027665 Ga0209983_1004354 Ga0209983_10043542 136
1078 3300027682 Ga0209971_1007432 Ga0209971_10074323 136
1079 3300027695 Ga0209966_1001108 Ga0209966_10011085 136
1080 3300027717 Ga0209998_10023943 Ga0209998_100239431 136
1081 3300027876 Ga0209974_10122607 Ga0209974_101226071 136
1082 3300027907 Ga0207428_10000082 Ga0207428_1000008239 136
1083 3300027907 Ga0207428_10000851 Ga0207428_1000085110 136
1084 3300027907 Ga0207428_10003417 Ga0207428_100034178 136
1085 3300027907 Ga0207428_10047756 Ga0207428_100477561 136
1086 3300027907 Ga0207428_10749768 Ga0207428_107497682 136
1087 3300027907 Ga0207428_10865681 Ga0207428_108656812 136
1088 3300027907 Ga0207428_11184320 Ga0207428_111843201 136
1089 3300028379 Ga0268266_10074102 Ga0268266_100741023 136
1090 3300028379 Ga0268266_10097469 Ga0268266_100974692 136
1091 3300028379 Ga0268266_12161329 Ga0268266_121613291 136
1092 3300028380 Ga0268265_10006616 Ga0268265_100066163 136
1093 3300028380 Ga0268265_10489154 Ga0268265_104891542 136
1094 3300028380 Ga0268265_10506826 Ga0268265_105068263 136
1095 3300028381 Ga0268264_10073734 Ga0268264_100737343 136
1096 3300028381 Ga0268264_11923867 Ga0268264_119238671 136
1097 3300028556 Ga0265337_1000345 Ga0265337_10003453 136
1098 3300028577 Ga0265318_10044752 Ga0265318_100447522 136
1099 3300028800 Ga0265338_10336927 Ga0265338_103369272 136
1100 3300028800 Ga0265338_10394638 Ga0265338_103946382 136
1101 3300028800 Ga0265338_10466405 Ga0265338_104664052 136
1102 3300031235 Ga0265330_10016486 Ga0265330_100164863 136
1103 3300031238 Ga0265332_10127991 Ga0265332_101279911 136
1104 3300031238 Ga0265332_10232371 Ga0265332_102323712 136
1105 3300031239 Ga0265328_10129840 Ga0265328_101298402 136
1106 3300031240 Ga0265320_10006100 Ga0265320_100061004 136
1107 3300031240 Ga0265320_10117184 Ga0265320_101171842 136
1108 3300031241 Ga0265325_10000043 Ga0265325_1000004332 136
1109 3300031241 Ga0265325_10002112 Ga0265325_100021129 136
1110 3300031241 Ga0265325_10012366 Ga0265325_100123663 136
1111 3300031241 Ga0265325_10040986 Ga0265325_100409862 136
1112 3300031241 Ga0265325_10142364 Ga0265325_101423642 136
1113 3300031241 Ga0265325_10154031 Ga0265325_101540313 136
1114 3300031241 Ga0265325_10173059 Ga0265325_101730591 136
1115 3300031242 Ga0265329_10014517 Ga0265329_100145173 136
1116 3300031247 Ga0265340_10085252 Ga0265340_100852523 136
1117 3300031247 Ga0265340_10145012 Ga0265340_101450122 136
1118 3300031247 Ga0265340_10145643 Ga0265340_101456432 136
1119 3300031249 Ga0265339_10013004 Ga0265339_100130041 136
1120 3300031249 Ga0265339_10048152 Ga0265339_100481523 136
1121 3300031249 Ga0265339_10059579 Ga0265339_100595792 136
1122 3300031249 Ga0265339_10417828 Ga0265339_104178281 136
1123 3300031250 Ga0265331_10110089 Ga0265331_101100892 136
1124 3300031344 Ga0265316_10044636 Ga0265316_100446365 136
1125 3300031344 Ga0265316_10045794 Ga0265316_100457944 136
1126 3300031344 Ga0265316_10127976 Ga0265316_101279763 136
1127 3300031344 Ga0265316_10218705 Ga0265316_102187052 136
1128 3300031344 Ga0265316_10228147 Ga0265316_102281472 136
1129 3300031344 Ga0265316_10442037 Ga0265316_104420371 136
1130 3300031456 Ga0307513_10112226 Ga0307513_101122262 136
1131 3300031456 Ga0307513_10263332 Ga0307513_102633321 136
1132 3300031507 Ga0307509_10515605 Ga0307509_105156051 136
1133 3300031595 Ga0265313_10010603 Ga0265313_100106033 136
1134 3300031595 Ga0265313_10020231 Ga0265313_100202312 136
1135 3300031595 Ga0265313_10080603 Ga0265313_100806031 136
1136 3300031595 Ga0265313_10085514 Ga0265313_100855142 136
1137 3300031595 Ga0265313_10148776 Ga0265313_101487762 136
1138 3300031595 Ga0265313_10321987 Ga0265313_103219872 136
1139 3300031711 Ga0265314_10004593 Ga0265314_100045934 136
1140 3300031711 Ga0265314_10005498 Ga0265314_100054985 136
1141 3300031711 Ga0265314_10154504 Ga0265314_101545042 136
1142 3300031712 Ga0265342_10007969 Ga0265342_1000796910 136
1143 3300031712 Ga0265342_10052475 Ga0265342_100524752 136
1144 3300034816 Ga0373930_0006379 Ga0373930_0006379_739_1149 136
1145 3300034816 Ga0373930_0035685 Ga0373930_0035685_120_530 136
1146 3300034817 Ga0373948_0000025 Ga0373948_0000025_8384_8794 136
1147 3300034818 Ga0373950_0000146 Ga0373950_0000146_9755_10165 136
1148 3300034818 Ga0373950_0093051 Ga0373950_0093051_17_427 136
1149 3300034819 Ga0373958_0000142 Ga0373958_0000142_1159_1569 136
1150 3300034820 Ga0373959_0000072 Ga0373959_0000072_11213_11623 136
1151 3300034957 Ga0373938_0006570 Ga0373938_0006570_717_1127 136
1152 3300034957 Ga0373938_0016484 Ga0373938_0016484_727_1137 136
1153 3300035084 Ga0373928_0000402 Ga0373928_0000402_86_496 136
1154 3300035084 Ga0373928_0006979 Ga0373928_0006979_234_644 136
1155 3300035084 Ga0373928_0008517 Ga0373928_0008517_895_1305 136
1156 3300035084 Ga0373928_0133423 Ga0373928_0133423_39_449 136
1157 3300035085 Ga0373929_0000222 Ga0373929_0000222_3134_3544 136
1158 3300035086 Ga0373934_0070008 Ga0373934_0070008_73_483 136
1159 3300035088 Ga0373940_0000232 Ga0373940_0000232_85_495 136
1160 3300035088 Ga0373940_0038039 Ga0373940_0038039_98_508 136
1161 3300035089 Ga0373944_0023114 Ga0373944_0023114_104_514 136
1162 3300035090 Ga0373949_0006489 Ga0373949_0006489_17_427 136
1163 3300035090 Ga0373949_0218374 Ga0373949_0218374_50_460 136
1164 3300035091 Ga0373951_0000275 Ga0373951_0000275_5712_6122 136
1165 3300035091 Ga0373951_0009495 Ga0373951_0009495_1135_1545 136
1166 3300035092 Ga0373952_0014498 Ga0373952_0014498_1149_1559 136
1167 3300035111 Ga0373923_0102399 Ga0373923_0102399_832_1242 136
1168 3300035111 Ga0373923_0109019 Ga0373923_0109019_590_1000 136
1169 3300035111 Ga0373923_0182167 Ga0373923_0182167_281_691 136
1170 3300035111 Ga0373923_0530276 Ga0373923_0530276_68_478 136
1171 3300035112 Ga0373932_0000059 Ga0373932_0000059_6042_6452 136
1172 3300035112 Ga0373932_0004242 Ga0373932_0004242_1922_2332 136
1173 3300035112 Ga0373932_0350916 Ga0373932_0350916_139_549 136
1174 3300035113 Ga0373936_0012745 Ga0373936_0012745_1293_1703 136
1175 3300035114 Ga0373939_0000508 Ga0373939_0000508_8316_8726 136
1176 3300035114 Ga0373939_0240503 Ga0373939_0240503_253_663 136
1177 3300035115 Ga0373941_0000727 Ga0373941_0000727_4835_5245 136
1178 3300035115 Ga0373941_0016442 Ga0373941_0016442_794_1204 136
1179 3300035116 Ga0373945_0065523 Ga0373945_0065523_509_919 136
1180 3300035116 Ga0373945_0190185 Ga0373945_0190185_166_576 136
1181 3300035117 Ga0373953_0000709 Ga0373953_0000709_6047_6457 136
1182 3300035117 Ga0373953_0014506 Ga0373953_0014506_1433_1843 136
1183 3300035117 Ga0373953_0074111 Ga0373953_0074111_458_868 136
1184 3300035117 Ga0373953_0121077 Ga0373953_0121077_21_431 136
1185 3300035117 Ga0373953_0304984 Ga0373953_0304984_253_663 136
1186 3300035118 Ga0373954_0009893 Ga0373954_0009893_1341_1751 136
1187 3300035118 Ga0373954_0030337 Ga0373954_0030337_1516_1926 136
1188 3300035118 Ga0373954_0115666 Ga0373954_0115666_100_510 136
1189 3300035119 Ga0373956_0113264 Ga0373956_0113264_690_1100 136
1190 3300035119 Ga0373956_0155098 Ga0373956_0155098_67_477 136
1191 3300035120 Ga0373957_0000730 Ga0373957_0000730_4241_4651 136
1192 3300035120 Ga0373957_0000821 Ga0373957_0000821_128_538 136
1193 3300035120 Ga0373957_0007761 Ga0373957_0007761_1255_1665 136
1194 3300035120 Ga0373957_0148954 Ga0373957_0148954_529_939 136
1195 3300035121 Ga0373960_0000038 Ga0373960_0000038_9817_10227 136
1196 3300035121 Ga0373960_0017899 Ga0373960_0017899_367_777 136
1197 3300035121 Ga0373960_0031290 Ga0373960_0031290_485_895 136
1198 3300035121 Ga0373960_0192189 Ga0373960_0192189_50_460 136
1199 3300035170 Ga0373943_0004287 Ga0373943_0004287_4768_5178 136
1200 3300035170 Ga0373943_0592717 Ga0373943_0592717_221_631 136
1201 3300035171 Ga0373946_0024180 Ga0373946_0024180_857_1267 136
1202 3300035172 Ga0373955_0001042 Ga0373955_0001042_3623_4033 136
1203 3300035172 Ga0373955_0024013 Ga0373955_0024013_728_1138 136
1204 3300035172 Ga0373955_0047645 Ga0373955_0047645_983_1393 136
1205 3300035172 Ga0373955_0264092 Ga0373955_0264092_478_888 136
1206 3300035207 Ga0373942_0001035 Ga0373942_0001035_4989_5399 136
1207 3300035207 Ga0373942_0004535 Ga0373942_0004535_125_535 136
1208 3300035241 Ga0373961_0000773 Ga0373961_0000773_3019_3429 136
1209 3300035242 Ga0373962_0000191 Ga0373962_0000191_10155_10565 136
1210 3300035242 Ga0373962_0001541 Ga0373962_0001541_2695_3105 136
1211 3300035242 Ga0373962_0035196 Ga0373962_0035196_598_1008 136
1212 3300035242 Ga0373962_0039599 Ga0373962_0039599_343_753 136
1213 3300035242 Ga0373962_0052504 Ga0373962_0052504_543_953 136
1214 3300035410 Ga0373924_0012208 Ga0373924_0012208_1846_2256 136
1215 3300035410 Ga0373924_0108152 Ga0373924_0108152_433_843 136
1216 3300035691 Ga0373931_0001217 Ga0373931_0001217_4342_4752 136
1217 3300035691 Ga0373931_0005504 Ga0373931_0005504_3184_3594 136
1218 3300035691 Ga0373931_0274885 Ga0373931_0274885_553_963 136
1219 3300035691 Ga0373931_0415136 Ga0373931_0415136_400_810 136
1220 3300035692 Ga0373935_0001775 Ga0373935_0001775_9615_10025 136
1221 3300035692 Ga0373935_0063163 Ga0373935_0063163_1056_1466 136
1222 3300035695 Ga0373927_0009671 Ga0373927_0009671_2511_2921 136
1223 3300035724 Ga0373933_0001719 Ga0373933_0001719_9321_9731 136
1224 3300035724 Ga0373933_0005248 Ga0373933_0005248_1845_2255 136
1225 3300035725 Ga0373947_0006573 Ga0373947_0006573_715_1125 136
1226 3300036401 Ga0373937_0001701 Ga0373937_0001701_7528_7938 136
1227 3300036401 Ga0373937_0003774 Ga0373937_0003774_11183_11593 136
1228 3300036401 Ga0373937_0028836 Ga0373937_0028836_755_1165 136
1229 3300036401 Ga0373937_0945749 Ga0373937_0945749_146_556 136
1230 3300037068 Ga0373925_0007244 Ga0373925_0007244_647_1057 136
1231 3300037068 Ga0373925_1401951 Ga0373925_1401951_17_427 136
1232 3300037853 Ga0436364_1155778 Ga0436364_1155778_112_525 136
1233 3300038996 Ga0242420_048831 Ga0242420_048831_17_427 136
1234 3300039437 Ga0436365_0127823 Ga0436365_0127823_100_513 136
1235 3300039450 Ga0436363_0631040 Ga0436363_0631040_935_1348 136
1236 3300041408 Ga0439453_0023953 Ga0439453_0023953_621_1034 136
1237 3300042003 Ga0439443_006764 Ga0439443_006764_736_1149 136
1238 3300042005 Ga0439448_0017401 Ga0439448_0017401_1055_1465 136
1239 3300042008 Ga0439450_137972 Ga0439450_137972_188_598 136
1240 3300042012 Ga0439455_0010687 Ga0439455_0010687_743_1153 136
1241 3300042142 Ga0450905_048606 Ga0450905_048606_256_666 136
1242 3300042157 Ga0439458_0068000 Ga0439458_0068000_63_473 136
1243 3300042436 Ga0439435_0032725 Ga0439435_0032725_249_662 136
1244 3300042439 Ga0439464_0008011 Ga0439464_0008011_2195_2605 136
1245 3300042461 Ga0439460_0019136 Ga0439460_0019136_383_796 136
1246 3300042461 Ga0439460_0026548 Ga0439460_0026548_1016_1426 136
1247 3300042993 Ga0439440_0145867 Ga0439440_0145867_46_456 136
1248 3300044673 Ga0453683_0081209 Ga0453683_0081209_1507_1917 136
1249 3300045051 Ga0451576_0078873 Ga0451576_0078873_918_1328 136
1250 3300046452 Ga0495617_116259 Ga0495617_116259_54_464 136
1251 3300046454 Ga0495592_0001738 Ga0495592_0001738_13168_13578 136
1252 3300046454 Ga0495592_0002150 Ga0495592_0002150_7400_7810 136
1253 3300046455 Ga0495603_0001287 Ga0495603_0001287_11533_11943 136
1254 3300046458 Ga0495591_046063 Ga0495591_046063_652_1062 136
1255 3300046459 Ga0495629_0000062 Ga0495629_0000062_64955_65365 136
1256 3300046460 Ga0495638_0017103 Ga0495638_0017103_1342_1755 136
1257 3300046460 Ga0495638_0287345 Ga0495638_0287345_153_566 136
1258 3300046461 Ga0495641_0045456 Ga0495641_0045456_764_1174 136
1259 3300046462 Ga0495651_0002729 Ga0495651_0002729_2057_2467 136
1260 3300046462 Ga0495651_0069543 Ga0495651_0069543_1292_1702 136
1261 3300046462 Ga0495651_0377413 Ga0495651_0377413_329_739 136
1262 3300046463 Ga0495653_0062762 Ga0495653_0062762_1902_2312 136
1263 3300046472 Ga0495580_0132036 Ga0495580_0132036_1302_1712 136
1264 3300046474 Ga0495605_0035610 Ga0495605_0035610_702_1112 136
1265 3300046476 Ga0495662_0000578 Ga0495662_0000578_9117_9527 136
1266 3300046477 Ga0495664_0007653 Ga0495664_0007653_2817_3227 136
1267 3300046477 Ga0495664_0132450 Ga0495664_0132450_476_886 136
1268 3300046491 Ga0495584_0033241 Ga0495584_0033241_949_1359 136
1269 3300046491 Ga0495584_0222577 Ga0495584_0222577_201_611 136
1270 3300046491 Ga0495584_0415312 Ga0495584_0415312_148_558 136
1271 3300046492 Ga0495585_0011808 Ga0495585_0011808_1547_1957 136
1272 3300046499 Ga0495594_0014612 Ga0495594_0014612_1372_1782 136
1273 3300046501 Ga0495607_0026320 Ga0495607_0026320_600_1010 136
1274 3300046511 Ga0495608_0000943 Ga0495608_0000943_11372_11782 136
1275 3300046511 Ga0495608_0006924 Ga0495608_0006924_6336_6746 136
1276 3300046511 Ga0495608_0200615 Ga0495608_0200615_815_1225 136
1277 3300046514 Ga0495618_0001029 Ga0495618_0001029_4520_4930 136
1278 3300046514 Ga0495618_0435702 Ga0495618_0435702_90_551 136
1279 3300046514 Ga0495618_0922310 Ga0495618_0922310_22_432 136
1280 3300046516 Ga0495628_0003985 Ga0495628_0003985_8660_9070 136
1281 3300046516 Ga0495628_0013284 Ga0495628_0013284_168_578 136
1282 3300046517 Ga0495630_0020549 Ga0495630_0020549_2352_2762 136
1283 3300046520 Ga0495637_0103561 Ga0495637_0103561_423_833 136
1284 3300046522 Ga0495643_0119249 Ga0495643_0119249_136_546 136
1285 3300046523 Ga0495644_0000776 Ga0495644_0000776_10473_10883 136
1286 3300046529 Ga0495652_0011331 Ga0495652_0011331_3570_3980 136
1287 3300046529 Ga0495652_0018893 Ga0495652_0018893_4323_4733 136
1288 3300046533 Ga0495640_0012379 Ga0495640_0012379_4242_4652 136
1289 3300046533 Ga0495640_0097940 Ga0495640_0097940_296_706 136
1290 3300046535 Ga0495586_0003355 Ga0495586_0003355_4942_5352 136
1291 3300046535 Ga0495586_0029328 Ga0495586_0029328_1002_1412 136
1292 3300046536 Ga0495587_0001771 Ga0495587_0001771_10144_10554 136
1293 3300046536 Ga0495587_0053582 Ga0495587_0053582_1607_2017 136
1294 3300046536 Ga0495587_0193482 Ga0495587_0193482_580_990 136
1295 3300046537 Ga0495598_0070152 Ga0495598_0070152_122_532 136
1296 3300046538 Ga0495609_0057651 Ga0495609_0057651_946_1356 136
1297 3300046543 Ga0495645_0002821 Ga0495645_0002821_10439_10849 136
1298 3300046543 Ga0495645_0073187 Ga0495645_0073187_1897_2307 136
1299 3300046543 Ga0495645_0661472 Ga0495645_0661472_53_463 136
1300 3300046558 Ga0495633_0005403 Ga0495633_0005403_6680_7090 136
1301 3300046559 Ga0495667_0005482 Ga0495667_0005482_7400_7810 136
1302 3300046559 Ga0495667_0061496 Ga0495667_0061496_170_580 136
1303 3300046559 Ga0495667_0082836 Ga0495667_0082836_511_921 136
1304 3300046559 Ga0495667_0180832 Ga0495667_0180832_193_603 136
1305 3300046615 Ga0495656_0000457 Ga0495656_0000457_8696_9106 136
1306 3300046615 Ga0495656_0737225 Ga0495656_0737225_10_420 136
1307 3300046642 Ga0495634_0128754 Ga0495634_0128754_691_1101 136
1308 3300046648 Ga0495611_0001107 Ga0495611_0001107_6019_6429 136
1309 3300046663 Ga0495635_0030151 Ga0495635_0030151_1464_1874 136
1310 3300046663 Ga0495635_0089696 Ga0495635_0089696_1319_1729 136
1311 3300046663 Ga0495635_0397249 Ga0495635_0397249_157_567 136
1312 3300046664 Ga0495659_0002978 Ga0495659_0002978_259_669 136
1313 3300046665 Ga0495661_0044082 Ga0495661_0044082_594_1004 136
1314 3300046674 Ga0495588_0001852 Ga0495588_0001852_5595_6005 136
1315 3300046674 Ga0495588_0045850 Ga0495588_0045850_1307_1717 136
1316 3300046675 Ga0495657_0046829 Ga0495657_0046829_1816_2226 136
1317 3300046675 Ga0495657_0058083 Ga0495657_0058083_1732_2142 136
1318 3300046675 Ga0495657_0186745 Ga0495657_0186745_458_868 136
1319 3300046678 Ga0495599_0015430 Ga0495599_0015430_388_798 136
1320 3300046679 Ga0495623_0000055 Ga0495623_0000055_57834_58244 136
1321 3300046679 Ga0495623_0048476 Ga0495623_0048476_1658_2068 136
1322 3300046681 Ga0495647_0003621 Ga0495647_0003621_1593_2003 136
1323 3300046683 Ga0495658_0002781 Ga0495658_0002781_6483_6893 136
1324 3300046683 Ga0495658_0201967 Ga0495658_0201967_675_1085 136
1325 3300046684 Ga0495669_0116493 Ga0495669_0116493_481_891 136
1326 3300046689 Ga0495613_0012460 Ga0495613_0012460_4215_4625 136
1327 3300046689 Ga0495613_0027248 Ga0495613_0027248_2323_2733 136
1328 3300046691 Ga0495670_0000732 Ga0495670_0000732_8598_9008 136
1329 3300046809 Ga0495600_0003351 Ga0495600_0003351_3876_4286 136
1330 3300046809 Ga0495600_0072897 Ga0495600_0072897_43_453 136
1331 3300046809 Ga0495600_0118616 Ga0495600_0118616_1274_1684 136
1332 3300047315 Ga0495581_0319038 Ga0495581_0319038_85_546 136
1333 3300047315 Ga0495581_0470469 Ga0495581_0470469_218_628 136
1334 3300047317 Ga0495604_0001634 Ga0495604_0001634_9467_9877 136
1335 3300047317 Ga0495604_0053300 Ga0495604_0053300_1372_1782 136
1336 3300047317 Ga0495604_0181676 Ga0495604_0181676_503_913 136
1337 3300047319 Ga0495674_0006479 Ga0495674_0006479_9924_10334 136
1338 3300047322 Ga0495680_0001836 Ga0495680_0001836_10796_11206 136
1339 3300047322 Ga0495680_0021036 Ga0495680_0021036_2391_2801 136
1340 3300047322 Ga0495680_0081554 Ga0495680_0081554_1784_2194 136
1341 3300047323 Ga0495683_0248240 Ga0495683_0248240_168_578 136
1342 3300047444 Ga0495675_0002106 Ga0495675_0002106_2964_3374 136
1343 3300047444 Ga0495675_0041837 Ga0495675_0041837_1535_1945 136
1344 3300047444 Ga0495675_0340827 Ga0495675_0340827_374_784 136
1345 3300047471 Ga0495684_0015714 Ga0495684_0015714_1847_2257 136
1346 3300047471 Ga0495684_0051598 Ga0495684_0051598_1033_1443 136
1347 3300047471 Ga0495684_0110670 Ga0495684_0110670_725_1135 136
1348 3300047471 Ga0495684_0240391 Ga0495684_0240391_37_447 136
1349 3300047471 Ga0495684_0274011 Ga0495684_0274011_613_1023 136
1350 3300047673 Ga0495593_0024144 Ga0495593_0024144_2472_2882 136
1351 3300047673 Ga0495593_0054865 Ga0495593_0054865_958_1368 136
1352 3300048088 Ga0495602_0006837 Ga0495602_0006837_10808_11218 136
1353 3300048088 Ga0495602_0033732 Ga0495602_0033732_3915_4325 136
1354 3300048088 Ga0495602_0068235 Ga0495602_0068235_1749_2159 136
1355 3300048088 Ga0495602_0391394 Ga0495602_0391394_427_837 136
1356 3300048903 Ga0496100_0022202 Ga0496100_0022202_2903_3313 136
1357 3300048903 Ga0496100_0099905 Ga0496100_0099905_683_1093 136
1358 3300048903 Ga0496100_0310403 Ga0496100_0310403_318_728 136
1359 3300048904 Ga0496101_0003602 Ga0496101_0003602_1875_2285 136
1360 3300048904 Ga0496101_1222811 Ga0496101_1222811_63_473 136
1361 3300048904 Ga0496101_1237817 Ga0496101_1237817_134_544 136
1362 3300048905 Ga0496102_0053554 Ga0496102_0053554_1637_2047 136
1363 3300048905 Ga0496102_0075563 Ga0496102_0075563_1257_1667 136
1364 3300048905 Ga0496102_0757770 Ga0496102_0757770_283_693 136
1365 3300048906 Ga0496103_0013538 Ga0496103_0013538_2669_3079 136
1366 3300048906 Ga0496103_0016090 Ga0496103_0016090_3148_3558 136
1367 3300048906 Ga0496103_0033766 Ga0496103_0033766_685_1095 136
1368 3300048907 Ga0496104_0029690 Ga0496104_0029690_4090_4500 136
1369 3300048907 Ga0496104_0035743 Ga0496104_0035743_2600_3010 136
1370 3300048907 Ga0496104_0131011 Ga0496104_0131011_1658_2068 136
1371 3300048907 Ga0496104_0178743 Ga0496104_0178743_87_497 136
1372 3300048907 Ga0496104_0385651 Ga0496104_0385651_304_714 136
1373 3300048908 Ga0496105_0000246 Ga0496105_0000246_20655_21065 136
1374 3300048908 Ga0496105_0047769 Ga0496105_0047769_410_820 136
1375 3300048908 Ga0496105_0059856 Ga0496105_0059856_2600_3010 136
1376 3300048908 Ga0496105_0190745 Ga0496105_0190745_82_492 136
1377 3300048908 Ga0496105_0241119 Ga0496105_0241119_457_867 136
1378 3300048908 Ga0496105_0557134 Ga0496105_0557134_234_644 136
1379 3300048908 Ga0496105_0582174 Ga0496105_0582174_382_792 136
1380 3300048909 Ga0496106_0025546 Ga0496106_0025546_2621_3031 136
1381 3300048909 Ga0496106_0035468 Ga0496106_0035468_1070_1480 136
1382 3300048909 Ga0496106_0042856 Ga0496106_0042856_2953_3363 136
1383 3300048909 Ga0496106_0640714 Ga0496106_0640714_100_510 136
1384 3300048909 Ga0496106_0808883 Ga0496106_0808883_52_462 136
1385 3300048909 Ga0496106_0879301 Ga0496106_0879301_235_645 136
1386 3300048910 Ga0496107_0006223 Ga0496107_0006223_4613_5023 136
1387 3300048910 Ga0496107_0020388 Ga0496107_0020388_1630_2040 136
1388 3300048910 Ga0496107_0066391 Ga0496107_0066391_1056_1466 136
1389 3300048910 Ga0496107_0609942 Ga0496107_0609942_349_759 136
1390 3300048910 Ga0496107_1257812 Ga0496107_1257812_66_476 136
1391 3300048911 Ga0496108_0004639 Ga0496108_0004639_260_670 136
1392 3300048911 Ga0496108_0043176 Ga0496108_0043176_1947_2357 136
1393 3300048911 Ga0496108_0073444 Ga0496108_0073444_1775_2185 136
1394 3300048911 Ga0496108_0086761 Ga0496108_0086761_779_1189 136
1395 3300048911 Ga0496108_0189209 Ga0496108_0189209_602_1012 136
1396 3300048911 Ga0496108_0318726 Ga0496108_0318726_632_1042 136
1397 3300048912 Ga0496109_0003538 Ga0496109_0003538_4141_4551 136
1398 3300048912 Ga0496109_0006194 Ga0496109_0006194_7791_8201 136
1399 3300048912 Ga0496109_0028458 Ga0496109_0028458_577_987 136
1400 3300048912 Ga0496109_0109427 Ga0496109_0109427_384_794 136
1401 3300048912 Ga0496109_0213983 Ga0496109_0213983_1381_1791 136
1402 3300048912 Ga0496109_0631663 Ga0496109_0631663_465_875 136
1403 3300048913 Ga0496110_0041064 Ga0496110_0041064_527_937 136
1404 3300048913 Ga0496110_0050483 Ga0496110_0050483_1910_2320 136
1405 3300048913 Ga0496110_0124450 Ga0496110_0124450_1832_2242 136
1406 3300048913 Ga0496110_0129917 Ga0496110_0129917_243_653 136
1407 3300048913 Ga0496110_0138545 Ga0496110_0138545_1741_2151 136
1408 3300048913 Ga0496110_0618103 Ga0496110_0618103_67_477 136
1409 3300048913 Ga0496110_0711097 Ga0496110_0711097_364_774 136
1410 3300048914 Ga0496111_0064785 Ga0496111_0064785_410_820 136
1411 3300048915 Ga0496112_0011049 Ga0496112_0011049_4307_4717 136
1412 3300048915 Ga0496112_0129321 Ga0496112_0129321_1708_2118 136
1413 3300048915 Ga0496112_0284931 Ga0496112_0284931_133_543 136
1414 3300048915 Ga0496112_0898799 Ga0496112_0898799_141_554 136
1415 3300048915 Ga0496112_1849220 Ga0496112_1849220_29_442 136
1416 3300048916 Ga0496113_0002940 Ga0496113_0002940_3139_3549 136
1417 3300048916 Ga0496113_0017669 Ga0496113_0017669_2179_2589 136
1418 3300048916 Ga0496113_0097856 Ga0496113_0097856_86_496 136
1419 3300048916 Ga0496113_0453440 Ga0496113_0453440_488_898 136
1420 3300048917 Ga0496114_0060812 Ga0496114_0060812_1869_2279 136
1421 3300048918 Ga0496115_0117213 Ga0496115_0117213_783_1193 136
1422 3300048918 Ga0496115_0124987 Ga0496115_0124987_1063_1473 136
1423 3300048918 Ga0496115_0187667 Ga0496115_0187667_804_1214 136
1424 3300048918 Ga0496115_0257731 Ga0496115_0257731_770_1183 136
1425 3300048918 Ga0496115_0795624 Ga0496115_0795624_190_600 136
1426 3300048922 Ga0496119_0328430 Ga0496119_0328430_52_462 136
1427 3300048924 Ga0496121_0335612 Ga0496121_0335612_477_887 136
1428 3300048928 Ga0496125_0306648 Ga0496125_0306648_469_879 136
1429 3300049568 Ga0501031_0051993 Ga0501031_0051993_1371_1781 136
1430 3300049569 Ga0501032_0118758 Ga0501032_0118758_889_1299 136
1431 3300049569 Ga0501032_0231564 Ga0501032_0231564_731_1141 136
1432 3300049569 Ga0501032_0450987 Ga0501032_0450987_307_717 136
1433 3300049570 Ga0501033_0048181 Ga0501033_0048181_1440_1850 136
1434 3300049570 Ga0501033_0071155 Ga0501033_0071155_882_1304 136
1435 3300049570 Ga0501033_0654419 Ga0501033_0654419_230_640 136
1436 3300049570 Ga0501033_0809797 Ga0501033_0809797_201_611 136
1437 3300049571 Ga0501034_0052903 Ga0501034_0052903_2792_3202 136
1438 3300049571 Ga0501034_0197290 Ga0501034_0197290_532_942 136
1439 3300049571 Ga0501034_0675931 Ga0501034_0675931_83_493 136
1440 3300049571 Ga0501034_1448405 Ga0501034_1448405_55_465 136
1441 3300049572 Ga0501036_0127120 Ga0501036_0127120_756_1166 136
1442 3300049572 Ga0501036_0272533 Ga0501036_0272533_844_1254 136
1443 3300049572 Ga0501036_1004110 Ga0501036_1004110_216_638 136
1444 3300049573 Ga0501037_0033859 Ga0501037_0033859_962_1372 136
1445 3300049573 Ga0501037_0195540 Ga0501037_0195540_661_1071 136
1446 3300049574 Ga0501038_0102566 Ga0501038_0102566_1665_2075 136
1447 3300049574 Ga0501038_0289949 Ga0501038_0289949_564_974 136
1448 3300049574 Ga0501038_0301081 Ga0501038_0301081_106_516 136
1449 3300049574 Ga0501038_0825961 Ga0501038_0825961_110_520 136
1450 3300049575 Ga0501039_0090029 Ga0501039_0090029_549_959 136
1451 3300049579 Ga0501043_0357778 Ga0501043_0357778_279_689 136
1452 3300049581 Ga0501047_0063808 Ga0501047_0063808_2196_2618 136
1453 3300049581 Ga0501047_0192126 Ga0501047_0192126_947_1357 136
1454 3300049581 Ga0501047_0197429 Ga0501047_0197429_1388_1798 136
1455 3300049581 Ga0501047_0226979 Ga0501047_0226979_1240_1650 136
1456 3300049581 Ga0501047_0874936 Ga0501047_0874936_179_589 136
1457 3300049581 Ga0501047_1343275 Ga0501047_1343275_41_451 136
1458 3300049582 Ga0501048_0521452 Ga0501048_0521452_63_485 136
1459 3300049584 Ga0501068_0436046 Ga0501068_0436046_345_755 136
1460 3300049586 Ga0501070_0063961 Ga0501070_0063961_2047_2457 136
1461 3300049586 Ga0501070_0064428 Ga0501070_0064428_132_542 136
1462 3300049586 Ga0501070_0288308 Ga0501070_0288308_883_1293 136
1463 3300049587 Ga0501071_0236218 Ga0501071_0236218_425_835 136
1464 3300049588 Ga0501072_0001175 Ga0501072_0001175_939_1352 136
1465 3300049589 Ga0501073_0177268 Ga0501073_0177268_378_788 136
1466 3300049593 Ga0501077_0028997 Ga0501077_0028997_916_1326 136
1467 3300049743 Ga0501081_0758655 Ga0501081_0758655_88_537 136
1468 3300049744 Ga0501083_0155246 Ga0501083_0155246_273_683 136
1469 3300049744 Ga0501083_0242423 Ga0501083_0242423_271_681 136
1470 3300049744 Ga0501083_0909881 Ga0501083_0909881_26_436 136
1471 3300049822 Ga0501035_0023751 Ga0501035_0023751_1430_1840 136
1472 3300049822 Ga0501035_0140241 Ga0501035_0140241_831_1253 136
1473 3300049822 Ga0501035_1092321 Ga0501035_1092321_15_425 136
1474 3300049823 Ga0501044_0148064 Ga0501044_0148064_1160_1582 136
1475 3300049823 Ga0501044_0250186 Ga0501044_0250186_889_1299 136
1476 3300049823 Ga0501044_0267705 Ga0501044_0267705_79_489 136
1477 3300049823 Ga0501044_0287826 Ga0501044_0287826_756_1166 136
1478 3300049823 Ga0501044_0317059 Ga0501044_0317059_701_1111 136
1479 3300049823 Ga0501044_0721061 Ga0501044_0721061_346_756 136
1480 3300050489 nmdc:mga03683_69915_c1 nmdc:mga03683_69915_c1_370_783 136
1481 3300050490 nmdc:mga03n38_42433_c1 nmdc:mga03n38_42433_c1_467_880 136
1482 3300050490 nmdc:mga03n38_958394_c1 nmdc:mga03n38_958394_c1_64_474 136
1483 3300050493 nmdc:mga0k408_107883_c1 nmdc:mga0k408_107883_c1_882_1295 136
1484 3300050494 nmdc:mga06z11_1029062_c1 nmdc:mga06z11_1029062_c1_34_447 136
1485 3300050494 nmdc:mga06z11_448214_c1 nmdc:mga06z11_448214_c1_262_672 136
1486 3300050494 nmdc:mga06z11_639954_c1 nmdc:mga06z11_639954_c1_103_513 136
1487 3300050495 nmdc:mga04h51_257938_c1 nmdc:mga04h51_257938_c1_16_426 136
1488 3300050496 nmdc:mga07m45_40742_c2 nmdc:mga07m45_40742_c2_604_1014 136
1489 3300050507 nmdc:mga05p37_1120143_c1 nmdc:mga05p37_1120143_c1_56_466 136
1490 3300050507 nmdc:mga05p37_19_c2 nmdc:mga05p37_19_c2_98363_98773 136
1491 3300050508 nmdc:mga09592_5913_c1 nmdc:mga09592_5913_c1_998_1408 136
1492 3300050509 nmdc:mga0qj67_1208994_c1 nmdc:mga0qj67_1208994_c1_58_468 136
1493 3300050509 nmdc:mga0qj67_351_c1 nmdc:mga0qj67_351_c1_1222_1632 136
1494 3300050510 nmdc:mga06r32_641_c1 nmdc:mga06r32_641_c1_25692_26102 136
1495 3300050510 nmdc:mga06r32_731115_c1 nmdc:mga06r32_731115_c1_73_483 136
1496 3300050511 nmdc:mga08y16_1043213_c1 nmdc:mga08y16_1043213_c1_298_711 136
1497 3300050511 nmdc:mga08y16_1530442_c1 nmdc:mga08y16_1530442_c1_160_573 136
1498 3300050511 nmdc:mga08y16_17011_c1 nmdc:mga08y16_17011_c1_1431_1841 136
1499 3300050511 nmdc:mga08y16_1859028_c1 nmdc:mga08y16_1859028_c1_119_532 136
1500 3300050511 nmdc:mga08y16_4379_c1 nmdc:mga08y16_4379_c1_2753_3163 136
1501 3300050511 nmdc:mga08y16_76513_c1 nmdc:mga08y16_76513_c1_2944_3354 136
1502 3300050511 nmdc:mga08y16_995027_c1 nmdc:mga08y16_995027_c1_82_495 136
1503 3300050512 nmdc:mga0n895_2066906_c1 nmdc:mga0n895_2066906_c1_52_462 136
1504 3300050512 nmdc:mga0n895_217896_c1 nmdc:mga0n895_217896_c1_74_484 136
1505 3300050512 nmdc:mga0n895_28041_c1 nmdc:mga0n895_28041_c1_4317_4727 136
1506 3300050512 nmdc:mga0n895_666_c1 nmdc:mga0n895_666_c1_20000_20410 136
1507 3300050513 nmdc:mga0rr50_108616_c1 nmdc:mga0rr50_108616_c1_559_969 136
1508 3300050513 nmdc:mga0rr50_109323_c1 nmdc:mga0rr50_109323_c1_1265_1675 136
1509 3300050513 nmdc:mga0rr50_11285_c1 nmdc:mga0rr50_11285_c1_2124_2534 136
1510 3300050513 nmdc:mga0rr50_40426_c1 nmdc:mga0rr50_40426_c1_1688_2098 136
1511 3300050513 nmdc:mga0rr50_689608_c1 nmdc:mga0rr50_689608_c1_362_772 136
1512 3300050513 nmdc:mga0rr50_7632_c1 nmdc:mga0rr50_7632_c1_3010_3420 136
1513 3300050514 nmdc:mga08x19_382435_c1 nmdc:mga08x19_382435_c1_418_828 136
1514 3300050515 nmdc:mga0a205_14489_c1 nmdc:mga0a205_14489_c1_2367_2777 136
1515 3300050515 nmdc:mga0a205_1663_c1 nmdc:mga0a205_1663_c1_3367_3777 136
1516 3300050515 nmdc:mga0a205_247191_c1 nmdc:mga0a205_247191_c1_343_753 136
1517 3300050515 nmdc:mga0a205_588071_c1 nmdc:mga0a205_588071_c1_270_680 136
1518 3300050515 nmdc:mga0a205_681_c1 nmdc:mga0a205_681_c1_1122_1532 136
1519 3300050516 nmdc:mga0sz30_97741_c1 nmdc:mga0sz30_97741_c1_462_875 136
1520 3300053077 Ga0495601_0004198 Ga0495601_0004198_4286_4696 136
1521 3300053077 Ga0495601_0006640 Ga0495601_0006640_1875_2285 136
1522 3300053077 Ga0495601_0014969 Ga0495601_0014969_596_1006 136
1523 3300053077 Ga0495601_0023546 Ga0495601_0023546_2646_3056 136
1524 3300053078 Ga0495612_0003202 Ga0495612_0003202_2805_3215 136
1525 3300053078 Ga0495612_0103558 Ga0495612_0103558_482_892 136
1526 3300053083 Ga0495655_0097709 Ga0495655_0097709_199_609 136
1527 3300053084 Ga0495595_0000235 Ga0495595_0000235_10934_11344 136
1528 3300053084 Ga0495595_0001396 Ga0495595_0001396_1583_1993 136
1529 3300053084 Ga0495595_0022045 Ga0495595_0022045_1861_2271 136
1530 3300053084 Ga0495595_0066035 Ga0495595_0066035_68_478 136
1531 3300053084 Ga0495595_0272198 Ga0495595_0272198_175_585 136
1532 3300053085 Ga0495619_0000052 Ga0495619_0000052_2128_2538 136
1533 3300053085 Ga0495619_0000078 Ga0495619_0000078_6090_6500 136
1534 3300053085 Ga0495619_0000414 Ga0495619_0000414_16501_16911 136
1535 3300053085 Ga0495619_0013659 Ga0495619_0013659_2596_3006 136
1536 3300053085 Ga0495619_0036570 Ga0495619_0036570_1897_2307 136
1537 3300053085 Ga0495619_0699103 Ga0495619_0699103_212_622 136
1538 3300053087 Ga0500643_004390 Ga0500643_004390_5095_5505 136
1539 3300053088 Ga0500644_0021428 Ga0500644_0021428_899_1309 136
1540 3300053088 Ga0500644_0244057 Ga0500644_0244057_315_725 136
1541 3300053090 Ga0500646_0009102 Ga0500646_0009102_1792_2205 136
1542 3300053090 Ga0500646_0137266 Ga0500646_0137266_334_744 136
1543 3300053094 Ga0500566_0019905 Ga0500566_0019905_2394_2804 136
1544 3300053096 Ga0500641_0002930 Ga0500641_0002930_2240_2650 136
1545 3300053096 Ga0500641_0285114 Ga0500641_0285114_222_635 136
1546 3300053098 Ga0500650_0133578 Ga0500650_0133578_363_773 136
1547 3300053119 Ga0500595_000001 Ga0500595_000001_556909_557319 136
1548 3300053125 Ga0500618_164735 Ga0500618_164735_19_429 136
1549 3300053130 Ga0500642_0229953 Ga0500642_0229953_383_796 136
1550 3300053133 Ga0500655_086098 Ga0500655_086098_119_529 136
1551 3300053134 Ga0500658_0072923 Ga0500658_0072923_156_569 136
1552 3300053139 Ga0500568_0342722 Ga0500568_0342722_39_452 136
1553 3300053146 Ga0500588_0243917 Ga0500588_0243917_232_645 136
1554 3300053151 Ga0500604_0054341 Ga0500604_0054341_726_1139 136
1555 3300053153 Ga0500616_0000001 Ga0500616_0000001_1432444_1432854 136
1556 3300053153 Ga0500616_0032543 Ga0500616_0032543_1278_1688 136
1557 3300053730 Ga0500645_010737 Ga0500645_010737_1276_1686 136
1558 3300054114 Ga0501084_0896959 Ga0501084_0896959_66_479 136
1559 3300060353 Ga0501082_0170580 Ga0501082_0170580_1438_1848 136
1560 3300060353 Ga0501082_0266612 Ga0501082_0266612_903_1313 136
1561 3300060353 Ga0501082_0802038 Ga0501082_0802038_17_430 136
1562 3300060353 Ga0501082_0967257 Ga0501082_0967257_264_713 136
1563 3300061734 Ga0530510_0318277 Ga0530510_0318277_648_1058 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

22

101

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9431 9 79
1u2m-assembly1.cif.gz_C crystal structure of skp 0.938 90 133
4l0r-assembly1.cif.gz_B crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. 0.9366 90 133
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9359 4 88
4asu-assembly1.cif.gz_H f1-atpase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the empty site 0.9273 6 83
ID Description Score Start End Superfamily
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.965 2 88 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9615 2 88 2.60.15.10
af_Q9H160_25_121_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9557 90 135 1.10.287.1060
af_Q6DHF1_14_110_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9557 90 136 1.10.287.1060
af_Q1RLQ9_15_111_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9555 90 135 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A525J889-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9909 2 84 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A533J4A4-F1-model_v4 deleted 0.9854 1 66
AF-A0A3D4ZC69-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9842 4 79 GO:0012505
GO:0045261
GO:0046933
AF-A0A3R7UCC7-F1-model_v4 ATP synthase F1 subunit epsilon (EC 3.6.3.14) 0.984 4 79 GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A496RTK1-F1-model_v4 ATP synthase F1 subunit epsilon (EC 3.6.3.14) 0.9828 1 79 GO:0012505
GO:0016787
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
93.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map