F494575

General Info

Members Datasets Scaffolds Average Seq Length
1527 530 1494 319

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0009196|Ga0373953_0009196_2043_3224
Length 385
Sequence MLDRPTDHAGGFEIHAPSIEKFRWPCEPAQPAAAIFRMDQDEPARHNRRGGARPVYGRGDRTGKQGTMDLKVGKQAIRDASNKLKNWGRWGADDQIGTLNHVTPEDIVQAASLICSGKVFALGIPLDRSGPQNGLFGGRWNPIHTMLATGTDAIAGRQDIVPNLRYADDSINMPVQCATHWDALGHIFYEDKMYNGFDARLVDSNGLGKLGIEHAKSKMVGRGVLLDIARHKGVRHLKDGQGISNDDLDSCAKAQNIQIRRGDFVIVRTGQMERCLEEKQWGGFAGGDAPGVKFENCYWCQDKQIAAICSDTWGVEVRPNETTEANQPWHWVVIPAMGLTMGEMFYLKDLAEDCAADGTYEFFFCGPPLVITGGTGSPINPQAIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
9 2643221651 Afipia sp. Root123D2 Isolate Unclassified
10 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
11 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
12 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
13 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
14 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
15 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
16 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
17 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
18 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
19 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
20 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
21 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
22 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
23 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
24 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
25 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
26 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
27 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
28 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
29 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
30 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
31 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
32 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
33 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
34 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
35 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
36 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
37 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
38 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
39 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
40 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
41 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
42 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
43 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
49 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
50 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
51 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
52 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
53 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
54 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
55 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
56 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
57 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
66 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
77 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
78 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
79 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
84 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
96 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
101 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
102 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
103 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
104 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
114 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
115 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
116 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
120 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
121 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
122 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
123 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
124 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
125 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
126 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
127 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
128 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
129 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
132 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
133 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
134 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
135 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
136 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
137 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
138 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
139 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
140 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
141 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
142 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
143 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
144 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
145 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
146 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
147 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
153 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
154 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
155 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
156 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
157 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
158 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
159 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
160 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
162 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
163 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
164 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
165 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
166 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
167 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
168 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
169 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
170 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
171 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
173 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
174 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
175 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
176 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
177 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
178 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
179 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
180 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
181 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
182 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
183 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
184 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
185 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
186 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
187 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
188 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
189 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
190 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
191 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
192 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
193 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
194 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
195 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
196 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
197 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
198 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
199 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
200 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
201 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
202 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
204 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
205 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
206 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
207 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
208 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
210 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
212 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
290 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
294 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
295 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
296 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
297 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
298 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
299 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
300 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
301 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
302 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
303 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
306 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
307 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
308 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
309 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
310 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
311 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
312 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
313 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
314 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
315 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
316 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
317 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
318 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
319 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
320 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
321 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
322 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
323 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
324 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
325 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
326 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
328 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
329 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
330 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
331 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
332 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
333 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
334 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
335 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
336 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
337 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
338 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
339 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
340 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
341 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
342 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
343 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
344 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
345 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
346 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
347 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
348 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
349 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
350 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
351 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
352 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
353 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
354 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
355 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
356 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
357 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
358 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
359 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
360 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
361 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
362 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
363 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
364 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
365 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
366 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
367 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
368 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
369 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
370 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
371 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
372 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
373 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
376 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
377 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
378 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
379 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
380 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
381 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
382 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
383 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
384 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
385 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
386 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
387 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
388 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
389 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
390 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
391 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
394 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
395 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
396 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
397 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
398 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
399 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
400 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
401 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
402 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
403 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
404 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
405 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
406 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
407 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
408 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
409 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
410 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
411 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
412 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
413 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
414 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
415 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
416 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
417 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
418 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
419 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
420 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
421 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
422 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
423 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
424 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
427 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
428 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
429 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
430 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
431 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
432 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
433 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
434 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
435 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
436 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
437 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
438 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
439 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
440 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
441 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
442 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
443 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
444 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
445 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
446 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
447 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
448 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
449 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
450 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
451 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
452 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
453 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
454 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
455 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
456 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
457 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
458 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
459 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
460 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
461 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
462 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
479 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
486 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
487 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
488 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
491 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
492 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
495 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
502 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
507 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
508 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
509 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
510 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
511 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
512 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
513 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
514 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
515 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
516 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
517 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
518 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
519 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
520 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
523 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
524 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
525 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
526 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
527 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
528 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
529 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
530 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.07
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 1.7
Rhizoplane 8.84
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2503292 2162886007 Bacteria 1713
2 2214683826 2209111006 Bacteria 4506
3 ARcpr5oldR_c000037 3300000041 Bacteria 26008
4 ARSoilYngRDRAFT_c00113 3300000042 Bacteria 13805
5 ARcpr5yngRDRAFT_c000014 3300000043 Bacteria 31433
6 ARSoilOldRDRAFT_c000005 3300000044 Bacteria 61735
7 ARCol0oldRDRAFT_c00471 3300000045 Bacteria 3754
8 LJQas_1002035 3300000549 Bacteria 2893
9 ARCol0yngRDRAFT_1000099 3300000652 Bacteria 16028
10 JGI24032J14994_100117 3300001430 Bacteria 3699
11 JGI24736J21556_1006279 3300001904 Bacteria 2002
12 JGI24741J21665_1008107 3300001915 Bacteria 1997
13 JGI24746J21847_1000648 3300001977 Bacteria 5315
14 JGI24747J21853_1001209 3300001978 Bacteria 1888
15 JGI24739J22299_10000871 3300001989 Bacteria 11154
16 JGI24737J22298_10001901 3300001990 Bacteria 7464
17 JGI24737J22298_10009338 3300001990 Bacteria 3266
18 JGI24743J22301_10003516 3300001991 Bacteria 2485
19 JGI24735J21928_10032226 3300002067 Bacteria 1552
20 JGI24750J21931_1000439 3300002070 Bacteria 6761
21 JGI24745J21846_1005235 3300002073 Bacteria 1412
22 JGI24748J21848_1005097 3300002074 Bacteria 1520
23 JGI24738J21930_10000856 3300002075 Bacteria 8728
24 JGI24744J21845_10013124 3300002077 Bacteria 1673
25 JGI24035J26624_1001996 3300002126 Bacteria 1901
26 JGI24033J26618_1001158 3300002155 Bacteria 2569
27 JGI24034J26672_10001465 3300002239 Bacteria 3137
28 JGI24742J22300_10000464 3300002244 Bacteria 6004
29 JGI24751J29686_10004435 3300002459 Bacteria 2850
30 JGI25153J46596_10004386 3300003215 Bacteria 7611
31 JGI25404J52841_10003777 3300003659 Bacteria 3021
32 Ga0055536_1000524 3300003781 Bacteria 26496
33 Ga0055530_10004363 3300003791 Bacteria 7333
34 Ga0055540_1000054 3300003792 Bacteria 142505
35 Ga0055531_10000037 3300003794 Bacteria 144244
36 JGI25405J52794_10006055 3300003911 Bacteria 2202
37 Ga0065717_1002123 3300005276 Bacteria 2843
38 Ga0065716_1002073 3300005277 Bacteria 2333
39 Ga0065704_10092942 3300005289 Bacteria 2611
40 Ga0065712_10074695 3300005290 Bacteria 4031
41 Ga0065715_10012983 3300005293 Bacteria 3599
42 Ga0065715_10026218 3300005293 Bacteria 2017
43 Ga0065707_10105725 3300005295 Bacteria 2631
44 Ga0065707_10112520 3300005295 Bacteria 2358
45 Ga0070658_10084650 3300005327 Bacteria 2607
46 Ga0070658_10096229 3300005327 Bacteria 2444
47 Ga0070676_10061936 3300005328 Bacteria 2225
48 Ga0070683_100013405 3300005329 Bacteria 7149
49 Ga0070683_100085340 3300005329 Bacteria 2959
50 Ga0070690_100003948 3300005330 Bacteria 8189
51 Ga0070690_100015657 3300005330 Bacteria 4530
52 Ga0070690_100024575 3300005330 Bacteria 3706
53 Ga0070690_100177059 3300005330 Bacteria 1472
54 Ga0070670_100025087 3300005331 Bacteria 5129
55 Ga0070670_100099329 3300005331 Bacteria 2504
56 Ga0070670_100246105 3300005331 Bacteria 1557
57 Ga0070677_10002031 3300005333 Bacteria 6438
58 Ga0070677_10102370 3300005333 Bacteria 1265
59 Ga0068869_100035291 3300005334 Bacteria 3543
60 Ga0068869_100046878 3300005334 Bacteria 3119
61 Ga0068869_100224938 3300005334 Bacteria 1489
62 Ga0070666_10006171 3300005335 Bacteria 7371
63 Ga0070666_10023242 3300005335 Bacteria 4035
64 Ga0070666_10103024 3300005335 Bacteria 1969
65 Ga0070680_100003647 3300005336 Bacteria 11501
66 Ga0070680_100019478 3300005336 Bacteria 5376
67 Ga0070680_100168978 3300005336 Bacteria 1839
68 Ga0070680_100367024 3300005336 Bacteria 1225
69 Ga0070682_100002015 3300005337 Bacteria 11351
70 Ga0070682_100171895 3300005337 Bacteria 1507
71 Ga0068868_100017327 3300005338 Bacteria 5364
72 Ga0068868_100051217 3300005338 Bacteria 3246
73 Ga0068868_100083566 3300005338 Bacteria 2563
74 Ga0070660_100003870 3300005339 Bacteria 10336
75 Ga0070660_100050132 3300005339 Bacteria 3211
76 Ga0070660_100075994 3300005339 Bacteria 2630
77 Ga0070660_100186912 3300005339 Bacteria 1677
78 Ga0070689_100006859 3300005340 Bacteria 7922
79 Ga0070689_100067079 3300005340 Bacteria 2796
80 Ga0070689_100167813 3300005340 Bacteria 1777
81 Ga0070689_100185900 3300005340 Bacteria 1690
82 Ga0070691_10004357 3300005341 Bacteria 6432
83 Ga0070691_10016445 3300005341 Bacteria 3398
84 Ga0070691_10044926 3300005341 Bacteria 2096
85 Ga0070687_100009855 3300005343 Bacteria 4103
86 Ga0070687_100032499 3300005343 Bacteria 2568
87 Ga0070687_100093310 3300005343 Bacteria 1669
88 Ga0070687_100175903 3300005343 Bacteria 1278
89 Ga0070692_10007167 3300005345 Bacteria 4895
90 Ga0070692_10040235 3300005345 Bacteria 2390
91 Ga0070692_10176558 3300005345 Bacteria 1235
92 Ga0070668_100004252 3300005347 Bacteria 10629
93 Ga0070668_100045512 3300005347 Bacteria 3367
94 Ga0070668_100098468 3300005347 Bacteria 2314
95 Ga0070669_100008306 3300005353 Bacteria 7414
96 Ga0070669_100035049 3300005353 Bacteria 3635
97 Ga0070669_100202959 3300005353 Bacteria 1561
98 Ga0070675_100044149 3300005354 Bacteria 3645
99 Ga0070675_100055315 3300005354 Bacteria 3266
100 Ga0070671_100006278 3300005355 Bacteria 9471
101 Ga0070671_100009728 3300005355 Bacteria 7722
102 Ga0070671_100015968 3300005355 Bacteria 6067
103 Ga0070671_100033397 3300005355 Bacteria 4254
104 Ga0070673_100012672 3300005364 Bacteria 5798
105 Ga0070673_100024715 3300005364 Bacteria 4409
106 Ga0070673_100118258 3300005364 Bacteria 2206
107 Ga0070673_100373958 3300005364 Bacteria 1269
108 Ga0070688_100039413 3300005365 Bacteria 2891
109 Ga0070688_100071559 3300005365 Bacteria 2220
110 Ga0070659_100026221 3300005366 Bacteria 4482
111 Ga0070659_100232167 3300005366 Bacteria 1525
112 Ga0070659_100295491 3300005366 Bacteria 1349
113 Ga0070667_100002235 3300005367 Bacteria 17041
114 Ga0070667_100013854 3300005367 Bacteria 6665
115 Ga0070667_100122035 3300005367 Bacteria 2267
116 Ga0070667_100140030 3300005367 Bacteria 2118
117 Ga0070667_100158721 3300005367 Bacteria 1991
118 Ga0070703_10004958 3300005406 Bacteria 3714
119 Ga0070703_10007397 3300005406 Bacteria 3084
120 Ga0070709_10011016 3300005434 Bacteria 5024
121 Ga0070709_10047697 3300005434 Bacteria 2669
122 Ga0070709_10067778 3300005434 Bacteria 2293
123 Ga0070714_100015917 3300005435 Bacteria 6063
124 Ga0070714_100053843 3300005435 Bacteria 3437
125 Ga0070713_100037939 3300005436 Bacteria 3899
126 Ga0070713_100064751 3300005436 Bacteria 3069
127 Ga0070713_100383500 3300005436 Bacteria 1310
128 Ga0070710_10002325 3300005437 Bacteria 8998
129 Ga0070710_10050700 3300005437 Bacteria 2328
130 Ga0070710_10067770 3300005437 Bacteria 2048
131 Ga0070710_10085486 3300005437 Bacteria 1850
132 Ga0070701_10002068 3300005438 Bacteria 7625
133 Ga0070701_10043327 3300005438 Bacteria 2302
134 Ga0070701_10108305 3300005438 Bacteria 1549
135 Ga0070711_100032612 3300005439 Bacteria 3464
136 Ga0070711_100154160 3300005439 Bacteria 1735
137 Ga0070711_100196272 3300005439 Bacteria 1555
138 Ga0070705_100000528 3300005440 Bacteria 22027
139 Ga0070705_100010364 3300005440 Bacteria 4663
140 Ga0070705_100031013 3300005440 Bacteria 2956
141 Ga0070705_100347503 3300005440 Bacteria 1080
142 Ga0070700_100024158 3300005441 Bacteria 3565
143 Ga0070700_100034214 3300005441 Bacteria 3067
144 Ga0070700_100277436 3300005441 Bacteria 1214
145 Ga0070694_100006551 3300005444 Bacteria 7073
146 Ga0070694_100011702 3300005444 Bacteria 5436
147 Ga0070694_100032984 3300005444 Bacteria 3403
148 Ga0070694_100368662 3300005444 Bacteria 1117
149 Ga0070708_100001688 3300005445 Bacteria 16974
150 Ga0070708_100055433 3300005445 Bacteria 3525
151 Ga0070708_100080088 3300005445 Bacteria 2955
152 Ga0070663_100009202 3300005455 Bacteria 6109
153 Ga0070663_100159867 3300005455 Bacteria 1733
154 Ga0070678_100034053 3300005456 Bacteria 3544
155 Ga0070678_100079875 3300005456 Bacteria 2475
156 Ga0070678_100213473 3300005456 Bacteria 1600
157 Ga0070678_100235032 3300005456 Bacteria 1530
158 Ga0070662_100011393 3300005457 Bacteria 5868
159 Ga0070662_100035015 3300005457 Bacteria 3543
160 Ga0070662_100127028 3300005457 Bacteria 1961
161 Ga0070681_10018493 3300005458 Bacteria 6965
162 Ga0070681_10040914 3300005458 Bacteria 4643
163 Ga0070681_10065168 3300005458 Bacteria 3612
164 Ga0070681_10075350 3300005458 Bacteria 3334
165 Ga0070681_10204988 3300005458 Bacteria 1889
166 Ga0068867_100005646 3300005459 Bacteria 8867
167 Ga0070685_10017763 3300005466 Bacteria 3814
168 Ga0070706_100104467 3300005467 Bacteria 2635
169 Ga0070707_100317375 3300005468 Bacteria 1514
170 Ga0070698_100221862 3300005471 Bacteria 1824
171 Ga0070698_100251705 3300005471 Bacteria 1699
172 Ga0074259_12010023 3300005507 Bacteria 2242
173 Ga0070699_100000147 3300005518 Bacteria 66774
174 Ga0070699_100099812 3300005518 Bacteria 2544
175 Ga0070699_100271659 3300005518 Bacteria 1517
176 Ga0070679_100016159 3300005530 Bacteria 7192
177 Ga0070679_100072533 3300005530 Bacteria 3435
178 Ga0070679_100139867 3300005530 Bacteria 2401
179 Ga0070679_100299686 3300005530 Bacteria 1558
180 Ga0070679_100299893 3300005530 Bacteria 1557
181 Ga0070679_100369957 3300005530 Bacteria 1380
182 Ga0070684_100020014 3300005535 Bacteria 5547
183 Ga0070684_100079026 3300005535 Bacteria 2907
184 Ga0070684_100082068 3300005535 Bacteria 2854
185 Ga0070684_100095019 3300005535 Bacteria 2655
186 Ga0070697_100006410 3300005536 Bacteria 9109
187 Ga0070697_100023710 3300005536 Bacteria 4882
188 Ga0070697_100225527 3300005536 Bacteria 1597
189 Ga0068853_100003634 3300005539 Bacteria 11828
190 Ga0068853_100188539 3300005539 Bacteria 1873
191 Ga0070672_100044896 3300005543 Bacteria 3415
192 Ga0070672_100245750 3300005543 Bacteria 1506
193 Ga0070686_100007349 3300005544 Bacteria 6142
194 Ga0070686_100055380 3300005544 Bacteria 2540
195 Ga0070686_100124883 3300005544 Bacteria 1772
196 Ga0070686_100208658 3300005544 Bacteria 1405
197 Ga0070695_100002809 3300005545 Bacteria 10113
198 Ga0070695_100016690 3300005545 Bacteria 4446
199 Ga0070695_100121973 3300005545 Bacteria 1784
200 Ga0070695_100264948 3300005545 Bacteria 1256
201 Ga0070696_100002859 3300005546 Bacteria 11479
202 Ga0070696_100010889 3300005546 Bacteria 6095
203 Ga0070696_100013307 3300005546 Bacteria 5520
204 Ga0070693_100004174 3300005547 Bacteria 6817
205 Ga0070693_100025730 3300005547 Bacteria 3169
206 Ga0070693_100157032 3300005547 Bacteria 1446
207 Ga0070665_100004170 3300005548 Bacteria 15207
208 Ga0070665_100006016 3300005548 Bacteria 12404
209 Ga0070665_100195770 3300005548 Bacteria 2022
210 Ga0070704_100022446 3300005549 Bacteria 4107
211 Ga0070704_100034292 3300005549 Bacteria 3440
212 Ga0070704_100177163 3300005549 Bacteria 1702
213 Ga0068855_100026130 3300005563 Bacteria 6985
214 Ga0068855_100275071 3300005563 Bacteria 1871
215 Ga0070664_100114890 3300005564 Bacteria 2352
216 Ga0070664_100135966 3300005564 Bacteria 2161
217 Ga0068857_100019002 3300005577 Bacteria 6029
218 Ga0068857_100110898 3300005577 Bacteria 2466
219 Ga0068857_100126963 3300005577 Bacteria 2299
220 Ga0068854_100002965 3300005578 Bacteria 10527
221 Ga0068854_100039626 3300005578 Bacteria 3321
222 Ga0068856_100005225 3300005614 Bacteria 12811
223 Ga0068856_100058468 3300005614 Bacteria 3807
224 Ga0068856_100125316 3300005614 Bacteria 2572
225 Ga0068852_100047369 3300005616 Bacteria 3667
226 Ga0068852_100071202 3300005616 Bacteria 3052
227 Ga0068852_100123780 3300005616 Bacteria 2371
228 Ga0068859_100008928 3300005617 Bacteria 10125
229 Ga0068859_100039892 3300005617 Bacteria 4712
230 Ga0068864_100013072 3300005618 Bacteria 6875
231 Ga0068864_100030146 3300005618 Bacteria 4597
232 Ga0068864_100079478 3300005618 Bacteria 2871
233 Ga0068864_100175221 3300005618 Bacteria 1958
234 Ga0068866_10017245 3300005718 Bacteria 3244
235 Ga0068861_100016579 3300005719 Bacteria 5215
236 Ga0068861_100038178 3300005719 Bacteria 3574
237 Ga0068861_100038636 3300005719 Bacteria 3557
238 Ga0068861_100119494 3300005719 Bacteria 2124
239 Ga0068851_10058728 3300005834 Bacteria 1966
240 Ga0068870_10008836 3300005840 Bacteria 4547
241 Ga0068870_10023842 3300005840 Bacteria 3023
242 Ga0068870_10031956 3300005840 Bacteria 2671
243 Ga0068863_100053128 3300005841 Bacteria 3839
244 Ga0068863_100099230 3300005841 Bacteria 2767
245 Ga0068863_100135514 3300005841 Bacteria 2352
246 Ga0068863_100230610 3300005841 Bacteria 1786
247 Ga0068858_100026832 3300005842 Bacteria 5350
248 Ga0068858_100031436 3300005842 Bacteria 4930
249 Ga0068858_100121393 3300005842 Bacteria 2444
250 Ga0068858_100198645 3300005842 Bacteria 1896
251 Ga0068860_100003101 3300005843 Bacteria 17176
252 Ga0068860_100023337 3300005843 Bacteria 5979
253 Ga0068860_100052065 3300005843 Bacteria 3894
254 Ga0068860_100060789 3300005843 Bacteria 3590
255 Ga0068860_100073921 3300005843 Bacteria 3240
256 Ga0068860_100125246 3300005843 Bacteria 2462
257 Ga0068860_100172469 3300005843 Bacteria 2090
258 Ga0068862_100001380 3300005844 Bacteria 22519
259 Ga0068862_100010646 3300005844 Bacteria 7598
260 Ga0068862_100078169 3300005844 Bacteria 2866
261 Ga0081455_10000096 3300005937 Bacteria 96503
262 Ga0081455_10000200 3300005937 Bacteria 76013
263 Ga0081455_10000768 3300005937 Bacteria 41613
264 Ga0081455_10045366 3300005937 Bacteria 3825
265 Ga0081455_10174039 3300005937 Bacteria 1636
266 Ga0081538_10007210 3300005981 Bacteria 9653
267 Ga0081538_10008625 3300005981 Bacteria 8621
268 Ga0081538_10016051 3300005981 Bacteria 5761
269 Ga0081538_10094613 3300005981 Bacteria 1529
270 Ga0081540_1000158 3300005983 Bacteria 69951
271 Ga0081540_1006707 3300005983 Bacteria 8324
272 Ga0081540_1025349 3300005983 Bacteria 3414
273 Ga0081540_1057025 3300005983 Bacteria 1892
274 Ga0081540_1086712 3300005983 Bacteria 1390
275 Ga0081539_10020277 3300005985 Bacteria 4502
276 Ga0081539_10027151 3300005985 Bacteria 3632
277 Ga0070717_10086802 3300006028 Bacteria 2634
278 Ga0070717_10147771 3300006028 Bacteria 2031
279 Ga0070717_10157079 3300006028 Bacteria 1971
280 Ga0070717_10309908 3300006028 Bacteria 1404
281 Ga0075365_10044325 3300006038 Bacteria 2914
282 Ga0075365_10079762 3300006038 Bacteria 2215
283 Ga0075368_10045474 3300006042 Bacteria 1734
284 Ga0075363_100054897 3300006048 Bacteria 2132
285 Ga0075432_10010891 3300006058 Bacteria 3087
286 Ga0070715_10038507 3300006163 Bacteria 1986
287 Ga0070716_100004647 3300006173 Bacteria 6580
288 Ga0070716_100066278 3300006173 Bacteria 2106
289 Ga0070716_100199148 3300006173 Bacteria 1330
290 Ga0070712_100000210 3300006175 Bacteria 32927
291 Ga0070712_100161297 3300006175 Bacteria 1732
292 Ga0070712_100409334 3300006175 Bacteria 1122
293 Ga0075362_10084393 3300006177 Bacteria 1467
294 Ga0075367_10021871 3300006178 Bacteria 3581
295 Ga0075367_10098232 3300006178 Bacteria 1787
296 Ga0075367_10135444 3300006178 Bacteria 1523
297 Ga0075369_10070243 3300006186 Bacteria 1540
298 Ga0075366_10013125 3300006195 Bacteria 4711
299 Ga0097621_100029343 3300006237 Bacteria 4343
300 Ga0097621_100039390 3300006237 Bacteria 3796
301 Ga0097621_100088576 3300006237 Bacteria 2586
302 Ga0097621_100208169 3300006237 Bacteria 1700
303 Ga0075370_10028731 3300006353 Bacteria 3093
304 Ga0068871_100003405 3300006358 Bacteria 10932
305 Ga0068871_100012612 3300006358 Bacteria 6240
306 Ga0068871_100044409 3300006358 Bacteria 3574
307 Ga0075428_100003646 3300006844 Bacteria 16887
308 Ga0075428_100058917 3300006844 Bacteria 4205
309 Ga0075428_100065348 3300006844 Bacteria 3984
310 Ga0075428_100153837 3300006844 Bacteria 2499
311 Ga0075428_100155914 3300006844 Bacteria 2481
312 Ga0075428_100326861 3300006844 Bacteria 1647
313 Ga0075430_100000133 3300006846 Bacteria 47377
314 Ga0075430_100001032 3300006846 Bacteria 22005
315 Ga0075430_100022952 3300006846 Bacteria 5307
316 Ga0075431_100000602 3300006847 Bacteria 30370
317 Ga0075431_100001362 3300006847 Bacteria 22408
318 Ga0075431_100057185 3300006847 Bacteria 4023
319 Ga0075431_100074190 3300006847 Bacteria 3510
320 Ga0075431_100120962 3300006847 Bacteria 2702
321 Ga0075433_10000328 3300006852 Bacteria 29209
322 Ga0075433_10028663 3300006852 Bacteria 4736
323 Ga0075433_10136920 3300006852 Bacteria 2177
324 Ga0075434_100001713 3300006871 Bacteria 18786
325 Ga0075434_100006226 3300006871 Bacteria 10934
326 Ga0075434_100018385 3300006871 Bacteria 6752
327 Ga0075434_100289224 3300006871 Bacteria 1659
328 Ga0075429_100000163 3300006880 Bacteria 42270
329 Ga0075429_100137894 3300006880 Bacteria 2135
330 Ga0068865_100001544 3300006881 Bacteria 13429
331 Ga0068865_100003466 3300006881 Bacteria 9451
332 Ga0075436_100025848 3300006914 Bacteria 4040
333 Ga0075436_100271637 3300006914 Bacteria 1211
334 Ga0097620_100008928 3300006931 Bacteria 10125
335 Ga0097620_100039897 3300006931 Bacteria 4712
336 Ga0075435_100001972 3300007076 Bacteria 13386
337 Ga0075435_100024791 3300007076 Bacteria 4661
338 Ga0075435_100081761 3300007076 Bacteria 2654
339 Ga0075435_100175333 3300007076 Bacteria 1810
340 Ga0099794_10132838 3300007265 Bacteria 1258
341 Ga0105244_10059189 3300009036 Bacteria 1932
342 Ga0105244_10136458 3300009036 Bacteria 1182
343 Ga0105240_10378029 3300009093 Bacteria 1600
344 Ga0111539_10000389 3300009094 Bacteria 54333
345 Ga0111539_10000725 3300009094 Bacteria 42875
346 Ga0111539_10001696 3300009094 Bacteria 29343
347 Ga0111539_10001808 3300009094 Bacteria 28479
348 Ga0111539_10018474 3300009094 Bacteria 8635
349 Ga0111539_10047916 3300009094 Bacteria 5105
350 Ga0111539_10065823 3300009094 Bacteria 4281
351 Ga0111539_10103174 3300009094 Bacteria 3347
352 Ga0111539_10122383 3300009094 Bacteria 3049
353 Ga0111539_10146602 3300009094 Bacteria 2763
354 Ga0111539_10186046 3300009094 Bacteria 2425
355 Ga0111539_10410216 3300009094 Bacteria 1578
356 Ga0111539_10482939 3300009094 Bacteria 1443
357 Ga0105245_10010250 3300009098 Bacteria 8160
358 Ga0105245_10015250 3300009098 Bacteria 6695
359 Ga0105245_10391633 3300009098 Bacteria 1386
360 Ga0105247_10022803 3300009101 Bacteria 3771
361 Ga0105247_10035997 3300009101 Bacteria 3018
362 Ga0105247_10041832 3300009101 Bacteria 2804
363 Ga0114129_10000227 3300009147 Bacteria 62698
364 Ga0114129_10008509 3300009147 Bacteria 14626
365 Ga0114129_10040105 3300009147 Bacteria 6602
366 Ga0114129_10225242 3300009147 Bacteria 2528
367 Ga0114129_10255373 3300009147 Bacteria 2351
368 Ga0105243_10003521 3300009148 Bacteria 12651
369 Ga0105243_10060998 3300009148 Bacteria 3014
370 Ga0105243_10067549 3300009148 Bacteria 2878
371 Ga0105241_10007067 3300009174 Bacteria 8267
372 Ga0105241_10195297 3300009174 Bacteria 1687
373 Ga0105242_10026334 3300009176 Bacteria 4608
374 Ga0105242_10035954 3300009176 Bacteria 3971
375 Ga0105242_10040216 3300009176 Bacteria 3767
376 Ga0105248_10011072 3300009177 Bacteria 9949
377 Ga0105248_10070147 3300009177 Bacteria 3935
378 Ga0105248_10109495 3300009177 Bacteria 3114
379 Ga0105248_10244342 3300009177 Bacteria 2020
380 Ga0105237_10007432 3300009545 Bacteria 11993
381 Ga0105237_10102994 3300009545 Bacteria 2846
382 Ga0105238_10034621 3300009551 Bacteria 5138
383 Ga0105249_10011087 3300009553 Bacteria 7919
384 Ga0105249_10019349 3300009553 Bacteria 6073
385 Ga0105249_10285547 3300009553 Bacteria 1650
386 Ga0105239_10033880 3300010375 Bacteria 5606
387 Ga0105239_10105997 3300010375 Bacteria 3113
388 Ga0105239_10152129 3300010375 Bacteria 2582
389 Ga0105239_10277133 3300010375 Bacteria 1887
390 Ga0105246_10004169 3300011119 Bacteria 8786
391 Ga0105246_10016137 3300011119 Bacteria 4726
392 Ga0105246_10035014 3300011119 Bacteria 3352
393 Ga0105246_10049515 3300011119 Bacteria 2877
394 Ga0105246_10136956 3300011119 Bacteria 1836
395 Ga0157335_1000780 3300012492 Bacteria 1569
396 Ga0157373_10035983 3300013100 Bacteria 3554
397 Ga0157371_10050774 3300013102 Bacteria 2948
398 Ga0157374_10002692 3300013296 Bacteria 14940
399 Ga0157374_10070776 3300013296 Bacteria 3287
400 Ga0157374_10175996 3300013296 Bacteria 2089
401 Ga0157378_10085517 3300013297 Bacteria 2857
402 Ga0157378_10102635 3300013297 Bacteria 2612
403 Ga0157378_10694426 3300013297 Bacteria 1036
404 Ga0163162_10017826 3300013306 Bacteria 6947
405 Ga0163162_10063021 3300013306 Bacteria 3749
406 Ga0163162_10206806 3300013306 Bacteria 2092
407 Ga0163162_10430330 3300013306 Bacteria 1452
408 Ga0157372_10040791 3300013307 Bacteria 5129
409 Ga0157375_10024786 3300013308 Bacteria 5559
410 Ga0157375_10061773 3300013308 Bacteria 3721
411 Ga0157375_10092850 3300013308 Bacteria 3083
412 Ga0157375_10104406 3300013308 Bacteria 2922
413 Ga0157375_10168893 3300013308 Bacteria 2334
414 Ga0163163_10001273 3300014325 Bacteria 21307
415 Ga0163163_10095739 3300014325 Bacteria 2988
416 Ga0163163_10122477 3300014325 Bacteria 2635
417 Ga0163163_10380939 3300014325 Bacteria 1468
418 Ga0157380_10006550 3300014326 Bacteria 8213
419 Ga0157377_10001621 3300014745 Bacteria 9812
420 Ga0157377_10042979 3300014745 Bacteria 2513
421 Ga0157376_10034213 3300014969 Bacteria 4101
422 Ga0157376_10104691 3300014969 Bacteria 2480
423 Ga0163161_10000266 3300017792 Bacteria 45979
424 Ga0163161_10076015 3300017792 Bacteria 2465
425 Ga0163161_10078274 3300017792 Bacteria 2430
426 Ga0163161_10137337 3300017792 Bacteria 1849
427 Ga0206354_11439474 3300020081 Bacteria 1420
428 Ga0213872_10013367 3300021361 Bacteria 3848
429 Ga0213874_10007563 3300021377 Bacteria 2613
430 Ga0213876_10000603 3300021384 Bacteria 26611
431 Ga0213876_10032997 3300021384 Bacteria 2730
432 Ga0213876_10035830 3300021384 Bacteria 2617
433 Ga0213876_10048232 3300021384 Bacteria 2251
434 Ga0213876_10150269 3300021384 Bacteria 1239
435 Ga0213875_10000918 3300021388 Bacteria 21317
436 Ga0213875_10146050 3300021388 Bacteria 1108
437 Ga0224572_1002050 3300024225 Bacteria 3172
438 Ga0207666_1000534 3300025271 Bacteria 4641
439 Ga0207666_1001132 3300025271 Bacteria 3153
440 Ga0207673_1000597 3300025290 Bacteria 3841
441 Ga0209676_1000105 3300025292 Bacteria 224151
442 Ga0209758_1001548 3300025297 Bacteria 26409
443 Ga0209758_1001765 3300025297 Bacteria 23988
444 Ga0209050_1001283 3300025298 Bacteria 28639
445 Ga0209051_1000064 3300025303 Bacteria 231735
446 Ga0209257_1000109 3300025304 Bacteria 239439
447 Ga0207697_10002026 3300025315 Bacteria 10716
448 Ga0207697_10003146 3300025315 Bacteria 8232
449 Ga0207656_10020871 3300025321 Bacteria 2609
450 Ga0207655_1055096 3300025728 Bacteria 1576
451 Ga0207653_10002185 3300025885 Bacteria 6229
452 Ga0207653_10002726 3300025885 Bacteria 5622
453 Ga0207682_10000009 3300025893 Bacteria 86366
454 Ga0207682_10003948 3300025893 Bacteria 6320
455 Ga0207692_10010088 3300025898 Bacteria 3967
456 Ga0207642_10007417 3300025899 Bacteria 3705
457 Ga0207642_10010905 3300025899 Bacteria 3223
458 Ga0207710_10001303 3300025900 Bacteria 12616
459 Ga0207688_10000892 3300025901 Bacteria 15087
460 Ga0207688_10110652 3300025901 Bacteria 1594
461 Ga0207688_10132250 3300025901 Bacteria 1463
462 Ga0207680_10004104 3300025903 Bacteria 6890
463 Ga0207680_10025243 3300025903 Bacteria 3276
464 Ga0207647_10002160 3300025904 Bacteria 15015
465 Ga0207685_10031650 3300025905 Bacteria 1896
466 Ga0207685_10055893 3300025905 Bacteria 1542
467 Ga0207699_10037062 3300025906 Bacteria 2785
468 Ga0207645_10000999 3300025907 Bacteria 23365
469 Ga0207645_10035204 3300025907 Bacteria 3215
470 Ga0207643_10001172 3300025908 Bacteria 15576
471 Ga0207643_10028428 3300025908 Bacteria 3105
472 Ga0207705_10076146 3300025909 Bacteria 2439
473 Ga0207705_10114279 3300025909 Bacteria 1997
474 Ga0207684_10019788 3300025910 Bacteria 5757
475 Ga0207654_10015486 3300025911 Bacteria 3958
476 Ga0207654_10156190 3300025911 Bacteria 1469
477 Ga0207707_10006761 3300025912 Bacteria 10013
478 Ga0207707_10045583 3300025912 Bacteria 3821
479 Ga0207707_10163271 3300025912 Bacteria 1947
480 Ga0207707_10247057 3300025912 Bacteria 1550
481 Ga0207707_10386783 3300025912 Bacteria 1202
482 Ga0207707_10448620 3300025912 Bacteria 1104
483 Ga0207695_10154802 3300025913 Bacteria 2228
484 Ga0207695_10170648 3300025913 Bacteria 2101
485 Ga0207671_10070082 3300025914 Bacteria 2613
486 Ga0207671_10113096 3300025914 Bacteria 2068
487 Ga0207693_10002396 3300025915 Bacteria 16268
488 Ga0207693_10007042 3300025915 Bacteria 9281
489 Ga0207693_10012580 3300025915 Bacteria 6835
490 Ga0207693_10024070 3300025915 Bacteria 4834
491 Ga0207693_10128480 3300025915 Bacteria 1992
492 Ga0207693_10192406 3300025915 Bacteria 1605
493 Ga0207663_10194477 3300025916 Bacteria 1459
494 Ga0207663_10266655 3300025916 Bacteria 1267
495 Ga0207660_10001283 3300025917 Bacteria 16867
496 Ga0207660_10096292 3300025917 Bacteria 2203
497 Ga0207662_10000025 3300025918 Bacteria 70078
498 Ga0207662_10007904 3300025918 Bacteria 5793
499 Ga0207662_10043635 3300025918 Bacteria 2645
500 Ga0207657_10010579 3300025919 Bacteria 9200
501 Ga0207657_10086122 3300025919 Bacteria 2630
502 Ga0207657_10146148 3300025919 Bacteria 1928
503 Ga0207657_10320484 3300025919 Bacteria 1226
504 Ga0207649_10006638 3300025920 Bacteria 6288
505 Ga0207649_10115293 3300025920 Bacteria 1802
506 Ga0207649_10176922 3300025920 Bacteria 1491
507 Ga0207652_10006125 3300025921 Bacteria 9727
508 Ga0207652_10059120 3300025921 Bacteria 3304
509 Ga0207652_10069453 3300025921 Bacteria 3058
510 Ga0207652_10103214 3300025921 Bacteria 2521
511 Ga0207652_10264514 3300025921 Bacteria 1551
512 Ga0207652_10371714 3300025921 Bacteria 1290
513 Ga0207652_10506786 3300025921 Bacteria 1086
514 Ga0207646_10051439 3300025922 Bacteria 3686
515 Ga0207681_10002039 3300025923 Bacteria 12958
516 Ga0207681_10012199 3300025923 Bacteria 5298
517 Ga0207694_10037333 3300025924 Bacteria 3731
518 Ga0207694_10353411 3300025924 Bacteria 1217
519 Ga0207650_10074985 3300025925 Bacteria 2552
520 Ga0207650_10237350 3300025925 Bacteria 1472
521 Ga0207659_10014716 3300025926 Bacteria 5053
522 Ga0207687_10003202 3300025927 Bacteria 11093
523 Ga0207687_10011809 3300025927 Bacteria 5714
524 Ga0207687_10255936 3300025927 Bacteria 1394
525 Ga0207700_10064877 3300025928 Bacteria 2784
526 Ga0207700_10155337 3300025928 Bacteria 1895
527 Ga0207644_10003326 3300025931 Bacteria 10373
528 Ga0207644_10009497 3300025931 Bacteria 6389
529 Ga0207644_10025426 3300025931 Bacteria 4072
530 Ga0207644_10190507 3300025931 Bacteria 1612
531 Ga0207690_10007239 3300025932 Bacteria 6589
532 Ga0207690_10264505 3300025932 Bacteria 1334
533 Ga0207706_10005363 3300025933 Bacteria 11952
534 Ga0207706_10007588 3300025933 Bacteria 10034
535 Ga0207706_10015532 3300025933 Bacteria 6879
536 Ga0207706_10016523 3300025933 Bacteria 6661
537 Ga0207706_10063677 3300025933 Bacteria 3246
538 Ga0207706_10107599 3300025933 Bacteria 2454
539 Ga0207686_10020623 3300025934 Bacteria 3768
540 Ga0207709_10002970 3300025935 Bacteria 10336
541 Ga0207709_10020213 3300025935 Bacteria 3753
542 Ga0207709_10027140 3300025935 Bacteria 3296
543 Ga0207709_10037377 3300025935 Bacteria 2885
544 Ga0207670_10003489 3300025936 Bacteria 8346
545 Ga0207670_10048850 3300025936 Bacteria 2826
546 Ga0207670_10082490 3300025936 Bacteria 2253
547 Ga0207670_10209815 3300025936 Bacteria 1485
548 Ga0207670_10391355 3300025936 Bacteria 1109
549 Ga0207669_10001324 3300025937 Bacteria 10540
550 Ga0207669_10022747 3300025937 Bacteria 3335
551 Ga0207669_10046762 3300025937 Bacteria 2559
552 Ga0207669_10082786 3300025937 Bacteria 2061
553 Ga0207669_10094727 3300025937 Bacteria 1955
554 Ga0207669_10187070 3300025937 Bacteria 1490
555 Ga0207669_10222069 3300025937 Bacteria 1387
556 Ga0207704_10000130 3300025938 Bacteria 41287
557 Ga0207704_10122991 3300025938 Bacteria 1780
558 Ga0207704_10184642 3300025938 Bacteria 1510
559 Ga0207665_10002113 3300025939 Bacteria 13436
560 Ga0207665_10024373 3300025939 Bacteria 3989
561 Ga0207665_10417650 3300025939 Bacteria 1024
562 Ga0207691_10001422 3300025940 Bacteria 23867
563 Ga0207691_10002604 3300025940 Bacteria 17616
564 Ga0207691_10103504 3300025940 Bacteria 2539
565 Ga0207691_10175920 3300025940 Bacteria 1872
566 Ga0207691_10386682 3300025940 Bacteria 1194
567 Ga0207711_10001071 3300025941 Bacteria 26139
568 Ga0207711_10012903 3300025941 Bacteria 6939
569 Ga0207711_10019431 3300025941 Bacteria 5657
570 Ga0207711_10081889 3300025941 Bacteria 2821
571 Ga0207711_10100479 3300025941 Bacteria 2558
572 Ga0207689_10001156 3300025942 Bacteria 25400
573 Ga0207689_10066148 3300025942 Bacteria 2973
574 Ga0207689_10254733 3300025942 Bacteria 1452
575 Ga0207661_10028696 3300025944 Bacteria 4264
576 Ga0207661_10186261 3300025944 Bacteria 1817
577 Ga0207661_10237224 3300025944 Bacteria 1617
578 Ga0207661_10415447 3300025944 Bacteria 1221
579 Ga0207661_10429362 3300025944 Bacteria 1201
580 Ga0207679_10003209 3300025945 Bacteria 10084
581 Ga0207679_10390710 3300025945 Bacteria 1222
582 Ga0207667_10028359 3300025949 Bacteria 6081
583 Ga0207667_10089076 3300025949 Bacteria 3190
584 Ga0207667_10272091 3300025949 Bacteria 1731
585 Ga0207667_10436413 3300025949 Bacteria 1332
586 Ga0207651_10010192 3300025960 Bacteria 5194
587 Ga0207651_10212060 3300025960 Bacteria 1560
588 Ga0207712_10000579 3300025961 Bacteria 29666
589 Ga0207712_10007061 3300025961 Bacteria 7084
590 Ga0207712_10020831 3300025961 Bacteria 4300
591 Ga0207668_10000815 3300025972 Bacteria 19101
592 Ga0207668_10003465 3300025972 Bacteria 9258
593 Ga0207668_10108641 3300025972 Bacteria 2076
594 Ga0207668_10203378 3300025972 Bacteria 1579
595 Ga0207640_10122108 3300025981 Bacteria 1868
596 Ga0207658_10002475 3300025986 Bacteria 13483
597 Ga0207658_10003151 3300025986 Bacteria 11783
598 Ga0207658_10015729 3300025986 Bacteria 5194
599 Ga0207658_10124397 3300025986 Bacteria 2061
600 Ga0207677_10011181 3300026023 Bacteria 5106
601 Ga0207677_10252437 3300026023 Bacteria 1433
602 Ga0207703_10010308 3300026035 Bacteria 7318
603 Ga0207703_10033374 3300026035 Bacteria 4080
604 Ga0207639_10001866 3300026041 Bacteria 14170
605 Ga0207639_10159860 3300026041 Bacteria 1897
606 Ga0207639_10383618 3300026041 Bacteria 1262
607 Ga0207678_10008348 3300026067 Bacteria 9133
608 Ga0207678_10008633 3300026067 Bacteria 8980
609 Ga0207678_10046782 3300026067 Bacteria 3742
610 Ga0207708_10000402 3300026075 Bacteria 34168
611 Ga0207708_10002738 3300026075 Bacteria 12941
612 Ga0207708_10055684 3300026075 Bacteria 3015
613 Ga0207708_10147325 3300026075 Bacteria 1851
614 Ga0207708_10437374 3300026075 Bacteria 1087
615 Ga0207702_10046199 3300026078 Bacteria 3665
616 Ga0207702_10091417 3300026078 Bacteria 2665
617 Ga0207641_10014704 3300026088 Bacteria 6417
618 Ga0207641_10072572 3300026088 Bacteria 2964
619 Ga0207641_10087180 3300026088 Bacteria 2723
620 Ga0207641_10095692 3300026088 Bacteria 2607
621 Ga0207648_10001500 3300026089 Bacteria 25704
622 Ga0207648_10004627 3300026089 Bacteria 14090
623 Ga0207676_10017931 3300026095 Bacteria 5136
624 Ga0207676_10071930 3300026095 Bacteria 2778
625 Ga0207676_10101902 3300026095 Bacteria 2381
626 Ga0207676_10137857 3300026095 Bacteria 2084
627 Ga0207674_10007131 3300026116 Bacteria 13059
628 Ga0207674_10021894 3300026116 Bacteria 6877
629 Ga0207674_10043375 3300026116 Bacteria 4638
630 Ga0207675_100002311 3300026118 Bacteria 18934
631 Ga0207675_100003859 3300026118 Bacteria 14570
632 Ga0207675_100019447 3300026118 Bacteria 6336
633 Ga0207675_100051796 3300026118 Bacteria 3831
634 Ga0207683_10000850 3300026121 Bacteria 28050
635 Ga0207683_10010051 3300026121 Bacteria 8075
636 Ga0207683_10062694 3300026121 Bacteria 3274
637 Ga0207683_10096310 3300026121 Bacteria 2639
638 Ga0207683_10208074 3300026121 Bacteria 1780
639 Ga0207683_10211505 3300026121 Bacteria 1765
640 Ga0207698_10005963 3300026142 Bacteria 7570
641 Ga0207698_10052400 3300026142 Bacteria 3126
642 Ga0207698_10344543 3300026142 Bacteria 1405
643 Ga0209995_1009515 3300027471 Bacteria 1572
644 Ga0210002_1000490 3300027617 Bacteria 5383
645 Ga0209971_1023345 3300027682 Bacteria 1475
646 Ga0209966_1003846 3300027695 Bacteria 2533
647 Ga0209998_10000759 3300027717 Bacteria 8436
648 Ga0209998_10001051 3300027717 Bacteria 6935
649 Ga0209974_10039214 3300027876 Bacteria 1575
650 Ga0207428_10000164 3300027907 Bacteria 91968
651 Ga0207428_10000391 3300027907 Bacteria 54825
652 Ga0207428_10001108 3300027907 Bacteria 29314
653 Ga0207428_10008433 3300027907 Bacteria 9303
654 Ga0207428_10024777 3300027907 Bacteria 5036
655 Ga0268266_10002016 3300028379 Bacteria 22644
656 Ga0268266_10127443 3300028379 Bacteria 2273
657 Ga0268265_10003240 3300028380 Bacteria 11822
658 Ga0268265_10042298 3300028380 Bacteria 3379
659 Ga0268265_10265390 3300028380 Bacteria 1529
660 Ga0268264_10020827 3300028381 Bacteria 5359
661 Ga0268264_10061652 3300028381 Bacteria 3147
662 Ga0268264_10061975 3300028381 Bacteria 3139
663 Ga0268264_10128256 3300028381 Bacteria 2245
664 Ga0268264_10144215 3300028381 Bacteria 2127
665 Ga0268264_10151718 3300028381 Bacteria 2078
666 Ga0268264_10167044 3300028381 Bacteria 1987
667 Ga0265337_1000284 3300028556 Bacteria 27492
668 Ga0307515_10248642 3300028794 Bacteria 1535
669 Ga0265338_10005223 3300028800 Bacteria 17029
670 Ga0265330_10027948 3300031235 Bacteria 2545
671 Ga0265330_10102093 3300031235 Bacteria 1227
672 Ga0265332_10000508 3300031238 Bacteria 26654
673 Ga0265332_10026267 3300031238 Bacteria 2554
674 Ga0265332_10073934 3300031238 Bacteria 1450
675 Ga0265325_10000019 3300031241 Bacteria 125265
676 Ga0265325_10001329 3300031241 Bacteria 17514
677 Ga0265325_10003017 3300031241 Bacteria 11157
678 Ga0265325_10004090 3300031241 Bacteria 9294
679 Ga0265325_10025995 3300031241 Bacteria 3175
680 Ga0265325_10034256 3300031241 Bacteria 2703
681 Ga0265325_10063293 3300031241 Bacteria 1872
682 Ga0265325_10067790 3300031241 Bacteria 1797
683 Ga0265340_10009669 3300031247 Bacteria 5168
684 Ga0265340_10024385 3300031247 Bacteria 3073
685 Ga0265340_10024647 3300031247 Bacteria 3053
686 Ga0265340_10037227 3300031247 Bacteria 2411
687 Ga0265339_10000096 3300031249 Bacteria 74964
688 Ga0265339_10001912 3300031249 Bacteria 15282
689 Ga0265339_10006450 3300031249 Bacteria 7694
690 Ga0265339_10008869 3300031249 Bacteria 6368
691 Ga0265339_10015052 3300031249 Bacteria 4648
692 Ga0265331_10042725 3300031250 Bacteria 2198
693 Ga0265327_10000177 3300031251 Bacteria 136559
694 Ga0265313_10000024 3300031595 Bacteria 138587
695 Ga0265313_10004465 3300031595 Bacteria 10721
696 Ga0265313_10006000 3300031595 Bacteria 8776
697 Ga0265313_10025519 3300031595 Bacteria 3129
698 Ga0265313_10028957 3300031595 Bacteria 2871
699 Ga0265313_10047499 3300031595 Bacteria 2077
700 Ga0265313_10100613 3300031595 Bacteria 1284
701 Ga0265314_10001355 3300031711 Bacteria 27657
702 Ga0265342_10000573 3300031712 Bacteria 38852
703 Ga0265342_10001257 3300031712 Bacteria 23945
704 Ga0307516_10054650 3300031730 Bacteria 3901
705 Ga0307407_10177306 3300031903 Bacteria 1409
706 Ga0307414_10063480 3300032004 Bacteria 2625
707 Ga0307415_100147752 3300032126 Bacteria 1805
708 Ga0316583_10001118 3300032133 Bacteria 8745
709 Ga0373930_0000713 3300034816 Bacteria 4686
710 Ga0373948_0000426 3300034817 Bacteria 5204
711 Ga0373948_0001212 3300034817 Bacteria 3513
712 Ga0373950_0004976 3300034818 Bacteria 1968
713 Ga0373958_0000992 3300034819 Bacteria 3699
714 Ga0373958_0005970 3300034819 Bacteria 1876
715 Ga0373959_0000111 3300034820 Bacteria 18330
716 Ga0373938_0000386 3300034957 Bacteria 7080
717 Ga0373938_0000527 3300034957 Bacteria 6207
718 Ga0373938_0004135 3300034957 Bacteria 2406
719 Ga0373926_0000388 3300035083 Bacteria 11245
720 Ga0373926_0012315 3300035083 Bacteria 2889
721 Ga0373928_0000045 3300035084 Bacteria 21176
722 Ga0373929_0000214 3300035085 Bacteria 10508
723 Ga0373934_0073810 3300035086 Bacteria 1366
724 Ga0373940_0003391 3300035088 Bacteria 3249
725 Ga0373940_0008685 3300035088 Bacteria 2341
726 Ga0373940_0016914 3300035088 Bacteria 1812
727 Ga0373944_0000734 3300035089 Bacteria 7963
728 Ga0373944_0013920 3300035089 Bacteria 2238
729 Ga0373944_0019891 3300035089 Bacteria 1930
730 Ga0373949_0002131 3300035090 Bacteria 5202
731 Ga0373949_0002981 3300035090 Bacteria 4164
732 Ga0373951_0000335 3300035091 Bacteria 14582
733 Ga0373951_0005629 3300035091 Bacteria 2901
734 Ga0373951_0013871 3300035091 Bacteria 1812
735 Ga0373952_0000179 3300035092 Bacteria 9804
736 Ga0373952_0004378 3300035092 Bacteria 2562
737 Ga0373923_0000978 3300035111 Bacteria 7693
738 Ga0373932_0000271 3300035112 Bacteria 15633
739 Ga0373932_0002322 3300035112 Bacteria 4835
740 Ga0373932_0023548 3300035112 Bacteria 1648
741 Ga0373936_0001860 3300035113 Bacteria 7784
742 Ga0373936_0011435 3300035113 Bacteria 3358
743 Ga0373936_0036477 3300035113 Bacteria 1961
744 Ga0373939_0008122 3300035114 Bacteria 2567
745 Ga0373939_0011931 3300035114 Bacteria 2205
746 Ga0373941_0000241 3300035115 Bacteria 10507
747 Ga0373941_0033442 3300035115 Bacteria 1545
748 Ga0373945_0016965 3300035116 Bacteria 2463
749 Ga0373945_0018406 3300035116 Bacteria 2376
750 Ga0373945_0028858 3300035116 Bacteria 1946
751 Ga0373953_0009196 3300035117 Bacteria 3387
752 Ga0373954_0000707 3300035118 Bacteria 12831
753 Ga0373954_0025763 3300035118 Bacteria 2692
754 Ga0373954_0045424 3300035118 Bacteria 2052
755 Ga0373954_0077547 3300035118 Bacteria 1585
756 Ga0373956_0023428 3300035119 Bacteria 2650
757 Ga0373956_0029934 3300035119 Bacteria 2377
758 Ga0373957_0002977 3300035120 Bacteria 4915
759 Ga0373957_0036321 3300035120 Bacteria 1835
760 Ga0373957_0047844 3300035120 Bacteria 1628
761 Ga0373960_0003102 3300035121 Bacteria 3752
762 Ga0373960_0024562 3300035121 Bacteria 1631
763 Ga0373943_0000233 3300035170 Bacteria 22738
764 Ga0373943_0000997 3300035170 Bacteria 12584
765 Ga0373943_0007851 3300035170 Bacteria 4791
766 Ga0373943_0047269 3300035170 Bacteria 2103
767 Ga0373946_0007488 3300035171 Bacteria 3991
768 Ga0373946_0011741 3300035171 Bacteria 3274
769 Ga0373946_0026501 3300035171 Bacteria 2287
770 Ga0373955_0001092 3300035172 Bacteria 11522
771 Ga0373955_0002224 3300035172 Bacteria 8418
772 Ga0373955_0005439 3300035172 Bacteria 5722
773 Ga0373955_0014964 3300035172 Bacteria 3788
774 Ga0373942_0008878 3300035207 Bacteria 2347
775 Ga0373961_0000592 3300035241 Bacteria 13503
776 Ga0373961_0003081 3300035241 Bacteria 4192
777 Ga0373961_0005827 3300035241 Bacteria 2960
778 Ga0373961_0011637 3300035241 Bacteria 2186
779 Ga0373962_0000848 3300035242 Bacteria 6984
780 Ga0373962_0002023 3300035242 Bacteria 4831
781 Ga0373962_0020380 3300035242 Bacteria 1741
782 Ga0373924_0070650 3300035410 Bacteria 1472
783 Ga0373924_0145353 3300035410 Bacteria 1036
784 Ga0373931_0001210 3300035691 Bacteria 11038
785 Ga0373931_0003979 3300035691 Bacteria 6696
786 Ga0373931_0004155 3300035691 Bacteria 6578
787 Ga0373931_0004514 3300035691 Bacteria 6366
788 Ga0373931_0018978 3300035691 Bacteria 3426
789 Ga0373931_0174512 3300035691 Bacteria 1269
790 Ga0373931_0275359 3300035691 Bacteria 1032
791 Ga0373935_0000377 3300035692 Bacteria 22883
792 Ga0373935_0001455 3300035692 Bacteria 13125
793 Ga0373935_0003956 3300035692 Bacteria 8651
794 Ga0373935_0084931 3300035692 Bacteria 2062
795 Ga0373935_0188072 3300035692 Bacteria 1421
796 Ga0373927_0000113 3300035695 Bacteria 60608
797 Ga0373927_0013803 3300035695 Bacteria 5362
798 Ga0373927_0017901 3300035695 Bacteria 4660
799 Ga0373927_0021648 3300035695 Bacteria 4214
800 Ga0373927_0035757 3300035695 Bacteria 3230
801 Ga0373927_0041852 3300035695 Bacteria 2970
802 Ga0373927_0060060 3300035695 Bacteria 2459
803 Ga0373927_0067856 3300035695 Bacteria 2307
804 Ga0373927_0080694 3300035695 Bacteria 2108
805 Ga0373933_0000258 3300035724 Bacteria 34845
806 Ga0373933_0010567 3300035724 Bacteria 5062
807 Ga0373933_0017191 3300035724 Bacteria 4055
808 Ga0373933_0034562 3300035724 Bacteria 2946
809 Ga0373933_0043589 3300035724 Bacteria 2655
810 Ga0373933_0129767 3300035724 Bacteria 1584
811 Ga0373947_0000168 3300035725 Bacteria 35315
812 Ga0373947_0000280 3300035725 Bacteria 28900
813 Ga0373947_0012523 3300035725 Bacteria 4865
814 Ga0373947_0013179 3300035725 Bacteria 4738
815 Ga0373947_0019089 3300035725 Bacteria 3951
816 Ga0373947_0020590 3300035725 Bacteria 3809
817 Ga0373937_0000814 3300036401 Bacteria 26684
818 Ga0373937_0001849 3300036401 Bacteria 17776
819 Ga0373937_0005769 3300036401 Bacteria 10643
820 Ga0373937_0008814 3300036401 Bacteria 8750
821 Ga0373937_0011708 3300036401 Bacteria 7693
822 Ga0373937_0017925 3300036401 Bacteria 6315
823 Ga0373937_0059689 3300036401 Bacteria 3505
824 Ga0373937_0191559 3300036401 Bacteria 1921
825 Ga0373925_0000075 3300037068 Bacteria 105395
826 Ga0373925_0001434 3300037068 Bacteria 20657
827 Ga0373925_0003256 3300037068 Bacteria 12656
828 Ga0373925_0013932 3300037068 Bacteria 5820
829 Ga0373925_0115233 3300037068 Bacteria 2081
830 Ga0373925_0136762 3300037068 Bacteria 1915
831 Ga0373925_0198248 3300037068 Bacteria 1596
832 Ga0373925_0313423 3300037068 Bacteria 1268
833 Ga0395899_0005270 3300037312 Bacteria 10041
834 Ga0395899_0083216 3300037312 Bacteria 2327
835 Ga0395900_0004997 3300037418 Bacteria 13928
836 Ga0395900_0334631 3300037418 Bacteria 1491
837 Ga0395898_0005343 3300037466 Bacteria 13890
838 Ga0395898_0109287 3300037466 Bacteria 2651
839 Ga0395898_0211384 3300037466 Bacteria 1850
840 Ga0395898_0252358 3300037466 Bacteria 1682
841 Ga0436364_0266645 3300037853 Bacteria 19395
842 Ga0436364_0611324 3300037853 Bacteria 1556
843 Ga0436364_1284638 3300037853 Bacteria 5477
844 Ga0395901_0009254 3300038443 Bacteria 9986
845 Ga0395901_0114297 3300038443 Bacteria 2835
846 Ga0242420_010110 3300038996 Bacteria 1561
847 Ga0436365_0117548 3300039437 Bacteria 62327
848 Ga0436365_0321935 3300039437 Bacteria 1084
849 Ga0436365_0448461 3300039437 Bacteria 3249
850 Ga0436365_0692136 3300039437 Bacteria 2988
851 Ga0436365_0827365 3300039437 Bacteria 2583
852 Ga0436365_1485216 3300039437 Bacteria 1943
853 Ga0436365_1545760 3300039437 Bacteria 2496
854 Ga0436361_0569994 3300039447 Bacteria 6230
855 Ga0436361_0679413 3300039447 Bacteria 1247
856 Ga0436361_1044250 3300039447 Bacteria 1373
857 Ga0436363_0519487 3300039450 Bacteria 1050
858 Ga0436363_1624569 3300039450 Bacteria 5180
859 Ga0436363_1706863 3300039450 Bacteria 1125
860 Ga0439453_0021580 3300041408 Bacteria 1162
861 Ga0451853_2607190 3300041512 Bacteria 1136
862 Ga0451853_3173075 3300041512 Bacteria 1259
863 Ga0439441_006469 3300042001 Bacteria 1860
864 Ga0439443_005645 3300042003 Bacteria 1681
865 Ga0439450_002586 3300042008 Bacteria 2870
866 Ga0466963_0002455 3300044694 Bacteria 10366
867 Ga0466963_0059496 3300044694 Bacteria 2550
868 Ga0466968_0009361 3300044735 Bacteria 3766
869 Ga0466957_0012658 3300044842 Bacteria 4887
870 Ga0466959_0045768 3300045049 Bacteria 3222
871 Ga0451576_0006479 3300045051 Bacteria 14344
872 Ga0466967_0006697 3300045976 Bacteria 8194
873 Ga0466967_0104801 3300045976 Bacteria 2590
874 Ga0466967_0180663 3300045976 Bacteria 1990
875 Ga0495592_0000060 3300046454 Bacteria 100113
876 Ga0495592_0003878 3300046454 Bacteria 10821
877 Ga0495592_0026131 3300046454 Bacteria 4430
878 Ga0495592_0051488 3300046454 Bacteria 3058
879 Ga0495592_0052855 3300046454 Bacteria 3014
880 Ga0495603_0004025 3300046455 Bacteria 8751
881 Ga0495603_0023263 3300046455 Bacteria 3751
882 Ga0495629_0000118 3300046459 Bacteria 70632
883 Ga0495629_0000139 3300046459 Bacteria 63649
884 Ga0495629_0027523 3300046459 Bacteria 4037
885 Ga0495629_0115745 3300046459 Bacteria 1868
886 Ga0495629_0117691 3300046459 Bacteria 1851
887 Ga0495629_0139108 3300046459 Bacteria 1690
888 Ga0495629_0145651 3300046459 Bacteria 1647
889 Ga0495629_0159256 3300046459 Bacteria 1568
890 Ga0495638_0043216 3300046460 Bacteria 2844
891 Ga0495641_0026615 3300046461 Bacteria 2820
892 Ga0495651_0000181 3300046462 Bacteria 46803
893 Ga0495651_0001419 3300046462 Bacteria 18593
894 Ga0495651_0004794 3300046462 Bacteria 10354
895 Ga0495651_0084089 3300046462 Bacteria 2398
896 Ga0495651_0086259 3300046462 Bacteria 2362
897 Ga0495653_0000141 3300046463 Bacteria 60033
898 Ga0495653_0006362 3300046463 Bacteria 9690
899 Ga0495653_0067003 3300046463 Bacteria 2698
900 Ga0495580_0005444 3300046472 Bacteria 10519
901 Ga0495580_0018852 3300046472 Bacteria 5133
902 Ga0495580_0047339 3300046472 Bacteria 3048
903 Ga0495580_0126130 3300046472 Bacteria 1776
904 Ga0495582_0037925 3300046473 Bacteria 2651
905 Ga0495582_0042876 3300046473 Bacteria 2491
906 Ga0495582_0044124 3300046473 Bacteria 2456
907 Ga0495582_0244600 3300046473 Bacteria 1028
908 Ga0495605_0065887 3300046474 Bacteria 1722
909 Ga0495639_0005719 3300046475 Bacteria 5349
910 Ga0495639_0037816 3300046475 Bacteria 2165
911 Ga0495639_0055354 3300046475 Bacteria 1809
912 Ga0495662_0000223 3300046476 Bacteria 23829
913 Ga0495662_0001139 3300046476 Bacteria 13118
914 Ga0495662_0028741 3300046476 Bacteria 2684
915 Ga0495664_0000003 3300046477 Bacteria 551602
916 Ga0495664_0000800 3300046477 Bacteria 16088
917 Ga0495664_0017877 3300046477 Bacteria 4054
918 Ga0495664_0076038 3300046477 Bacteria 2009
919 Ga0495664_0132456 3300046477 Bacteria 1510
920 Ga0495584_0039361 3300046491 Bacteria 2388
921 Ga0495585_0001030 3300046492 Bacteria 23180
922 Ga0495594_0002129 3300046499 Bacteria 10306
923 Ga0495594_0015379 3300046499 Bacteria 4019
924 Ga0495594_0026453 3300046499 Bacteria 3121
925 Ga0495607_0006002 3300046501 Bacteria 8613
926 Ga0495607_0187944 3300046501 Bacteria 1031
927 Ga0495606_0020594 3300046507 Bacteria 4855
928 Ga0495606_0034704 3300046507 Bacteria 3459
929 Ga0495608_0000011 3300046511 Bacteria 248514
930 Ga0495608_0000398 3300046511 Bacteria 30359
931 Ga0495608_0000911 3300046511 Bacteria 20725
932 Ga0495608_0030340 3300046511 Bacteria 3661
933 Ga0495608_0036267 3300046511 Bacteria 3320
934 Ga0495608_0061262 3300046511 Bacteria 2475
935 Ga0495608_0120492 3300046511 Bacteria 1683
936 Ga0495618_0000044 3300046514 Bacteria 95526
937 Ga0495618_0017292 3300046514 Bacteria 4419
938 Ga0495618_0019414 3300046514 Bacteria 4181
939 Ga0495618_0028428 3300046514 Bacteria 3484
940 Ga0495618_0067596 3300046514 Bacteria 2272
941 Ga0495618_0069530 3300046514 Bacteria 2238
942 Ga0495618_0126539 3300046514 Bacteria 1636
943 Ga0495628_0000001 3300046516 Bacteria 917742
944 Ga0495628_0005139 3300046516 Bacteria 11502
945 Ga0495628_0006666 3300046516 Bacteria 10072
946 Ga0495628_0024922 3300046516 Bacteria 4892
947 Ga0495628_0258755 3300046516 Bacteria 1298
948 Ga0495630_0000574 3300046517 Bacteria 26824
949 Ga0495630_0011656 3300046517 Bacteria 6370
950 Ga0495630_0047151 3300046517 Bacteria 3222
951 Ga0495630_0070201 3300046517 Bacteria 2635
952 Ga0495630_0100159 3300046517 Bacteria 2192
953 Ga0495630_0200181 3300046517 Bacteria 1524
954 Ga0495637_0054463 3300046520 Bacteria 1662
955 Ga0495644_0000513 3300046523 Bacteria 16576
956 Ga0495648_0004446 3300046524 Bacteria 11977
957 Ga0495663_0053960 3300046525 Bacteria 1250
958 Ga0495666_0002030 3300046526 Bacteria 10010
959 Ga0495666_0009646 3300046526 Bacteria 4827
960 Ga0495652_0000002 3300046529 Bacteria 946606
961 Ga0495652_0014420 3300046529 Bacteria 7096
962 Ga0495652_0016128 3300046529 Bacteria 6683
963 Ga0495652_0016289 3300046529 Bacteria 6649
964 Ga0495652_0032084 3300046529 Bacteria 4595
965 Ga0495652_0081927 3300046529 Bacteria 2661
966 Ga0495652_0134264 3300046529 Bacteria 1955
967 Ga0495652_0136862 3300046529 Bacteria 1931
968 Ga0495665_0003032 3300046531 Bacteria 9074
969 Ga0495665_0004686 3300046531 Bacteria 7373
970 Ga0495665_0028599 3300046531 Bacteria 2988
971 Ga0495665_0032349 3300046531 Bacteria 2798
972 Ga0495665_0041588 3300046531 Bacteria 2447
973 Ga0495665_0056169 3300046531 Bacteria 2078
974 Ga0495665_0074346 3300046531 Bacteria 1789
975 Ga0495640_0000002 3300046533 Bacteria 646434
976 Ga0495640_0000544 3300046533 Bacteria 27687
977 Ga0495640_0015185 3300046533 Bacteria 5801
978 Ga0495640_0108952 3300046533 Bacteria 1811
979 Ga0495640_0141892 3300046533 Bacteria 1548
980 Ga0495586_0037924 3300046535 Bacteria 2587
981 Ga0495587_0000001 3300046536 Bacteria 724132
982 Ga0495587_0000599 3300046536 Bacteria 24689
983 Ga0495587_0002174 3300046536 Bacteria 13130
984 Ga0495587_0003798 3300046536 Bacteria 10023
985 Ga0495587_0015799 3300046536 Bacteria 4706
986 Ga0495587_0048234 3300046536 Bacteria 2522
987 Ga0495587_0100622 3300046536 Bacteria 1666
988 Ga0495621_0006662 3300046539 Bacteria 3383
989 Ga0495645_0000002 3300046543 Bacteria 651644
990 Ga0495645_0008747 3300046543 Bacteria 7070
991 Ga0495645_0016750 3300046543 Bacteria 5243
992 Ga0495645_0026193 3300046543 Bacteria 4232
993 Ga0495645_0072642 3300046543 Bacteria 2479
994 Ga0495633_0004113 3300046558 Bacteria 9379
995 Ga0495633_0134210 3300046558 Bacteria 1145
996 Ga0495667_0000039 3300046559 Bacteria 131308
997 Ga0495667_0008770 3300046559 Bacteria 6874
998 Ga0495667_0023899 3300046559 Bacteria 4116
999 Ga0495667_0047251 3300046559 Bacteria 2844
1000 Ga0495667_0056128 3300046559 Bacteria 2590
1001 Ga0495656_0000091 3300046615 Bacteria 38995
1002 Ga0495656_0046837 3300046615 Bacteria 1831
1003 Ga0495634_0000010 3300046642 Bacteria 143792
1004 Ga0495634_0023758 3300046642 Bacteria 4306
1005 Ga0495634_0126332 3300046642 Bacteria 1634
1006 Ga0495634_0182707 3300046642 Bacteria 1312
1007 Ga0495625_0000012 3300046660 Bacteria 363006
1008 Ga0495635_0000001 3300046663 Bacteria 704901
1009 Ga0495635_0004203 3300046663 Bacteria 9986
1010 Ga0495635_0006281 3300046663 Bacteria 8276
1011 Ga0495635_0018687 3300046663 Bacteria 4834
1012 Ga0495659_0059779 3300046664 Bacteria 1405
1013 Ga0495588_0010028 3300046674 Bacteria 4391
1014 Ga0495588_0033132 3300046674 Bacteria 2608
1015 Ga0495588_0041177 3300046674 Bacteria 2358
1016 Ga0495657_0000042 3300046675 Bacteria 114669
1017 Ga0495657_0001942 3300046675 Bacteria 17644
1018 Ga0495657_0031508 3300046675 Bacteria 3706
1019 Ga0495657_0107094 3300046675 Bacteria 1774
1020 Ga0495599_0000013 3300046678 Bacteria 179828
1021 Ga0495599_0008880 3300046678 Bacteria 6119
1022 Ga0495599_0042108 3300046678 Bacteria 2866
1023 Ga0495623_0000050 3300046679 Bacteria 72959
1024 Ga0495623_0006342 3300046679 Bacteria 7687
1025 Ga0495623_0028043 3300046679 Bacteria 3625
1026 Ga0495623_0035033 3300046679 Bacteria 3217
1027 Ga0495623_0088991 3300046679 Bacteria 1899
1028 Ga0495646_0000009 3300046680 Bacteria 200698
1029 Ga0495646_0021007 3300046680 Bacteria 4127
1030 Ga0495646_0090311 3300046680 Bacteria 1770
1031 Ga0495646_0096072 3300046680 Bacteria 1704
1032 Ga0495647_0013620 3300046681 Bacteria 2821
1033 Ga0495647_0057352 3300046681 Bacteria 1529
1034 Ga0495658_0000065 3300046683 Bacteria 52835
1035 Ga0495658_0003665 3300046683 Bacteria 7602
1036 Ga0495658_0086163 3300046683 Bacteria 1852
1037 Ga0495669_0038062 3300046684 Bacteria 2130
1038 Ga0495613_0006292 3300046689 Bacteria 8882
1039 Ga0495613_0009544 3300046689 Bacteria 7205
1040 Ga0495624_0001118 3300046690 Bacteria 21215
1041 Ga0495624_0001463 3300046690 Bacteria 18374
1042 Ga0495624_0011107 3300046690 Bacteria 6196
1043 Ga0495624_0062489 3300046690 Bacteria 2329
1044 Ga0495624_0082189 3300046690 Bacteria 1994
1045 Ga0495670_0000506 3300046691 Bacteria 18484
1046 Ga0495671_0068569 3300046692 Bacteria 1744
1047 Ga0495671_0101024 3300046692 Bacteria 1410
1048 Ga0495649_0095725 3300046694 Bacteria 1580
1049 Ga0495600_0001478 3300046809 Bacteria 13016
1050 Ga0495600_0008371 3300046809 Bacteria 6351
1051 Ga0495600_0016518 3300046809 Bacteria 4686
1052 Ga0495600_0038130 3300046809 Bacteria 3126
1053 Ga0495600_0141975 3300046809 Bacteria 1558
1054 Ga0495660_0100064 3300046810 Bacteria 1494
1055 Ga0495581_0002630 3300047315 Bacteria 10219
1056 Ga0495581_0007122 3300047315 Bacteria 6478
1057 Ga0495581_0008727 3300047315 Bacteria 5870
1058 Ga0495581_0036712 3300047315 Bacteria 2835
1059 Ga0495581_0044466 3300047315 Bacteria 2568
1060 Ga0495581_0073821 3300047315 Bacteria 1974
1061 Ga0495581_0084489 3300047315 Bacteria 1839
1062 Ga0495604_0000069 3300047317 Bacteria 89935
1063 Ga0495604_0014602 3300047317 Bacteria 6259
1064 Ga0495604_0029121 3300047317 Bacteria 4394
1065 Ga0495604_0073607 3300047317 Bacteria 2578
1066 Ga0495604_0183139 3300047317 Bacteria 1464
1067 Ga0495674_0000002 3300047319 Bacteria 642785
1068 Ga0495674_0002892 3300047319 Bacteria 16713
1069 Ga0495674_0033064 3300047319 Bacteria 4687
1070 Ga0495674_0036782 3300047319 Bacteria 4403
1071 Ga0495674_0066059 3300047319 Bacteria 3140
1072 Ga0495674_0100049 3300047319 Bacteria 2468
1073 Ga0495674_0126427 3300047319 Bacteria 2156
1074 Ga0495674_0243184 3300047319 Bacteria 1482
1075 Ga0495672_0011413 3300047320 Bacteria 6273
1076 Ga0495672_0033677 3300047320 Bacteria 3173
1077 Ga0495676_0015401 3300047321 Bacteria 6811
1078 Ga0495676_0046916 3300047321 Bacteria 3501
1079 Ga0495680_0000313 3300047322 Bacteria 54486
1080 Ga0495680_0000328 3300047322 Bacteria 53287
1081 Ga0495680_0009069 3300047322 Bacteria 8981
1082 Ga0495680_0014330 3300047322 Bacteria 6872
1083 Ga0495680_0025994 3300047322 Bacteria 4835
1084 Ga0495680_0026513 3300047322 Bacteria 4775
1085 Ga0495680_0049430 3300047322 Bacteria 3293
1086 Ga0495680_0069978 3300047322 Bacteria 2676
1087 Ga0495680_0179285 3300047322 Bacteria 1530
1088 Ga0495675_0000245 3300047444 Bacteria 39142
1089 Ga0495677_0094565 3300047445 Bacteria 1128
1090 Ga0495679_027413 3300047446 Bacteria 1879
1091 Ga0495679_033413 3300047446 Bacteria 1644
1092 Ga0495673_0075718 3300047469 Bacteria 1405
1093 Ga0495684_0000016 3300047471 Bacteria 169338
1094 Ga0495684_0000928 3300047471 Bacteria 23791
1095 Ga0495684_0001073 3300047471 Bacteria 22129
1096 Ga0495684_0001824 3300047471 Bacteria 17119
1097 Ga0495684_0056185 3300047471 Bacteria 3001
1098 Ga0495684_0175543 3300047471 Bacteria 1591
1099 Ga0495684_0364734 3300047471 Bacteria 1022
1100 Ga0495686_0001995 3300047472 Bacteria 20251
1101 Ga0495593_0000809 3300047673 Bacteria 18103
1102 Ga0495593_0001500 3300047673 Bacteria 13713
1103 Ga0495593_0004700 3300047673 Bacteria 8121
1104 Ga0495593_0033052 3300047673 Bacteria 2818
1105 Ga0495593_0061049 3300047673 Bacteria 1972
1106 Ga0495593_0082694 3300047673 Bacteria 1659
1107 Ga0495602_0000024 3300048088 Bacteria 151162
1108 Ga0495602_0005919 3300048088 Bacteria 12839
1109 Ga0495602_0021956 3300048088 Bacteria 6260
1110 Ga0495614_0003207 3300048089 Bacteria 7303
1111 Ga0496100_0002405 3300048903 Bacteria 9481
1112 Ga0496100_0003039 3300048903 Bacteria 8659
1113 Ga0496100_0016920 3300048903 Bacteria 4291
1114 Ga0496100_0050540 3300048903 Bacteria 2694
1115 Ga0496100_0200898 3300048903 Bacteria 1453
1116 Ga0496100_0384940 3300048903 Bacteria 1066
1117 Ga0496101_0001763 3300048904 Bacteria 12984
1118 Ga0496101_0003783 3300048904 Bacteria 9451
1119 Ga0496101_0015757 3300048904 Bacteria 5102
1120 Ga0496101_0044395 3300048904 Bacteria 3180
1121 Ga0496101_0060405 3300048904 Bacteria 2750
1122 Ga0496101_0134347 3300048904 Bacteria 1881
1123 Ga0496101_0178331 3300048904 Bacteria 1635
1124 Ga0496101_0235241 3300048904 Bacteria 1425
1125 Ga0496101_0321250 3300048904 Bacteria 1214
1126 Ga0496101_0413151 3300048904 Bacteria 1063
1127 Ga0496102_0001184 3300048905 Bacteria 23693
1128 Ga0496102_0005532 3300048905 Bacteria 10730
1129 Ga0496102_0011515 3300048905 Bacteria 7628
1130 Ga0496102_0112166 3300048905 Bacteria 2543
1131 Ga0496102_0129686 3300048905 Bacteria 2359
1132 Ga0496103_0003142 3300048906 Bacteria 10157
1133 Ga0496103_0005741 3300048906 Bacteria 7414
1134 Ga0496103_0009796 3300048906 Bacteria 5674
1135 Ga0496103_0010831 3300048906 Bacteria 5397
1136 Ga0496103_0022961 3300048906 Bacteria 3760
1137 Ga0496103_0051842 3300048906 Bacteria 2540
1138 Ga0496104_0000217 3300048907 Bacteria 50667
1139 Ga0496104_0001112 3300048907 Bacteria 22984
1140 Ga0496104_0001920 3300048907 Bacteria 18014
1141 Ga0496104_0002202 3300048907 Bacteria 16864
1142 Ga0496104_0010108 3300048907 Bacteria 8424
1143 Ga0496104_0041321 3300048907 Bacteria 4324
1144 Ga0496104_0043848 3300048907 Bacteria 4201
1145 Ga0496104_0107613 3300048907 Bacteria 2672
1146 Ga0496104_0111996 3300048907 Bacteria 2617
1147 Ga0496104_0140324 3300048907 Bacteria 2321
1148 Ga0496104_0292062 3300048907 Bacteria 1543
1149 Ga0496105_0000424 3300048908 Bacteria 27799
1150 Ga0496105_0008853 3300048908 Bacteria 7842
1151 Ga0496105_0010753 3300048908 Bacteria 7205
1152 Ga0496105_0020488 3300048908 Bacteria 5344
1153 Ga0496105_0066987 3300048908 Bacteria 2965
1154 Ga0496105_0090307 3300048908 Bacteria 2530
1155 Ga0496105_0250926 3300048908 Bacteria 1433
1156 Ga0496106_0001028 3300048909 Bacteria 20530
1157 Ga0496106_0005882 3300048909 Bacteria 9068
1158 Ga0496106_0007383 3300048909 Bacteria 8123
1159 Ga0496106_0008421 3300048909 Bacteria 7629
1160 Ga0496106_0017304 3300048909 Bacteria 5336
1161 Ga0496106_0026339 3300048909 Bacteria 4329
1162 Ga0496106_0026733 3300048909 Bacteria 4297
1163 Ga0496106_0253802 3300048909 Bacteria 1406
1164 Ga0496107_0000509 3300048910 Bacteria 21565
1165 Ga0496107_0003427 3300048910 Bacteria 10601
1166 Ga0496107_0014192 3300048910 Bacteria 5578
1167 Ga0496107_0019213 3300048910 Bacteria 4821
1168 Ga0496107_0040165 3300048910 Bacteria 3357
1169 Ga0496107_0099576 3300048910 Bacteria 2130
1170 Ga0496107_0222569 3300048910 Bacteria 1404
1171 Ga0496107_0229736 3300048910 Bacteria 1380
1172 Ga0496107_0371454 3300048910 Bacteria 1064
1173 Ga0496108_0010986 3300048911 Bacteria 7354
1174 Ga0496108_0012311 3300048911 Bacteria 6958
1175 Ga0496108_0062932 3300048911 Bacteria 3124
1176 Ga0496108_0080066 3300048911 Bacteria 2766
1177 Ga0496108_0154080 3300048911 Bacteria 1984
1178 Ga0496108_0253034 3300048911 Bacteria 1532
1179 Ga0496108_0319159 3300048911 Bacteria 1354
1180 Ga0496109_0001304 3300048912 Bacteria 20607
1181 Ga0496109_0006308 3300048912 Bacteria 9983
1182 Ga0496109_0013194 3300048912 Bacteria 7151
1183 Ga0496109_0016348 3300048912 Bacteria 6484
1184 Ga0496109_0017528 3300048912 Bacteria 6278
1185 Ga0496109_0066202 3300048912 Bacteria 3307
1186 Ga0496109_0119756 3300048912 Bacteria 2451
1187 Ga0496109_0122629 3300048912 Bacteria 2421
1188 Ga0496110_0000973 3300048913 Bacteria 20082
1189 Ga0496110_0002430 3300048913 Bacteria 13955
1190 Ga0496110_0003313 3300048913 Bacteria 12303
1191 Ga0496110_0005366 3300048913 Bacteria 10043
1192 Ga0496110_0009961 3300048913 Bacteria 7709
1193 Ga0496110_0014024 3300048913 Bacteria 6642
1194 Ga0496110_0034472 3300048913 Bacteria 4384
1195 Ga0496110_0045595 3300048913 Bacteria 3833
1196 Ga0496110_0075530 3300048913 Bacteria 2994
1197 Ga0496110_0097096 3300048913 Bacteria 2640
1198 Ga0496110_0098571 3300048913 Bacteria 2619
1199 Ga0496110_0111838 3300048913 Bacteria 2455
1200 Ga0496110_0127002 3300048913 Bacteria 2301
1201 Ga0496110_0218297 3300048913 Bacteria 1734
1202 Ga0496111_0000315 3300048914 Bacteria 23917
1203 Ga0496111_0002323 3300048914 Bacteria 11453
1204 Ga0496111_0003314 3300048914 Bacteria 9963
1205 Ga0496111_0003533 3300048914 Bacteria 9672
1206 Ga0496111_0011769 3300048914 Bacteria 5906
1207 Ga0496111_0042567 3300048914 Bacteria 3261
1208 Ga0496111_0044287 3300048914 Bacteria 3199
1209 Ga0496111_0047206 3300048914 Bacteria 3101
1210 Ga0496111_0055762 3300048914 Bacteria 2858
1211 Ga0496111_0063460 3300048914 Bacteria 2679
1212 Ga0496111_0063536 3300048914 Bacteria 2677
1213 Ga0496111_0103789 3300048914 Bacteria 2091
1214 Ga0496112_0009043 3300048915 Bacteria 8947
1215 Ga0496112_0013631 3300048915 Bacteria 7511
1216 Ga0496112_0015062 3300048915 Bacteria 7200
1217 Ga0496112_0022357 3300048915 Bacteria 6026
1218 Ga0496112_0054415 3300048915 Bacteria 3932
1219 Ga0496112_0090794 3300048915 Bacteria 3023
1220 Ga0496112_0090957 3300048915 Bacteria 3020
1221 Ga0496112_0121718 3300048915 Bacteria 2579
1222 Ga0496113_0000218 3300048916 Bacteria 26800
1223 Ga0496113_0008621 3300048916 Bacteria 6650
1224 Ga0496113_0011117 3300048916 Bacteria 5989
1225 Ga0496113_0014177 3300048916 Bacteria 5429
1226 Ga0496113_0026670 3300048916 Bacteria 4134
1227 Ga0496113_0055008 3300048916 Bacteria 2982
1228 Ga0496113_0126245 3300048916 Bacteria 2004
1229 Ga0496114_0001306 3300048917 Bacteria 18867
1230 Ga0496114_0011259 3300048917 Bacteria 7142
1231 Ga0496114_0014735 3300048917 Bacteria 6283
1232 Ga0496114_0044883 3300048917 Bacteria 3669
1233 Ga0496114_0076917 3300048917 Bacteria 2813
1234 Ga0496114_0077791 3300048917 Bacteria 2797
1235 Ga0496114_0098426 3300048917 Bacteria 2494
1236 Ga0496114_0210099 3300048917 Bacteria 1707
1237 Ga0496115_0011530 3300048918 Bacteria 6627
1238 Ga0496115_0014069 3300048918 Bacteria 6057
1239 Ga0496115_0039477 3300048918 Bacteria 3749
1240 Ga0496115_0042694 3300048918 Bacteria 3613
1241 Ga0496115_0047308 3300048918 Bacteria 3439
1242 Ga0496115_0063814 3300048918 Bacteria 2972
1243 Ga0496115_0104992 3300048918 Bacteria 2318
1244 Ga0496115_0245420 3300048918 Bacteria 1475
1245 Ga0496115_0271854 3300048918 Bacteria 1392
1246 Ga0496118_0029210 3300048921 Bacteria 4628
1247 Ga0496119_0002669 3300048922 Bacteria 19295
1248 Ga0496121_0007863 3300048924 Bacteria 12751
1249 Ga0496121_0013732 3300048924 Bacteria 8677
1250 Ga0496121_0039594 3300048924 Bacteria 4149
1251 Ga0496122_0002391 3300048925 Bacteria 26802
1252 Ga0496123_0003029 3300048926 Bacteria 19369
1253 Ga0496126_0263095 3300048929 Bacteria 1434
1254 Ga0501032_0289553 3300049569 Bacteria 1060
1255 Ga0501033_0010955 3300049570 Bacteria 6950
1256 Ga0501033_0060740 3300049570 Bacteria 2787
1257 Ga0501033_0077246 3300049570 Bacteria 2443
1258 Ga0501033_0223876 3300049570 Bacteria 1338
1259 Ga0501034_0000593 3300049571 Bacteria 57233
1260 Ga0501034_0003588 3300049571 Bacteria 17615
1261 Ga0501034_0074896 3300049571 Bacteria 3392
1262 Ga0501034_0098547 3300049571 Bacteria 2918
1263 Ga0501034_0116919 3300049571 Bacteria 2654
1264 Ga0501034_0508197 3300049571 Bacteria 1118
1265 Ga0501036_0001313 3300049572 Bacteria 19069
1266 Ga0501036_0042140 3300049572 Bacteria 3865
1267 Ga0501036_0081419 3300049572 Bacteria 2736
1268 Ga0501036_0126272 3300049572 Bacteria 2160
1269 Ga0501036_0178315 3300049572 Bacteria 1789
1270 Ga0501036_0263095 3300049572 Bacteria 1445
1271 Ga0501037_0016752 3300049573 Bacteria 5392
1272 Ga0501037_0021673 3300049573 Bacteria 4751
1273 Ga0501037_0046626 3300049573 Bacteria 3178
1274 Ga0501037_0098724 3300049573 Bacteria 2109
1275 Ga0501038_0007428 3300049574 Bacteria 10112
1276 Ga0501038_0063407 3300049574 Bacteria 3154
1277 Ga0501038_0076825 3300049574 Bacteria 2821
1278 Ga0501038_0264128 3300049574 Bacteria 1359
1279 Ga0501038_0303510 3300049574 Bacteria 1252
1280 Ga0501039_0022541 3300049575 Bacteria 4834
1281 Ga0501039_0069025 3300049575 Bacteria 2744
1282 Ga0501039_0084247 3300049575 Bacteria 2476
1283 Ga0501039_0130674 3300049575 Bacteria 1971
1284 Ga0501039_0314428 3300049575 Bacteria 1231
1285 Ga0501040_0032088 3300049576 Bacteria 3553
1286 Ga0501040_0222102 3300049576 Bacteria 1344
1287 Ga0501041_0058110 3300049577 Bacteria 2366
1288 Ga0501041_0094593 3300049577 Bacteria 1846
1289 Ga0501042_0114506 3300049578 Bacteria 1942
1290 Ga0501042_0195303 3300049578 Bacteria 1459
1291 Ga0501043_0032193 3300049579 Bacteria 4121
1292 Ga0501043_0063574 3300049579 Bacteria 2898
1293 Ga0501043_0083864 3300049579 Bacteria 2505
1294 Ga0501043_0102847 3300049579 Bacteria 2245
1295 Ga0501046_0002900 3300049580 Bacteria 15897
1296 Ga0501046_0005890 3300049580 Bacteria 10927
1297 Ga0501046_0127900 3300049580 Bacteria 1928
1298 Ga0501046_0247967 3300049580 Bacteria 1312
1299 Ga0501047_0001425 3300049581 Bacteria 23479
1300 Ga0501047_0022734 3300049581 Bacteria 6021
1301 Ga0501047_0048449 3300049581 Bacteria 4103
1302 Ga0501047_0097901 3300049581 Bacteria 2811
1303 Ga0501047_0126688 3300049581 Bacteria 2434
1304 Ga0501047_0128295 3300049581 Bacteria 2416
1305 Ga0501047_0131968 3300049581 Bacteria 2378
1306 Ga0501048_0001752 3300049582 Bacteria 16493
1307 Ga0501048_0015643 3300049582 Bacteria 5599
1308 Ga0501048_0047698 3300049582 Bacteria 3056
1309 Ga0501048_0073887 3300049582 Bacteria 2406
1310 Ga0501048_0193556 3300049582 Bacteria 1441
1311 Ga0501048_0281688 3300049582 Bacteria 1182
1312 Ga0501067_0023420 3300049583 Bacteria 3422
1313 Ga0501069_0003119 3300049585 Bacteria 8495
1314 Ga0501070_0020547 3300049586 Bacteria 5538
1315 Ga0501070_0056637 3300049586 Bacteria 3249
1316 Ga0501070_0094072 3300049586 Bacteria 2479
1317 Ga0501070_0114437 3300049586 Bacteria 2228
1318 Ga0501070_0141509 3300049586 Bacteria 1986
1319 Ga0501070_0166139 3300049586 Bacteria 1819
1320 Ga0501071_0050928 3300049587 Bacteria 2983
1321 Ga0501071_0143544 3300049587 Bacteria 1779
1322 Ga0501071_0222903 3300049587 Bacteria 1419
1323 Ga0501072_0040845 3300049588 Bacteria 3643
1324 Ga0501072_0074044 3300049588 Bacteria 2693
1325 Ga0501072_0088508 3300049588 Bacteria 2457
1326 Ga0501072_0111280 3300049588 Bacteria 2180
1327 Ga0501073_0060235 3300049589 Bacteria 2649
1328 Ga0501073_0063745 3300049589 Bacteria 2570
1329 Ga0501074_0003293 3300049590 Bacteria 11426
1330 Ga0501074_0053538 3300049590 Bacteria 2910
1331 Ga0501074_0085454 3300049590 Bacteria 2261
1332 Ga0501075_0135541 3300049591 Bacteria 1876
1333 Ga0501075_0207424 3300049591 Bacteria 1495
1334 Ga0501075_0351370 3300049591 Bacteria 1123
1335 Ga0501076_0050078 3300049592 Bacteria 3304
1336 Ga0501076_0091065 3300049592 Bacteria 2453
1337 Ga0501076_0124978 3300049592 Bacteria 2084
1338 Ga0501076_0308837 3300049592 Bacteria 1297
1339 Ga0501077_0019666 3300049593 Bacteria 4271
1340 Ga0501077_0085097 3300049593 Bacteria 2004
1341 Ga0501077_0090493 3300049593 Bacteria 1939
1342 Ga0501079_0005101 3300049741 Bacteria 9754
1343 Ga0501079_0066375 3300049741 Bacteria 2784
1344 Ga0501079_0085626 3300049741 Bacteria 2439
1345 Ga0501079_0219527 3300049741 Bacteria 1485
1346 Ga0501079_0402719 3300049741 Bacteria 1073
1347 Ga0501079_0578200 3300049741 Bacteria 884
1348 Ga0501080_0002905 3300049742 Bacteria 15074
1349 Ga0501080_0007783 3300049742 Bacteria 9688
1350 Ga0501080_0015270 3300049742 Bacteria 7079
1351 Ga0501080_0025023 3300049742 Bacteria 5538
1352 Ga0501080_0027138 3300049742 Bacteria 5325
1353 Ga0501080_0081094 3300049742 Bacteria 3015
1354 Ga0501080_0092084 3300049742 Bacteria 2816
1355 Ga0501080_0303916 3300049742 Bacteria 1446
1356 Ga0501081_0000115 3300049743 Bacteria 34620
1357 Ga0501081_0041663 3300049743 Bacteria 3145
1358 Ga0501081_0065915 3300049743 Bacteria 2518
1359 Ga0501083_0000907 3300049744 Bacteria 19630
1360 Ga0501083_0051915 3300049744 Bacteria 2756
1361 Ga0501083_0066550 3300049744 Bacteria 2399
1362 Ga0501083_0137240 3300049744 Bacteria 1602
1363 Ga0501035_0000672 3300049822 Bacteria 37408
1364 Ga0501035_0129635 3300049822 Bacteria 2199
1365 Ga0501035_0140538 3300049822 Bacteria 2100
1366 Ga0501035_0222623 3300049822 Bacteria 1610
1367 Ga0501035_0385350 3300049822 Bacteria 1168
1368 Ga0501044_0003604 3300049823 Bacteria 17424
1369 Ga0501044_0005514 3300049823 Bacteria 14047
1370 Ga0501044_0011063 3300049823 Bacteria 9787
1371 Ga0501044_0036817 3300049823 Bacteria 5118
1372 Ga0501044_0312533 3300049823 Bacteria 1497
1373 Ga0501045_0036085 3300049824 Bacteria 3590
1374 Ga0501045_0069102 3300049824 Bacteria 2596
1375 nmdc:mga03683_111459_c1 3300050489 Bacteria 1210
1376 nmdc:mga03683_2647_c2 3300050489 Bacteria 3463
1377 nmdc:mga0yw44_103397_c1 3300050492 Bacteria 1817
1378 nmdc:mga0yw44_78820_c1 3300050492 Bacteria 2060
1379 nmdc:mga0k408_17687_c1 3300050493 Bacteria 3503
1380 nmdc:mga0k408_6014_c1 3300050493 Bacteria 6474
1381 nmdc:mga06z11_68606_c1 3300050494 Bacteria 1869
1382 nmdc:mga07m45_14790_c1 3300050496 Bacteria 4166
1383 nmdc:mga07m45_69058_c1 3300050496 Bacteria 2009
1384 nmdc:mga05p37_151_c1 3300050507 Bacteria 65585
1385 nmdc:mga05p37_158006_c1 3300050507 Bacteria 2770
1386 nmdc:mga05p37_19658_c1 3300050507 Bacteria 8171
1387 nmdc:mga05p37_205256_c1 3300050507 Bacteria 2384
1388 nmdc:mga05p37_354005_c1 3300050507 Bacteria 1728
1389 nmdc:mga05p37_486326_c1 3300050507 Bacteria 1420
1390 nmdc:mga05p37_7272_c1 3300050507 Bacteria 13063
1391 nmdc:mga05p37_76_c1 3300050507 Bacteria 86726
1392 nmdc:mga05p37_835274_c1 3300050507 Bacteria 1003
1393 nmdc:mga09592_41035_c1 3300050508 Bacteria 3890
1394 nmdc:mga09592_6099_c1 3300050508 Bacteria 9821
1395 nmdc:mga0qj67_61979_c1 3300050509 Bacteria 2971
1396 nmdc:mga0qj67_842_c1 3300050509 Bacteria 21012
1397 nmdc:mga06r32_114164_c1 3300050510 Bacteria 2659
1398 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
1399 nmdc:mga06r32_41813_c1 3300050510 Bacteria 4356
1400 nmdc:mga06r32_755_c1 3300050510 Bacteria 28474
1401 nmdc:mga06r32_95862_c1 3300050510 Bacteria 2904
1402 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
1403 nmdc:mga08y16_11999_c1 3300050511 Bacteria 9100
1404 nmdc:mga08y16_13020_c1 3300050511 Bacteria 8754
1405 nmdc:mga08y16_16965_c1 3300050511 Bacteria 7667
1406 nmdc:mga08y16_178114_c1 3300050511 Bacteria 2208
1407 nmdc:mga08y16_204344_c1 3300050511 Bacteria 2047
1408 nmdc:mga08y16_294692_c1 3300050511 Bacteria 1672
1409 nmdc:mga08y16_376567_c1 3300050511 Bacteria 1455
1410 nmdc:mga08y16_4279_c1 3300050511 Bacteria 14901
1411 nmdc:mga08y16_5583_c1 3300050511 Bacteria 13179
1412 nmdc:mga08y16_88424_c1 3300050511 Bacteria 3229
1413 nmdc:mga0n895_265_c1 3300050512 Bacteria 34107
1414 nmdc:mga0n895_2675_c1 3300050512 Bacteria 14060
1415 nmdc:mga0n895_2995_c1 3300050512 Bacteria 13410
1416 nmdc:mga0n895_30642_c1 3300050512 Bacteria 5143
1417 nmdc:mga0n895_35580_c1 3300050512 Bacteria 4802
1418 nmdc:mga0n895_363615_c1 3300050512 Bacteria 1465
1419 nmdc:mga0rr50_362627_c1 3300050513 Bacteria 1220
1420 nmdc:mga0rr50_60567_c1 3300050513 Bacteria 2848
1421 nmdc:mga0rr50_642_c1 3300050513 Bacteria 18790
1422 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
1423 nmdc:mga08x19_8004_c1 3300050514 Bacteria 6281
1424 nmdc:mga0a205_1049_c1 3300050515 Bacteria 23004
1425 nmdc:mga0a205_146_c1 3300050515 Bacteria 45616
1426 nmdc:mga0a205_315959_c1 3300050515 Bacteria 1433
1427 nmdc:mga0a205_464753_c1 3300050515 Bacteria 1125
1428 Ga0495601_0000001 3300053077 Bacteria 549454
1429 Ga0495601_0000355 3300053077 Bacteria 24059
1430 Ga0495601_0000589 3300053077 Bacteria 19331
1431 Ga0495601_0002218 3300053077 Bacteria 10937
1432 Ga0495601_0027567 3300053077 Bacteria 3512
1433 Ga0495601_0041071 3300053077 Bacteria 2899
1434 Ga0495601_0052633 3300053077 Bacteria 2571
1435 Ga0495601_0174202 3300053077 Bacteria 1406
1436 Ga0495612_0000017 3300053078 Bacteria 152112
1437 Ga0495612_0001305 3300053078 Bacteria 10290
1438 Ga0495612_0002281 3300053078 Bacteria 7892
1439 Ga0495612_0002637 3300053078 Bacteria 7395
1440 Ga0495612_0005030 3300053078 Bacteria 5474
1441 Ga0495612_0030943 3300053078 Bacteria 2157
1442 Ga0495595_0000010 3300053084 Bacteria 178819
1443 Ga0495595_0002470 3300053084 Bacteria 7231
1444 Ga0495595_0005994 3300053084 Bacteria 4935
1445 Ga0495595_0010133 3300053084 Bacteria 3913
1446 Ga0495595_0010381 3300053084 Bacteria 3869
1447 Ga0495595_0027953 3300053084 Bacteria 2515
1448 Ga0495619_0000004 3300053085 Bacteria 500068
1449 Ga0495619_0000048 3300053085 Bacteria 102117
1450 Ga0495619_0000256 3300053085 Bacteria 38697
1451 Ga0495619_0004051 3300053085 Bacteria 9387
1452 Ga0495619_0005443 3300053085 Bacteria 8068
1453 Ga0495619_0007179 3300053085 Bacteria 7058
1454 Ga0495619_0016131 3300053085 Bacteria 4728
1455 Ga0495619_0024473 3300053085 Bacteria 3872
1456 Ga0495619_0027188 3300053085 Bacteria 3685
1457 Ga0495619_0108884 3300053085 Bacteria 1891
1458 Ga0495619_0131097 3300053085 Bacteria 1723
1459 Ga0500644_0000933 3300053088 Bacteria 9264
1460 Ga0500651_0037963 3300053093 Bacteria 3035
1461 Ga0500651_0102768 3300053093 Bacteria 1751
1462 Ga0500641_0019072 3300053096 Bacteria 2590
1463 Ga0500650_0044577 3300053098 Bacteria 2053
1464 Ga0500555_016514 3300053103 Bacteria 2127
1465 Ga0500556_0000068 3300053104 Bacteria 103123
1466 Ga0500595_000003 3300053119 Bacteria 419332
1467 Ga0500595_003914 3300053119 Bacteria 6824
1468 Ga0500595_026787 3300053119 Bacteria 1982
1469 Ga0500652_001172 3300053131 Bacteria 8365
1470 Ga0500652_039202 3300053131 Bacteria 1899
1471 Ga0500652_068971 3300053131 Bacteria 1463
1472 Ga0500616_0000002 3300053153 Bacteria 1611257
1473 Ga0500616_0004397 3300053153 Bacteria 10067
1474 Ga0500616_0034790 3300053153 Bacteria 2743
1475 Ga0500616_0089834 3300053153 Bacteria 1524
1476 Ga0500622_0138552 3300053156 Bacteria 1163
1477 Ga0500645_000078 3300053730 Bacteria 76931
1478 Ga0500645_008422 3300053730 Bacteria 3523
1479 Ga0501084_0009668 3300054114 Bacteria 7977
1480 Ga0501084_0034716 3300054114 Bacteria 4217
1481 Ga0501084_0128439 3300054114 Bacteria 2133
1482 Ga0501084_0287667 3300054114 Bacteria 1388
1483 Ga0501084_0307775 3300054114 Bacteria 1338
1484 Ga0501084_0332364 3300054114 Bacteria 1283
1485 Ga0501082_0000510 3300060353 Bacteria 34491
1486 Ga0501082_0030402 3300060353 Bacteria 4654
1487 Ga0501082_0038034 3300060353 Bacteria 4150
1488 Ga0501082_0051708 3300060353 Bacteria 3541
1489 Ga0501082_0063448 3300060353 Bacteria 3181
1490 Ga0501082_0095928 3300060353 Bacteria 2563
1491 Ga0501082_0429790 3300060353 Bacteria 1153
1492 Ga0530510_0037742 3300061734 Bacteria 3486
1493 Ga0530510_0114950 3300061734 Bacteria 1972
1494 Ga0530510_0262622 3300061734 Bacteria 1288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0578200 Ga0501079_0578200_11_841 276
2 3300045976 Ga0466967_0180663 Ga0466967_0180663_835_1740 299
3 iso_pu_bacteria 2919713450 2919717988 301
4 iso_pu_bacteria 2523231044 2523382649 302
5 3300005435 Ga0070714_100015917 Ga0070714_1000159175 305
6 3300053153 Ga0500616_0034790 Ga0500616_0034790_585_1568 305
7 3300031251 Ga0265327_10000177 Ga0265327_10000177126 306
8 3300046531 Ga0495665_0028599 Ga0495665_0028599_1871_2797 306
9 3300047315 Ga0495581_0044466 Ga0495581_0044466_515_1441 306
10 3300005456 Ga0070678_100213473 Ga0070678_1002134732 308
11 3300005548 Ga0070665_100004170 Ga0070665_1000041709 308
12 3300025972 Ga0207668_10000815 Ga0207668_1000081520 308
13 3300046507 Ga0495606_0034704 Ga0495606_0034704_1119_2111 308
14 3300021384 Ga0213876_10032997 Ga0213876_100329972 309
15 3300039437 Ga0436365_0448461 Ga0436365_0448461_1569_2555 309
16 iso_pu_bacteria 2513237093 2513635471 310
17 iso_pu_bacteria 2513237161 2514014860 310
18 iso_pu_bacteria 2515154112 2515628579 310
19 iso_pu_bacteria 2524023210 2524465008 310
20 iso_pu_bacteria 2534681796 2535520930 310
21 iso_pu_bacteria 2643221651 2644291236 310
22 iso_pu_bacteria 2838680041 2838685997 310
23 iso_pu_bacteria 2838686498 2838687808 310
24 iso_pu_bacteria 2838694306 2838699640 310
25 iso_pu_bacteria 2838707686 2838713059 310
26 iso_pu_bacteria 2842077413 2842082555 310
27 iso_pu_bacteria 2842118031 2842123309 310
28 iso_pu_bacteria 2842237096 2842242245 310
29 iso_pu_bacteria 2842271015 2842272161 310
30 iso_pu_bacteria 2842291075 2842296311 310
31 iso_pu_bacteria 2842370503 2842375260 310
32 iso_pu_bacteria 2842377471 2842382863 310
33 iso_pu_bacteria 2842384541 2842389422 310
34 iso_pu_bacteria 2844454524 2844462284 310
35 iso_pu_bacteria 2874590934 2874594804 310
36 iso_pu_bacteria 2876771140 2876774354 310
37 iso_pu_bacteria 2876818435 2876822856 310
38 iso_pu_bacteria 2879074833 2879078509 310
39 iso_pu_bacteria 2879127579 2879129830 310
40 iso_pu_bacteria 2879142872 2879146155 310
41 iso_pu_bacteria 2935894831 2935899207 310
42 iso_pu_bacteria 639633055 639651250 310
43 iso_pu_bacteria 8005542996 8005549870 310
44 iso_pu_bacteria 8056681323 8056681937 310
45 3300009094 Ga0111539_10047916 Ga0111539_100479163 311
46 3300050511 nmdc:mga08y16_11999_c1 nmdc:mga08y16_11999_c1_5455_6390 311
47 3300005440 Ga0070705_100347503 Ga0070705_1003475031 312
48 iso_pu_bacteria 2919450847 2919453271 313
49 iso_pu_bacteria 8001845381 8001847189 313
50 3300000549 LJQas_1002035 LJQas_10020352 314
51 3300005339 Ga0070660_100075994 Ga0070660_1000759942 314
52 3300005530 Ga0070679_100299686 Ga0070679_1002996861 314
53 3300021384 Ga0213876_10000603 Ga0213876_1000060319 314
54 3300025297 Ga0209758_1001548 Ga0209758_100154819 314
55 3300025939 Ga0207665_10417650 Ga0207665_104176501 314
56 3300039437 Ga0436365_0117548 Ga0436365_0117548_13689_14639 314
57 3300044842 Ga0466957_0012658 Ga0466957_0012658_3781_4731 314
58 3300046507 Ga0495606_0020594 Ga0495606_0020594_3075_4025 314
59 3300048921 Ga0496118_0029210 Ga0496118_0029210_28_978 314
60 3300048924 Ga0496121_0007863 Ga0496121_0007863_347_1297 314
61 3300048924 Ga0496121_0013732 Ga0496121_0013732_5868_6818 314
62 3300048929 Ga0496126_0263095 Ga0496126_0263095_252_1202 314
63 3300049574 Ga0501038_0076825 Ga0501038_0076825_248_1198 314
64 3300049581 Ga0501047_0022734 Ga0501047_0022734_3350_4300 314
65 3300049586 Ga0501070_0166139 Ga0501070_0166139_504_1454 314
66 3300049822 Ga0501035_0140538 Ga0501035_0140538_828_1778 314
67 3300053098 Ga0500650_0044577 Ga0500650_0044577_776_1726 314
68 3300053119 Ga0500595_003914 Ga0500595_003914_2223_3173 314
69 3300053156 Ga0500622_0138552 Ga0500622_0138552_62_1012 314
70 3300003911 JGI25405J52794_10006055 JGI25405J52794_100060553 315
71 3300005330 Ga0070690_100177059 Ga0070690_1001770591 315
72 3300005341 Ga0070691_10044926 Ga0070691_100449261 315
73 3300005406 Ga0070703_10004958 Ga0070703_100049583 315
74 3300005438 Ga0070701_10108305 Ga0070701_101083051 315
75 3300005440 Ga0070705_100000528 Ga0070705_1000005286 315
76 3300005441 Ga0070700_100024158 Ga0070700_1000241582 315
77 3300005444 Ga0070694_100011702 Ga0070694_1000117022 315
78 3300005445 Ga0070708_100001688 Ga0070708_10000168818 315
79 3300005455 Ga0070663_100009202 Ga0070663_1000092023 315
80 3300005458 Ga0070681_10040914 Ga0070681_100409141 315
81 3300005467 Ga0070706_100104467 Ga0070706_1001044672 315
82 3300005518 Ga0070699_100000147 Ga0070699_10000014767 315
83 3300005530 Ga0070679_100072533 Ga0070679_1000725332 315
84 3300005536 Ga0070697_100023710 Ga0070697_1000237107 315
85 3300005545 Ga0070695_100002809 Ga0070695_1000028097 315
86 3300005545 Ga0070695_100264948 Ga0070695_1002649481 315
87 3300005546 Ga0070696_100002859 Ga0070696_10000285910 315
88 3300005547 Ga0070693_100025730 Ga0070693_1000257303 315
89 3300005617 Ga0068859_100008928 Ga0068859_1000089287 315
90 3300005618 Ga0068864_100175221 Ga0068864_1001752213 315
91 3300005719 Ga0068861_100038636 Ga0068861_1000386364 315
92 3300005719 Ga0068861_100119494 Ga0068861_1001194942 315
93 3300005843 Ga0068860_100003101 Ga0068860_10000310119 315
94 3300005844 Ga0068862_100001380 Ga0068862_10000138022 315
95 3300005937 Ga0081455_10000096 Ga0081455_1000009618 315
96 3300005983 Ga0081540_1000158 Ga0081540_100015817 315
97 3300006844 Ga0075428_100153837 Ga0075428_1001538372 315
98 3300006847 Ga0075431_100074190 Ga0075431_1000741903 315
99 3300006852 Ga0075433_10028663 Ga0075433_100286632 315
100 3300006852 Ga0075433_10136920 Ga0075433_101369201 315
101 3300006871 Ga0075434_100006226 Ga0075434_10000622612 315
102 3300006871 Ga0075434_100018385 Ga0075434_1000183854 315
103 3300006880 Ga0075429_100137894 Ga0075429_1001378942 315
104 3300006931 Ga0097620_100008928 Ga0097620_1000089287 315
105 3300007076 Ga0075435_100024791 Ga0075435_1000247913 315
106 3300009094 Ga0111539_10018474 Ga0111539_100184748 315
107 3300009094 Ga0111539_10146602 Ga0111539_101466021 315
108 3300009147 Ga0114129_10225242 Ga0114129_102252424 315
109 3300010375 Ga0105239_10277133 Ga0105239_102771332 315
110 3300011119 Ga0105246_10016137 Ga0105246_100161373 315
111 3300013308 Ga0157375_10092850 Ga0157375_100928502 315
112 3300017792 Ga0163161_10076015 Ga0163161_100760152 315
113 3300025885 Ga0207653_10002726 Ga0207653_100027262 315
114 3300025905 Ga0207685_10055893 Ga0207685_100558932 315
115 3300025912 Ga0207707_10163271 Ga0207707_101632712 315
116 3300025921 Ga0207652_10059120 Ga0207652_100591202 315
117 3300025927 Ga0207687_10255936 Ga0207687_102559361 315
118 3300026067 Ga0207678_10008633 Ga0207678_100086336 315
119 3300026075 Ga0207708_10055684 Ga0207708_100556842 315
120 3300026118 Ga0207675_100051796 Ga0207675_1000517962 315
121 3300027907 Ga0207428_10024777 Ga0207428_100247774 315
122 3300028380 Ga0268265_10003240 Ga0268265_100032407 315
123 3300028381 Ga0268264_10020827 Ga0268264_100208276 315
124 3300035088 Ga0373940_0003391 Ga0373940_0003391_1243_2220 315
125 3300035112 Ga0373932_0023548 Ga0373932_0023548_47_1024 315
126 3300035114 Ga0373939_0008122 Ga0373939_0008122_426_1403 315
127 3300035114 Ga0373939_0011931 Ga0373939_0011931_580_1566 315
128 3300035115 Ga0373941_0033442 Ga0373941_0033442_30_1007 315
129 3300035121 Ga0373960_0024562 Ga0373960_0024562_177_1163 315
130 3300035207 Ga0373942_0008878 Ga0373942_0008878_118_1095 315
131 3300035691 Ga0373931_0001210 Ga0373931_0001210_6965_7942 315
132 3300035691 Ga0373931_0004155 Ga0373931_0004155_1755_2741 315
133 3300046491 Ga0495584_0039361 Ga0495584_0039361_1255_2244 315
134 3300048905 Ga0496102_0001184 Ga0496102_0001184_19610_20578 315
135 3300048906 Ga0496103_0051842 Ga0496103_0051842_62_1030 315
136 3300048907 Ga0496104_0001112 Ga0496104_0001112_6263_7246 315
137 3300048907 Ga0496104_0111996 Ga0496104_0111996_277_1245 315
138 3300048908 Ga0496105_0066987 Ga0496105_0066987_1452_2435 315
139 3300048909 Ga0496106_0001028 Ga0496106_0001028_3667_4635 315
140 3300048910 Ga0496107_0014192 Ga0496107_0014192_366_1334 315
141 3300048912 Ga0496109_0006308 Ga0496109_0006308_8654_9637 315
142 3300048912 Ga0496109_0122629 Ga0496109_0122629_650_1627 315
143 3300048913 Ga0496110_0009961 Ga0496110_0009961_5533_6516 315
144 3300048913 Ga0496110_0111838 Ga0496110_0111838_692_1669 315
145 3300048914 Ga0496111_0063536 Ga0496111_0063536_1354_2337 315
146 3300048915 Ga0496112_0015062 Ga0496112_0015062_3821_4804 315
147 3300048916 Ga0496113_0014177 Ga0496113_0014177_70_1053 315
148 3300048916 Ga0496113_0055008 Ga0496113_0055008_305_1279 315
149 3300049572 Ga0501036_0263095 Ga0501036_0263095_428_1396 315
150 3300049575 Ga0501039_0084247 Ga0501039_0084247_426_1400 315
151 3300049576 Ga0501040_0222102 Ga0501040_0222102_337_1305 315
152 3300049577 Ga0501041_0058110 Ga0501041_0058110_692_1660 315
153 3300049577 Ga0501041_0094593 Ga0501041_0094593_521_1540 315
154 3300049578 Ga0501042_0114506 Ga0501042_0114506_467_1435 315
155 3300049580 Ga0501046_0247967 Ga0501046_0247967_123_1187 315
156 3300049582 Ga0501048_0047698 Ga0501048_0047698_2014_3033 315
157 3300049582 Ga0501048_0073887 Ga0501048_0073887_1030_2004 315
158 3300049587 Ga0501071_0050928 Ga0501071_0050928_14_991 315
159 3300049587 Ga0501071_0143544 Ga0501071_0143544_625_1593 315
160 3300049588 Ga0501072_0088508 Ga0501072_0088508_30_998 315
161 3300049591 Ga0501075_0207424 Ga0501075_0207424_42_1010 315
162 3300049591 Ga0501075_0351370 Ga0501075_0351370_144_1112 315
163 3300049592 Ga0501076_0308837 Ga0501076_0308837_86_1054 315
164 3300049593 Ga0501077_0090493 Ga0501077_0090493_188_1156 315
165 3300049741 Ga0501079_0005101 Ga0501079_0005101_5818_6795 315
166 3300049742 Ga0501080_0007783 Ga0501080_0007783_1497_2474 315
167 3300049824 Ga0501045_0036085 Ga0501045_0036085_1988_3007 315
168 3300050507 nmdc:mga05p37_205256_c1 nmdc:mga05p37_205256_c1_1385_2368 315
169 3300050510 nmdc:mga06r32_41813_c1 nmdc:mga06r32_41813_c1_2039_3007 315
170 3300050511 nmdc:mga08y16_178114_c1 nmdc:mga08y16_178114_c1_180_1166 315
171 3300050511 nmdc:mga08y16_88424_c1 nmdc:mga08y16_88424_c1_1061_2038 315
172 3300050512 nmdc:mga0n895_2675_c1 nmdc:mga0n895_2675_c1_1202_2179 315
173 3300050512 nmdc:mga0n895_30642_c1 nmdc:mga0n895_30642_c1_62_1039 315
174 3300050512 nmdc:mga0n895_363615_c1 nmdc:mga0n895_363615_c1_471_1448 315
175 3300050515 nmdc:mga0a205_464753_c1 nmdc:mga0a205_464753_c1_128_1105 315
176 3300053103 Ga0500555_016514 Ga0500555_016514_245_1213 315
177 3300054114 Ga0501084_0009668 Ga0501084_0009668_1449_2426 315
178 3300060353 Ga0501082_0063448 Ga0501082_0063448_832_1809 315
179 3300061734 Ga0530510_0037742 Ga0530510_0037742_1387_2355 315
180 3300005367 Ga0070667_100158721 Ga0070667_1001587212 316
181 3300005471 Ga0070698_100251705 Ga0070698_1002517052 316
182 3300005843 Ga0068860_100023337 Ga0068860_1000233372 316
183 3300006028 Ga0070717_10157079 Ga0070717_101570792 316
184 3300010375 Ga0105239_10152129 Ga0105239_101521292 316
185 3300014325 Ga0163163_10001273 Ga0163163_1000127315 316
186 3300021384 Ga0213876_10150269 Ga0213876_101502692 316
187 3300021388 Ga0213875_10146050 Ga0213875_101460502 316
188 3300025945 Ga0207679_10390710 Ga0207679_103907101 316
189 3300028381 Ga0268264_10144215 Ga0268264_101442152 316
190 3300035725 Ga0373947_0012523 Ga0373947_0012523_199_1149 316
191 3300037853 Ga0436364_0611324 Ga0436364_0611324_80_1036 316
192 3300037853 Ga0436364_1284638 Ga0436364_1284638_3556_4506 316
193 3300039437 Ga0436365_1485216 Ga0436365_1485216_535_1491 316
194 3300048904 Ga0496101_0134347 Ga0496101_0134347_326_1297 316
195 3300048907 Ga0496104_0010108 Ga0496104_0010108_865_1815 316
196 3300048908 Ga0496105_0000424 Ga0496105_0000424_4676_5626 316
197 3300048911 Ga0496108_0012311 Ga0496108_0012311_550_1500 316
198 3300048912 Ga0496109_0001304 Ga0496109_0001304_5460_6410 316
199 3300048913 Ga0496110_0000973 Ga0496110_0000973_13673_14623 316
200 3300048913 Ga0496110_0075530 Ga0496110_0075530_1801_2772 316
201 3300048914 Ga0496111_0000315 Ga0496111_0000315_620_1570 316
202 3300048916 Ga0496113_0000218 Ga0496113_0000218_22187_23137 316
203 3300048917 Ga0496114_0011259 Ga0496114_0011259_4068_5039 316
204 3300048917 Ga0496114_0098426 Ga0496114_0098426_399_1349 316
205 3300048918 Ga0496115_0039477 Ga0496115_0039477_1511_2482 316
206 3300050493 nmdc:mga0k408_17687_c1 nmdc:mga0k408_17687_c1_1608_2570 316
207 3300053085 Ga0495619_0024473 Ga0495619_0024473_1212_2165 316
208 2162886007 SwRhRL2b_contig_2503292 SwRhRL2b_0785.00005610 317
209 2209111006 2214683826 2213702589 317
210 3300000041 ARcpr5oldR_c000037 ARcpr5oldR_00003715 317
211 3300000042 ARSoilYngRDRAFT_c00113 ARSoilYngRDRAFT_0011312 317
212 3300000043 ARcpr5yngRDRAFT_c000014 ARcpr5yngRDRAFT_00001411 317
213 3300000044 ARSoilOldRDRAFT_c000005 ARSoilOldRDRAFT_00000511 317
214 3300000045 ARCol0oldRDRAFT_c00471 ARCol0oldRDRAFT_004713 317
215 3300000652 ARCol0yngRDRAFT_1000099 ARCol0yngRDRAFT_100009915 317
216 3300001430 JGI24032J14994_100117 JGI24032J14994_1001173 317
217 3300001904 JGI24736J21556_1006279 JGI24736J21556_10062792 317
218 3300001915 JGI24741J21665_1008107 JGI24741J21665_10081073 317
219 3300001977 JGI24746J21847_1000648 JGI24746J21847_10006482 317
220 3300001978 JGI24747J21853_1001209 JGI24747J21853_10012092 317
221 3300001989 JGI24739J22299_10000871 JGI24739J22299_100008712 317
222 3300001990 JGI24737J22298_10001901 JGI24737J22298_100019017 317
223 3300001990 JGI24737J22298_10009338 JGI24737J22298_100093383 317
224 3300001991 JGI24743J22301_10003516 JGI24743J22301_100035161 317
225 3300002067 JGI24735J21928_10032226 JGI24735J21928_100322262 317
226 3300002070 JGI24750J21931_1000439 JGI24750J21931_10004396 317
227 3300002073 JGI24745J21846_1005235 JGI24745J21846_10052352 317
228 3300002074 JGI24748J21848_1005097 JGI24748J21848_10050972 317
229 3300002075 JGI24738J21930_10000856 JGI24738J21930_100008563 317
230 3300002077 JGI24744J21845_10013124 JGI24744J21845_100131242 317
231 3300002126 JGI24035J26624_1001996 JGI24035J26624_10019962 317
232 3300002155 JGI24033J26618_1001158 JGI24033J26618_10011582 317
233 3300002239 JGI24034J26672_10001465 JGI24034J26672_100014652 317
234 3300002244 JGI24742J22300_10000464 JGI24742J22300_100004642 317
235 3300002459 JGI24751J29686_10004435 JGI24751J29686_100044352 317
236 3300003215 JGI25153J46596_10004386 JGI25153J46596_100043867 317
237 3300003659 JGI25404J52841_10003777 JGI25404J52841_100037772 317
238 3300003781 Ga0055536_1000524 Ga0055536_10005247 317
239 3300003791 Ga0055530_10004363 Ga0055530_100043636 317
240 3300003792 Ga0055540_1000054 Ga0055540_1000054116 317
241 3300003794 Ga0055531_10000037 Ga0055531_1000003724 317
242 3300005276 Ga0065717_1002123 Ga0065717_10021233 317
243 3300005277 Ga0065716_1002073 Ga0065716_10020733 317
244 3300005289 Ga0065704_10092942 Ga0065704_100929423 317
245 3300005290 Ga0065712_10074695 Ga0065712_100746953 317
246 3300005293 Ga0065715_10012983 Ga0065715_100129834 317
247 3300005293 Ga0065715_10026218 Ga0065715_100262182 317
248 3300005295 Ga0065707_10105725 Ga0065707_101057253 317
249 3300005295 Ga0065707_10112520 Ga0065707_101125204 317
250 3300005327 Ga0070658_10084650 Ga0070658_100846502 317
251 3300005327 Ga0070658_10096229 Ga0070658_100962292 317
252 3300005328 Ga0070676_10061936 Ga0070676_100619362 317
253 3300005329 Ga0070683_100013405 Ga0070683_1000134052 317
254 3300005329 Ga0070683_100085340 Ga0070683_1000853404 317
255 3300005330 Ga0070690_100003948 Ga0070690_1000039487 317
256 3300005330 Ga0070690_100015657 Ga0070690_1000156572 317
257 3300005330 Ga0070690_100024575 Ga0070690_1000245752 317
258 3300005331 Ga0070670_100025087 Ga0070670_1000250873 317
259 3300005331 Ga0070670_100099329 Ga0070670_1000993292 317
260 3300005331 Ga0070670_100246105 Ga0070670_1002461052 317
261 3300005333 Ga0070677_10002031 Ga0070677_100020316 317
262 3300005333 Ga0070677_10102370 Ga0070677_101023702 317
263 3300005334 Ga0068869_100035291 Ga0068869_1000352913 317
264 3300005334 Ga0068869_100046878 Ga0068869_1000468783 317
265 3300005334 Ga0068869_100224938 Ga0068869_1002249382 317
266 3300005335 Ga0070666_10006171 Ga0070666_100061715 317
267 3300005335 Ga0070666_10023242 Ga0070666_100232424 317
268 3300005335 Ga0070666_10103024 Ga0070666_101030242 317
269 3300005336 Ga0070680_100003647 Ga0070680_1000036472 317
270 3300005336 Ga0070680_100019478 Ga0070680_1000194782 317
271 3300005336 Ga0070680_100168978 Ga0070680_1001689782 317
272 3300005336 Ga0070680_100367024 Ga0070680_1003670241 317
273 3300005337 Ga0070682_100002015 Ga0070682_1000020155 317
274 3300005337 Ga0070682_100171895 Ga0070682_1001718952 317
275 3300005338 Ga0068868_100017327 Ga0068868_1000173272 317
276 3300005338 Ga0068868_100051217 Ga0068868_1000512172 317
277 3300005338 Ga0068868_100083566 Ga0068868_1000835663 317
278 3300005339 Ga0070660_100003870 Ga0070660_1000038709 317
279 3300005339 Ga0070660_100050132 Ga0070660_1000501324 317
280 3300005339 Ga0070660_100186912 Ga0070660_1001869122 317
281 3300005340 Ga0070689_100006859 Ga0070689_1000068592 317
282 3300005340 Ga0070689_100067079 Ga0070689_1000670792 317
283 3300005340 Ga0070689_100167813 Ga0070689_1001678132 317
284 3300005340 Ga0070689_100185900 Ga0070689_1001859001 317
285 3300005341 Ga0070691_10004357 Ga0070691_100043573 317
286 3300005341 Ga0070691_10016445 Ga0070691_100164452 317
287 3300005343 Ga0070687_100009855 Ga0070687_1000098554 317
288 3300005343 Ga0070687_100032499 Ga0070687_1000324991 317
289 3300005343 Ga0070687_100093310 Ga0070687_1000933102 317
290 3300005343 Ga0070687_100175903 Ga0070687_1001759032 317
291 3300005345 Ga0070692_10007167 Ga0070692_100071673 317
292 3300005345 Ga0070692_10040235 Ga0070692_100402352 317
293 3300005345 Ga0070692_10176558 Ga0070692_101765581 317
294 3300005347 Ga0070668_100004252 Ga0070668_1000042526 317
295 3300005347 Ga0070668_100045512 Ga0070668_1000455123 317
296 3300005347 Ga0070668_100098468 Ga0070668_1000984682 317
297 3300005353 Ga0070669_100008306 Ga0070669_1000083066 317
298 3300005353 Ga0070669_100035049 Ga0070669_1000350493 317
299 3300005353 Ga0070669_100202959 Ga0070669_1002029591 317
300 3300005354 Ga0070675_100044149 Ga0070675_1000441492 317
301 3300005354 Ga0070675_100055315 Ga0070675_1000553152 317
302 3300005355 Ga0070671_100006278 Ga0070671_1000062786 317
303 3300005355 Ga0070671_100009728 Ga0070671_1000097285 317
304 3300005355 Ga0070671_100015968 Ga0070671_1000159684 317
305 3300005355 Ga0070671_100033397 Ga0070671_1000333972 317
306 3300005364 Ga0070673_100012672 Ga0070673_1000126723 317
307 3300005364 Ga0070673_100024715 Ga0070673_1000247153 317
308 3300005364 Ga0070673_100118258 Ga0070673_1001182582 317
309 3300005364 Ga0070673_100373958 Ga0070673_1003739581 317
310 3300005365 Ga0070688_100039413 Ga0070688_1000394132 317
311 3300005365 Ga0070688_100071559 Ga0070688_1000715592 317
312 3300005366 Ga0070659_100026221 Ga0070659_1000262213 317
313 3300005366 Ga0070659_100232167 Ga0070659_1002321672 317
314 3300005366 Ga0070659_100295491 Ga0070659_1002954911 317
315 3300005367 Ga0070667_100002235 Ga0070667_10000223511 317
316 3300005367 Ga0070667_100013854 Ga0070667_1000138544 317
317 3300005367 Ga0070667_100122035 Ga0070667_1001220353 317
318 3300005367 Ga0070667_100140030 Ga0070667_1001400303 317
319 3300005406 Ga0070703_10007397 Ga0070703_100073973 317
320 3300005434 Ga0070709_10011016 Ga0070709_100110163 317
321 3300005434 Ga0070709_10047697 Ga0070709_100476972 317
322 3300005434 Ga0070709_10067778 Ga0070709_100677782 317
323 3300005435 Ga0070714_100053843 Ga0070714_1000538431 317
324 3300005436 Ga0070713_100037939 Ga0070713_1000379393 317
325 3300005436 Ga0070713_100064751 Ga0070713_1000647512 317
326 3300005436 Ga0070713_100383500 Ga0070713_1003835002 317
327 3300005437 Ga0070710_10002325 Ga0070710_100023252 317
328 3300005437 Ga0070710_10050700 Ga0070710_100507002 317
329 3300005437 Ga0070710_10067770 Ga0070710_100677702 317
330 3300005437 Ga0070710_10085486 Ga0070710_100854862 317
331 3300005438 Ga0070701_10002068 Ga0070701_100020684 317
332 3300005438 Ga0070701_10043327 Ga0070701_100433272 317
333 3300005439 Ga0070711_100032612 Ga0070711_1000326123 317
334 3300005439 Ga0070711_100154160 Ga0070711_1001541603 317
335 3300005439 Ga0070711_100196272 Ga0070711_1001962721 317
336 3300005440 Ga0070705_100010364 Ga0070705_1000103643 317
337 3300005440 Ga0070705_100031013 Ga0070705_1000310132 317
338 3300005441 Ga0070700_100034214 Ga0070700_1000342142 317
339 3300005441 Ga0070700_100277436 Ga0070700_1002774361 317
340 3300005444 Ga0070694_100006551 Ga0070694_1000065516 317
341 3300005444 Ga0070694_100032984 Ga0070694_1000329843 317
342 3300005444 Ga0070694_100368662 Ga0070694_1003686621 317
343 3300005445 Ga0070708_100055433 Ga0070708_1000554332 317
344 3300005445 Ga0070708_100080088 Ga0070708_1000800882 317
345 3300005455 Ga0070663_100159867 Ga0070663_1001598671 317
346 3300005456 Ga0070678_100034053 Ga0070678_1000340534 317
347 3300005456 Ga0070678_100079875 Ga0070678_1000798752 317
348 3300005456 Ga0070678_100235032 Ga0070678_1002350322 317
349 3300005457 Ga0070662_100011393 Ga0070662_1000113933 317
350 3300005457 Ga0070662_100035015 Ga0070662_1000350152 317
351 3300005457 Ga0070662_100127028 Ga0070662_1001270282 317
352 3300005458 Ga0070681_10018493 Ga0070681_100184935 317
353 3300005458 Ga0070681_10065168 Ga0070681_100651683 317
354 3300005458 Ga0070681_10075350 Ga0070681_100753503 317
355 3300005458 Ga0070681_10204988 Ga0070681_102049882 317
356 3300005459 Ga0068867_100005646 Ga0068867_1000056462 317
357 3300005466 Ga0070685_10017763 Ga0070685_100177633 317
358 3300005468 Ga0070707_100317375 Ga0070707_1003173752 317
359 3300005471 Ga0070698_100221862 Ga0070698_1002218622 317
360 3300005507 Ga0074259_12010023 Ga0074259_120100234 317
361 3300005518 Ga0070699_100099812 Ga0070699_1000998122 317
362 3300005518 Ga0070699_100271659 Ga0070699_1002716592 317
363 3300005530 Ga0070679_100016159 Ga0070679_1000161592 317
364 3300005530 Ga0070679_100139867 Ga0070679_1001398671 317
365 3300005530 Ga0070679_100299893 Ga0070679_1002998932 317
366 3300005530 Ga0070679_100369957 Ga0070679_1003699572 317
367 3300005535 Ga0070684_100020014 Ga0070684_1000200144 317
368 3300005535 Ga0070684_100079026 Ga0070684_1000790263 317
369 3300005535 Ga0070684_100082068 Ga0070684_1000820682 317
370 3300005535 Ga0070684_100095019 Ga0070684_1000950194 317
371 3300005536 Ga0070697_100006410 Ga0070697_1000064103 317
372 3300005536 Ga0070697_100225527 Ga0070697_1002255271 317
373 3300005539 Ga0068853_100003634 Ga0068853_1000036342 317
374 3300005539 Ga0068853_100188539 Ga0068853_1001885392 317
375 3300005543 Ga0070672_100044896 Ga0070672_1000448962 317
376 3300005543 Ga0070672_100245750 Ga0070672_1002457503 317
377 3300005544 Ga0070686_100007349 Ga0070686_1000073492 317
378 3300005544 Ga0070686_100055380 Ga0070686_1000553802 317
379 3300005544 Ga0070686_100124883 Ga0070686_1001248833 317
380 3300005544 Ga0070686_100208658 Ga0070686_1002086582 317
381 3300005545 Ga0070695_100016690 Ga0070695_1000166902 317
382 3300005545 Ga0070695_100121973 Ga0070695_1001219732 317
383 3300005546 Ga0070696_100010889 Ga0070696_1000108895 317
384 3300005546 Ga0070696_100013307 Ga0070696_1000133075 317
385 3300005547 Ga0070693_100004174 Ga0070693_1000041746 317
386 3300005547 Ga0070693_100157032 Ga0070693_1001570322 317
387 3300005548 Ga0070665_100006016 Ga0070665_1000060167 317
388 3300005548 Ga0070665_100195770 Ga0070665_1001957702 317
389 3300005549 Ga0070704_100022446 Ga0070704_1000224463 317
390 3300005549 Ga0070704_100034292 Ga0070704_1000342922 317
391 3300005549 Ga0070704_100177163 Ga0070704_1001771632 317
392 3300005563 Ga0068855_100026130 Ga0068855_1000261303 317
393 3300005563 Ga0068855_100275071 Ga0068855_1002750712 317
394 3300005564 Ga0070664_100114890 Ga0070664_1001148902 317
395 3300005564 Ga0070664_100135966 Ga0070664_1001359663 317
396 3300005577 Ga0068857_100019002 Ga0068857_1000190023 317
397 3300005577 Ga0068857_100110898 Ga0068857_1001108982 317
398 3300005577 Ga0068857_100126963 Ga0068857_1001269632 317
399 3300005578 Ga0068854_100002965 Ga0068854_1000029656 317
400 3300005578 Ga0068854_100039626 Ga0068854_1000396262 317
401 3300005614 Ga0068856_100005225 Ga0068856_1000052253 317
402 3300005614 Ga0068856_100058468 Ga0068856_1000584683 317
403 3300005614 Ga0068856_100125316 Ga0068856_1001253162 317
404 3300005616 Ga0068852_100047369 Ga0068852_1000473694 317
405 3300005616 Ga0068852_100071202 Ga0068852_1000712022 317
406 3300005616 Ga0068852_100123780 Ga0068852_1001237803 317
407 3300005617 Ga0068859_100039892 Ga0068859_1000398923 317
408 3300005618 Ga0068864_100013072 Ga0068864_1000130727 317
409 3300005618 Ga0068864_100030146 Ga0068864_1000301463 317
410 3300005618 Ga0068864_100079478 Ga0068864_1000794783 317
411 3300005718 Ga0068866_10017245 Ga0068866_100172452 317
412 3300005719 Ga0068861_100016579 Ga0068861_1000165795 317
413 3300005719 Ga0068861_100038178 Ga0068861_1000381782 317
414 3300005834 Ga0068851_10058728 Ga0068851_100587282 317
415 3300005840 Ga0068870_10008836 Ga0068870_100088363 317
416 3300005840 Ga0068870_10023842 Ga0068870_100238421 317
417 3300005840 Ga0068870_10031956 Ga0068870_100319563 317
418 3300005841 Ga0068863_100053128 Ga0068863_1000531283 317
419 3300005841 Ga0068863_100099230 Ga0068863_1000992302 317
420 3300005841 Ga0068863_100135514 Ga0068863_1001355142 317
421 3300005841 Ga0068863_100230610 Ga0068863_1002306102 317
422 3300005842 Ga0068858_100026832 Ga0068858_1000268325 317
423 3300005842 Ga0068858_100031436 Ga0068858_1000314363 317
424 3300005842 Ga0068858_100121393 Ga0068858_1001213932 317
425 3300005842 Ga0068858_100198645 Ga0068858_1001986452 317
426 3300005843 Ga0068860_100052065 Ga0068860_1000520653 317
427 3300005843 Ga0068860_100060789 Ga0068860_1000607893 317
428 3300005843 Ga0068860_100073921 Ga0068860_1000739213 317
429 3300005843 Ga0068860_100125246 Ga0068860_1001252462 317
430 3300005843 Ga0068860_100172469 Ga0068860_1001724693 317
431 3300005844 Ga0068862_100010646 Ga0068862_1000106466 317
432 3300005844 Ga0068862_100078169 Ga0068862_1000781692 317
433 3300005937 Ga0081455_10000200 Ga0081455_1000020044 317
434 3300005937 Ga0081455_10000768 Ga0081455_100007686 317
435 3300005937 Ga0081455_10045366 Ga0081455_100453662 317
436 3300005937 Ga0081455_10174039 Ga0081455_101740392 317
437 3300005981 Ga0081538_10007210 Ga0081538_100072104 317
438 3300005981 Ga0081538_10008625 Ga0081538_100086255 317
439 3300005981 Ga0081538_10016051 Ga0081538_100160515 317
440 3300005981 Ga0081538_10094613 Ga0081538_100946132 317
441 3300005983 Ga0081540_1006707 Ga0081540_10067073 317
442 3300005983 Ga0081540_1025349 Ga0081540_10253492 317
443 3300005983 Ga0081540_1057025 Ga0081540_10570252 317
444 3300005983 Ga0081540_1086712 Ga0081540_10867122 317
445 3300005985 Ga0081539_10020277 Ga0081539_100202772 317
446 3300005985 Ga0081539_10027151 Ga0081539_100271514 317
447 3300006028 Ga0070717_10086802 Ga0070717_100868023 317
448 3300006028 Ga0070717_10147771 Ga0070717_101477712 317
449 3300006028 Ga0070717_10309908 Ga0070717_103099081 317
450 3300006038 Ga0075365_10044325 Ga0075365_100443253 317
451 3300006038 Ga0075365_10079762 Ga0075365_100797622 317
452 3300006042 Ga0075368_10045474 Ga0075368_100454742 317
453 3300006048 Ga0075363_100054897 Ga0075363_1000548972 317
454 3300006058 Ga0075432_10010891 Ga0075432_100108912 317
455 3300006163 Ga0070715_10038507 Ga0070715_100385072 317
456 3300006173 Ga0070716_100004647 Ga0070716_1000046473 317
457 3300006173 Ga0070716_100066278 Ga0070716_1000662782 317
458 3300006173 Ga0070716_100199148 Ga0070716_1001991482 317
459 3300006175 Ga0070712_100000210 Ga0070712_10000021024 317
460 3300006175 Ga0070712_100161297 Ga0070712_1001612971 317
461 3300006175 Ga0070712_100409334 Ga0070712_1004093342 317
462 3300006177 Ga0075362_10084393 Ga0075362_100843932 317
463 3300006178 Ga0075367_10021871 Ga0075367_100218713 317
464 3300006178 Ga0075367_10098232 Ga0075367_100982322 317
465 3300006178 Ga0075367_10135444 Ga0075367_101354441 317
466 3300006186 Ga0075369_10070243 Ga0075369_100702432 317
467 3300006195 Ga0075366_10013125 Ga0075366_100131252 317
468 3300006237 Ga0097621_100029343 Ga0097621_1000293432 317
469 3300006237 Ga0097621_100039390 Ga0097621_1000393902 317
470 3300006237 Ga0097621_100088576 Ga0097621_1000885762 317
471 3300006237 Ga0097621_100208169 Ga0097621_1002081693 317
472 3300006353 Ga0075370_10028731 Ga0075370_100287313 317
473 3300006358 Ga0068871_100003405 Ga0068871_1000034056 317
474 3300006358 Ga0068871_100012612 Ga0068871_1000126123 317
475 3300006358 Ga0068871_100044409 Ga0068871_1000444091 317
476 3300006844 Ga0075428_100003646 Ga0075428_10000364616 317
477 3300006844 Ga0075428_100058917 Ga0075428_1000589173 317
478 3300006844 Ga0075428_100065348 Ga0075428_1000653482 317
479 3300006844 Ga0075428_100155914 Ga0075428_1001559142 317
480 3300006844 Ga0075428_100326861 Ga0075428_1003268612 317
481 3300006846 Ga0075430_100000133 Ga0075430_10000013329 317
482 3300006846 Ga0075430_100001032 Ga0075430_10000103216 317
483 3300006846 Ga0075430_100022952 Ga0075430_1000229522 317
484 3300006847 Ga0075431_100000602 Ga0075431_10000060215 317
485 3300006847 Ga0075431_100001362 Ga0075431_10000136216 317
486 3300006847 Ga0075431_100057185 Ga0075431_1000571852 317
487 3300006847 Ga0075431_100120962 Ga0075431_1001209622 317
488 3300006852 Ga0075433_10000328 Ga0075433_100003285 317
489 3300006871 Ga0075434_100001713 Ga0075434_1000017132 317
490 3300006871 Ga0075434_100289224 Ga0075434_1002892242 317
491 3300006880 Ga0075429_100000163 Ga0075429_10000016329 317
492 3300006881 Ga0068865_100001544 Ga0068865_1000015444 317
493 3300006881 Ga0068865_100003466 Ga0068865_1000034669 317
494 3300006914 Ga0075436_100025848 Ga0075436_1000258482 317
495 3300006914 Ga0075436_100271637 Ga0075436_1002716371 317
496 3300006931 Ga0097620_100039897 Ga0097620_1000398973 317
497 3300007076 Ga0075435_100001972 Ga0075435_1000019727 317
498 3300007076 Ga0075435_100081761 Ga0075435_1000817612 317
499 3300007076 Ga0075435_100175333 Ga0075435_1001753332 317
500 3300007265 Ga0099794_10132838 Ga0099794_101328382 317
501 3300009036 Ga0105244_10059189 Ga0105244_100591892 317
502 3300009036 Ga0105244_10136458 Ga0105244_101364582 317
503 3300009093 Ga0105240_10378029 Ga0105240_103780292 317
504 3300009094 Ga0111539_10000389 Ga0111539_1000038921 317
505 3300009094 Ga0111539_10000725 Ga0111539_1000072535 317
506 3300009094 Ga0111539_10001696 Ga0111539_1000169610 317
507 3300009094 Ga0111539_10001808 Ga0111539_1000180811 317
508 3300009094 Ga0111539_10065823 Ga0111539_100658232 317
509 3300009094 Ga0111539_10103174 Ga0111539_101031742 317
510 3300009094 Ga0111539_10122383 Ga0111539_101223832 317
511 3300009094 Ga0111539_10186046 Ga0111539_101860462 317
512 3300009094 Ga0111539_10410216 Ga0111539_104102162 317
513 3300009094 Ga0111539_10482939 Ga0111539_104829392 317
514 3300009098 Ga0105245_10010250 Ga0105245_100102502 317
515 3300009098 Ga0105245_10015250 Ga0105245_100152505 317
516 3300009098 Ga0105245_10391633 Ga0105245_103916332 317
517 3300009101 Ga0105247_10022803 Ga0105247_100228035 317
518 3300009101 Ga0105247_10035997 Ga0105247_100359972 317
519 3300009101 Ga0105247_10041832 Ga0105247_100418323 317
520 3300009147 Ga0114129_10000227 Ga0114129_1000022736 317
521 3300009147 Ga0114129_10008509 Ga0114129_100085095 317
522 3300009147 Ga0114129_10040105 Ga0114129_100401055 317
523 3300009147 Ga0114129_10255373 Ga0114129_102553732 317
524 3300009148 Ga0105243_10003521 Ga0105243_100035218 317
525 3300009148 Ga0105243_10060998 Ga0105243_100609982 317
526 3300009148 Ga0105243_10067549 Ga0105243_100675493 317
527 3300009174 Ga0105241_10007067 Ga0105241_100070677 317
528 3300009174 Ga0105241_10195297 Ga0105241_101952972 317
529 3300009176 Ga0105242_10026334 Ga0105242_100263345 317
530 3300009176 Ga0105242_10035954 Ga0105242_100359543 317
531 3300009176 Ga0105242_10040216 Ga0105242_100402164 317
532 3300009177 Ga0105248_10011072 Ga0105248_100110723 317
533 3300009177 Ga0105248_10070147 Ga0105248_100701473 317
534 3300009177 Ga0105248_10109495 Ga0105248_101094951 317
535 3300009177 Ga0105248_10244342 Ga0105248_102443422 317
536 3300009545 Ga0105237_10007432 Ga0105237_1000743211 317
537 3300009545 Ga0105237_10102994 Ga0105237_101029944 317
538 3300009551 Ga0105238_10034621 Ga0105238_100346214 317
539 3300009553 Ga0105249_10011087 Ga0105249_100110875 317
540 3300009553 Ga0105249_10019349 Ga0105249_100193494 317
541 3300009553 Ga0105249_10285547 Ga0105249_102855471 317
542 3300010375 Ga0105239_10033880 Ga0105239_100338803 317
543 3300010375 Ga0105239_10105997 Ga0105239_101059972 317
544 3300011119 Ga0105246_10004169 Ga0105246_100041698 317
545 3300011119 Ga0105246_10035014 Ga0105246_100350144 317
546 3300011119 Ga0105246_10049515 Ga0105246_100495152 317
547 3300011119 Ga0105246_10136956 Ga0105246_101369562 317
548 3300012492 Ga0157335_1000780 Ga0157335_10007804 317
549 3300013100 Ga0157373_10035983 Ga0157373_100359833 317
550 3300013102 Ga0157371_10050774 Ga0157371_100507743 317
551 3300013296 Ga0157374_10002692 Ga0157374_100026927 317
552 3300013296 Ga0157374_10070776 Ga0157374_100707762 317
553 3300013296 Ga0157374_10175996 Ga0157374_101759962 317
554 3300013297 Ga0157378_10085517 Ga0157378_100855172 317
555 3300013297 Ga0157378_10102635 Ga0157378_101026352 317
556 3300013297 Ga0157378_10694426 Ga0157378_106944261 317
557 3300013306 Ga0163162_10017826 Ga0163162_100178264 317
558 3300013306 Ga0163162_10063021 Ga0163162_100630213 317
559 3300013306 Ga0163162_10206806 Ga0163162_102068062 317
560 3300013306 Ga0163162_10430330 Ga0163162_104303303 317
561 3300013307 Ga0157372_10040791 Ga0157372_100407913 317
562 3300013308 Ga0157375_10024786 Ga0157375_100247863 317
563 3300013308 Ga0157375_10061773 Ga0157375_100617734 317
564 3300013308 Ga0157375_10104406 Ga0157375_101044062 317
565 3300013308 Ga0157375_10168893 Ga0157375_101688933 317
566 3300014325 Ga0163163_10095739 Ga0163163_100957392 317
567 3300014325 Ga0163163_10122477 Ga0163163_101224772 317
568 3300014325 Ga0163163_10380939 Ga0163163_103809392 317
569 3300014326 Ga0157380_10006550 Ga0157380_100065508 317
570 3300014745 Ga0157377_10001621 Ga0157377_100016214 317
571 3300014745 Ga0157377_10042979 Ga0157377_100429792 317
572 3300014969 Ga0157376_10034213 Ga0157376_100342134 317
573 3300014969 Ga0157376_10104691 Ga0157376_101046912 317
574 3300017792 Ga0163161_10000266 Ga0163161_1000026619 317
575 3300017792 Ga0163161_10078274 Ga0163161_100782742 317
576 3300017792 Ga0163161_10137337 Ga0163161_101373372 317
577 3300020081 Ga0206354_11439474 Ga0206354_114394742 317
578 3300021361 Ga0213872_10013367 Ga0213872_100133674 317
579 3300021377 Ga0213874_10007563 Ga0213874_100075632 317
580 3300021384 Ga0213876_10035830 Ga0213876_100358302 317
581 3300021384 Ga0213876_10048232 Ga0213876_100482322 317
582 3300021388 Ga0213875_10000918 Ga0213875_1000091820 317
583 3300024225 Ga0224572_1002050 Ga0224572_10020502 317
584 3300025271 Ga0207666_1000534 Ga0207666_10005343 317
585 3300025271 Ga0207666_1001132 Ga0207666_10011323 317
586 3300025290 Ga0207673_1000597 Ga0207673_10005973 317
587 3300025292 Ga0209676_1000105 Ga0209676_1000105101 317
588 3300025297 Ga0209758_1001765 Ga0209758_10017655 317
589 3300025298 Ga0209050_1001283 Ga0209050_100128323 317
590 3300025303 Ga0209051_1000064 Ga0209051_1000064120 317
591 3300025304 Ga0209257_1000109 Ga0209257_1000109120 317
592 3300025315 Ga0207697_10002026 Ga0207697_100020266 317
593 3300025315 Ga0207697_10003146 Ga0207697_100031462 317
594 3300025321 Ga0207656_10020871 Ga0207656_100208712 317
595 3300025728 Ga0207655_1055096 Ga0207655_10550962 317
596 3300025885 Ga0207653_10002185 Ga0207653_100021854 317
597 3300025893 Ga0207682_10000009 Ga0207682_1000000959 317
598 3300025893 Ga0207682_10003948 Ga0207682_100039482 317
599 3300025898 Ga0207692_10010088 Ga0207692_100100884 317
600 3300025899 Ga0207642_10007417 Ga0207642_100074172 317
601 3300025899 Ga0207642_10010905 Ga0207642_100109053 317
602 3300025900 Ga0207710_10001303 Ga0207710_100013038 317
603 3300025901 Ga0207688_10000892 Ga0207688_100008926 317
604 3300025901 Ga0207688_10110652 Ga0207688_101106523 317
605 3300025901 Ga0207688_10132250 Ga0207688_101322502 317
606 3300025903 Ga0207680_10004104 Ga0207680_100041045 317
607 3300025903 Ga0207680_10025243 Ga0207680_100252432 317
608 3300025904 Ga0207647_10002160 Ga0207647_100021606 317
609 3300025905 Ga0207685_10031650 Ga0207685_100316502 317
610 3300025906 Ga0207699_10037062 Ga0207699_100370623 317
611 3300025907 Ga0207645_10000999 Ga0207645_1000099912 317
612 3300025907 Ga0207645_10035204 Ga0207645_100352042 317
613 3300025908 Ga0207643_10001172 Ga0207643_100011728 317
614 3300025908 Ga0207643_10028428 Ga0207643_100284282 317
615 3300025909 Ga0207705_10076146 Ga0207705_100761462 317
616 3300025909 Ga0207705_10114279 Ga0207705_101142791 317
617 3300025910 Ga0207684_10019788 Ga0207684_100197882 317
618 3300025911 Ga0207654_10015486 Ga0207654_100154863 317
619 3300025911 Ga0207654_10156190 Ga0207654_101561902 317
620 3300025912 Ga0207707_10006761 Ga0207707_100067613 317
621 3300025912 Ga0207707_10045583 Ga0207707_100455834 317
622 3300025912 Ga0207707_10247057 Ga0207707_102470572 317
623 3300025912 Ga0207707_10386783 Ga0207707_103867831 317
624 3300025912 Ga0207707_10448620 Ga0207707_104486201 317
625 3300025913 Ga0207695_10154802 Ga0207695_101548022 317
626 3300025913 Ga0207695_10170648 Ga0207695_101706481 317
627 3300025914 Ga0207671_10070082 Ga0207671_100700823 317
628 3300025914 Ga0207671_10113096 Ga0207671_101130962 317
629 3300025915 Ga0207693_10002396 Ga0207693_100023967 317
630 3300025915 Ga0207693_10007042 Ga0207693_100070422 317
631 3300025915 Ga0207693_10012580 Ga0207693_100125801 317
632 3300025915 Ga0207693_10024070 Ga0207693_100240702 317
633 3300025915 Ga0207693_10128480 Ga0207693_101284802 317
634 3300025915 Ga0207693_10192406 Ga0207693_101924061 317
635 3300025916 Ga0207663_10194477 Ga0207663_101944771 317
636 3300025916 Ga0207663_10266655 Ga0207663_102666551 317
637 3300025917 Ga0207660_10001283 Ga0207660_1000128311 317
638 3300025917 Ga0207660_10096292 Ga0207660_100962922 317
639 3300025918 Ga0207662_10000025 Ga0207662_1000002558 317
640 3300025918 Ga0207662_10007904 Ga0207662_100079045 317
641 3300025918 Ga0207662_10043635 Ga0207662_100436352 317
642 3300025919 Ga0207657_10010579 Ga0207657_100105793 317
643 3300025919 Ga0207657_10086122 Ga0207657_100861223 317
644 3300025919 Ga0207657_10146148 Ga0207657_101461482 317
645 3300025919 Ga0207657_10320484 Ga0207657_103204841 317
646 3300025920 Ga0207649_10006638 Ga0207649_100066383 317
647 3300025920 Ga0207649_10115293 Ga0207649_101152932 317
648 3300025920 Ga0207649_10176922 Ga0207649_101769222 317
649 3300025921 Ga0207652_10006125 Ga0207652_100061253 317
650 3300025921 Ga0207652_10069453 Ga0207652_100694531 317
651 3300025921 Ga0207652_10103214 Ga0207652_101032143 317
652 3300025921 Ga0207652_10264514 Ga0207652_102645143 317
653 3300025921 Ga0207652_10371714 Ga0207652_103717142 317
654 3300025921 Ga0207652_10506786 Ga0207652_105067861 317
655 3300025922 Ga0207646_10051439 Ga0207646_100514394 317
656 3300025923 Ga0207681_10002039 Ga0207681_100020392 317
657 3300025923 Ga0207681_10012199 Ga0207681_100121994 317
658 3300025924 Ga0207694_10037333 Ga0207694_100373332 317
659 3300025924 Ga0207694_10353411 Ga0207694_103534111 317
660 3300025925 Ga0207650_10074985 Ga0207650_100749852 317
661 3300025925 Ga0207650_10237350 Ga0207650_102373502 317
662 3300025926 Ga0207659_10014716 Ga0207659_100147164 317
663 3300025927 Ga0207687_10003202 Ga0207687_100032028 317
664 3300025927 Ga0207687_10011809 Ga0207687_100118096 317
665 3300025928 Ga0207700_10064877 Ga0207700_100648772 317
666 3300025928 Ga0207700_10155337 Ga0207700_101553372 317
667 3300025931 Ga0207644_10003326 Ga0207644_100033264 317
668 3300025931 Ga0207644_10009497 Ga0207644_100094973 317
669 3300025931 Ga0207644_10025426 Ga0207644_100254263 317
670 3300025931 Ga0207644_10190507 Ga0207644_101905072 317
671 3300025932 Ga0207690_10007239 Ga0207690_100072396 317
672 3300025932 Ga0207690_10264505 Ga0207690_102645052 317
673 3300025933 Ga0207706_10005363 Ga0207706_100053633 317
674 3300025933 Ga0207706_10007588 Ga0207706_1000758811 317
675 3300025933 Ga0207706_10015532 Ga0207706_100155323 317
676 3300025933 Ga0207706_10016523 Ga0207706_100165234 317
677 3300025933 Ga0207706_10063677 Ga0207706_100636772 317
678 3300025933 Ga0207706_10107599 Ga0207706_101075992 317
679 3300025934 Ga0207686_10020623 Ga0207686_100206233 317
680 3300025935 Ga0207709_10002970 Ga0207709_100029708 317
681 3300025935 Ga0207709_10020213 Ga0207709_100202133 317
682 3300025935 Ga0207709_10027140 Ga0207709_100271403 317
683 3300025935 Ga0207709_10037377 Ga0207709_100373773 317
684 3300025936 Ga0207670_10003489 Ga0207670_100034893 317
685 3300025936 Ga0207670_10048850 Ga0207670_100488503 317
686 3300025936 Ga0207670_10082490 Ga0207670_100824902 317
687 3300025936 Ga0207670_10209815 Ga0207670_102098151 317
688 3300025936 Ga0207670_10391355 Ga0207670_103913551 317
689 3300025937 Ga0207669_10001324 Ga0207669_100013242 317
690 3300025937 Ga0207669_10022747 Ga0207669_100227472 317
691 3300025937 Ga0207669_10046762 Ga0207669_100467623 317
692 3300025937 Ga0207669_10082786 Ga0207669_100827861 317
693 3300025937 Ga0207669_10094727 Ga0207669_100947272 317
694 3300025937 Ga0207669_10187070 Ga0207669_101870703 317
695 3300025937 Ga0207669_10222069 Ga0207669_102220691 317
696 3300025938 Ga0207704_10000130 Ga0207704_100001303 317
697 3300025938 Ga0207704_10122991 Ga0207704_101229911 317
698 3300025938 Ga0207704_10184642 Ga0207704_101846423 317
699 3300025939 Ga0207665_10002113 Ga0207665_1000211311 317
700 3300025939 Ga0207665_10024373 Ga0207665_100243732 317
701 3300025940 Ga0207691_10001422 Ga0207691_1000142217 317
702 3300025940 Ga0207691_10002604 Ga0207691_1000260411 317
703 3300025940 Ga0207691_10103504 Ga0207691_101035042 317
704 3300025940 Ga0207691_10175920 Ga0207691_101759202 317
705 3300025940 Ga0207691_10386682 Ga0207691_103866822 317
706 3300025941 Ga0207711_10001071 Ga0207711_1000107115 317
707 3300025941 Ga0207711_10012903 Ga0207711_100129033 317
708 3300025941 Ga0207711_10019431 Ga0207711_100194315 317
709 3300025941 Ga0207711_10081889 Ga0207711_100818892 317
710 3300025941 Ga0207711_10100479 Ga0207711_101004793 317
711 3300025942 Ga0207689_10001156 Ga0207689_1000115615 317
712 3300025942 Ga0207689_10066148 Ga0207689_100661483 317
713 3300025942 Ga0207689_10254733 Ga0207689_102547332 317
714 3300025944 Ga0207661_10028696 Ga0207661_100286962 317
715 3300025944 Ga0207661_10186261 Ga0207661_101862611 317
716 3300025944 Ga0207661_10237224 Ga0207661_102372242 317
717 3300025944 Ga0207661_10415447 Ga0207661_104154471 317
718 3300025944 Ga0207661_10429362 Ga0207661_104293621 317
719 3300025945 Ga0207679_10003209 Ga0207679_100032099 317
720 3300025949 Ga0207667_10028359 Ga0207667_100283596 317
721 3300025949 Ga0207667_10089076 Ga0207667_100890763 317
722 3300025949 Ga0207667_10272091 Ga0207667_102720912 317
723 3300025949 Ga0207667_10436413 Ga0207667_104364131 317
724 3300025960 Ga0207651_10010192 Ga0207651_100101922 317
725 3300025960 Ga0207651_10212060 Ga0207651_102120603 317
726 3300025961 Ga0207712_10000579 Ga0207712_1000057911 317
727 3300025961 Ga0207712_10007061 Ga0207712_100070615 317
728 3300025961 Ga0207712_10020831 Ga0207712_100208312 317
729 3300025972 Ga0207668_10003465 Ga0207668_100034658 317
730 3300025972 Ga0207668_10108641 Ga0207668_101086412 317
731 3300025972 Ga0207668_10203378 Ga0207668_102033781 317
732 3300025981 Ga0207640_10122108 Ga0207640_101221082 317
733 3300025986 Ga0207658_10002475 Ga0207658_1000247512 317
734 3300025986 Ga0207658_10003151 Ga0207658_100031519 317
735 3300025986 Ga0207658_10015729 Ga0207658_100157291 317
736 3300025986 Ga0207658_10124397 Ga0207658_101243972 317
737 3300026023 Ga0207677_10011181 Ga0207677_100111812 317
738 3300026023 Ga0207677_10252437 Ga0207677_102524372 317
739 3300026035 Ga0207703_10010308 Ga0207703_100103083 317
740 3300026035 Ga0207703_10033374 Ga0207703_100333743 317
741 3300026041 Ga0207639_10001866 Ga0207639_100018664 317
742 3300026041 Ga0207639_10159860 Ga0207639_101598603 317
743 3300026041 Ga0207639_10383618 Ga0207639_103836181 317
744 3300026067 Ga0207678_10008348 Ga0207678_100083483 317
745 3300026067 Ga0207678_10046782 Ga0207678_100467824 317
746 3300026075 Ga0207708_10000402 Ga0207708_100004025 317
747 3300026075 Ga0207708_10002738 Ga0207708_100027386 317
748 3300026075 Ga0207708_10147325 Ga0207708_101473252 317
749 3300026075 Ga0207708_10437374 Ga0207708_104373741 317
750 3300026078 Ga0207702_10046199 Ga0207702_100461992 317
751 3300026078 Ga0207702_10091417 Ga0207702_100914173 317
752 3300026088 Ga0207641_10014704 Ga0207641_100147045 317
753 3300026088 Ga0207641_10072572 Ga0207641_100725721 317
754 3300026088 Ga0207641_10087180 Ga0207641_100871802 317
755 3300026088 Ga0207641_10095692 Ga0207641_100956923 317
756 3300026089 Ga0207648_10001500 Ga0207648_100015004 317
757 3300026089 Ga0207648_10004627 Ga0207648_100046275 317
758 3300026095 Ga0207676_10017931 Ga0207676_100179312 317
759 3300026095 Ga0207676_10071930 Ga0207676_100719302 317
760 3300026095 Ga0207676_10101902 Ga0207676_101019022 317
761 3300026095 Ga0207676_10137857 Ga0207676_101378572 317
762 3300026116 Ga0207674_10007131 Ga0207674_100071316 317
763 3300026116 Ga0207674_10021894 Ga0207674_100218944 317
764 3300026116 Ga0207674_10043375 Ga0207674_100433755 317
765 3300026118 Ga0207675_100002311 Ga0207675_1000023114 317
766 3300026118 Ga0207675_100003859 Ga0207675_1000038596 317
767 3300026118 Ga0207675_100019447 Ga0207675_1000194476 317
768 3300026121 Ga0207683_10000850 Ga0207683_1000085011 317
769 3300026121 Ga0207683_10010051 Ga0207683_100100517 317
770 3300026121 Ga0207683_10062694 Ga0207683_100626943 317
771 3300026121 Ga0207683_10096310 Ga0207683_100963102 317
772 3300026121 Ga0207683_10208074 Ga0207683_102080741 317
773 3300026121 Ga0207683_10211505 Ga0207683_102115051 317
774 3300026142 Ga0207698_10005963 Ga0207698_100059635 317
775 3300026142 Ga0207698_10052400 Ga0207698_100524003 317
776 3300026142 Ga0207698_10344543 Ga0207698_103445432 317
777 3300027471 Ga0209995_1009515 Ga0209995_10095152 317
778 3300027617 Ga0210002_1000490 Ga0210002_10004902 317
779 3300027682 Ga0209971_1023345 Ga0209971_10233453 317
780 3300027695 Ga0209966_1003846 Ga0209966_10038463 317
781 3300027717 Ga0209998_10000759 Ga0209998_100007597 317
782 3300027717 Ga0209998_10001051 Ga0209998_100010512 317
783 3300027876 Ga0209974_10039214 Ga0209974_100392141 317
784 3300027907 Ga0207428_10000164 Ga0207428_1000016452 317
785 3300027907 Ga0207428_10000391 Ga0207428_1000039121 317
786 3300027907 Ga0207428_10001108 Ga0207428_1000110820 317
787 3300027907 Ga0207428_10008433 Ga0207428_100084335 317
788 3300028379 Ga0268266_10002016 Ga0268266_1000201612 317
789 3300028379 Ga0268266_10127443 Ga0268266_101274432 317
790 3300028380 Ga0268265_10042298 Ga0268265_100422982 317
791 3300028380 Ga0268265_10265390 Ga0268265_102653902 317
792 3300028381 Ga0268264_10061652 Ga0268264_100616522 317
793 3300028381 Ga0268264_10061975 Ga0268264_100619752 317
794 3300028381 Ga0268264_10128256 Ga0268264_101282562 317
795 3300028381 Ga0268264_10151718 Ga0268264_101517182 317
796 3300028381 Ga0268264_10167044 Ga0268264_101670442 317
797 3300028556 Ga0265337_1000284 Ga0265337_100028425 317
798 3300028794 Ga0307515_10248642 Ga0307515_102486421 317
799 3300028800 Ga0265338_10005223 Ga0265338_1000522312 317
800 3300031235 Ga0265330_10027948 Ga0265330_100279481 317
801 3300031235 Ga0265330_10102093 Ga0265330_101020931 317
802 3300031238 Ga0265332_10000508 Ga0265332_1000050826 317
803 3300031238 Ga0265332_10026267 Ga0265332_100262672 317
804 3300031238 Ga0265332_10073934 Ga0265332_100739342 317
805 3300031241 Ga0265325_10000019 Ga0265325_1000001947 317
806 3300031241 Ga0265325_10001329 Ga0265325_100013295 317
807 3300031241 Ga0265325_10003017 Ga0265325_100030178 317
808 3300031241 Ga0265325_10004090 Ga0265325_100040909 317
809 3300031241 Ga0265325_10025995 Ga0265325_100259953 317
810 3300031241 Ga0265325_10034256 Ga0265325_100342562 317
811 3300031241 Ga0265325_10063293 Ga0265325_100632932 317
812 3300031241 Ga0265325_10067790 Ga0265325_100677901 317
813 3300031247 Ga0265340_10009669 Ga0265340_100096691 317
814 3300031247 Ga0265340_10024385 Ga0265340_100243853 317
815 3300031247 Ga0265340_10024647 Ga0265340_100246473 317
816 3300031247 Ga0265340_10037227 Ga0265340_100372273 317
817 3300031249 Ga0265339_10000096 Ga0265339_1000009619 317
818 3300031249 Ga0265339_10001912 Ga0265339_1000191214 317
819 3300031249 Ga0265339_10006450 Ga0265339_100064501 317
820 3300031249 Ga0265339_10008869 Ga0265339_100088695 317
821 3300031249 Ga0265339_10015052 Ga0265339_100150523 317
822 3300031250 Ga0265331_10042725 Ga0265331_100427252 317
823 3300031595 Ga0265313_10000024 Ga0265313_10000024107 317
824 3300031595 Ga0265313_10004465 Ga0265313_100044656 317
825 3300031595 Ga0265313_10006000 Ga0265313_100060009 317
826 3300031595 Ga0265313_10025519 Ga0265313_100255193 317
827 3300031595 Ga0265313_10028957 Ga0265313_100289571 317
828 3300031595 Ga0265313_10047499 Ga0265313_100474992 317
829 3300031595 Ga0265313_10100613 Ga0265313_101006132 317
830 3300031711 Ga0265314_10001355 Ga0265314_100013555 317
831 3300031712 Ga0265342_10000573 Ga0265342_1000057331 317
832 3300031712 Ga0265342_10001257 Ga0265342_1000125717 317
833 3300031730 Ga0307516_10054650 Ga0307516_100546503 317
834 3300031903 Ga0307407_10177306 Ga0307407_101773061 317
835 3300032004 Ga0307414_10063480 Ga0307414_100634802 317
836 3300032126 Ga0307415_100147752 Ga0307415_1001477522 317
837 3300032133 Ga0316583_10001118 Ga0316583_100011182 317
838 3300034816 Ga0373930_0000713 Ga0373930_0000713_946_1899 317
839 3300034817 Ga0373948_0000426 Ga0373948_0000426_3272_4225 317
840 3300034817 Ga0373948_0001212 Ga0373948_0001212_611_1564 317
841 3300034818 Ga0373950_0004976 Ga0373950_0004976_988_1941 317
842 3300034819 Ga0373958_0000992 Ga0373958_0000992_2332_3285 317
843 3300034819 Ga0373958_0005970 Ga0373958_0005970_540_1493 317
844 3300034820 Ga0373959_0000111 Ga0373959_0000111_8197_9150 317
845 3300034957 Ga0373938_0000386 Ga0373938_0000386_3451_4404 317
846 3300034957 Ga0373938_0000527 Ga0373938_0000527_4190_5143 317
847 3300034957 Ga0373938_0004135 Ga0373938_0004135_43_1008 317
848 3300035083 Ga0373926_0000388 Ga0373926_0000388_817_1770 317
849 3300035083 Ga0373926_0012315 Ga0373926_0012315_978_1931 317
850 3300035084 Ga0373928_0000045 Ga0373928_0000045_9874_10827 317
851 3300035085 Ga0373929_0000214 Ga0373929_0000214_276_1229 317
852 3300035086 Ga0373934_0073810 Ga0373934_0073810_85_1047 317
853 3300035088 Ga0373940_0008685 Ga0373940_0008685_1220_2173 317
854 3300035088 Ga0373940_0016914 Ga0373940_0016914_435_1388 317
855 3300035089 Ga0373944_0000734 Ga0373944_0000734_230_1183 317
856 3300035089 Ga0373944_0013920 Ga0373944_0013920_1243_2196 317
857 3300035089 Ga0373944_0019891 Ga0373944_0019891_652_1605 317
858 3300035090 Ga0373949_0002131 Ga0373949_0002131_4237_5190 317
859 3300035090 Ga0373949_0002981 Ga0373949_0002981_2496_3449 317
860 3300035091 Ga0373951_0000335 Ga0373951_0000335_8666_9619 317
861 3300035091 Ga0373951_0005629 Ga0373951_0005629_808_1761 317
862 3300035091 Ga0373951_0013871 Ga0373951_0013871_298_1308 317
863 3300035092 Ga0373952_0000179 Ga0373952_0000179_3576_4529 317
864 3300035092 Ga0373952_0004378 Ga0373952_0004378_1068_2021 317
865 3300035111 Ga0373923_0000978 Ga0373923_0000978_5327_6280 317
866 3300035112 Ga0373932_0000271 Ga0373932_0000271_5809_6762 317
867 3300035112 Ga0373932_0002322 Ga0373932_0002322_1620_2573 317
868 3300035113 Ga0373936_0001860 Ga0373936_0001860_5559_6512 317
869 3300035113 Ga0373936_0011435 Ga0373936_0011435_1845_2798 317
870 3300035113 Ga0373936_0036477 Ga0373936_0036477_204_1157 317
871 3300035115 Ga0373941_0000241 Ga0373941_0000241_275_1228 317
872 3300035116 Ga0373945_0016965 Ga0373945_0016965_1365_2318 317
873 3300035116 Ga0373945_0018406 Ga0373945_0018406_406_1359 317
874 3300035116 Ga0373945_0028858 Ga0373945_0028858_458_1411 317
875 3300035117 Ga0373953_0009196 Ga0373953_0009196_2043_3224 317
876 3300035118 Ga0373954_0000707 Ga0373954_0000707_9458_10411 317
877 3300035118 Ga0373954_0025763 Ga0373954_0025763_56_1009 317
878 3300035118 Ga0373954_0045424 Ga0373954_0045424_639_1592 317
879 3300035118 Ga0373954_0077547 Ga0373954_0077547_25_978 317
880 3300035119 Ga0373956_0023428 Ga0373956_0023428_1051_2121 317
881 3300035119 Ga0373956_0029934 Ga0373956_0029934_763_1716 317
882 3300035120 Ga0373957_0002977 Ga0373957_0002977_731_1684 317
883 3300035120 Ga0373957_0036321 Ga0373957_0036321_869_1822 317
884 3300035120 Ga0373957_0047844 Ga0373957_0047844_565_1518 317
885 3300035121 Ga0373960_0003102 Ga0373960_0003102_1172_2125 317
886 3300035170 Ga0373943_0000233 Ga0373943_0000233_16703_17656 317
887 3300035170 Ga0373943_0000997 Ga0373943_0000997_1153_2106 317
888 3300035170 Ga0373943_0007851 Ga0373943_0007851_64_1059 317
889 3300035170 Ga0373943_0047269 Ga0373943_0047269_362_1315 317
890 3300035171 Ga0373946_0007488 Ga0373946_0007488_826_1779 317
891 3300035171 Ga0373946_0011741 Ga0373946_0011741_43_1038 317
892 3300035171 Ga0373946_0026501 Ga0373946_0026501_544_1497 317
893 3300035172 Ga0373955_0001092 Ga0373955_0001092_9700_10653 317
894 3300035172 Ga0373955_0002224 Ga0373955_0002224_7042_8073 317
895 3300035172 Ga0373955_0005439 Ga0373955_0005439_2804_3799 317
896 3300035172 Ga0373955_0014964 Ga0373955_0014964_2554_3507 317
897 3300035241 Ga0373961_0000592 Ga0373961_0000592_9090_10043 317
898 3300035241 Ga0373961_0003081 Ga0373961_0003081_1592_2545 317
899 3300035241 Ga0373961_0005827 Ga0373961_0005827_962_1915 317
900 3300035241 Ga0373961_0011637 Ga0373961_0011637_496_1461 317
901 3300035242 Ga0373962_0000848 Ga0373962_0000848_4237_5190 317
902 3300035242 Ga0373962_0002023 Ga0373962_0002023_2349_3302 317
903 3300035242 Ga0373962_0020380 Ga0373962_0020380_521_1474 317
904 3300035410 Ga0373924_0070650 Ga0373924_0070650_482_1435 317
905 3300035410 Ga0373924_0145353 Ga0373924_0145353_35_988 317
906 3300035691 Ga0373931_0003979 Ga0373931_0003979_4925_5878 317
907 3300035691 Ga0373931_0004514 Ga0373931_0004514_3276_4229 317
908 3300035691 Ga0373931_0018978 Ga0373931_0018978_379_1344 317
909 3300035691 Ga0373931_0174512 Ga0373931_0174512_275_1228 317
910 3300035691 Ga0373931_0275359 Ga0373931_0275359_23_976 317
911 3300035692 Ga0373935_0000377 Ga0373935_0000377_15191_16144 317
912 3300035692 Ga0373935_0001455 Ga0373935_0001455_2901_3854 317
913 3300035692 Ga0373935_0003956 Ga0373935_0003956_2324_3277 317
914 3300035692 Ga0373935_0084931 Ga0373935_0084931_298_1251 317
915 3300035692 Ga0373935_0188072 Ga0373935_0188072_208_1407 317
916 3300035695 Ga0373927_0000113 Ga0373927_0000113_36869_37822 317
917 3300035695 Ga0373927_0013803 Ga0373927_0013803_3161_4114 317
918 3300035695 Ga0373927_0017901 Ga0373927_0017901_2542_3495 317
919 3300035695 Ga0373927_0021648 Ga0373927_0021648_204_1157 317
920 3300035695 Ga0373927_0035757 Ga0373927_0035757_1246_2199 317
921 3300035695 Ga0373927_0041852 Ga0373927_0041852_54_1049 317
922 3300035695 Ga0373927_0060060 Ga0373927_0060060_719_1672 317
923 3300035695 Ga0373927_0067856 Ga0373927_0067856_394_1347 317
924 3300035695 Ga0373927_0080694 Ga0373927_0080694_509_1462 317
925 3300035724 Ga0373933_0000258 Ga0373933_0000258_10032_10988 317
926 3300035724 Ga0373933_0010567 Ga0373933_0010567_3337_4290 317
927 3300035724 Ga0373933_0017191 Ga0373933_0017191_793_1749 317
928 3300035724 Ga0373933_0034562 Ga0373933_0034562_453_1406 317
929 3300035724 Ga0373933_0043589 Ga0373933_0043589_191_1144 317
930 3300035724 Ga0373933_0129767 Ga0373933_0129767_330_1292 317
931 3300035725 Ga0373947_0000168 Ga0373947_0000168_30319_31272 317
932 3300035725 Ga0373947_0000280 Ga0373947_0000280_25_978 317
933 3300035725 Ga0373947_0013179 Ga0373947_0013179_972_1928 317
934 3300035725 Ga0373947_0019089 Ga0373947_0019089_929_1882 317
935 3300035725 Ga0373947_0020590 Ga0373947_0020590_2269_3222 317
936 3300036401 Ga0373937_0000814 Ga0373937_0000814_2810_3766 317
937 3300036401 Ga0373937_0001849 Ga0373937_0001849_8554_9507 317
938 3300036401 Ga0373937_0005769 Ga0373937_0005769_6773_7954 317
939 3300036401 Ga0373937_0008814 Ga0373937_0008814_869_1900 317
940 3300036401 Ga0373937_0011708 Ga0373937_0011708_3074_4027 317
941 3300036401 Ga0373937_0017925 Ga0373937_0017925_3991_4944 317
942 3300036401 Ga0373937_0059689 Ga0373937_0059689_1706_2662 317
943 3300036401 Ga0373937_0191559 Ga0373937_0191559_119_1072 317
944 3300037068 Ga0373925_0000075 Ga0373925_0000075_28196_29149 317
945 3300037068 Ga0373925_0001434 Ga0373925_0001434_10050_11003 317
946 3300037068 Ga0373925_0003256 Ga0373925_0003256_3543_4496 317
947 3300037068 Ga0373925_0013932 Ga0373925_0013932_1175_2170 317
948 3300037068 Ga0373925_0115233 Ga0373925_0115233_618_1571 317
949 3300037068 Ga0373925_0136762 Ga0373925_0136762_552_1505 317
950 3300037068 Ga0373925_0198248 Ga0373925_0198248_82_1047 317
951 3300037068 Ga0373925_0313423 Ga0373925_0313423_210_1163 317
952 3300037312 Ga0395899_0005270 Ga0395899_0005270_5756_6709 317
953 3300037312 Ga0395899_0083216 Ga0395899_0083216_361_1314 317
954 3300037418 Ga0395900_0004997 Ga0395900_0004997_3586_4539 317
955 3300037418 Ga0395900_0334631 Ga0395900_0334631_225_1178 317
956 3300037466 Ga0395898_0005343 Ga0395898_0005343_11029_11982 317
957 3300037466 Ga0395898_0109287 Ga0395898_0109287_851_1804 317
958 3300037466 Ga0395898_0211384 Ga0395898_0211384_272_1225 317
959 3300037466 Ga0395898_0252358 Ga0395898_0252358_556_1509 317
960 3300037853 Ga0436364_0266645 Ga0436364_0266645_18278_19231 317
961 3300038443 Ga0395901_0009254 Ga0395901_0009254_5266_6219 317
962 3300038443 Ga0395901_0114297 Ga0395901_0114297_272_1225 317
963 3300038996 Ga0242420_010110 Ga0242420_010110_298_1251 317
964 3300039437 Ga0436365_0321935 Ga0436365_0321935_84_1037 317
965 3300039437 Ga0436365_0692136 Ga0436365_0692136_1922_2875 317
966 3300039437 Ga0436365_0827365 Ga0436365_0827365_741_1694 317
967 3300039437 Ga0436365_1545760 Ga0436365_1545760_1404_2366 317
968 3300039447 Ga0436361_0569994 Ga0436361_0569994_3855_4808 317
969 3300039447 Ga0436361_0679413 Ga0436361_0679413_176_1129 317
970 3300039447 Ga0436361_1044250 Ga0436361_1044250_81_1037 317
971 3300039450 Ga0436363_0519487 Ga0436363_0519487_64_1017 317
972 3300039450 Ga0436363_1624569 Ga0436363_1624569_2822_3784 317
973 3300039450 Ga0436363_1706863 Ga0436363_1706863_73_1026 317
974 3300041408 Ga0439453_0021580 Ga0439453_0021580_13_966 317
975 3300041512 Ga0451853_2607190 Ga0451853_2607190_92_1045 317
976 3300041512 Ga0451853_3173075 Ga0451853_3173075_106_1059 317
977 3300042001 Ga0439441_006469 Ga0439441_006469_160_1128 317
978 3300042003 Ga0439443_005645 Ga0439443_005645_694_1647 317
979 3300042008 Ga0439450_002586 Ga0439450_002586_967_1920 317
980 3300044694 Ga0466963_0002455 Ga0466963_0002455_3013_3966 317
981 3300044694 Ga0466963_0059496 Ga0466963_0059496_1322_2275 317
982 3300044735 Ga0466968_0009361 Ga0466968_0009361_628_1584 317
983 3300045049 Ga0466959_0045768 Ga0466959_0045768_1517_2470 317
984 3300045051 Ga0451576_0006479 Ga0451576_0006479_2914_3867 317
985 3300045976 Ga0466967_0006697 Ga0466967_0006697_4966_5919 317
986 3300045976 Ga0466967_0104801 Ga0466967_0104801_571_1524 317
987 3300046454 Ga0495592_0000060 Ga0495592_0000060_24110_25063 317
988 3300046454 Ga0495592_0003878 Ga0495592_0003878_5344_6300 317
989 3300046454 Ga0495592_0026131 Ga0495592_0026131_3414_4367 317
990 3300046454 Ga0495592_0051488 Ga0495592_0051488_347_1342 317
991 3300046454 Ga0495592_0052855 Ga0495592_0052855_541_1572 317
992 3300046455 Ga0495603_0004025 Ga0495603_0004025_5177_6130 317
993 3300046455 Ga0495603_0023263 Ga0495603_0023263_545_1498 317
994 3300046459 Ga0495629_0000118 Ga0495629_0000118_16288_17256 317
995 3300046459 Ga0495629_0000139 Ga0495629_0000139_39784_40737 317
996 3300046459 Ga0495629_0027523 Ga0495629_0027523_590_1543 317
997 3300046459 Ga0495629_0115745 Ga0495629_0115745_364_1317 317
998 3300046459 Ga0495629_0117691 Ga0495629_0117691_545_1498 317
999 3300046459 Ga0495629_0139108 Ga0495629_0139108_296_1249 317
1000 3300046459 Ga0495629_0145651 Ga0495629_0145651_469_1422 317
1001 3300046459 Ga0495629_0159256 Ga0495629_0159256_158_1111 317
1002 3300046460 Ga0495638_0043216 Ga0495638_0043216_1302_2255 317
1003 3300046461 Ga0495641_0026615 Ga0495641_0026615_1064_2017 317
1004 3300046462 Ga0495651_0000181 Ga0495651_0000181_21800_22753 317
1005 3300046462 Ga0495651_0001419 Ga0495651_0001419_6278_7273 317
1006 3300046462 Ga0495651_0004794 Ga0495651_0004794_4359_5312 317
1007 3300046462 Ga0495651_0084089 Ga0495651_0084089_26_982 317
1008 3300046462 Ga0495651_0086259 Ga0495651_0086259_957_1910 317
1009 3300046463 Ga0495653_0000141 Ga0495653_0000141_50143_51111 317
1010 3300046463 Ga0495653_0006362 Ga0495653_0006362_1394_2347 317
1011 3300046463 Ga0495653_0067003 Ga0495653_0067003_1379_2374 317
1012 3300046472 Ga0495580_0005444 Ga0495580_0005444_3979_4947 317
1013 3300046472 Ga0495580_0018852 Ga0495580_0018852_365_1318 317
1014 3300046472 Ga0495580_0047339 Ga0495580_0047339_1248_2201 317
1015 3300046472 Ga0495580_0126130 Ga0495580_0126130_612_1565 317
1016 3300046473 Ga0495582_0037925 Ga0495582_0037925_946_1914 317
1017 3300046473 Ga0495582_0042876 Ga0495582_0042876_890_1843 317
1018 3300046473 Ga0495582_0044124 Ga0495582_0044124_1079_2032 317
1019 3300046473 Ga0495582_0244600 Ga0495582_0244600_44_997 317
1020 3300046474 Ga0495605_0065887 Ga0495605_0065887_169_1122 317
1021 3300046475 Ga0495639_0005719 Ga0495639_0005719_770_1723 317
1022 3300046475 Ga0495639_0037816 Ga0495639_0037816_1090_2043 317
1023 3300046475 Ga0495639_0055354 Ga0495639_0055354_206_1159 317
1024 3300046476 Ga0495662_0000223 Ga0495662_0000223_12005_12958 317
1025 3300046476 Ga0495662_0001139 Ga0495662_0001139_9402_10355 317
1026 3300046476 Ga0495662_0028741 Ga0495662_0028741_1535_2530 317
1027 3300046477 Ga0495664_0000003 Ga0495664_0000003_58670_59623 317
1028 3300046477 Ga0495664_0000800 Ga0495664_0000800_2133_3086 317
1029 3300046477 Ga0495664_0017877 Ga0495664_0017877_1984_2937 317
1030 3300046477 Ga0495664_0076038 Ga0495664_0076038_899_1894 317
1031 3300046477 Ga0495664_0132456 Ga0495664_0132456_544_1497 317
1032 3300046492 Ga0495585_0001030 Ga0495585_0001030_14420_15415 317
1033 3300046499 Ga0495594_0002129 Ga0495594_0002129_5219_6172 317
1034 3300046499 Ga0495594_0015379 Ga0495594_0015379_151_1104 317
1035 3300046499 Ga0495594_0026453 Ga0495594_0026453_1882_2835 317
1036 3300046501 Ga0495607_0006002 Ga0495607_0006002_7411_8364 317
1037 3300046501 Ga0495607_0187944 Ga0495607_0187944_25_978 317
1038 3300046511 Ga0495608_0000011 Ga0495608_0000011_4674_5627 317
1039 3300046511 Ga0495608_0000398 Ga0495608_0000398_19942_20898 317
1040 3300046511 Ga0495608_0000911 Ga0495608_0000911_19704_20657 317
1041 3300046511 Ga0495608_0030340 Ga0495608_0030340_649_1602 317
1042 3300046511 Ga0495608_0036267 Ga0495608_0036267_2027_3022 317
1043 3300046511 Ga0495608_0061262 Ga0495608_0061262_101_1054 317
1044 3300046511 Ga0495608_0120492 Ga0495608_0120492_653_1609 317
1045 3300046514 Ga0495618_0000044 Ga0495618_0000044_70503_71456 317
1046 3300046514 Ga0495618_0017292 Ga0495618_0017292_1213_2166 317
1047 3300046514 Ga0495618_0019414 Ga0495618_0019414_528_1484 317
1048 3300046514 Ga0495618_0028428 Ga0495618_0028428_660_1613 317
1049 3300046514 Ga0495618_0067596 Ga0495618_0067596_32_985 317
1050 3300046514 Ga0495618_0069530 Ga0495618_0069530_1013_1966 317
1051 3300046514 Ga0495618_0126539 Ga0495618_0126539_562_1515 317
1052 3300046516 Ga0495628_0000001 Ga0495628_0000001_548071_549024 317
1053 3300046516 Ga0495628_0005139 Ga0495628_0005139_9268_10299 317
1054 3300046516 Ga0495628_0006666 Ga0495628_0006666_9008_9976 317
1055 3300046516 Ga0495628_0024922 Ga0495628_0024922_1670_2626 317
1056 3300046516 Ga0495628_0258755 Ga0495628_0258755_69_1022 317
1057 3300046517 Ga0495630_0000574 Ga0495630_0000574_2710_3663 317
1058 3300046517 Ga0495630_0011656 Ga0495630_0011656_1915_2868 317
1059 3300046517 Ga0495630_0047151 Ga0495630_0047151_179_1132 317
1060 3300046517 Ga0495630_0070201 Ga0495630_0070201_1418_2371 317
1061 3300046517 Ga0495630_0100159 Ga0495630_0100159_652_1605 317
1062 3300046517 Ga0495630_0200181 Ga0495630_0200181_82_1035 317
1063 3300046520 Ga0495637_0054463 Ga0495637_0054463_571_1524 317
1064 3300046523 Ga0495644_0000513 Ga0495644_0000513_36_989 317
1065 3300046524 Ga0495648_0004446 Ga0495648_0004446_8923_9891 317
1066 3300046525 Ga0495663_0053960 Ga0495663_0053960_181_1134 317
1067 3300046526 Ga0495666_0002030 Ga0495666_0002030_7657_8610 317
1068 3300046526 Ga0495666_0009646 Ga0495666_0009646_3238_4191 317
1069 3300046529 Ga0495652_0000002 Ga0495652_0000002_762605_763558 317
1070 3300046529 Ga0495652_0014420 Ga0495652_0014420_4422_5375 317
1071 3300046529 Ga0495652_0016128 Ga0495652_0016128_910_1941 317
1072 3300046529 Ga0495652_0016289 Ga0495652_0016289_4635_5591 317
1073 3300046529 Ga0495652_0032084 Ga0495652_0032084_2769_3722 317
1074 3300046529 Ga0495652_0081927 Ga0495652_0081927_43_996 317
1075 3300046529 Ga0495652_0134264 Ga0495652_0134264_934_1890 317
1076 3300046529 Ga0495652_0136862 Ga0495652_0136862_570_1523 317
1077 3300046531 Ga0495665_0003032 Ga0495665_0003032_2374_3327 317
1078 3300046531 Ga0495665_0004686 Ga0495665_0004686_4818_5771 317
1079 3300046531 Ga0495665_0032349 Ga0495665_0032349_1628_2581 317
1080 3300046531 Ga0495665_0041588 Ga0495665_0041588_179_1147 317
1081 3300046531 Ga0495665_0056169 Ga0495665_0056169_662_1615 317
1082 3300046531 Ga0495665_0074346 Ga0495665_0074346_753_1706 317
1083 3300046533 Ga0495640_0000002 Ga0495640_0000002_2934_3887 317
1084 3300046533 Ga0495640_0000544 Ga0495640_0000544_1877_2830 317
1085 3300046533 Ga0495640_0015185 Ga0495640_0015185_4581_5534 317
1086 3300046533 Ga0495640_0108952 Ga0495640_0108952_426_1379 317
1087 3300046533 Ga0495640_0141892 Ga0495640_0141892_89_1159 317
1088 3300046535 Ga0495586_0037924 Ga0495586_0037924_24_977 317
1089 3300046536 Ga0495587_0000001 Ga0495587_0000001_75340_76293 317
1090 3300046536 Ga0495587_0000599 Ga0495587_0000599_12196_13152 317
1091 3300046536 Ga0495587_0002174 Ga0495587_0002174_6653_7606 317
1092 3300046536 Ga0495587_0003798 Ga0495587_0003798_5452_6405 317
1093 3300046536 Ga0495587_0015799 Ga0495587_0015799_805_1758 317
1094 3300046536 Ga0495587_0048234 Ga0495587_0048234_635_1588 317
1095 3300046536 Ga0495587_0100622 Ga0495587_0100622_196_1152 317
1096 3300046539 Ga0495621_0006662 Ga0495621_0006662_1935_2888 317
1097 3300046543 Ga0495645_0000002 Ga0495645_0000002_548084_549037 317
1098 3300046543 Ga0495645_0008747 Ga0495645_0008747_4619_5572 317
1099 3300046543 Ga0495645_0016750 Ga0495645_0016750_2913_3866 317
1100 3300046543 Ga0495645_0026193 Ga0495645_0026193_219_1175 317
1101 3300046543 Ga0495645_0072642 Ga0495645_0072642_928_1881 317
1102 3300046558 Ga0495633_0004113 Ga0495633_0004113_740_1735 317
1103 3300046558 Ga0495633_0134210 Ga0495633_0134210_174_1127 317
1104 3300046559 Ga0495667_0000039 Ga0495667_0000039_106229_107182 317
1105 3300046559 Ga0495667_0008770 Ga0495667_0008770_2068_3021 317
1106 3300046559 Ga0495667_0023899 Ga0495667_0023899_267_1220 317
1107 3300046559 Ga0495667_0047251 Ga0495667_0047251_1442_2395 317
1108 3300046559 Ga0495667_0056128 Ga0495667_0056128_390_1346 317
1109 3300046615 Ga0495656_0000091 Ga0495656_0000091_28556_29551 317
1110 3300046615 Ga0495656_0046837 Ga0495656_0046837_693_1646 317
1111 3300046642 Ga0495634_0000010 Ga0495634_0000010_93458_94411 317
1112 3300046642 Ga0495634_0023758 Ga0495634_0023758_1771_2724 317
1113 3300046642 Ga0495634_0126332 Ga0495634_0126332_199_1152 317
1114 3300046642 Ga0495634_0182707 Ga0495634_0182707_220_1173 317
1115 3300046660 Ga0495625_0000012 Ga0495625_0000012_81568_82536 317
1116 3300046663 Ga0495635_0000001 Ga0495635_0000001_61164_62117 317
1117 3300046663 Ga0495635_0004203 Ga0495635_0004203_2152_3105 317
1118 3300046663 Ga0495635_0006281 Ga0495635_0006281_6210_7166 317
1119 3300046663 Ga0495635_0018687 Ga0495635_0018687_974_1969 317
1120 3300046664 Ga0495659_0059779 Ga0495659_0059779_429_1382 317
1121 3300046674 Ga0495588_0010028 Ga0495588_0010028_1477_2430 317
1122 3300046674 Ga0495588_0033132 Ga0495588_0033132_50_1003 317
1123 3300046674 Ga0495588_0041177 Ga0495588_0041177_935_1906 317
1124 3300046675 Ga0495657_0000042 Ga0495657_0000042_89750_90703 317
1125 3300046675 Ga0495657_0001942 Ga0495657_0001942_13618_14571 317
1126 3300046675 Ga0495657_0031508 Ga0495657_0031508_805_1758 317
1127 3300046675 Ga0495657_0107094 Ga0495657_0107094_397_1428 317
1128 3300046678 Ga0495599_0000013 Ga0495599_0000013_102589_103542 317
1129 3300046678 Ga0495599_0008880 Ga0495599_0008880_1499_2452 317
1130 3300046678 Ga0495599_0042108 Ga0495599_0042108_772_1725 317
1131 3300046679 Ga0495623_0000050 Ga0495623_0000050_8840_9793 317
1132 3300046679 Ga0495623_0006342 Ga0495623_0006342_1199_2155 317
1133 3300046679 Ga0495623_0028043 Ga0495623_0028043_1473_2504 317
1134 3300046679 Ga0495623_0035033 Ga0495623_0035033_1603_2556 317
1135 3300046679 Ga0495623_0088991 Ga0495623_0088991_805_1758 317
1136 3300046680 Ga0495646_0000009 Ga0495646_0000009_76173_77126 317
1137 3300046680 Ga0495646_0021007 Ga0495646_0021007_1395_2348 317
1138 3300046680 Ga0495646_0090311 Ga0495646_0090311_251_1207 317
1139 3300046680 Ga0495646_0096072 Ga0495646_0096072_643_1596 317
1140 3300046681 Ga0495647_0013620 Ga0495647_0013620_940_1893 317
1141 3300046681 Ga0495647_0057352 Ga0495647_0057352_523_1479 317
1142 3300046683 Ga0495658_0000065 Ga0495658_0000065_29812_30765 317
1143 3300046683 Ga0495658_0003665 Ga0495658_0003665_5095_6048 317
1144 3300046683 Ga0495658_0086163 Ga0495658_0086163_545_1498 317
1145 3300046684 Ga0495669_0038062 Ga0495669_0038062_650_1645 317
1146 3300046689 Ga0495613_0006292 Ga0495613_0006292_7215_8168 317
1147 3300046689 Ga0495613_0009544 Ga0495613_0009544_5512_6465 317
1148 3300046690 Ga0495624_0001118 Ga0495624_0001118_16721_17674 317
1149 3300046690 Ga0495624_0001463 Ga0495624_0001463_6718_7686 317
1150 3300046690 Ga0495624_0011107 Ga0495624_0011107_1341_2294 317
1151 3300046690 Ga0495624_0062489 Ga0495624_0062489_342_1295 317
1152 3300046690 Ga0495624_0082189 Ga0495624_0082189_90_1043 317
1153 3300046691 Ga0495670_0000506 Ga0495670_0000506_4992_5987 317
1154 3300046692 Ga0495671_0068569 Ga0495671_0068569_414_1367 317
1155 3300046692 Ga0495671_0101024 Ga0495671_0101024_48_1043 317
1156 3300046694 Ga0495649_0095725 Ga0495649_0095725_395_1348 317
1157 3300046809 Ga0495600_0001478 Ga0495600_0001478_3308_4264 317
1158 3300046809 Ga0495600_0008371 Ga0495600_0008371_263_1216 317
1159 3300046809 Ga0495600_0016518 Ga0495600_0016518_401_1354 317
1160 3300046809 Ga0495600_0038130 Ga0495600_0038130_926_1957 317
1161 3300046809 Ga0495600_0141975 Ga0495600_0141975_34_990 317
1162 3300046810 Ga0495660_0100064 Ga0495660_0100064_181_1134 317
1163 3300047315 Ga0495581_0002630 Ga0495581_0002630_3389_4342 317
1164 3300047315 Ga0495581_0007122 Ga0495581_0007122_1108_2061 317
1165 3300047315 Ga0495581_0008727 Ga0495581_0008727_3978_4931 317
1166 3300047315 Ga0495581_0036712 Ga0495581_0036712_312_1265 317
1167 3300047315 Ga0495581_0073821 Ga0495581_0073821_992_1945 317
1168 3300047315 Ga0495581_0084489 Ga0495581_0084489_408_1361 317
1169 3300047317 Ga0495604_0000069 Ga0495604_0000069_50089_51042 317
1170 3300047317 Ga0495604_0014602 Ga0495604_0014602_3567_4523 317
1171 3300047317 Ga0495604_0029121 Ga0495604_0029121_2028_2981 317
1172 3300047317 Ga0495604_0073607 Ga0495604_0073607_856_1809 317
1173 3300047317 Ga0495604_0183139 Ga0495604_0183139_450_1403 317
1174 3300047319 Ga0495674_0000002 Ga0495674_0000002_548072_549025 317
1175 3300047319 Ga0495674_0002892 Ga0495674_0002892_6718_7686 317
1176 3300047319 Ga0495674_0033064 Ga0495674_0033064_1711_2664 317
1177 3300047319 Ga0495674_0036782 Ga0495674_0036782_2448_3404 317
1178 3300047319 Ga0495674_0066059 Ga0495674_0066059_601_1554 317
1179 3300047319 Ga0495674_0100049 Ga0495674_0100049_442_1473 317
1180 3300047319 Ga0495674_0126427 Ga0495674_0126427_404_1357 317
1181 3300047319 Ga0495674_0243184 Ga0495674_0243184_448_1404 317
1182 3300047320 Ga0495672_0011413 Ga0495672_0011413_4170_5126 317
1183 3300047320 Ga0495672_0033677 Ga0495672_0033677_749_1717 317
1184 3300047321 Ga0495676_0015401 Ga0495676_0015401_4613_5566 317
1185 3300047321 Ga0495676_0046916 Ga0495676_0046916_2417_3385 317
1186 3300047322 Ga0495680_0000313 Ga0495680_0000313_18938_19894 317
1187 3300047322 Ga0495680_0000328 Ga0495680_0000328_28192_29145 317
1188 3300047322 Ga0495680_0009069 Ga0495680_0009069_1417_2370 317
1189 3300047322 Ga0495680_0014330 Ga0495680_0014330_751_1782 317
1190 3300047322 Ga0495680_0025994 Ga0495680_0025994_231_1184 317
1191 3300047322 Ga0495680_0026513 Ga0495680_0026513_578_1531 317
1192 3300047322 Ga0495680_0049430 Ga0495680_0049430_461_1417 317
1193 3300047322 Ga0495680_0069978 Ga0495680_0069978_759_1712 317
1194 3300047322 Ga0495680_0179285 Ga0495680_0179285_382_1452 317
1195 3300047444 Ga0495675_0000245 Ga0495675_0000245_28183_29136 317
1196 3300047445 Ga0495677_0094565 Ga0495677_0094565_79_1074 317
1197 3300047446 Ga0495679_027413 Ga0495679_027413_664_1659 317
1198 3300047446 Ga0495679_033413 Ga0495679_033413_158_1111 317
1199 3300047469 Ga0495673_0075718 Ga0495673_0075718_207_1160 317
1200 3300047471 Ga0495684_0000016 Ga0495684_0000016_139788_140741 317
1201 3300047471 Ga0495684_0000928 Ga0495684_0000928_19300_20253 317
1202 3300047471 Ga0495684_0001073 Ga0495684_0001073_18280_19233 317
1203 3300047471 Ga0495684_0001824 Ga0495684_0001824_3592_4545 317
1204 3300047471 Ga0495684_0056185 Ga0495684_0056185_150_1103 317
1205 3300047471 Ga0495684_0175543 Ga0495684_0175543_55_1008 317
1206 3300047471 Ga0495684_0364734 Ga0495684_0364734_25_978 317
1207 3300047472 Ga0495686_0001995 Ga0495686_0001995_12434_13402 317
1208 3300047673 Ga0495593_0000809 Ga0495593_0000809_8333_9301 317
1209 3300047673 Ga0495593_0001500 Ga0495593_0001500_2825_3778 317
1210 3300047673 Ga0495593_0004700 Ga0495593_0004700_6205_7158 317
1211 3300047673 Ga0495593_0033052 Ga0495593_0033052_42_995 317
1212 3300047673 Ga0495593_0061049 Ga0495593_0061049_422_1375 317
1213 3300047673 Ga0495593_0082694 Ga0495593_0082694_52_1005 317
1214 3300048088 Ga0495602_0000024 Ga0495602_0000024_140222_141175 317
1215 3300048088 Ga0495602_0005919 Ga0495602_0005919_10902_11858 317
1216 3300048088 Ga0495602_0021956 Ga0495602_0021956_1079_2110 317
1217 3300048089 Ga0495614_0003207 Ga0495614_0003207_2573_3526 317
1218 3300048903 Ga0496100_0002405 Ga0496100_0002405_608_1573 317
1219 3300048903 Ga0496100_0003039 Ga0496100_0003039_719_1672 317
1220 3300048903 Ga0496100_0016920 Ga0496100_0016920_2207_3160 317
1221 3300048903 Ga0496100_0050540 Ga0496100_0050540_499_1452 317
1222 3300048903 Ga0496100_0200898 Ga0496100_0200898_349_1305 317
1223 3300048903 Ga0496100_0384940 Ga0496100_0384940_21_974 317
1224 3300048904 Ga0496101_0001763 Ga0496101_0001763_6636_7637 317
1225 3300048904 Ga0496101_0003783 Ga0496101_0003783_1889_2842 317
1226 3300048904 Ga0496101_0015757 Ga0496101_0015757_3531_4484 317
1227 3300048904 Ga0496101_0044395 Ga0496101_0044395_1731_2696 317
1228 3300048904 Ga0496101_0060405 Ga0496101_0060405_1381_2334 317
1229 3300048904 Ga0496101_0178331 Ga0496101_0178331_239_1192 317
1230 3300048904 Ga0496101_0235241 Ga0496101_0235241_16_972 317
1231 3300048904 Ga0496101_0321250 Ga0496101_0321250_218_1171 317
1232 3300048904 Ga0496101_0413151 Ga0496101_0413151_47_1000 317
1233 3300048905 Ga0496102_0005532 Ga0496102_0005532_3242_4252 317
1234 3300048905 Ga0496102_0011515 Ga0496102_0011515_3313_4266 317
1235 3300048905 Ga0496102_0112166 Ga0496102_0112166_559_1515 317
1236 3300048905 Ga0496102_0129686 Ga0496102_0129686_512_1477 317
1237 3300048906 Ga0496103_0003142 Ga0496103_0003142_5746_6756 317
1238 3300048906 Ga0496103_0005741 Ga0496103_0005741_1563_2516 317
1239 3300048906 Ga0496103_0009796 Ga0496103_0009796_975_1928 317
1240 3300048906 Ga0496103_0010831 Ga0496103_0010831_4289_5242 317
1241 3300048906 Ga0496103_0022961 Ga0496103_0022961_566_1531 317
1242 3300048907 Ga0496104_0000217 Ga0496104_0000217_1976_2929 317
1243 3300048907 Ga0496104_0001920 Ga0496104_0001920_16700_17701 317
1244 3300048907 Ga0496104_0002202 Ga0496104_0002202_15369_16322 317
1245 3300048907 Ga0496104_0041321 Ga0496104_0041321_837_1802 317
1246 3300048907 Ga0496104_0043848 Ga0496104_0043848_2959_3912 317
1247 3300048907 Ga0496104_0107613 Ga0496104_0107613_1473_2426 317
1248 3300048907 Ga0496104_0140324 Ga0496104_0140324_1351_2304 317
1249 3300048907 Ga0496104_0292062 Ga0496104_0292062_18_971 317
1250 3300048908 Ga0496105_0008853 Ga0496105_0008853_6472_7425 317
1251 3300048908 Ga0496105_0010753 Ga0496105_0010753_5367_6320 317
1252 3300048908 Ga0496105_0020488 Ga0496105_0020488_2644_3597 317
1253 3300048908 Ga0496105_0090307 Ga0496105_0090307_1551_2504 317
1254 3300048908 Ga0496105_0250926 Ga0496105_0250926_172_1137 317
1255 3300048909 Ga0496106_0005882 Ga0496106_0005882_255_1256 317
1256 3300048909 Ga0496106_0007383 Ga0496106_0007383_218_1228 317
1257 3300048909 Ga0496106_0008421 Ga0496106_0008421_85_1050 317
1258 3300048909 Ga0496106_0017304 Ga0496106_0017304_3629_4582 317
1259 3300048909 Ga0496106_0026339 Ga0496106_0026339_1656_2609 317
1260 3300048909 Ga0496106_0026733 Ga0496106_0026733_1782_2735 317
1261 3300048909 Ga0496106_0253802 Ga0496106_0253802_152_1105 317
1262 3300048910 Ga0496107_0000509 Ga0496107_0000509_5101_6054 317
1263 3300048910 Ga0496107_0003427 Ga0496107_0003427_418_1371 317
1264 3300048910 Ga0496107_0019213 Ga0496107_0019213_2028_2981 317
1265 3300048910 Ga0496107_0040165 Ga0496107_0040165_323_1276 317
1266 3300048910 Ga0496107_0099576 Ga0496107_0099576_196_1161 317
1267 3300048910 Ga0496107_0222569 Ga0496107_0222569_414_1367 317
1268 3300048910 Ga0496107_0229736 Ga0496107_0229736_359_1369 317
1269 3300048910 Ga0496107_0371454 Ga0496107_0371454_89_1054 317
1270 3300048911 Ga0496108_0010986 Ga0496108_0010986_1571_2524 317
1271 3300048911 Ga0496108_0062932 Ga0496108_0062932_933_1886 317
1272 3300048911 Ga0496108_0080066 Ga0496108_0080066_672_1625 317
1273 3300048911 Ga0496108_0154080 Ga0496108_0154080_241_1206 317
1274 3300048911 Ga0496108_0253034 Ga0496108_0253034_558_1511 317
1275 3300048911 Ga0496108_0319159 Ga0496108_0319159_11_964 317
1276 3300048912 Ga0496109_0013194 Ga0496109_0013194_1066_2019 317
1277 3300048912 Ga0496109_0016348 Ga0496109_0016348_4358_5311 317
1278 3300048912 Ga0496109_0017528 Ga0496109_0017528_4694_5647 317
1279 3300048912 Ga0496109_0066202 Ga0496109_0066202_1349_2359 317
1280 3300048912 Ga0496109_0119756 Ga0496109_0119756_1024_2034 317
1281 3300048913 Ga0496110_0002430 Ga0496110_0002430_10694_11647 317
1282 3300048913 Ga0496110_0003313 Ga0496110_0003313_7966_8967 317
1283 3300048913 Ga0496110_0005366 Ga0496110_0005366_2705_3715 317
1284 3300048913 Ga0496110_0014024 Ga0496110_0014024_1991_2944 317
1285 3300048913 Ga0496110_0034472 Ga0496110_0034472_3140_4093 317
1286 3300048913 Ga0496110_0045595 Ga0496110_0045595_2153_3106 317
1287 3300048913 Ga0496110_0097096 Ga0496110_0097096_1151_2104 317
1288 3300048913 Ga0496110_0098571 Ga0496110_0098571_1123_2076 317
1289 3300048913 Ga0496110_0127002 Ga0496110_0127002_44_997 317
1290 3300048913 Ga0496110_0218297 Ga0496110_0218297_555_1511 317
1291 3300048914 Ga0496111_0002323 Ga0496111_0002323_7792_8745 317
1292 3300048914 Ga0496111_0003314 Ga0496111_0003314_667_1668 317
1293 3300048914 Ga0496111_0003533 Ga0496111_0003533_2312_3265 317
1294 3300048914 Ga0496111_0011769 Ga0496111_0011769_16_969 317
1295 3300048914 Ga0496111_0042567 Ga0496111_0042567_1540_2550 317
1296 3300048914 Ga0496111_0044287 Ga0496111_0044287_1544_2497 317
1297 3300048914 Ga0496111_0047206 Ga0496111_0047206_986_1939 317
1298 3300048914 Ga0496111_0055762 Ga0496111_0055762_1699_2664 317
1299 3300048914 Ga0496111_0063460 Ga0496111_0063460_488_1441 317
1300 3300048914 Ga0496111_0103789 Ga0496111_0103789_439_1392 317
1301 3300048915 Ga0496112_0009043 Ga0496112_0009043_4436_5392 317
1302 3300048915 Ga0496112_0013631 Ga0496112_0013631_1259_2212 317
1303 3300048915 Ga0496112_0022357 Ga0496112_0022357_465_1418 317
1304 3300048915 Ga0496112_0054415 Ga0496112_0054415_374_1330 317
1305 3300048915 Ga0496112_0090794 Ga0496112_0090794_1797_2762 317
1306 3300048915 Ga0496112_0090957 Ga0496112_0090957_218_1228 317
1307 3300048915 Ga0496112_0121718 Ga0496112_0121718_142_1143 317
1308 3300048916 Ga0496113_0008621 Ga0496113_0008621_3710_4663 317
1309 3300048916 Ga0496113_0011117 Ga0496113_0011117_2163_3173 317
1310 3300048916 Ga0496113_0026670 Ga0496113_0026670_2813_3814 317
1311 3300048916 Ga0496113_0126245 Ga0496113_0126245_814_1767 317
1312 3300048917 Ga0496114_0001306 Ga0496114_0001306_5585_6538 317
1313 3300048917 Ga0496114_0014735 Ga0496114_0014735_4710_5675 317
1314 3300048917 Ga0496114_0044883 Ga0496114_0044883_938_1891 317
1315 3300048917 Ga0496114_0076917 Ga0496114_0076917_1709_2662 317
1316 3300048917 Ga0496114_0077791 Ga0496114_0077791_848_1801 317
1317 3300048917 Ga0496114_0210099 Ga0496114_0210099_667_1668 317
1318 3300048918 Ga0496115_0011530 Ga0496115_0011530_2803_3756 317
1319 3300048918 Ga0496115_0014069 Ga0496115_0014069_632_1585 317
1320 3300048918 Ga0496115_0042694 Ga0496115_0042694_1313_2266 317
1321 3300048918 Ga0496115_0047308 Ga0496115_0047308_1045_2136 317
1322 3300048918 Ga0496115_0063814 Ga0496115_0063814_2008_2961 317
1323 3300048918 Ga0496115_0104992 Ga0496115_0104992_597_1562 317
1324 3300048918 Ga0496115_0245420 Ga0496115_0245420_290_1243 317
1325 3300048918 Ga0496115_0271854 Ga0496115_0271854_330_1295 317
1326 3300048922 Ga0496119_0002669 Ga0496119_0002669_13810_14763 317
1327 3300048924 Ga0496121_0039594 Ga0496121_0039594_451_1461 317
1328 3300048925 Ga0496122_0002391 Ga0496122_0002391_2792_3745 317
1329 3300048926 Ga0496123_0003029 Ga0496123_0003029_10198_11151 317
1330 3300049569 Ga0501032_0289553 Ga0501032_0289553_55_1008 317
1331 3300049570 Ga0501033_0010955 Ga0501033_0010955_4505_5458 317
1332 3300049570 Ga0501033_0060740 Ga0501033_0060740_1304_2257 317
1333 3300049570 Ga0501033_0077246 Ga0501033_0077246_529_1482 317
1334 3300049570 Ga0501033_0223876 Ga0501033_0223876_107_1063 317
1335 3300049571 Ga0501034_0000593 Ga0501034_0000593_46628_47581 317
1336 3300049571 Ga0501034_0003588 Ga0501034_0003588_1067_2020 317
1337 3300049571 Ga0501034_0074896 Ga0501034_0074896_1274_2227 317
1338 3300049571 Ga0501034_0098547 Ga0501034_0098547_1137_2090 317
1339 3300049571 Ga0501034_0116919 Ga0501034_0116919_307_1260 317
1340 3300049571 Ga0501034_0508197 Ga0501034_0508197_128_1081 317
1341 3300049572 Ga0501036_0001313 Ga0501036_0001313_16507_17460 317
1342 3300049572 Ga0501036_0042140 Ga0501036_0042140_66_1022 317
1343 3300049572 Ga0501036_0081419 Ga0501036_0081419_538_1494 317
1344 3300049572 Ga0501036_0126272 Ga0501036_0126272_994_1947 317
1345 3300049572 Ga0501036_0178315 Ga0501036_0178315_394_1350 317
1346 3300049573 Ga0501037_0016752 Ga0501037_0016752_989_1966 317
1347 3300049573 Ga0501037_0021673 Ga0501037_0021673_2970_3923 317
1348 3300049573 Ga0501037_0046626 Ga0501037_0046626_2206_3159 317
1349 3300049573 Ga0501037_0098724 Ga0501037_0098724_161_1114 317
1350 3300049574 Ga0501038_0007428 Ga0501038_0007428_5084_6037 317
1351 3300049574 Ga0501038_0063407 Ga0501038_0063407_795_1748 317
1352 3300049574 Ga0501038_0264128 Ga0501038_0264128_337_1293 317
1353 3300049574 Ga0501038_0303510 Ga0501038_0303510_282_1235 317
1354 3300049575 Ga0501039_0022541 Ga0501039_0022541_3256_4212 317
1355 3300049575 Ga0501039_0069025 Ga0501039_0069025_53_1006 317
1356 3300049575 Ga0501039_0130674 Ga0501039_0130674_842_1795 317
1357 3300049575 Ga0501039_0314428 Ga0501039_0314428_29_982 317
1358 3300049576 Ga0501040_0032088 Ga0501040_0032088_1372_2349 317
1359 3300049578 Ga0501042_0195303 Ga0501042_0195303_70_1026 317
1360 3300049579 Ga0501043_0032193 Ga0501043_0032193_829_1782 317
1361 3300049579 Ga0501043_0063574 Ga0501043_0063574_469_1455 317
1362 3300049579 Ga0501043_0083864 Ga0501043_0083864_475_1452 317
1363 3300049579 Ga0501043_0102847 Ga0501043_0102847_1181_2137 317
1364 3300049580 Ga0501046_0002900 Ga0501046_0002900_9403_10356 317
1365 3300049580 Ga0501046_0005890 Ga0501046_0005890_8128_9081 317
1366 3300049580 Ga0501046_0127900 Ga0501046_0127900_781_1734 317
1367 3300049581 Ga0501047_0001425 Ga0501047_0001425_11099_12052 317
1368 3300049581 Ga0501047_0048449 Ga0501047_0048449_2159_3112 317
1369 3300049581 Ga0501047_0097901 Ga0501047_0097901_829_1782 317
1370 3300049581 Ga0501047_0126688 Ga0501047_0126688_279_1232 317
1371 3300049581 Ga0501047_0128295 Ga0501047_0128295_1200_2153 317
1372 3300049581 Ga0501047_0131968 Ga0501047_0131968_178_1131 317
1373 3300049582 Ga0501048_0001752 Ga0501048_0001752_819_1772 317
1374 3300049582 Ga0501048_0015643 Ga0501048_0015643_2136_3092 317
1375 3300049582 Ga0501048_0193556 Ga0501048_0193556_81_1034 317
1376 3300049582 Ga0501048_0281688 Ga0501048_0281688_152_1114 317
1377 3300049583 Ga0501067_0023420 Ga0501067_0023420_2344_3306 317
1378 3300049585 Ga0501069_0003119 Ga0501069_0003119_6559_7512 317
1379 3300049586 Ga0501070_0020547 Ga0501070_0020547_4004_4957 317
1380 3300049586 Ga0501070_0056637 Ga0501070_0056637_1529_2482 317
1381 3300049586 Ga0501070_0094072 Ga0501070_0094072_921_1874 317
1382 3300049586 Ga0501070_0114437 Ga0501070_0114437_539_1492 317
1383 3300049586 Ga0501070_0141509 Ga0501070_0141509_459_1421 317
1384 3300049587 Ga0501071_0222903 Ga0501071_0222903_345_1301 317
1385 3300049588 Ga0501072_0040845 Ga0501072_0040845_1612_2574 317
1386 3300049588 Ga0501072_0074044 Ga0501072_0074044_770_1723 317
1387 3300049588 Ga0501072_0111280 Ga0501072_0111280_816_1769 317
1388 3300049589 Ga0501073_0060235 Ga0501073_0060235_693_1646 317
1389 3300049589 Ga0501073_0063745 Ga0501073_0063745_601_1563 317
1390 3300049590 Ga0501074_0003293 Ga0501074_0003293_9076_10029 317
1391 3300049590 Ga0501074_0053538 Ga0501074_0053538_1081_2034 317
1392 3300049590 Ga0501074_0085454 Ga0501074_0085454_783_1739 317
1393 3300049591 Ga0501075_0135541 Ga0501075_0135541_524_1477 317
1394 3300049592 Ga0501076_0050078 Ga0501076_0050078_627_1580 317
1395 3300049592 Ga0501076_0091065 Ga0501076_0091065_1061_2014 317
1396 3300049592 Ga0501076_0124978 Ga0501076_0124978_524_1480 317
1397 3300049593 Ga0501077_0019666 Ga0501077_0019666_1450_2406 317
1398 3300049593 Ga0501077_0085097 Ga0501077_0085097_168_1121 317
1399 3300049741 Ga0501079_0066375 Ga0501079_0066375_835_1788 317
1400 3300049741 Ga0501079_0085626 Ga0501079_0085626_659_1612 317
1401 3300049741 Ga0501079_0219527 Ga0501079_0219527_381_1334 317
1402 3300049741 Ga0501079_0402719 Ga0501079_0402719_86_1039 317
1403 3300049742 Ga0501080_0002905 Ga0501080_0002905_9111_10064 317
1404 3300049742 Ga0501080_0015270 Ga0501080_0015270_999_1952 317
1405 3300049742 Ga0501080_0025023 Ga0501080_0025023_4453_5430 317
1406 3300049742 Ga0501080_0027138 Ga0501080_0027138_4210_5163 317
1407 3300049742 Ga0501080_0081094 Ga0501080_0081094_296_1291 317
1408 3300049742 Ga0501080_0092084 Ga0501080_0092084_493_1446 317
1409 3300049742 Ga0501080_0303916 Ga0501080_0303916_314_1267 317
1410 3300049743 Ga0501081_0000115 Ga0501081_0000115_4129_5106 317
1411 3300049743 Ga0501081_0041663 Ga0501081_0041663_1428_2384 317
1412 3300049743 Ga0501081_0065915 Ga0501081_0065915_146_1099 317
1413 3300049744 Ga0501083_0000907 Ga0501083_0000907_9991_10944 317
1414 3300049744 Ga0501083_0051915 Ga0501083_0051915_730_1683 317
1415 3300049744 Ga0501083_0066550 Ga0501083_0066550_1337_2299 317
1416 3300049744 Ga0501083_0137240 Ga0501083_0137240_255_1211 317
1417 3300049822 Ga0501035_0000672 Ga0501035_0000672_27942_28904 317
1418 3300049822 Ga0501035_0129635 Ga0501035_0129635_111_1064 317
1419 3300049822 Ga0501035_0222623 Ga0501035_0222623_85_1110 317
1420 3300049822 Ga0501035_0385350 Ga0501035_0385350_60_1013 317
1421 3300049823 Ga0501044_0003604 Ga0501044_0003604_4818_5771 317
1422 3300049823 Ga0501044_0005514 Ga0501044_0005514_10553_11506 317
1423 3300049823 Ga0501044_0011063 Ga0501044_0011063_2044_2997 317
1424 3300049823 Ga0501044_0036817 Ga0501044_0036817_2489_3451 317
1425 3300049823 Ga0501044_0312533 Ga0501044_0312533_18_1043 317
1426 3300049824 Ga0501045_0069102 Ga0501045_0069102_1379_2335 317
1427 3300050489 nmdc:mga03683_111459_c1 nmdc:mga03683_111459_c1_18_971 317
1428 3300050489 nmdc:mga03683_2647_c2 nmdc:mga03683_2647_c2_1567_2520 317
1429 3300050492 nmdc:mga0yw44_103397_c1 nmdc:mga0yw44_103397_c1_286_1239 317
1430 3300050492 nmdc:mga0yw44_78820_c1 nmdc:mga0yw44_78820_c1_643_1599 317
1431 3300050493 nmdc:mga0k408_6014_c1 nmdc:mga0k408_6014_c1_888_1841 317
1432 3300050494 nmdc:mga06z11_68606_c1 nmdc:mga06z11_68606_c1_611_1576 317
1433 3300050496 nmdc:mga07m45_14790_c1 nmdc:mga07m45_14790_c1_2490_3443 317
1434 3300050496 nmdc:mga07m45_69058_c1 nmdc:mga07m45_69058_c1_958_1911 317
1435 3300050507 nmdc:mga05p37_151_c1 nmdc:mga05p37_151_c1_26234_27187 317
1436 3300050507 nmdc:mga05p37_158006_c1 nmdc:mga05p37_158006_c1_1436_2389 317
1437 3300050507 nmdc:mga05p37_19658_c1 nmdc:mga05p37_19658_c1_6433_7386 317
1438 3300050507 nmdc:mga05p37_354005_c1 nmdc:mga05p37_354005_c1_366_1319 317
1439 3300050507 nmdc:mga05p37_486326_c1 nmdc:mga05p37_486326_c1_154_1107 317
1440 3300050507 nmdc:mga05p37_7272_c1 nmdc:mga05p37_7272_c1_2563_3516 317
1441 3300050507 nmdc:mga05p37_76_c1 nmdc:mga05p37_76_c1_72086_73039 317
1442 3300050507 nmdc:mga05p37_835274_c1 nmdc:mga05p37_835274_c1_39_992 317
1443 3300050508 nmdc:mga09592_41035_c1 nmdc:mga09592_41035_c1_2027_2980 317
1444 3300050508 nmdc:mga09592_6099_c1 nmdc:mga09592_6099_c1_7815_8768 317
1445 3300050509 nmdc:mga0qj67_61979_c1 nmdc:mga0qj67_61979_c1_785_1738 317
1446 3300050509 nmdc:mga0qj67_842_c1 nmdc:mga0qj67_842_c1_14488_15441 317
1447 3300050510 nmdc:mga06r32_114164_c1 nmdc:mga06r32_114164_c1_722_1675 317
1448 3300050510 nmdc:mga06r32_134_c1 nmdc:mga06r32_134_c1_14378_15331 317
1449 3300050510 nmdc:mga06r32_755_c1 nmdc:mga06r32_755_c1_15299_16252 317
1450 3300050510 nmdc:mga06r32_95862_c1 nmdc:mga06r32_95862_c1_1515_2468 317
1451 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_45157_46110 317
1452 3300050511 nmdc:mga08y16_13020_c1 nmdc:mga08y16_13020_c1_1341_2294 317
1453 3300050511 nmdc:mga08y16_16965_c1 nmdc:mga08y16_16965_c1_6511_7464 317
1454 3300050511 nmdc:mga08y16_204344_c1 nmdc:mga08y16_204344_c1_545_1498 317
1455 3300050511 nmdc:mga08y16_294692_c1 nmdc:mga08y16_294692_c1_36_989 317
1456 3300050511 nmdc:mga08y16_376567_c1 nmdc:mga08y16_376567_c1_92_1045 317
1457 3300050511 nmdc:mga08y16_4279_c1 nmdc:mga08y16_4279_c1_6697_7650 317
1458 3300050511 nmdc:mga08y16_5583_c1 nmdc:mga08y16_5583_c1_11884_12837 317
1459 3300050512 nmdc:mga0n895_265_c1 nmdc:mga0n895_265_c1_29860_30813 317
1460 3300050512 nmdc:mga0n895_2995_c1 nmdc:mga0n895_2995_c1_6312_7265 317
1461 3300050512 nmdc:mga0n895_35580_c1 nmdc:mga0n895_35580_c1_2941_3894 317
1462 3300050513 nmdc:mga0rr50_362627_c1 nmdc:mga0rr50_362627_c1_155_1108 317
1463 3300050513 nmdc:mga0rr50_60567_c1 nmdc:mga0rr50_60567_c1_1503_2456 317
1464 3300050513 nmdc:mga0rr50_642_c1 nmdc:mga0rr50_642_c1_13935_14888 317
1465 3300050514 nmdc:mga08x19_35_c1 nmdc:mga08x19_35_c1_71997_73004 317
1466 3300050514 nmdc:mga08x19_8004_c1 nmdc:mga08x19_8004_c1_2399_3352 317
1467 3300050515 nmdc:mga0a205_1049_c1 nmdc:mga0a205_1049_c1_4993_5946 317
1468 3300050515 nmdc:mga0a205_146_c1 nmdc:mga0a205_146_c1_12720_13673 317
1469 3300050515 nmdc:mga0a205_315959_c1 nmdc:mga0a205_315959_c1_377_1330 317
1470 3300053077 Ga0495601_0000001 Ga0495601_0000001_483302_484255 317
1471 3300053077 Ga0495601_0000355 Ga0495601_0000355_2014_3045 317
1472 3300053077 Ga0495601_0000589 Ga0495601_0000589_5488_6444 317
1473 3300053077 Ga0495601_0002218 Ga0495601_0002218_2703_3656 317
1474 3300053077 Ga0495601_0027567 Ga0495601_0027567_933_1886 317
1475 3300053077 Ga0495601_0041071 Ga0495601_0041071_694_1647 317
1476 3300053077 Ga0495601_0052633 Ga0495601_0052633_235_1188 317
1477 3300053077 Ga0495601_0174202 Ga0495601_0174202_53_1009 317
1478 3300053078 Ga0495612_0000017 Ga0495612_0000017_75087_76040 317
1479 3300053078 Ga0495612_0001305 Ga0495612_0001305_7314_8267 317
1480 3300053078 Ga0495612_0002281 Ga0495612_0002281_6007_6960 317
1481 3300053078 Ga0495612_0002637 Ga0495612_0002637_2072_3028 317
1482 3300053078 Ga0495612_0005030 Ga0495612_0005030_2912_3865 317
1483 3300053078 Ga0495612_0030943 Ga0495612_0030943_1073_2029 317
1484 3300053084 Ga0495595_0000010 Ga0495595_0000010_102565_103518 317
1485 3300053084 Ga0495595_0002470 Ga0495595_0002470_2021_2974 317
1486 3300053084 Ga0495595_0005994 Ga0495595_0005994_1103_2059 317
1487 3300053084 Ga0495595_0010133 Ga0495595_0010133_2156_3109 317
1488 3300053084 Ga0495595_0010381 Ga0495595_0010381_732_1688 317
1489 3300053084 Ga0495595_0027953 Ga0495595_0027953_1531_2484 317
1490 3300053085 Ga0495619_0000004 Ga0495619_0000004_483339_484292 317
1491 3300053085 Ga0495619_0000048 Ga0495619_0000048_49321_50274 317
1492 3300053085 Ga0495619_0000256 Ga0495619_0000256_27731_28684 317
1493 3300053085 Ga0495619_0004051 Ga0495619_0004051_3509_4462 317
1494 3300053085 Ga0495619_0005443 Ga0495619_0005443_3811_4767 317
1495 3300053085 Ga0495619_0007179 Ga0495619_0007179_4388_5341 317
1496 3300053085 Ga0495619_0016131 Ga0495619_0016131_2630_3583 317
1497 3300053085 Ga0495619_0027188 Ga0495619_0027188_2288_3241 317
1498 3300053085 Ga0495619_0108884 Ga0495619_0108884_404_1357 317
1499 3300053085 Ga0495619_0131097 Ga0495619_0131097_132_1085 317
1500 3300053088 Ga0500644_0000933 Ga0500644_0000933_1651_2604 317
1501 3300053093 Ga0500651_0037963 Ga0500651_0037963_257_1210 317
1502 3300053093 Ga0500651_0102768 Ga0500651_0102768_645_1598 317
1503 3300053096 Ga0500641_0019072 Ga0500641_0019072_855_1817 317
1504 3300053104 Ga0500556_0000068 Ga0500556_0000068_59887_60840 317
1505 3300053119 Ga0500595_000003 Ga0500595_000003_143087_144040 317
1506 3300053119 Ga0500595_026787 Ga0500595_026787_360_1313 317
1507 3300053131 Ga0500652_001172 Ga0500652_001172_6389_7345 317
1508 3300053131 Ga0500652_039202 Ga0500652_039202_307_1260 317
1509 3300053131 Ga0500652_068971 Ga0500652_068971_470_1423 317
1510 3300053153 Ga0500616_0000002 Ga0500616_0000002_1329658_1330611 317
1511 3300053153 Ga0500616_0004397 Ga0500616_0004397_631_1584 317
1512 3300053153 Ga0500616_0089834 Ga0500616_0089834_514_1467 317
1513 3300053730 Ga0500645_000078 Ga0500645_000078_59997_60950 317
1514 3300053730 Ga0500645_008422 Ga0500645_008422_2117_3070 317
1515 3300054114 Ga0501084_0034716 Ga0501084_0034716_113_1090 317
1516 3300054114 Ga0501084_0128439 Ga0501084_0128439_736_1692 317
1517 3300054114 Ga0501084_0287667 Ga0501084_0287667_312_1268 317
1518 3300054114 Ga0501084_0307775 Ga0501084_0307775_90_1043 317
1519 3300054114 Ga0501084_0332364 Ga0501084_0332364_68_1021 317
1520 3300060353 Ga0501082_0000510 Ga0501082_0000510_22945_23901 317
1521 3300060353 Ga0501082_0030402 Ga0501082_0030402_2528_3505 317
1522 3300060353 Ga0501082_0038034 Ga0501082_0038034_1382_2407 317
1523 3300060353 Ga0501082_0051708 Ga0501082_0051708_649_1602 317
1524 3300060353 Ga0501082_0095928 Ga0501082_0095928_287_1243 317
1525 3300060353 Ga0501082_0429790 Ga0501082_0429790_105_1058 317
1526 3300061734 Ga0530510_0114950 Ga0530510_0114950_545_1498 317
1527 3300061734 Ga0530510_0262622 Ga0530510_0262622_116_1069 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

120

317

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.8966 17 317
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.8908 17 317
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.8906 14 317
5ibz-assembly1.cif.gz_B crystal structure of a novel cyclase (pfam04199). 0.8872 14 317
5ibz-assembly1.cif.gz_C crystal structure of a novel cyclase (pfam04199). 0.8785 17 317
ID Description Score Start End Superfamily
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7846 51 315 3.50.30.50
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7745 51 315 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7675 51 315 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7554 51 316 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7486 49 315 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A849GSB7-F1-model_v4 Cyclase family protein 0.9942 118 317 GO:0004061
GO:0019441
AF-A0A848TGR9-F1-model_v4 Cyclase family protein 0.9894 196 317 GO:0004061
GO:0019441
AF-A0A849GSB7-F1-model_v4 Cyclase family protein 0.9844 118 317 GO:0004061
GO:0019441
AF-A0A7W5AG36-F1-model_v4 Kynurenine formamidase 0.9836 157 317 GO:0004061
GO:0019441
AF-A0A2V6Y4V2-F1-model_v4 Cyclase 0.9832 180 317 GO:0004061
GO:0019441

Feature Viewer

pLDDT pTM Quality
91.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map