F494568

General Info

Members Datasets Scaffolds Average Seq Length
1526 439 1526 285

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10004959|Ga0316579_100049592
Length 281
Sequence VIKKIFVVGAGTMGNGIAQTAAVAGYDVVMMDVDAGQIEKAREVIARSVEKLFQKERISQEGRDQALGIQTTLTYEGIEDADLVIEAATENYPLKEKIFREMDHKAPAKAILASNTSSISLTRLAAATGRPEKVIGMHFMNPVPLMKLVEVIRGLDTSDETTQAVVEAAEAMGKVAVESADSPGFISNRILCPMINEAVFALQEGVGTPEAIDEVMKLGMNHPMGPLTLADLIGLDVVLSVMEVLQEDLGEDKYRPAYLLKKMVAAGHLGRKTGRGFYTYD

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
218 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
219 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
220 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
221 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
252 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
253 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
254 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
256 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
262 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
274 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
284 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
285 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
286 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
287 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
288 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
289 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
290 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
291 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
292 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
293 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
298 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
299 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
300 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
301 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
304 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
305 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
306 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
307 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
314 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
315 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
335 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
336 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
337 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
338 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
344 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
349 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
350 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
351 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
358 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
359 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
380 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
381 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
391 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
395 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
396 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
397 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
398 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
399 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
400 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
401 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
402 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
403 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
404 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
405 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
406 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
407 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
408 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
409 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
410 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
411 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
412 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
413 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
414 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
415 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
416 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
417 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
418 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
425 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
430 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
431 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
434 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
435 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
436 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
437 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
438 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 1.44
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 2.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2561847 2162886006 Bacteria 1055
2 JGI24034J26672_10000005 3300002239 Bacteria 404185
3 JGI24751J29686_10000249 3300002459 Bacteria 21224
4 JGI25159J45721_1015439 3300002987 Bacteria 1672
5 JGI25151J46595_10003245 3300003187 Bacteria 9054
6 JGI25151J46595_10010930 3300003187 Bacteria 4195
7 rootH1_10160702 3300003323 Bacteria 2766
8 Ga0055538_1000128 3300003751 Bacteria 55980
9 Ga0055532_1002260 3300003758 Bacteria 4187
10 Ga0055528_1004453 3300003790 Bacteria 6750
11 Ga0065704_10085743 3300005289 Bacteria 3190
12 Ga0065704_10165084 3300005289 Bacteria 1323
13 Ga0065704_10201625 3300005289 Bacteria 1144
14 Ga0065712_10067741 3300005290 Bacteria 78248
15 Ga0065712_10092799 3300005290 Bacteria 2318
16 Ga0065715_10017326 3300005293 Bacteria 2393
17 Ga0065715_10089000 3300005293 Bacteria 17514
18 Ga0065715_10089598 3300005293 Bacteria 9292
19 Ga0065715_10100462 3300005293 Bacteria 3301
20 Ga0065715_10124152 3300005293 Bacteria 2159
21 Ga0065715_10185327 3300005293 Bacteria 1428
22 Ga0065707_10001483 3300005295 Bacteria 6858
23 Ga0065707_10093821 3300005295 Bacteria 3570
24 Ga0065707_10095917 3300005295 Bacteria 3324
25 Ga0065707_10111856 3300005295 Bacteria 2381
26 Ga0065707_10155041 3300005295 Bacteria 1617
27 Ga0070658_10041880 3300005327 Bacteria 3694
28 Ga0070658_10118424 3300005327 Bacteria 2199
29 Ga0070676_10009312 3300005328 Bacteria 5311
30 Ga0070683_100007595 3300005329 Bacteria 9168
31 Ga0070683_100017774 3300005329 Bacteria 6284
32 Ga0070683_100190087 3300005329 Bacteria 1949
33 Ga0070683_100214295 3300005329 Bacteria 1830
34 Ga0070690_100001189 3300005330 Bacteria 13425
35 Ga0070690_100017664 3300005330 Bacteria 4295
36 Ga0070690_100028961 3300005330 Bacteria 3432
37 Ga0070690_100086527 3300005330 Bacteria 2057
38 Ga0070690_100087534 3300005330 Bacteria 2046
39 Ga0070690_100108794 3300005330 Bacteria 1847
40 Ga0070690_100385971 3300005330 Bacteria 1025
41 Ga0070670_100000118 3300005331 Bacteria 73231
42 Ga0070670_100017304 3300005331 Bacteria 6182
43 Ga0070670_100122037 3300005331 Bacteria 2248
44 Ga0070670_100324305 3300005331 Bacteria 1350
45 Ga0070677_10030271 3300005333 Bacteria 2060
46 Ga0070677_10066622 3300005333 Bacteria 1502
47 Ga0068869_100041527 3300005334 Bacteria 3295
48 Ga0068869_100042834 3300005334 Bacteria 3248
49 Ga0068869_100044303 3300005334 Bacteria 3199
50 Ga0068869_100110681 3300005334 Bacteria 2089
51 Ga0068869_100211380 3300005334 Bacteria 1534
52 Ga0068869_100240922 3300005334 Bacteria 1441
53 Ga0070666_10002354 3300005335 Bacteria 11421
54 Ga0070666_10006000 3300005335 Bacteria 7465
55 Ga0070666_10066628 3300005335 Bacteria 2444
56 Ga0070666_10272846 3300005335 Bacteria 1201
57 Ga0070680_100000106 3300005336 Bacteria 48502
58 Ga0070680_100017984 3300005336 Bacteria 5581
59 Ga0070680_100019737 3300005336 Bacteria 5345
60 Ga0070680_100030090 3300005336 Bacteria 4360
61 Ga0070680_100043957 3300005336 Bacteria 3629
62 Ga0070680_100271412 3300005336 Bacteria 1436
63 Ga0070682_100000007 3300005337 Bacteria 346590
64 Ga0070682_100000068 3300005337 Bacteria 96186
65 Ga0070682_100000499 3300005337 Bacteria 24624
66 Ga0070682_100013159 3300005337 Bacteria 4753
67 Ga0070682_100018240 3300005337 Bacteria 4099
68 Ga0070682_100053147 3300005337 Bacteria 2538
69 Ga0068868_100002955 3300005338 Bacteria 11800
70 Ga0068868_100069916 3300005338 Bacteria 2798
71 Ga0068868_100126653 3300005338 Bacteria 2087
72 Ga0068868_100401151 3300005338 Bacteria 1183
73 Ga0070660_100039616 3300005339 Bacteria 3582
74 Ga0070660_100408979 3300005339 Bacteria 1123
75 Ga0070689_100000370 3300005340 Bacteria 26473
76 Ga0070689_100008593 3300005340 Bacteria 7199
77 Ga0070689_100014656 3300005340 Bacteria 5701
78 Ga0070689_100021268 3300005340 Bacteria 4826
79 Ga0070689_100046932 3300005340 Bacteria 3329
80 Ga0070689_100084498 3300005340 Bacteria 2495
81 Ga0070689_100089611 3300005340 Bacteria 2423
82 Ga0070689_100135866 3300005340 Bacteria 1974
83 Ga0070689_100193725 3300005340 Bacteria 1656
84 Ga0070689_100199915 3300005340 Bacteria 1631
85 Ga0070689_100493705 3300005340 Bacteria 1048
86 Ga0070691_10047060 3300005341 Bacteria 2050
87 Ga0070687_100049167 3300005343 Bacteria 2172
88 Ga0070687_100172200 3300005343 Bacteria 1289
89 Ga0070661_100019697 3300005344 Bacteria 4808
90 Ga0070661_100043122 3300005344 Bacteria 3295
91 Ga0070661_100053013 3300005344 Bacteria 2968
92 Ga0070661_100072860 3300005344 Bacteria 2528
93 Ga0070661_100389036 3300005344 Bacteria 1101
94 Ga0070692_10004491 3300005345 Bacteria 5836
95 Ga0070692_10024794 3300005345 Bacteria 2952
96 Ga0070692_10090768 3300005345 Bacteria 1660
97 Ga0070668_100013245 3300005347 Bacteria 6151
98 Ga0070668_100014996 3300005347 Bacteria 5789
99 Ga0070668_100184932 3300005347 Bacteria 1704
100 Ga0070669_100000025 3300005353 Bacteria 170551
101 Ga0070669_100022956 3300005353 Bacteria 4463
102 Ga0070669_100030989 3300005353 Bacteria 3861
103 Ga0070669_100048993 3300005353 Bacteria 3085
104 Ga0070669_100084711 3300005353 Bacteria 2366
105 Ga0070669_100122511 3300005353 Bacteria 1986
106 Ga0070669_100340159 3300005353 Bacteria 1216
107 Ga0070675_100004398 3300005354 Bacteria 10751
108 Ga0070675_100016644 3300005354 Bacteria 5838
109 Ga0070675_100020751 3300005354 Bacteria 5243
110 Ga0070675_100035978 3300005354 Bacteria 4027
111 Ga0070675_100191245 3300005354 Bacteria 1773
112 Ga0070675_100217565 3300005354 Bacteria 1662
113 Ga0070671_100003656 3300005355 Bacteria 12044
114 Ga0070671_100007241 3300005355 Bacteria 8865
115 Ga0070671_100026590 3300005355 Bacteria 4757
116 Ga0070671_100104436 3300005355 Bacteria 2378
117 Ga0070671_100164851 3300005355 Bacteria 1874
118 Ga0070671_100532957 3300005355 Bacteria 1012
119 Ga0070674_100404820 3300005356 Bacteria 1116
120 Ga0070673_100025347 3300005364 Bacteria 4364
121 Ga0070673_100152690 3300005364 Bacteria 1957
122 Ga0070673_100163719 3300005364 Bacteria 1893
123 Ga0070673_100491942 3300005364 Bacteria 1108
124 Ga0070688_100001731 3300005365 Bacteria 10883
125 Ga0070688_100019228 3300005365 Bacteria 3955
126 Ga0070688_100049902 3300005365 Bacteria 2606
127 Ga0070688_100064350 3300005365 Bacteria 2327
128 Ga0070688_100078384 3300005365 Bacteria 2131
129 Ga0070688_100188645 3300005365 Bacteria 1435
130 Ga0070659_100002916 3300005366 Bacteria 12183
131 Ga0070659_100032555 3300005366 Bacteria 4045
132 Ga0070667_100033014 3300005367 Bacteria 4321
133 Ga0070667_100066761 3300005367 Bacteria 3057
134 Ga0070667_100083571 3300005367 Bacteria 2735
135 Ga0070667_100087771 3300005367 Bacteria 2670
136 Ga0070667_100145207 3300005367 Bacteria 2080
137 Ga0070667_100238099 3300005367 Bacteria 1624
138 Ga0070667_100294515 3300005367 Bacteria 1460
139 Ga0070703_10000100 3300005406 Bacteria 44584
140 Ga0070703_10002606 3300005406 Bacteria 5197
141 Ga0070703_10020438 3300005406 Bacteria 1926
142 Ga0070709_10081155 3300005434 Bacteria 2116
143 Ga0070714_100014141 3300005435 Bacteria 6408
144 Ga0070714_100047153 3300005435 Bacteria 3659
145 Ga0070714_100076132 3300005435 Bacteria 2912
146 Ga0070713_100007921 3300005436 Bacteria 7500
147 Ga0070710_10054143 3300005437 Bacteria 2263
148 Ga0070701_10027300 3300005438 Bacteria 2794
149 Ga0070701_10035805 3300005438 Bacteria 2497
150 Ga0070701_10059772 3300005438 Bacteria 2005
151 Ga0070701_10142361 3300005438 Bacteria 1373
152 Ga0070701_10231624 3300005438 Bacteria 1107
153 Ga0070705_100208251 3300005440 Bacteria 1346
154 Ga0070700_100000115 3300005441 Bacteria 51077
155 Ga0070700_100033371 3300005441 Bacteria 3100
156 Ga0070700_100105912 3300005441 Bacteria 1860
157 Ga0070700_100267913 3300005441 Bacteria 1233
158 Ga0070694_100004899 3300005444 Bacteria 8064
159 Ga0070694_100014229 3300005444 Bacteria 4980
160 Ga0070694_100028193 3300005444 Bacteria 3651
161 Ga0070694_100057904 3300005444 Bacteria 2635
162 Ga0070694_100106887 3300005444 Bacteria 1988
163 Ga0070694_100294519 3300005444 Bacteria 1241
164 Ga0070708_100000002 3300005445 Bacteria 195857
165 Ga0070708_100000055 3300005445 Bacteria 75728
166 Ga0070708_100003559 3300005445 Bacteria 12216
167 Ga0070708_100021637 3300005445 Bacteria 5441
168 Ga0070708_100140599 3300005445 Bacteria 2238
169 Ga0070708_100149329 3300005445 Bacteria 2173
170 Ga0070708_100274574 3300005445 Bacteria 1586
171 Ga0070663_100051578 3300005455 Bacteria 2931
172 Ga0070678_100233191 3300005456 Bacteria 1535
173 Ga0070678_100357154 3300005456 Bacteria 1258
174 Ga0070678_100549703 3300005456 Bacteria 1025
175 Ga0070662_100010051 3300005457 Bacteria 6200
176 Ga0070662_100016946 3300005457 Bacteria 4899
177 Ga0070662_100102488 3300005457 Bacteria 2169
178 Ga0070662_100188373 3300005457 Bacteria 1630
179 Ga0070662_100559688 3300005457 Bacteria 959
180 Ga0070681_10000162 3300005458 Bacteria 50502
181 Ga0070681_10002912 3300005458 Bacteria 15842
182 Ga0070681_10008791 3300005458 Bacteria 9912
183 Ga0070681_10048760 3300005458 Bacteria 4231
184 Ga0070681_10051476 3300005458 Bacteria 4108
185 Ga0070681_10115920 3300005458 Bacteria 2616
186 Ga0070681_10147453 3300005458 Bacteria 2281
187 Ga0070681_10149313 3300005458 Bacteria 2264
188 Ga0070681_10218846 3300005458 Bacteria 1820
189 Ga0068867_100016073 3300005459 Bacteria 5313
190 Ga0068867_100058175 3300005459 Bacteria 2864
191 Ga0068867_100161804 3300005459 Bacteria 1766
192 Ga0068867_100373986 3300005459 Bacteria 1195
193 Ga0068867_100634927 3300005459 Bacteria 935
194 Ga0070685_10013125 3300005466 Bacteria 4362
195 Ga0070685_10056932 3300005466 Bacteria 2274
196 Ga0070685_10065351 3300005466 Bacteria 2141
197 Ga0070685_10100505 3300005466 Bacteria 1765
198 Ga0070706_100000032 3300005467 Bacteria 152892
199 Ga0070706_100006681 3300005467 Bacteria 10886
200 Ga0070706_100011928 3300005467 Bacteria 8067
201 Ga0070706_100014045 3300005467 Bacteria 7399
202 Ga0070706_100034341 3300005467 Bacteria 4685
203 Ga0070706_100053844 3300005467 Bacteria 3714
204 Ga0070706_100058355 3300005467 Bacteria 3562
205 Ga0070706_100081341 3300005467 Bacteria 3000
206 Ga0070706_100083530 3300005467 Bacteria 2959
207 Ga0070706_100106755 3300005467 Bacteria 2605
208 Ga0070707_100001111 3300005468 Bacteria 26561
209 Ga0070707_100011439 3300005468 Bacteria 8276
210 Ga0070707_100197757 3300005468 Bacteria 1960
211 Ga0070707_100206665 3300005468 Bacteria 1914
212 Ga0070707_100226635 3300005468 Bacteria 1820
213 Ga0070707_100568433 3300005468 Bacteria 1096
214 Ga0070698_100004139 3300005471 Bacteria 15956
215 Ga0070698_100009625 3300005471 Bacteria 10337
216 Ga0070698_100017187 3300005471 Bacteria 7623
217 Ga0070698_100019053 3300005471 Bacteria 7217
218 Ga0070698_100025311 3300005471 Bacteria 6185
219 Ga0070698_100061277 3300005471 Bacteria 3796
220 Ga0070698_100071458 3300005471 Bacteria 3480
221 Ga0070698_100087349 3300005471 Bacteria 3104
222 Ga0070698_100110067 3300005471 Bacteria 2720
223 Ga0070699_100000027 3300005518 Bacteria 157339
224 Ga0070699_100003796 3300005518 Bacteria 13351
225 Ga0070699_100015881 3300005518 Bacteria 6464
226 Ga0070699_100072552 3300005518 Bacteria 2995
227 Ga0070679_100000011 3300005530 Bacteria 162902
228 Ga0070679_100000837 3300005530 Bacteria 26775
229 Ga0070679_100016973 3300005530 Bacteria 7037
230 Ga0070679_100020724 3300005530 Bacteria 6414
231 Ga0070679_100087076 3300005530 Bacteria 3110
232 Ga0070679_100139147 3300005530 Bacteria 2408
233 Ga0070679_100162961 3300005530 Bacteria 2203
234 Ga0070679_100366979 3300005530 Bacteria 1387
235 Ga0070684_100002044 3300005535 Bacteria 14860
236 Ga0070684_100143089 3300005535 Bacteria 2163
237 Ga0070684_100145165 3300005535 Bacteria 2148
238 Ga0070684_100199324 3300005535 Bacteria 1823
239 Ga0070697_100000071 3300005536 Bacteria 80945
240 Ga0070697_100000762 3300005536 Bacteria 24111
241 Ga0070697_100031926 3300005536 Bacteria 4237
242 Ga0070697_100057598 3300005536 Bacteria 3162
243 Ga0070697_100064982 3300005536 Bacteria 2980
244 Ga0070697_100112707 3300005536 Bacteria 2269
245 Ga0070697_100136708 3300005536 Bacteria 2058
246 Ga0070697_100196444 3300005536 Bacteria 1714
247 Ga0070697_100198578 3300005536 Bacteria 1705
248 Ga0068853_100015219 3300005539 Bacteria 6322
249 Ga0068853_100057900 3300005539 Bacteria 3345
250 Ga0068853_100196795 3300005539 Bacteria 1833
251 Ga0068853_100303176 3300005539 Bacteria 1477
252 Ga0068853_100318452 3300005539 Bacteria 1441
253 Ga0068853_100396245 3300005539 Bacteria 1291
254 Ga0070672_100002792 3300005543 Bacteria 11188
255 Ga0070672_100007194 3300005543 Bacteria 7535
256 Ga0070672_100591869 3300005543 Bacteria 965
257 Ga0070686_100003636 3300005544 Bacteria 8463
258 Ga0070686_100015394 3300005544 Bacteria 4430
259 Ga0070686_100084693 3300005544 Bacteria 2107
260 Ga0070686_100106327 3300005544 Bacteria 1904
261 Ga0070686_100141200 3300005544 Bacteria 1677
262 Ga0070686_100222799 3300005544 Bacteria 1364
263 Ga0070686_100322203 3300005544 Bacteria 1153
264 Ga0070686_100340863 3300005544 Bacteria 1123
265 Ga0070695_100000181 3300005545 Bacteria 30093
266 Ga0070695_100089860 3300005545 Bacteria 2048
267 Ga0070695_100106293 3300005545 Bacteria 1898
268 Ga0070695_100122069 3300005545 Bacteria 1784
269 Ga0070695_100188323 3300005545 Bacteria 1467
270 Ga0070695_100218820 3300005545 Bacteria 1371
271 Ga0070696_100013547 3300005546 Bacteria 5472
272 Ga0070696_100190112 3300005546 Bacteria 1528
273 Ga0070696_100316562 3300005546 Bacteria 1200
274 Ga0070693_100001794 3300005547 Bacteria 9780
275 Ga0070693_100008823 3300005547 Bacteria 4995
276 Ga0070693_100069928 3300005547 Bacteria 2064
277 Ga0070665_100000235 3300005548 Bacteria 91903
278 Ga0070665_100071363 3300005548 Bacteria 3479
279 Ga0070665_100072656 3300005548 Bacteria 3447
280 Ga0070665_100116730 3300005548 Bacteria 2672
281 Ga0070665_100231472 3300005548 Bacteria 1848
282 Ga0070704_100021872 3300005549 Bacteria 4154
283 Ga0070704_100026305 3300005549 Bacteria 3843
284 Ga0070704_100045309 3300005549 Bacteria 3060
285 Ga0070704_100052894 3300005549 Bacteria 2867
286 Ga0070704_100068594 3300005549 Bacteria 2566
287 Ga0070704_100172871 3300005549 Bacteria 1720
288 Ga0070704_100180690 3300005549 Bacteria 1687
289 Ga0070704_100314539 3300005549 Bacteria 1309
290 Ga0070704_100340015 3300005549 Bacteria 1263
291 Ga0068855_100007946 3300005563 Bacteria 12820
292 Ga0068855_100224657 3300005563 Bacteria 2104
293 Ga0068855_100291688 3300005563 Bacteria 1808
294 Ga0070664_100000151 3300005564 Bacteria 48168
295 Ga0070664_100034054 3300005564 Bacteria 4271
296 Ga0070664_100047012 3300005564 Bacteria 3646
297 Ga0070664_100113417 3300005564 Bacteria 2367
298 Ga0070664_100247131 3300005564 Bacteria 1603
299 Ga0068857_100014851 3300005577 Bacteria 6791
300 Ga0068857_100015095 3300005577 Bacteria 6744
301 Ga0068857_100039911 3300005577 Bacteria 4160
302 Ga0068857_100057452 3300005577 Bacteria 3454
303 Ga0068857_100138324 3300005577 Bacteria 2200
304 Ga0068857_100154199 3300005577 Bacteria 2082
305 Ga0068854_100297331 3300005578 Bacteria 1305
306 Ga0068854_100497905 3300005578 Bacteria 1026
307 Ga0068856_100075594 3300005614 Bacteria 3336
308 Ga0070702_100072526 3300005615 Bacteria 2038
309 Ga0070702_100153932 3300005615 Bacteria 1479
310 Ga0068852_100033378 3300005616 Bacteria 4272
311 Ga0068852_100305278 3300005616 Bacteria 1542
312 Ga0068859_100002426 3300005617 Bacteria 18981
313 Ga0068859_100023962 3300005617 Bacteria 6125
314 Ga0068859_100025986 3300005617 Bacteria 5874
315 Ga0068859_100029833 3300005617 Bacteria 5471
316 Ga0068859_100041257 3300005617 Bacteria 4635
317 Ga0068859_100050130 3300005617 Bacteria 4194
318 Ga0068859_100054294 3300005617 Bacteria 4029
319 Ga0068859_100068754 3300005617 Bacteria 3576
320 Ga0068859_100177932 3300005617 Bacteria 2209
321 Ga0068859_100246081 3300005617 Bacteria 1878
322 Ga0068859_100256651 3300005617 Bacteria 1839
323 Ga0068859_100850290 3300005617 Bacteria 998
324 Ga0068864_100000028 3300005618 Bacteria 227840
325 Ga0068864_100003410 3300005618 Bacteria 13144
326 Ga0068864_100024879 3300005618 Bacteria 5037
327 Ga0068864_100133354 3300005618 Bacteria 2234
328 Ga0068864_100220859 3300005618 Bacteria 1748
329 Ga0068864_100317165 3300005618 Bacteria 1463
330 Ga0068864_100799645 3300005618 Bacteria 927
331 Ga0068866_10129167 3300005718 Bacteria 1435
332 Ga0068861_100008836 3300005719 Bacteria 6943
333 Ga0068861_100022159 3300005719 Bacteria 4573
334 Ga0068861_100024073 3300005719 Bacteria 4399
335 Ga0068861_100075647 3300005719 Bacteria 2622
336 Ga0068851_10001543 3300005834 Bacteria 10096
337 Ga0068851_10170558 3300005834 Bacteria 1201
338 Ga0068870_10002726 3300005840 Bacteria 7413
339 Ga0068870_10003324 3300005840 Bacteria 6799
340 Ga0068870_10262306 3300005840 Bacteria 1076
341 Ga0068863_100003203 3300005841 Bacteria 16194
342 Ga0068863_100039671 3300005841 Bacteria 4479
343 Ga0068863_100146109 3300005841 Bacteria 2262
344 Ga0068863_100239112 3300005841 Bacteria 1753
345 Ga0068863_100282003 3300005841 Bacteria 1610
346 Ga0068863_100326425 3300005841 Bacteria 1491
347 Ga0068858_100000026 3300005842 Bacteria 153013
348 Ga0068858_100000351 3300005842 Bacteria 48460
349 Ga0068858_100006584 3300005842 Bacteria 11300
350 Ga0068858_100009315 3300005842 Bacteria 9375
351 Ga0068858_100017723 3300005842 Bacteria 6671
352 Ga0068858_100070697 3300005842 Bacteria 3235
353 Ga0068858_100111875 3300005842 Bacteria 2550
354 Ga0068858_100436526 3300005842 Bacteria 1261
355 Ga0068858_100484358 3300005842 Bacteria 1194
356 Ga0068858_100617087 3300005842 Bacteria 1053
357 Ga0068860_100003298 3300005843 Bacteria 16606
358 Ga0068860_100011315 3300005843 Bacteria 8793
359 Ga0068860_100043929 3300005843 Bacteria 4260
360 Ga0068860_100088407 3300005843 Bacteria 2949
361 Ga0068860_100524821 3300005843 Bacteria 1184
362 Ga0068862_100024156 3300005844 Bacteria 5098
363 Ga0068862_100034324 3300005844 Bacteria 4291
364 Ga0068862_100070982 3300005844 Bacteria 3007
365 Ga0068862_100078544 3300005844 Bacteria 2860
366 Ga0068862_100158827 3300005844 Bacteria 2017
367 Ga0068862_100273737 3300005844 Bacteria 1545
368 Ga0081455_10031556 3300005937 Bacteria 4790
369 Ga0081539_10001016 3300005985 Bacteria 51656
370 Ga0081539_10001250 3300005985 Bacteria 45064
371 Ga0081539_10001451 3300005985 Bacteria 40546
372 Ga0070717_10257013 3300006028 Bacteria 1545
373 Ga0070717_10468450 3300006028 Bacteria 1137
374 Ga0070716_100060839 3300006173 Bacteria 2183
375 Ga0070712_100066671 3300006175 Bacteria 2559
376 Ga0070712_100513096 3300006175 Bacteria 1006
377 Ga0075362_10056618 3300006177 Bacteria 1765
378 Ga0075367_10054189 3300006178 Bacteria 2378
379 Ga0097621_100008589 3300006237 Bacteria 7364
380 Ga0097621_100013095 3300006237 Bacteria 6169
381 Ga0097621_100079182 3300006237 Bacteria 2731
382 Ga0068871_100003336 3300006358 Bacteria 11027
383 Ga0068871_100005112 3300006358 Bacteria 9166
384 Ga0068871_100007247 3300006358 Bacteria 7911
385 Ga0068871_100101319 3300006358 Bacteria 2413
386 Ga0068871_100246335 3300006358 Bacteria 1555
387 Ga0075428_100039803 3300006844 Bacteria 5174
388 Ga0075428_100096706 3300006844 Bacteria 3219
389 Ga0075428_100102316 3300006844 Bacteria 3124
390 Ga0075428_100159066 3300006844 Bacteria 2452
391 Ga0075428_100197549 3300006844 Bacteria 2175
392 Ga0075428_100215353 3300006844 Bacteria 2075
393 Ga0075428_100265703 3300006844 Bacteria 1847
394 Ga0075428_100295436 3300006844 Bacteria 1742
395 Ga0075430_100004742 3300006846 Bacteria 11440
396 Ga0075430_100037824 3300006846 Bacteria 4090
397 Ga0075430_100039080 3300006846 Bacteria 4018
398 Ga0075430_100117575 3300006846 Bacteria 2216
399 Ga0075430_100157892 3300006846 Bacteria 1888
400 Ga0075430_100218579 3300006846 Bacteria 1581
401 Ga0075430_100255503 3300006846 Bacteria 1452
402 Ga0075430_100565355 3300006846 Bacteria 938
403 Ga0075430_100573671 3300006846 Bacteria 931
404 Ga0075431_100007693 3300006847 Bacteria 10730
405 Ga0075431_100012361 3300006847 Bacteria 8615
406 Ga0075431_100016034 3300006847 Bacteria 7605
407 Ga0075431_100021854 3300006847 Bacteria 6541
408 Ga0075431_100033151 3300006847 Bacteria 5323
409 Ga0075431_100058636 3300006847 Bacteria 3973
410 Ga0075431_100070019 3300006847 Bacteria 3619
411 Ga0075431_100128719 3300006847 Bacteria 2612
412 Ga0075431_100193070 3300006847 Bacteria 2086
413 Ga0075431_100213558 3300006847 Bacteria 1970
414 Ga0075431_100448237 3300006847 Bacteria 1286
415 Ga0075431_100510414 3300006847 Bacteria 1192
416 Ga0075433_10001773 3300006852 Bacteria 16163
417 Ga0075433_10006336 3300006852 Bacteria 9354
418 Ga0075433_10019641 3300006852 Bacteria 5634
419 Ga0075433_10041752 3300006852 Bacteria 3976
420 Ga0075433_10067121 3300006852 Bacteria 3148
421 Ga0075433_10070825 3300006852 Bacteria 3065
422 Ga0075433_10239276 3300006852 Bacteria 1611
423 Ga0075433_10306957 3300006852 Bacteria 1405
424 Ga0075433_10494193 3300006852 Unclassified 1077
425 Ga0075434_100002739 3300006871 Bacteria 15574
426 Ga0075434_100005810 3300006871 Bacteria 11265
427 Ga0075434_100008913 3300006871 Bacteria 9339
428 Ga0075434_100011502 3300006871 Bacteria 8351
429 Ga0075434_100012838 3300006871 Bacteria 7953
430 Ga0075434_100022525 3300006871 Bacteria 6134
431 Ga0075434_100036500 3300006871 Bacteria 4862
432 Ga0075434_100036722 3300006871 Bacteria 4846
433 Ga0075434_100272266 3300006871 Bacteria 1712
434 Ga0075434_100298580 3300006871 Bacteria 1631
435 Ga0075434_100507267 3300006871 Bacteria 1227
436 Ga0075434_100565060 3300006871 Unclassified 1157
437 Ga0075429_100002126 3300006880 Bacteria 16535
438 Ga0075429_100009408 3300006880 Bacteria 8484
439 Ga0075429_100015327 3300006880 Bacteria 6641
440 Ga0075429_100054294 3300006880 Bacteria 3485
441 Ga0075429_100087995 3300006880 Bacteria 2707
442 Ga0075429_100147567 3300006880 Bacteria 2059
443 Ga0075429_100148532 3300006880 Bacteria 2052
444 Ga0075429_100150287 3300006880 Bacteria 2039
445 Ga0075429_100216844 3300006880 Bacteria 1676
446 Ga0075429_100298091 3300006880 Bacteria 1411
447 Ga0068865_100009971 3300006881 Bacteria 5902
448 Ga0068865_100127972 3300006881 Bacteria 1899
449 Ga0068865_100148602 3300006881 Bacteria 1775
450 Ga0068865_100171568 3300006881 Bacteria 1663
451 Ga0068865_100241745 3300006881 Bacteria 1421
452 Ga0075436_100014980 3300006914 Bacteria 5315
453 Ga0075436_100036990 3300006914 Bacteria 3370
454 Ga0075436_100109000 3300006914 Bacteria 1932
455 Ga0075436_100149731 3300006914 Bacteria 1642
456 Ga0097620_100002426 3300006931 Bacteria 18981
457 Ga0097620_100023962 3300006931 Bacteria 6125
458 Ga0097620_100025986 3300006931 Bacteria 5874
459 Ga0097620_100029833 3300006931 Bacteria 5471
460 Ga0097620_100041258 3300006931 Bacteria 4635
461 Ga0097620_100050131 3300006931 Bacteria 4194
462 Ga0097620_100054295 3300006931 Bacteria 4029
463 Ga0097620_100068753 3300006931 Bacteria 3576
464 Ga0097620_100177932 3300006931 Bacteria 2209
465 Ga0097620_100246069 3300006931 Bacteria 1878
466 Ga0097620_100256645 3300006931 Bacteria 1839
467 Ga0097620_100325968 3300006931 Bacteria 1630
468 Ga0097620_100340663 3300006931 Bacteria 1594
469 Ga0097620_100850254 3300006931 Bacteria 998
470 Ga0075435_100000796 3300007076 Bacteria 19622
471 Ga0075435_100031745 3300007076 Bacteria 4165
472 Ga0075435_100068526 3300007076 Bacteria 2891
473 Ga0075435_100098635 3300007076 Bacteria 2419
474 Ga0075435_100245964 3300007076 Bacteria 1522
475 Ga0075435_100371460 3300007076 Bacteria 1228
476 Ga0105251_10001754 3300009011 Bacteria 18101
477 Ga0105251_10006311 3300009011 Bacteria 7582
478 Ga0105244_10001582 3300009036 Bacteria 18089
479 Ga0105244_10069154 3300009036 Bacteria 1763
480 Ga0105250_10005529 3300009092 Bacteria 5654
481 Ga0105250_10007779 3300009092 Bacteria 4590
482 Ga0105250_10011891 3300009092 Bacteria 3606
483 Ga0105250_10013893 3300009092 Bacteria 3316
484 Ga0105240_10018010 3300009093 Bacteria 9501
485 Ga0105240_10085674 3300009093 Bacteria 3860
486 Ga0105240_10222247 3300009093 Bacteria 2199
487 Ga0105240_10225010 3300009093 Bacteria 2183
488 Ga0105240_10367905 3300009093 Bacteria 1626
489 Ga0111539_10002573 3300009094 Bacteria 24013
490 Ga0111539_10006722 3300009094 Bacteria 14804
491 Ga0111539_10007608 3300009094 Bacteria 13842
492 Ga0111539_10011422 3300009094 Bacteria 11147
493 Ga0111539_10014333 3300009094 Bacteria 9898
494 Ga0111539_10020389 3300009094 Bacteria 8164
495 Ga0111539_10064168 3300009094 Bacteria 4347
496 Ga0111539_10135472 3300009094 Bacteria 2884
497 Ga0111539_10295950 3300009094 Bacteria 1883
498 Ga0111539_10459538 3300009094 Bacteria 1483
499 Ga0111539_10606754 3300009094 Bacteria 1275
500 Ga0105245_10000032 3300009098 Bacteria 150103
501 Ga0105245_10003014 3300009098 Bacteria 15103
502 Ga0105245_10003399 3300009098 Bacteria 14249
503 Ga0105245_10089774 3300009098 Bacteria 2826
504 Ga0105245_10107542 3300009098 Bacteria 2590
505 Ga0105245_10345557 3300009098 Bacteria 1472
506 Ga0105245_10611054 3300009098 Bacteria 1118
507 Ga0105247_10000022 3300009101 Bacteria 219796
508 Ga0105247_10007606 3300009101 Bacteria 6636
509 Ga0105247_10027597 3300009101 Bacteria 3432
510 Ga0105247_10034565 3300009101 Bacteria 3078
511 Ga0114129_10000109 3300009147 Bacteria 81939
512 Ga0114129_10000132 3300009147 Bacteria 76665
513 Ga0114129_10005210 3300009147 Bacteria 18321
514 Ga0114129_10009658 3300009147 Bacteria 13766
515 Ga0114129_10013515 3300009147 Bacteria 11634
516 Ga0114129_10021043 3300009147 Bacteria 9263
517 Ga0114129_10029541 3300009147 Bacteria 7763
518 Ga0114129_10036803 3300009147 Bacteria 6911
519 Ga0114129_10038463 3300009147 Bacteria 6748
520 Ga0114129_10040292 3300009147 Bacteria 6585
521 Ga0114129_10059546 3300009147 Bacteria 5339
522 Ga0114129_10094124 3300009147 Bacteria 4149
523 Ga0114129_10104519 3300009147 Bacteria 3914
524 Ga0114129_10120296 3300009147 Bacteria 3616
525 Ga0114129_10139010 3300009147 Bacteria 3331
526 Ga0114129_10157646 3300009147 Bacteria 3103
527 Ga0114129_10357204 3300009147 Bacteria 1934
528 Ga0114129_10408387 3300009147 Bacteria 1789
529 Ga0114129_10464028 3300009147 Bacteria 1659
530 Ga0114129_10741034 3300009147 Bacteria 1259
531 Ga0114129_10862091 3300009147 Bacteria 1150
532 Ga0114129_10921241 3300009147 Bacteria 1106
533 Ga0105243_10000084 3300009148 Bacteria 106821
534 Ga0105243_10001349 3300009148 Bacteria 21855
535 Ga0105243_10009094 3300009148 Bacteria 7589
536 Ga0105243_10056402 3300009148 Bacteria 3124
537 Ga0105243_10074263 3300009148 Bacteria 2757
538 Ga0105243_10146208 3300009148 Bacteria 2022
539 Ga0105243_10150143 3300009148 Bacteria 1998
540 Ga0105243_10274821 3300009148 Bacteria 1515
541 Ga0105243_10313798 3300009148 Bacteria 1426
542 Ga0105243_10427435 3300009148 Bacteria 1237
543 Ga0105243_10438141 3300009148 Bacteria 1223
544 Ga0105241_10000078 3300009174 Bacteria 72328
545 Ga0105241_10061489 3300009174 Bacteria 2892
546 Ga0105241_10074370 3300009174 Bacteria 2646
547 Ga0105241_10198432 3300009174 Bacteria 1674
548 Ga0105242_10000026 3300009176 Bacteria 108155
549 Ga0105242_10001968 3300009176 Bacteria 16160
550 Ga0105242_10014925 3300009176 Bacteria 6022
551 Ga0105242_10062958 3300009176 Bacteria 3054
552 Ga0105242_10158505 3300009176 Bacteria 1979
553 Ga0105242_10288208 3300009176 Bacteria 1494
554 Ga0105248_10001763 3300009177 Bacteria 24061
555 Ga0105248_10001828 3300009177 Bacteria 23629
556 Ga0105248_10021123 3300009177 Bacteria 7214
557 Ga0105248_10025148 3300009177 Bacteria 6619
558 Ga0105248_10026661 3300009177 Bacteria 6425
559 Ga0105248_10036469 3300009177 Bacteria 5499
560 Ga0105248_10101581 3300009177 Bacteria 3241
561 Ga0105248_10172299 3300009177 Bacteria 2439
562 Ga0105248_10225172 3300009177 Bacteria 2111
563 Ga0105248_10249522 3300009177 Bacteria 1998
564 Ga0105248_10343156 3300009177 Bacteria 1681
565 Ga0105248_10741840 3300009177 Bacteria 1108
566 Ga0105237_10007870 3300009545 Bacteria 11617
567 Ga0105237_10175459 3300009545 Bacteria 2143
568 Ga0105237_10182253 3300009545 Bacteria 2100
569 Ga0105237_10240327 3300009545 Bacteria 1812
570 Ga0105237_10532318 3300009545 Bacteria 1182
571 Ga0105238_10000082 3300009551 Bacteria 107565
572 Ga0105238_10336272 3300009551 Bacteria 1497
573 Ga0105249_10000924 3300009553 Bacteria 25990
574 Ga0105249_10025738 3300009553 Bacteria 5299
575 Ga0105249_10033172 3300009553 Bacteria 4674
576 Ga0105249_10033291 3300009553 Bacteria 4665
577 Ga0105249_10050480 3300009553 Bacteria 3792
578 Ga0105249_10078211 3300009553 Bacteria 3069
579 Ga0105249_10564467 3300009553 Bacteria 1190
580 Ga0105239_10010092 3300010375 Bacteria 10587
581 Ga0105239_10234599 3300010375 Bacteria 2059
582 Ga0105239_10254532 3300010375 Bacteria 1972
583 Ga0105246_10003254 3300011119 Bacteria 9856
584 Ga0105246_10036510 3300011119 Bacteria 3292
585 Ga0105246_10329027 3300011119 Bacteria 1245
586 Ga0157373_10126532 3300013100 Bacteria 1797
587 Ga0157373_10143336 3300013100 Bacteria 1680
588 Ga0157371_10008643 3300013102 Bacteria 8091
589 Ga0157371_10079982 3300013102 Bacteria 2315
590 Ga0157371_10448802 3300013102 Bacteria 948
591 Ga0157370_10106379 3300013104 Bacteria 2625
592 Ga0157369_10085077 3300013105 Bacteria 3379
593 Ga0157374_10028399 3300013296 Bacteria 5054
594 Ga0157374_10072591 3300013296 Bacteria 3247
595 Ga0157374_10075774 3300013296 Bacteria 3179
596 Ga0157374_10145138 3300013296 Bacteria 2305
597 Ga0157374_10416285 3300013296 Bacteria 1342
598 Ga0157378_10000011 3300013297 Bacteria 158889
599 Ga0157378_10003809 3300013297 Bacteria 13354
600 Ga0157378_10010486 3300013297 Bacteria 8093
601 Ga0157378_10010551 3300013297 Bacteria 8074
602 Ga0157378_10034466 3300013297 Bacteria 4477
603 Ga0157378_10055440 3300013297 Bacteria 3531
604 Ga0157378_10059977 3300013297 Bacteria 3395
605 Ga0157378_10099627 3300013297 Bacteria 2651
606 Ga0157378_10183159 3300013297 Bacteria 1971
607 Ga0157378_10475637 3300013297 Bacteria 1244
608 Ga0163162_10001026 3300013306 Bacteria 25953
609 Ga0163162_10009322 3300013306 Bacteria 9544
610 Ga0163162_10019961 3300013306 Bacteria 6582
611 Ga0163162_10065850 3300013306 Bacteria 3672
612 Ga0163162_10070726 3300013306 Bacteria 3541
613 Ga0163162_10141863 3300013306 Bacteria 2516
614 Ga0163162_10160377 3300013306 Bacteria 2371
615 Ga0163162_10176637 3300013306 Bacteria 2261
616 Ga0163162_10247327 3300013306 Bacteria 1915
617 Ga0163162_10299507 3300013306 Bacteria 1740
618 Ga0163162_10917087 3300013306 Bacteria 988
619 Ga0157372_10006976 3300013307 Bacteria 12029
620 Ga0157372_10112732 3300013307 Bacteria 3116
621 Ga0157372_10119384 3300013307 Bacteria 3027
622 Ga0157372_10143645 3300013307 Bacteria 2752
623 Ga0157372_10474434 3300013307 Bacteria 1458
624 Ga0157372_10530745 3300013307 Bacteria 1372
625 Ga0157375_10000005 3300013308 Bacteria 429412
626 Ga0157375_10001113 3300013308 Bacteria 23324
627 Ga0157375_10004719 3300013308 Bacteria 11848
628 Ga0157375_10015067 3300013308 Bacteria 6914
629 Ga0157375_10143818 3300013308 Bacteria 2514
630 Ga0163163_10003051 3300014325 Bacteria 14168
631 Ga0163163_10009313 3300014325 Bacteria 8761
632 Ga0163163_10013319 3300014325 Bacteria 7524
633 Ga0163163_10049417 3300014325 Bacteria 4139
634 Ga0163163_10058018 3300014325 Bacteria 3828
635 Ga0163163_10155208 3300014325 Bacteria 2333
636 Ga0163163_10166194 3300014325 Bacteria 2253
637 Ga0163163_10245573 3300014325 Bacteria 1840
638 Ga0163163_10303182 3300014325 Bacteria 1650
639 Ga0157380_10018412 3300014326 Bacteria 5183
640 Ga0157380_10057401 3300014326 Bacteria 3100
641 Ga0157380_10127459 3300014326 Bacteria 2166
642 Ga0157380_10359181 3300014326 Bacteria 1366
643 Ga0157380_10388669 3300014326 Bacteria 1319
644 Ga0157377_10028026 3300014745 Bacteria 3029
645 Ga0157377_10043637 3300014745 Bacteria 2496
646 Ga0157377_10096999 3300014745 Bacteria 1750
647 Ga0157377_10108428 3300014745 Bacteria 1666
648 Ga0157379_10009043 3300014968 Bacteria 8679
649 Ga0157379_10071326 3300014968 Bacteria 3108
650 Ga0157379_10385720 3300014968 Bacteria 1286
651 Ga0157379_10449279 3300014968 Bacteria 1190
652 Ga0157379_10780694 3300014968 Bacteria 901
653 Ga0157376_10015484 3300014969 Bacteria 5761
654 Ga0157376_10063221 3300014969 Bacteria 3117
655 Ga0157376_10078118 3300014969 Bacteria 2833
656 Ga0157376_10090586 3300014969 Bacteria 2647
657 Ga0157376_10480980 3300014969 Bacteria 1217
658 Ga0163161_10019634 3300017792 Bacteria 4740
659 Ga0163161_10059316 3300017792 Bacteria 2782
660 Ga0163161_10117109 3300017792 Bacteria 1998
661 Ga0213872_10002872 3300021361 Bacteria 9818
662 Ga0213872_10052460 3300021361 Bacteria 1850
663 Ga0213876_10003099 3300021384 Bacteria 9616
664 Ga0207672_1000027 3300025223 Bacteria 18614
665 Ga0209784_100051 3300025224 Bacteria 183666
666 Ga0209147_100099 3300025229 Bacteria 162754
667 Ga0209147_102062 3300025229 Bacteria 5699
668 Ga0209130_1000940 3300025284 Bacteria 23191
669 Ga0209130_1002628 3300025284 Bacteria 8636
670 Ga0209130_1006010 3300025284 Bacteria 4042
671 Ga0209676_1045510 3300025292 Bacteria 1194
672 Ga0209025_1000011 3300025294 Bacteria 976387
673 Ga0209025_1001243 3300025294 Bacteria 35434
674 Ga0209025_1001377 3300025294 Bacteria 32622
675 Ga0209025_1001513 3300025294 Bacteria 29849
676 Ga0209025_1002114 3300025294 Bacteria 22397
677 Ga0209025_1003800 3300025294 Bacteria 13806
678 Ga0209025_1004437 3300025294 Bacteria 12194
679 Ga0209025_1005550 3300025294 Bacteria 10227
680 Ga0209025_1010779 3300025294 Bacteria 6142
681 Ga0209025_1013139 3300025294 Bacteria 5229
682 Ga0209025_1073124 3300025294 Bacteria 1205
683 Ga0207697_10003632 3300025315 Bacteria 7568
684 Ga0207697_10162764 3300025315 Bacteria 974
685 Ga0207696_1000580 3300025711 Bacteria 28547
686 Ga0207696_1005627 3300025711 Bacteria 5169
687 Ga0207696_1006649 3300025711 Bacteria 4625
688 Ga0207655_1001343 3300025728 Bacteria 23118
689 Ga0207655_1038907 3300025728 Bacteria 2072
690 Ga0207713_1002044 3300025735 Bacteria 15109
691 Ga0207713_1010901 3300025735 Bacteria 4991
692 Ga0207653_10000034 3300025885 Bacteria 103130
693 Ga0207653_10000638 3300025885 Bacteria 12055
694 Ga0207682_10066920 3300025893 Bacteria 1515
695 Ga0207710_10000001 3300025900 Bacteria 1797433
696 Ga0207710_10000938 3300025900 Bacteria 15505
697 Ga0207680_10091031 3300025903 Bacteria 1940
698 Ga0207680_10113576 3300025903 Bacteria 1761
699 Ga0207647_10012246 3300025904 Bacteria 5977
700 Ga0207647_10029345 3300025904 Bacteria 3561
701 Ga0207645_10002492 3300025907 Bacteria 14447
702 Ga0207645_10015845 3300025907 Bacteria 4994
703 Ga0207643_10000914 3300025908 Bacteria 17655
704 Ga0207643_10014032 3300025908 Bacteria 4348
705 Ga0207643_10136740 3300025908 Bacteria 1461
706 Ga0207643_10222680 3300025908 Bacteria 1155
707 Ga0207705_10131182 3300025909 Bacteria 1865
708 Ga0207705_10181682 3300025909 Bacteria 1588
709 Ga0207684_10000065 3300025910 Bacteria 194463
710 Ga0207684_10005843 3300025910 Bacteria 11269
711 Ga0207684_10006018 3300025910 Bacteria 11098
712 Ga0207684_10040536 3300025910 Bacteria 3947
713 Ga0207684_10041360 3300025910 Bacteria 3908
714 Ga0207684_10042463 3300025910 Bacteria 3854
715 Ga0207684_10187548 3300025910 Bacteria 1783
716 Ga0207684_10226956 3300025910 Bacteria 1611
717 Ga0207684_10384367 3300025910 Bacteria 1207
718 Ga0207684_10416376 3300025910 Bacteria 1155
719 Ga0207654_10000050 3300025911 Bacteria 88868
720 Ga0207654_10019167 3300025911 Bacteria 3606
721 Ga0207707_10000028 3300025912 Bacteria 167115
722 Ga0207707_10002650 3300025912 Bacteria 15996
723 Ga0207707_10005634 3300025912 Bacteria 10958
724 Ga0207707_10017351 3300025912 Bacteria 6276
725 Ga0207707_10021789 3300025912 Bacteria 5601
726 Ga0207707_10033306 3300025912 Bacteria 4510
727 Ga0207707_10039516 3300025912 Bacteria 4123
728 Ga0207707_10331077 3300025912 Bacteria 1314
729 Ga0207695_10052375 3300025913 Bacteria 4277
730 Ga0207695_10118693 3300025913 Bacteria 2616
731 Ga0207671_10003695 3300025914 Bacteria 15087
732 Ga0207671_10061160 3300025914 Bacteria 2794
733 Ga0207693_10422525 3300025915 Bacteria 1042
734 Ga0207663_10034672 3300025916 Bacteria 3021
735 Ga0207663_10037893 3300025916 Bacteria 2909
736 Ga0207660_10003300 3300025917 Bacteria 10554
737 Ga0207660_10028006 3300025917 Bacteria 3851
738 Ga0207660_10048047 3300025917 Bacteria 3020
739 Ga0207660_10050203 3300025917 Bacteria 2961
740 Ga0207660_10130611 3300025917 Bacteria 1911
741 Ga0207660_10196181 3300025917 Bacteria 1575
742 Ga0207660_10200566 3300025917 Bacteria 1558
743 Ga0207662_10004272 3300025918 Bacteria 7500
744 Ga0207662_10068608 3300025918 Bacteria 2141
745 Ga0207662_10111523 3300025918 Bacteria 1706
746 Ga0207657_10052979 3300025919 Bacteria 3518
747 Ga0207657_10538018 3300025919 Bacteria 914
748 Ga0207649_10011373 3300025920 Bacteria 4908
749 Ga0207649_10026623 3300025920 Bacteria 3385
750 Ga0207649_10079225 3300025920 Bacteria 2122
751 Ga0207649_10182386 3300025920 Bacteria 1470
752 Ga0207652_10000573 3300025921 Bacteria 37033
753 Ga0207652_10015858 3300025921 Bacteria 6140
754 Ga0207652_10319795 3300025921 Bacteria 1401
755 Ga0207646_10000347 3300025922 Bacteria 62841
756 Ga0207646_10004439 3300025922 Bacteria 15223
757 Ga0207646_10005716 3300025922 Bacteria 13043
758 Ga0207646_10050978 3300025922 Bacteria 3704
759 Ga0207646_10081521 3300025922 Bacteria 2893
760 Ga0207646_10118276 3300025922 Bacteria 2381
761 Ga0207646_10152925 3300025922 Bacteria 2081
762 Ga0207646_10290240 3300025922 Bacteria 1478
763 Ga0207646_10372002 3300025922 Bacteria 1291
764 Ga0207646_10426553 3300025922 Bacteria 1197
765 Ga0207681_10000018 3300025923 Bacteria 278874
766 Ga0207681_10035223 3300025923 Bacteria 3297
767 Ga0207681_10037492 3300025923 Bacteria 3205
768 Ga0207681_10038805 3300025923 Bacteria 3158
769 Ga0207681_10101044 3300025923 Bacteria 2080
770 Ga0207681_10166374 3300025923 Bacteria 1667
771 Ga0207681_10457983 3300025923 Bacteria 1038
772 Ga0207694_10000031 3300025924 Bacteria 223403
773 Ga0207694_10005990 3300025924 Bacteria 9313
774 Ga0207694_10053213 3300025924 Bacteria 3138
775 Ga0207650_10000046 3300025925 Bacteria 178190
776 Ga0207650_10018187 3300025925 Bacteria 4930
777 Ga0207650_10179037 3300025925 Bacteria 1689
778 Ga0207650_10342445 3300025925 Bacteria 1228
779 Ga0207650_10349283 3300025925 Bacteria 1216
780 Ga0207659_10005311 3300025926 Bacteria 7807
781 Ga0207659_10080239 3300025926 Bacteria 2410
782 Ga0207659_10278645 3300025926 Bacteria 1366
783 Ga0207687_10000066 3300025927 Bacteria 80190
784 Ga0207687_10000199 3300025927 Bacteria 40591
785 Ga0207687_10000637 3300025927 Bacteria 23691
786 Ga0207687_10071926 3300025927 Bacteria 2472
787 Ga0207687_10082448 3300025927 Bacteria 2327
788 Ga0207687_10375510 3300025927 Bacteria 1163
789 Ga0207664_10011416 3300025929 Bacteria 6313
790 Ga0207664_10089360 3300025929 Bacteria 2522
791 Ga0207644_10002401 3300025931 Bacteria 12070
792 Ga0207644_10002547 3300025931 Bacteria 11731
793 Ga0207644_10094818 3300025931 Bacteria 2231
794 Ga0207644_10143684 3300025931 Bacteria 1840
795 Ga0207644_10182016 3300025931 Bacteria 1648
796 Ga0207690_10045153 3300025932 Bacteria 2909
797 Ga0207690_10054121 3300025932 Bacteria 2697
798 Ga0207690_10084289 3300025932 Bacteria 2228
799 Ga0207690_10174099 3300025932 Bacteria 1615
800 Ga0207706_10011037 3300025933 Bacteria 8234
801 Ga0207706_10105448 3300025933 Bacteria 2480
802 Ga0207706_10123770 3300025933 Bacteria 2275
803 Ga0207706_10216440 3300025933 Bacteria 1678
804 Ga0207686_10000015 3300025934 Bacteria 202118
805 Ga0207686_10000581 3300025934 Bacteria 22911
806 Ga0207686_10013241 3300025934 Bacteria 4560
807 Ga0207686_10095264 3300025934 Bacteria 1975
808 Ga0207709_10000043 3300025935 Bacteria 248179
809 Ga0207709_10002880 3300025935 Bacteria 10535
810 Ga0207709_10003312 3300025935 Bacteria 9649
811 Ga0207709_10082766 3300025935 Bacteria 2073
812 Ga0207709_10097368 3300025935 Bacteria 1937
813 Ga0207709_10297974 3300025935 Bacteria 1198
814 Ga0207670_10000381 3300025936 Bacteria 25536
815 Ga0207670_10000785 3300025936 Bacteria 16643
816 Ga0207670_10002575 3300025936 Bacteria 9541
817 Ga0207670_10014845 3300025936 Bacteria 4636
818 Ga0207670_10046364 3300025936 Bacteria 2887
819 Ga0207670_10046948 3300025936 Bacteria 2872
820 Ga0207670_10049434 3300025936 Bacteria 2813
821 Ga0207670_10103374 3300025936 Bacteria 2039
822 Ga0207670_10117280 3300025936 Bacteria 1929
823 Ga0207670_10148069 3300025936 Bacteria 1739
824 Ga0207670_10260061 3300025936 Bacteria 1345
825 Ga0207670_10318811 3300025936 Bacteria 1222
826 Ga0207669_10013082 3300025937 Bacteria 4107
827 Ga0207669_10108225 3300025937 Bacteria 1856
828 Ga0207669_10116668 3300025937 Bacteria 1802
829 Ga0207669_10196143 3300025937 Bacteria 1461
830 Ga0207704_10013627 3300025938 Bacteria 4077
831 Ga0207704_10029332 3300025938 Bacteria 3066
832 Ga0207704_10098271 3300025938 Bacteria 1944
833 Ga0207704_10288899 3300025938 Bacteria 1250
834 Ga0207704_10353159 3300025938 Bacteria 1145
835 Ga0207704_10405354 3300025938 Bacteria 1077
836 Ga0207665_10000720 3300025939 Bacteria 22450
837 Ga0207665_10021762 3300025939 Bacteria 4219
838 Ga0207665_10023103 3300025939 Bacteria 4097
839 Ga0207665_10341974 3300025939 Bacteria 1128
840 Ga0207691_10000839 3300025940 Bacteria 30609
841 Ga0207691_10005878 3300025940 Bacteria 11852
842 Ga0207691_10010044 3300025940 Bacteria 9083
843 Ga0207691_10015656 3300025940 Bacteria 7208
844 Ga0207691_10022150 3300025940 Bacteria 5995
845 Ga0207691_10215593 3300025940 Bacteria 1666
846 Ga0207691_10303616 3300025940 Bacteria 1371
847 Ga0207711_10002751 3300025941 Bacteria 15497
848 Ga0207711_10014196 3300025941 Bacteria 6616
849 Ga0207711_10016587 3300025941 Bacteria 6116
850 Ga0207711_10056760 3300025941 Bacteria 3365
851 Ga0207711_10065203 3300025941 Bacteria 3148
852 Ga0207711_10150084 3300025941 Bacteria 2102
853 Ga0207711_10213676 3300025941 Bacteria 1762
854 Ga0207711_10225985 3300025941 Bacteria 1713
855 Ga0207711_10253866 3300025941 Bacteria 1615
856 Ga0207689_10002876 3300025942 Bacteria 15867
857 Ga0207689_10006744 3300025942 Bacteria 10122
858 Ga0207689_10027971 3300025942 Bacteria 4716
859 Ga0207689_10038211 3300025942 Bacteria 3978
860 Ga0207689_10045842 3300025942 Bacteria 3615
861 Ga0207689_10059455 3300025942 Bacteria 3144
862 Ga0207661_10000677 3300025944 Bacteria 22076
863 Ga0207661_10036180 3300025944 Bacteria 3852
864 Ga0207661_10076448 3300025944 Bacteria 2750
865 Ga0207661_10214643 3300025944 Bacteria 1697
866 Ga0207679_10014187 3300025945 Bacteria 5234
867 Ga0207679_10023779 3300025945 Bacteria 4194
868 Ga0207667_10018788 3300025949 Bacteria 7739
869 Ga0207667_10021568 3300025949 Bacteria 7136
870 Ga0207667_10634501 3300025949 Bacteria 1075
871 Ga0207651_10010248 3300025960 Bacteria 5184
872 Ga0207651_10120065 3300025960 Bacteria 1992
873 Ga0207651_10387634 3300025960 Bacteria 1186
874 Ga0207712_10011245 3300025961 Bacteria 5699
875 Ga0207712_10218151 3300025961 Bacteria 1523
876 Ga0207668_10008496 3300025972 Bacteria 6125
877 Ga0207640_10272955 3300025981 Bacteria 1324
878 Ga0207658_10052330 3300025986 Bacteria 3013
879 Ga0207658_10065937 3300025986 Bacteria 2722
880 Ga0207658_10105901 3300025986 Bacteria 2213
881 Ga0207658_10152078 3300025986 Bacteria 1887
882 Ga0207658_10164781 3300025986 Bacteria 1820
883 Ga0207658_10337595 3300025986 Bacteria 1309
884 Ga0207677_10000038 3300026023 Bacteria 113012
885 Ga0207677_10006278 3300026023 Bacteria 6504
886 Ga0207677_10110040 3300026023 Bacteria 2050
887 Ga0207677_10271874 3300026023 Bacteria 1387
888 Ga0207703_10000291 3300026035 Bacteria 55245
889 Ga0207703_10000543 3300026035 Bacteria 38782
890 Ga0207703_10010969 3300026035 Bacteria 7061
891 Ga0207703_10023195 3300026035 Bacteria 4874
892 Ga0207703_10024118 3300026035 Bacteria 4785
893 Ga0207703_10037543 3300026035 Bacteria 3859
894 Ga0207703_10044712 3300026035 Bacteria 3560
895 Ga0207703_10060376 3300026035 Bacteria 3100
896 Ga0207703_10113550 3300026035 Bacteria 2315
897 Ga0207703_10390129 3300026035 Bacteria 1290
898 Ga0207639_10066880 3300026041 Bacteria 2795
899 Ga0207639_10161099 3300026041 Bacteria 1891
900 Ga0207639_10167750 3300026041 Bacteria 1856
901 Ga0207639_10269403 3300026041 Bacteria 1493
902 Ga0207678_10201374 3300026067 Bacteria 1702
903 Ga0207678_10338881 3300026067 Bacteria 1295
904 Ga0207678_10414824 3300026067 Bacteria 1167
905 Ga0207678_10450124 3300026067 Bacteria 1119
906 Ga0207708_10000083 3300026075 Bacteria 74423
907 Ga0207708_10006021 3300026075 Bacteria 8988
908 Ga0207708_10067042 3300026075 Bacteria 2745
909 Ga0207708_10076229 3300026075 Bacteria 2572
910 Ga0207708_10120683 3300026075 Bacteria 2042
911 Ga0207708_10316542 3300026075 Bacteria 1272
912 Ga0207702_10118735 3300026078 Bacteria 2363
913 Ga0207702_10174677 3300026078 Bacteria 1973
914 Ga0207641_10004103 3300026088 Bacteria 12694
915 Ga0207641_10053884 3300026088 Bacteria 3411
916 Ga0207641_10065682 3300026088 Bacteria 3104
917 Ga0207641_10071500 3300026088 Bacteria 2984
918 Ga0207641_10101239 3300026088 Bacteria 2539
919 Ga0207641_10413972 3300026088 Bacteria 1297
920 Ga0207641_10632842 3300026088 Bacteria 1050
921 Ga0207648_10012589 3300026089 Bacteria 7916
922 Ga0207648_10040827 3300026089 Bacteria 4076
923 Ga0207648_10055080 3300026089 Bacteria 3472
924 Ga0207648_10079978 3300026089 Bacteria 2851
925 Ga0207648_10431571 3300026089 Bacteria 1197
926 Ga0207648_10511531 3300026089 Bacteria 1099
927 Ga0207676_10000002 3300026095 Bacteria 1198607
928 Ga0207676_10006852 3300026095 Bacteria 8069
929 Ga0207676_10086266 3300026095 Bacteria 2564
930 Ga0207676_10095057 3300026095 Bacteria 2457
931 Ga0207676_10224225 3300026095 Bacteria 1676
932 Ga0207676_10245503 3300026095 Bacteria 1609
933 Ga0207674_10006409 3300026116 Bacteria 13842
934 Ga0207674_10014910 3300026116 Bacteria 8568
935 Ga0207674_10035909 3300026116 Bacteria 5170
936 Ga0207674_10046039 3300026116 Bacteria 4482
937 Ga0207674_10051334 3300026116 Bacteria 4209
938 Ga0207674_10059494 3300026116 Bacteria 3866
939 Ga0207674_10104541 3300026116 Bacteria 2810
940 Ga0207674_10191696 3300026116 Bacteria 1994
941 Ga0207675_100001016 3300026118 Bacteria 27800
942 Ga0207675_100001228 3300026118 Bacteria 25571
943 Ga0207675_100026037 3300026118 Bacteria 5445
944 Ga0207675_100027465 3300026118 Bacteria 5300
945 Ga0207675_100043363 3300026118 Bacteria 4201
946 Ga0207675_100050184 3300026118 Bacteria 3893
947 Ga0207675_100075639 3300026118 Bacteria 3152
948 Ga0207683_10015914 3300026121 Bacteria 6404
949 Ga0207698_10169049 3300026142 Bacteria 1923
950 Ga0207698_10267614 3300026142 Bacteria 1574
951 Ga0207698_10339827 3300026142 Bacteria 1414
952 Ga0207698_10480129 3300026142 Bacteria 1205
953 Ga0207698_10626445 3300026142 Bacteria 1063
954 Ga0207698_10744608 3300026142 Bacteria 978
955 Ga0209996_1009804 3300027395 Bacteria 1265
956 Ga0209999_1013787 3300027543 Bacteria 1466
957 Ga0207428_10008326 3300027907 Bacteria 9371
958 Ga0207428_10010234 3300027907 Bacteria 8384
959 Ga0207428_10010988 3300027907 Bacteria 8052
960 Ga0207428_10030570 3300027907 Bacteria 4452
961 Ga0207428_10079620 3300027907 Bacteria 2561
962 Ga0207428_10245864 3300027907 Bacteria 1335
963 Ga0268266_10000147 3300028379 Bacteria 135216
964 Ga0268266_10002811 3300028379 Bacteria 18157
965 Ga0268266_10129771 3300028379 Bacteria 2253
966 Ga0268265_10024691 3300028380 Bacteria 4257
967 Ga0268265_10026912 3300028380 Bacteria 4097
968 Ga0268265_10404759 3300028380 Bacteria 1262
969 Ga0268264_10008818 3300028381 Bacteria 8359
970 Ga0268264_10037422 3300028381 Bacteria 4001
971 Ga0268264_10144403 3300028381 Bacteria 2126
972 Ga0268264_10190869 3300028381 Bacteria 1867
973 Ga0268264_10398834 3300028381 Bacteria 1321
974 Ga0268264_10533557 3300028381 Bacteria 1149
975 Ga0265337_1000672 3300028556 Bacteria 18087
976 Ga0265319_1000209 3300028563 Bacteria 44508
977 Ga0265334_10006926 3300028573 Bacteria 4865
978 Ga0265334_10012453 3300028573 Bacteria 3573
979 Ga0265318_10015985 3300028577 Bacteria 3107
980 Ga0265322_10000636 3300028654 Bacteria 13220
981 Ga0265336_10005141 3300028666 Bacteria 4863
982 Ga0307515_10025750 3300028794 Bacteria 10161
983 Ga0265338_10000261 3300028800 Bacteria 96027
984 Ga0265338_10005713 3300028800 Bacteria 16089
985 Ga0265338_10050309 3300028800 Bacteria 3768
986 Ga0265338_10175017 3300028800 Bacteria 1641
987 Ga0237817_10352 3300030083 Bacteria 8517
988 Ga0237817_10549 3300030083 Bacteria 4388
989 Ga0265320_10004686 3300031240 Bacteria 8922
990 Ga0265325_10008441 3300031241 Bacteria 6080
991 Ga0265340_10035207 3300031247 Bacteria 2487
992 Ga0265316_10033105 3300031344 Bacteria 4213
993 Ga0265316_10064461 3300031344 Bacteria 2838
994 Ga0265316_10216106 3300031344 Bacteria 1416
995 Ga0307513_10015284 3300031456 Bacteria 9313
996 Ga0307509_10000024 3300031507 Bacteria 237566
997 Ga0307509_10026949 3300031507 Bacteria 6401
998 Ga0307509_10273597 3300031507 Bacteria 1455
999 Ga0307408_100135994 3300031548 Bacteria 1923
1000 Ga0265313_10002095 3300031595 Bacteria 17791
1001 Ga0316575_10000065 3300031665 Bacteria 25931
1002 Ga0316575_10002176 3300031665 Bacteria 6537
1003 Ga0316575_10005219 3300031665 Bacteria 4621
1004 Ga0316579_10000589 3300031691 Bacteria 12178
1005 Ga0316579_10002573 3300031691 Bacteria 6864
1006 Ga0316579_10004959 3300031691 Bacteria 5334
1007 Ga0316579_10006999 3300031691 Bacteria 4635
1008 Ga0316579_10009745 3300031691 Bacteria 4045
1009 Ga0316579_10013935 3300031691 Bacteria 3467
1010 Ga0316579_10048190 3300031691 Bacteria 1990
1011 Ga0316579_10151814 3300031691 Bacteria 1118
1012 Ga0265314_10098473 3300031711 Bacteria 1886
1013 Ga0265342_10003183 3300031712 Bacteria 13661
1014 Ga0316576_10002782 3300031727 Bacteria 10050
1015 Ga0316576_10021561 3300031727 Bacteria 4458
1016 Ga0316576_10021611 3300031727 Bacteria 4454
1017 Ga0316576_10050237 3300031727 Bacteria 3032
1018 Ga0316576_10109079 3300031727 Bacteria 2074
1019 Ga0316576_10125861 3300031727 Bacteria 1926
1020 Ga0316576_10126771 3300031727 Bacteria 1919
1021 Ga0316576_10131407 3300031727 Bacteria 1884
1022 Ga0316578_10002294 3300031728 Bacteria 8311
1023 Ga0316578_10002668 3300031728 Bacteria 7925
1024 Ga0316578_10006682 3300031728 Bacteria 5711
1025 Ga0316578_10037065 3300031728 Bacteria 2808
1026 Ga0316578_10100183 3300031728 Bacteria 1736
1027 Ga0316578_10119046 3300031728 Bacteria 1587
1028 Ga0316578_10120692 3300031728 Bacteria 1576
1029 Ga0316578_10163636 3300031728 Bacteria 1341
1030 Ga0316577_10002550 3300031733 Bacteria 9057
1031 Ga0316577_10004168 3300031733 Bacteria 7422
1032 Ga0316577_10025435 3300031733 Bacteria 3292
1033 Ga0316577_10059337 3300031733 Bacteria 2135
1034 Ga0316577_10095179 3300031733 Bacteria 1668
1035 Ga0316577_10173444 3300031733 Bacteria 1217
1036 Ga0307413_10078899 3300031824 Bacteria 2103
1037 Ga0307413_10626227 3300031824 Bacteria 884
1038 Ga0307410_10000419 3300031852 Bacteria 16849
1039 Ga0307410_10052045 3300031852 Bacteria 2763
1040 Ga0307410_10072680 3300031852 Bacteria 2389
1041 Ga0307406_10020729 3300031901 Bacteria 3877
1042 Ga0307406_10102325 3300031901 Bacteria 1954
1043 Ga0307406_10150223 3300031901 Bacteria 1661
1044 Ga0307406_10155274 3300031901 Bacteria 1638
1045 Ga0307406_10637293 3300031901 Bacteria 883
1046 Ga0307407_10001347 3300031903 Bacteria 8830
1047 Ga0307407_10146709 3300031903 Bacteria 1529
1048 Ga0307412_10011768 3300031911 Bacteria 5076
1049 Ga0307412_10013837 3300031911 Bacteria 4742
1050 Ga0307409_100001036 3300031995 Bacteria 13047
1051 Ga0307409_100033168 3300031995 Bacteria 3754
1052 Ga0307409_100158905 3300031995 Bacteria 1974
1053 Ga0307416_100000967 3300032002 Bacteria 15179
1054 Ga0307416_100014183 3300032002 Bacteria 5447
1055 Ga0307416_100097278 3300032002 Bacteria 2548
1056 Ga0307416_100231658 3300032002 Bacteria 1781
1057 Ga0307416_100535784 3300032002 Bacteria 1242
1058 Ga0307414_10001587 3300032004 Bacteria 11795
1059 Ga0307414_10551818 3300032004 Bacteria 1027
1060 Ga0307411_10000495 3300032005 Bacteria 13739
1061 Ga0307411_10004631 3300032005 Bacteria 6624
1062 Ga0307411_10093251 3300032005 Bacteria 2108
1063 Ga0307411_10247988 3300032005 Bacteria 1398
1064 Ga0307411_10499344 3300032005 Bacteria 1028
1065 Ga0307415_100002989 3300032126 Bacteria 8501
1066 Ga0307415_100168243 3300032126 Bacteria 1707
1067 Ga0307415_100294112 3300032126 Bacteria 1342
1068 Ga0316583_10001483 3300032133 Bacteria 7860
1069 Ga0316583_10003424 3300032133 Bacteria 5586
1070 Ga0316583_10019319 3300032133 Bacteria 2446
1071 Ga0316585_10010791 3300032137 Bacteria 2685
1072 Ga0316585_10011528 3300032137 Bacteria 2608
1073 Ga0316580_10002121 3300032139 Bacteria 5395
1074 Ga0316593_10119313 3300032168 Bacteria 946
1075 Ga0307507_10156485 3300033179 Bacteria 1697
1076 Ga0316588_1009988 3300033528 Bacteria 1990
1077 Ga0373959_0000156 3300034820 Bacteria 15335
1078 Ga0373926_0001470 3300035083 Bacteria 7185
1079 Ga0373934_0000557 3300035086 Bacteria 13162
1080 Ga0373940_0011440 3300035088 Bacteria 2107
1081 Ga0373949_0000064 3300035090 Bacteria 39367
1082 Ga0373949_0027973 3300035090 Bacteria 1329
1083 Ga0373936_0000010 3300035113 Bacteria 254300
1084 Ga0373953_0037227 3300035117 Bacteria 1919
1085 Ga0373956_0004354 3300035119 Bacteria 5676
1086 Ga0373957_0006575 3300035120 Bacteria 3670
1087 Ga0373943_0008617 3300035170 Bacteria 4573
1088 Ga0373943_0050674 3300035170 Bacteria 2041
1089 Ga0373943_0052456 3300035170 Bacteria 2011
1090 Ga0373955_0028648 3300035172 Bacteria 2889
1091 Ga0373961_0000189 3300035241 Bacteria 29564
1092 Ga0373961_0000277 3300035241 Bacteria 23116
1093 Ga0316574_0000175 3300035398 Bacteria 21488
1094 Ga0316574_0002372 3300035398 Bacteria 9415
1095 Ga0316574_0015002 3300035398 Bacteria 4488
1096 Ga0316574_0020020 3300035398 Bacteria 3955
1097 Ga0373931_0186035 3300035691 Bacteria 1233
1098 Ga0373935_0000570 3300035692 Bacteria 19220
1099 Ga0373937_0038044 3300036401 Bacteria 4386
1100 Ga0373937_0166776 3300036401 Bacteria 2065
1101 Ga0373937_0420228 3300036401 Bacteria 1269
1102 Ga0316582_0000258 3300036647 Bacteria 17826
1103 Ga0316582_0001625 3300036647 Bacteria 10024
1104 Ga0316582_0005946 3300036647 Bacteria 6352
1105 Ga0316582_0010937 3300036647 Bacteria 4997
1106 Ga0316582_0025391 3300036647 Bacteria 3557
1107 Ga0316582_0058044 3300036647 Bacteria 2474
1108 Ga0316582_0109753 3300036647 Bacteria 1835
1109 Ga0316582_0135991 3300036647 Bacteria 1654
1110 Ga0316582_0146527 3300036647 Bacteria 1594
1111 Ga0316584_0002276 3300036712 Bacteria 12083
1112 Ga0316584_0006415 3300036712 Bacteria 7964
1113 Ga0316584_0012758 3300036712 Bacteria 5931
1114 Ga0316584_0015436 3300036712 Bacteria 5464
1115 Ga0316584_0031073 3300036712 Bacteria 3949
1116 Ga0316584_0034827 3300036712 Bacteria 3734
1117 Ga0316584_0093682 3300036712 Bacteria 2249
1118 Ga0316584_0099329 3300036712 Bacteria 2180
1119 Ga0316584_0116416 3300036712 Bacteria 1999
1120 Ga0316584_0221576 3300036712 Bacteria 1390
1121 Ga0373925_0001623 3300037068 Bacteria 18993
1122 Ga0373925_0023695 3300037068 Bacteria 4479
1123 Ga0373925_0094111 3300037068 Bacteria 2294
1124 Ga0395899_0068270 3300037312 Bacteria 2607
1125 Ga0395899_0172890 3300037312 Bacteria 1520
1126 Ga0395900_0026447 3300037418 Bacteria 5942
1127 Ga0395900_0075081 3300037418 Bacteria 3475
1128 Ga0395900_0237129 3300037418 Bacteria 1832
1129 Ga0395898_0058215 3300037466 Bacteria 3763
1130 Ga0395898_0171076 3300037466 Bacteria 2077
1131 Ga0395905_0008275 3300037471 Bacteria 10267
1132 Ga0395905_0057725 3300037471 Bacteria 3630
1133 Ga0395905_0065722 3300037471 Bacteria 3396
1134 Ga0395905_0179796 3300037471 Bacteria 1986
1135 Ga0395905_0179921 3300037471 Bacteria 1985
1136 Ga0316581_0009488 3300037588 Bacteria 2676
1137 Ga0316581_0013227 3300037588 Bacteria 2337
1138 Ga0316581_0025895 3300037588 Bacteria 1747
1139 Ga0436364_0209524 3300037853 Bacteria 5873
1140 Ga0395901_0003701 3300038443 Bacteria 15421
1141 Ga0395901_0433440 3300038443 Bacteria 1346
1142 Ga0237819_00011 3300038705 Bacteria 65140
1143 Ga0237819_00072 3300038705 Bacteria 35999
1144 Ga0400484_03515 3300038725 Bacteria 11330
1145 Ga0400490_35387 3300038726 Bacteria 2397
1146 Ga0400491_26103 3300038727 Bacteria 4564
1147 Ga0400485_18179 3300038735 Bacteria 4686
1148 Ga0400488_13817 3300038741 Bacteria 3888
1149 Ga0400486_22010 3300038742 Bacteria 12077
1150 Ga0400486_31955 3300038742 Bacteria 54509
1151 Ga0242420_002205 3300038996 Bacteria 2751
1152 Ga0400483_005135 3300039062 Bacteria 49198
1153 Ga0400483_117225 3300039062 Bacteria 4711
1154 Ga0400483_127419 3300039062 Bacteria 1448
1155 Ga0400483_147632 3300039062 Unclassified 3173
1156 Ga0400483_190891 3300039062 Bacteria 15413
1157 Ga0400483_226761 3300039062 Bacteria 37033
1158 Ga0400489_02082 3300039093 Bacteria 1397
1159 Ga0400489_31839 3300039093 Bacteria 16627
1160 Ga0400487_64678 3300039110 Bacteria 2444
1161 Ga0436365_0609386 3300039437 Bacteria 1277
1162 Ga0436365_0895411 3300039437 Bacteria 24537
1163 Ga0436365_1192947 3300039437 Bacteria 4986
1164 Ga0436361_0551962 3300039447 Bacteria 5869
1165 Ga0436361_0628951 3300039447 Bacteria 18481
1166 Ga0436361_1109690 3300039447 Bacteria 3732
1167 Ga0436362_0984254 3300039453 Bacteria 405590
1168 Ga0439436_0003023 3300041404 Bacteria 5106
1169 Ga0439439_0000069 3300041406 Bacteria 13157
1170 Ga0451837_1835074 3300041494 Bacteria 1326
1171 Ga0451841_1185704 3300041498 Bacteria 1358
1172 Ga0451849_0460671 3300041505 Bacteria 5861
1173 Ga0451849_0476718 3300041505 Bacteria 1569
1174 Ga0451853_0197269 3300041512 Bacteria 27774
1175 Ga0439449_0000310 3300042007 Bacteria 17543
1176 Ga0439462_0000401 3300042015 Bacteria 8374
1177 Ga0439462_0005925 3300042015 Bacteria 3025
1178 Ga0439446_0106332 3300042156 Bacteria 892
1179 Ga0439434_0010303 3300042435 Bacteria 2756
1180 Ga0439435_0069994 3300042436 Bacteria 1037
1181 Ga0451577_0000079 3300042876 Bacteria 219292
1182 Ga0451577_0001383 3300042876 Bacteria 32504
1183 Ga0451577_0002426 3300042876 Bacteria 22222
1184 Ga0451577_0010061 3300042876 Bacteria 9060
1185 Ga0451577_0010261 3300042876 Bacteria 8969
1186 Ga0451577_0011583 3300042876 Bacteria 8333
1187 Ga0451577_0013346 3300042876 Bacteria 7694
1188 Ga0451577_0023988 3300042876 Bacteria 5554
1189 Ga0451577_0036406 3300042876 Bacteria 4429
1190 Ga0451577_0066985 3300042876 Bacteria 3202
1191 Ga0451577_0073333 3300042876 Bacteria 3054
1192 Ga0451577_0084993 3300042876 Bacteria 2823
1193 Ga0451577_0104422 3300042876 Bacteria 2532
1194 Ga0451577_0133362 3300042876 Bacteria 2229
1195 Ga0451577_0169900 3300042876 Bacteria 1965
1196 Ga0451577_0198011 3300042876 Bacteria 1813
1197 Ga0451577_0306749 3300042876 Bacteria 1439
1198 Ga0451577_0561081 3300042876 Bacteria 1037
1199 Ga0451577_0572184 3300042876 Bacteria 1025
1200 Ga0453683_0000002 3300044673 Bacteria 1244396
1201 Ga0453683_0000266 3300044673 Bacteria 68566
1202 Ga0453683_0000326 3300044673 Bacteria 58490
1203 Ga0453683_0000890 3300044673 Bacteria 28654
1204 Ga0453683_0001905 3300044673 Bacteria 17023
1205 Ga0453683_0003551 3300044673 Bacteria 11462
1206 Ga0453683_0004105 3300044673 Bacteria 10465
1207 Ga0453683_0008682 3300044673 Bacteria 6813
1208 Ga0453683_0011614 3300044673 Bacteria 5801
1209 Ga0453683_0063868 3300044673 Bacteria 2301
1210 Ga0453683_0079189 3300044673 Bacteria 2058
1211 Ga0453683_0085470 3300044673 Bacteria 1977
1212 Ga0453683_0090403 3300044673 Bacteria 1919
1213 Ga0453683_0148772 3300044673 Bacteria 1479
1214 Ga0453683_0172382 3300044673 Bacteria 1371
1215 Ga0453683_0179427 3300044673 Bacteria 1343
1216 Ga0466966_0072787 3300044684 Bacteria 2151
1217 Ga0466966_0135769 3300044684 Bacteria 1504
1218 Ga0466961_0003085 3300044693 Bacteria 10355
1219 Ga0466963_0026588 3300044694 Bacteria 3702
1220 Ga0453684_0000004 3300044712 Bacteria 1469893
1221 Ga0453684_0000242 3300044712 Bacteria 234895
1222 Ga0453684_0000386 3300044712 Bacteria 180948
1223 Ga0453684_0000594 3300044712 Bacteria 134181
1224 Ga0453684_0001014 3300044712 Bacteria 90517
1225 Ga0453684_0001289 3300044712 Bacteria 74584
1226 Ga0453684_0007441 3300044712 Bacteria 20133
1227 Ga0453684_0007574 3300044712 Bacteria 19903
1228 Ga0453684_0009801 3300044712 Bacteria 16614
1229 Ga0453684_0010428 3300044712 Bacteria 15896
1230 Ga0453684_0031284 3300044712 Bacteria 7486
1231 Ga0453684_0032891 3300044712 Bacteria 7242
1232 Ga0453684_0035072 3300044712 Bacteria 6945
1233 Ga0453684_0036767 3300044712 Bacteria 6740
1234 Ga0453684_0037929 3300044712 Bacteria 6603
1235 Ga0453684_0048327 3300044712 Bacteria 5629
1236 Ga0453684_0049251 3300044712 Bacteria 5559
1237 Ga0453684_0050277 3300044712 Bacteria 5486
1238 Ga0453684_0059314 3300044712 Bacteria 4935
1239 Ga0453684_0092432 3300044712 Bacteria 3730
1240 Ga0453684_0092552 3300044712 Bacteria 3727
1241 Ga0453684_0093505 3300044712 Bacteria 3703
1242 Ga0453684_0096351 3300044712 Bacteria 3635
1243 Ga0453684_0125393 3300044712 Bacteria 3092
1244 Ga0453684_0136787 3300044712 Bacteria 2932
1245 Ga0453684_0196306 3300044712 Bacteria 2357
1246 Ga0453684_0445461 3300044712 Bacteria 1442
1247 Ga0453684_0478244 3300044712 Bacteria 1382
1248 Ga0453684_0497642 3300044712 Bacteria 1350
1249 Ga0466971_0111233 3300044719 Bacteria 1264
1250 Ga0466968_0011627 3300044735 Bacteria 3433
1251 Ga0466957_0186083 3300044842 Bacteria 1358
1252 Ga0466959_0150730 3300045049 Bacteria 1639
1253 Ga0451576_0000321 3300045051 Bacteria 116475
1254 Ga0451576_0003052 3300045051 Bacteria 23559
1255 Ga0451576_0006382 3300045051 Bacteria 14479
1256 Ga0451576_0012969 3300045051 Bacteria 9340
1257 Ga0451576_0021802 3300045051 Bacteria 6954
1258 Ga0451576_0034893 3300045051 Bacteria 5340
1259 Ga0451576_0039031 3300045051 Bacteria 5025
1260 Ga0451576_0063769 3300045051 Bacteria 3840
1261 Ga0451576_0064909 3300045051 Bacteria 3802
1262 Ga0451576_0123690 3300045051 Bacteria 2694
1263 Ga0451576_0144316 3300045051 Bacteria 2482
1264 Ga0451576_0405561 3300045051 Bacteria 1429
1265 Ga0466967_0000143 3300045976 Bacteria 27834
1266 Ga0495592_0058173 3300046454 Bacteria 2852
1267 Ga0495592_0213877 3300046454 Bacteria 1293
1268 Ga0495629_0000038 3300046459 Bacteria 117040
1269 Ga0495629_0002434 3300046459 Bacteria 14285
1270 Ga0495629_0053065 3300046459 Bacteria 2836
1271 Ga0495629_0253945 3300046459 Bacteria 1209
1272 Ga0495638_0059138 3300046460 Bacteria 2374
1273 Ga0495653_0084340 3300046463 Bacteria 2340
1274 Ga0495653_0146320 3300046463 Bacteria 1655
1275 Ga0495580_0214169 3300046472 Bacteria 1325
1276 Ga0495582_0056811 3300046473 Bacteria 2157
1277 Ga0495582_0184307 3300046473 Bacteria 1190
1278 Ga0495639_0000188 3300046475 Bacteria 32565
1279 Ga0495639_0003211 3300046475 Bacteria 7106
1280 Ga0495662_0041262 3300046476 Bacteria 2228
1281 Ga0495662_0097280 3300046476 Bacteria 1439
1282 Ga0495664_0265549 3300046477 Bacteria 1037
1283 Ga0495594_0058302 3300046499 Bacteria 2133
1284 Ga0495594_0071070 3300046499 Bacteria 1935
1285 Ga0495608_0003813 3300046511 Bacteria 10836
1286 Ga0495608_0008469 3300046511 Bacteria 7204
1287 Ga0495618_0011418 3300046514 Bacteria 5386
1288 Ga0495628_0001822 3300046516 Bacteria 19347
1289 Ga0495628_0026844 3300046516 Bacteria 4688
1290 Ga0495628_0350927 3300046516 Bacteria 1084
1291 Ga0495630_0048918 3300046517 Bacteria 3164
1292 Ga0495630_0259412 3300046517 Bacteria 1328
1293 Ga0495632_0021671 3300046519 Bacteria 3459
1294 Ga0495643_0000016 3300046522 Bacteria 313579
1295 Ga0495663_0000350 3300046525 Bacteria 17196
1296 Ga0495663_0079763 3300046525 Bacteria 1053
1297 Ga0495666_0000032 3300046526 Bacteria 53492
1298 Ga0495652_0044317 3300046529 Bacteria 3832
1299 Ga0495652_0089110 3300046529 Bacteria 2527
1300 Ga0495665_0001812 3300046531 Bacteria 11517
1301 Ga0495665_0013030 3300046531 Bacteria 4503
1302 Ga0495640_0024828 3300046533 Bacteria 4354
1303 Ga0495586_0000140 3300046535 Bacteria 45613
1304 Ga0495586_0018581 3300046535 Bacteria 3701
1305 Ga0495586_0111646 3300046535 Bacteria 1522
1306 Ga0495586_0121251 3300046535 Bacteria 1461
1307 Ga0495587_0033448 3300046536 Bacteria 3104
1308 Ga0495598_0000451 3300046537 Bacteria 7464
1309 Ga0495621_0000925 3300046539 Bacteria 7458
1310 Ga0495621_0058694 3300046539 Bacteria 1392
1311 Ga0495667_0003016 3300046559 Bacteria 11285
1312 Ga0495667_0015909 3300046559 Bacteria 5085
1313 Ga0495667_0025347 3300046559 Bacteria 3996
1314 Ga0495667_0025575 3300046559 Bacteria 3977
1315 Ga0495656_0090835 3300046615 Bacteria 1396
1316 Ga0495635_0007993 3300046663 Bacteria 7394
1317 Ga0495635_0063066 3300046663 Bacteria 2545
1318 Ga0495635_0094960 3300046663 Bacteria 2038
1319 Ga0495635_0099905 3300046663 Bacteria 1983
1320 Ga0495661_0036609 3300046665 Bacteria 3071
1321 Ga0495588_0003546 3300046674 Bacteria 6813
1322 Ga0495657_0000848 3300046675 Bacteria 26984
1323 Ga0495657_0016847 3300046675 Bacteria 5314
1324 Ga0495657_0075480 3300046675 Bacteria 2191
1325 Ga0495599_0013056 3300046678 Bacteria 5128
1326 Ga0495599_0016848 3300046678 Bacteria 4539
1327 Ga0495599_0032369 3300046678 Bacteria 3283
1328 Ga0495646_0033409 3300046680 Bacteria 3197
1329 Ga0495658_0046984 3300046683 Bacteria 2429
1330 Ga0495613_0020478 3300046689 Bacteria 4930
1331 Ga0495613_0174080 3300046689 Bacteria 1526
1332 Ga0495613_0189217 3300046689 Bacteria 1455
1333 Ga0495624_0288191 3300046690 Bacteria 991
1334 Ga0495600_0002642 3300046809 Bacteria 10347
1335 Ga0495600_0007108 3300046809 Bacteria 6842
1336 Ga0495600_0011115 3300046809 Bacteria 5604
1337 Ga0495581_0005570 3300047315 Bacteria 7297
1338 Ga0495581_0006925 3300047315 Bacteria 6570
1339 Ga0495581_0011954 3300047315 Bacteria 5022
1340 Ga0495581_0243329 3300047315 Bacteria 1052
1341 Ga0495581_0297572 3300047315 Bacteria 943
1342 Ga0495604_0012866 3300047317 Bacteria 6664
1343 Ga0495636_0000275 3300047318 Bacteria 20174
1344 Ga0495636_0030618 3300047318 Bacteria 2201
1345 Ga0495674_0081965 3300047319 Bacteria 2766
1346 Ga0495676_0013319 3300047321 Bacteria 7391
1347 Ga0495676_0047316 3300047321 Bacteria 3479
1348 Ga0495676_0086312 3300047321 Bacteria 2362
1349 Ga0495676_0107623 3300047321 Bacteria 2052
1350 Ga0495680_0006701 3300047322 Bacteria 10661
1351 Ga0495680_0216792 3300047322 Bacteria 1368
1352 Ga0495675_0003757 3300047444 Bacteria 9183
1353 Ga0495675_0085133 3300047444 Bacteria 1988
1354 Ga0495684_0009426 3300047471 Bacteria 7538
1355 Ga0495684_0040067 3300047471 Bacteria 3592
1356 Ga0495684_0089257 3300047471 Bacteria 2335
1357 Ga0495684_0204411 3300047471 Bacteria 1455
1358 Ga0495684_0371980 3300047471 Bacteria 1010
1359 Ga0495602_0158582 3300048088 Bacteria 1769
1360 Ga0495615_0042123 3300048090 Bacteria 1144
1361 Ga0496102_0369083 3300048905 Bacteria 1351
1362 Ga0496102_0644619 3300048905 Bacteria 982
1363 Ga0496103_0014139 3300048906 Bacteria 4738
1364 Ga0496103_0114228 3300048906 Bacteria 1717
1365 Ga0496104_0147406 3300048907 Bacteria 2260
1366 Ga0496106_0038192 3300048909 Bacteria 3593
1367 Ga0496109_0376911 3300048912 Bacteria 1340
1368 Ga0496109_0436058 3300048912 Bacteria 1238
1369 Ga0496109_0478565 3300048912 Bacteria 1176
1370 Ga0496110_0000375 3300048913 Bacteria 29935
1371 Ga0496110_0003343 3300048913 Bacteria 12263
1372 Ga0496110_0207943 3300048913 Bacteria 1779
1373 Ga0496110_0274967 3300048913 Bacteria 1534
1374 Ga0496111_0009778 3300048914 Bacteria 6410
1375 Ga0496112_0001611 3300048915 Bacteria 17447
1376 Ga0496112_0007138 3300048915 Bacteria 9889
1377 Ga0496112_0035551 3300048915 Bacteria 4854
1378 Ga0496112_0245784 3300048915 Bacteria 1741
1379 Ga0496112_0362635 3300048915 Bacteria 1391
1380 Ga0496113_0099578 3300048916 Bacteria 2251
1381 Ga0496113_0468959 3300048916 Bacteria 1012
1382 Ga0496115_0002827 3300048918 Bacteria 12487
1383 Ga0496126_0128697 3300048929 Bacteria 2190
1384 Ga0501305_004673 3300049161 Bacteria 1621
1385 Ga0501305_020982 3300049161 Bacteria 964
1386 Ga0501298_005044 3300049521 Bacteria 2102
1387 Ga0501299_012445 3300049522 Bacteria 1452
1388 Ga0501336_000948 3300049552 Bacteria 1622
1389 Ga0501033_0199398 3300049570 Bacteria 1430
1390 Ga0501034_0149391 3300049571 Bacteria 2313
1391 Ga0501036_0094733 3300049572 Bacteria 2524
1392 Ga0501037_0029352 3300049573 Bacteria 4063
1393 Ga0501040_0009603 3300049576 Bacteria 6313
1394 Ga0501042_0011877 3300049578 Bacteria 5884
1395 Ga0501042_0275893 3300049578 Bacteria 1214
1396 Ga0501047_0000842 3300049581 Bacteria 31665
1397 Ga0501047_0136680 3300049581 Bacteria 2331
1398 Ga0501048_0040171 3300049582 Bacteria 3353
1399 Ga0501048_0164702 3300049582 Bacteria 1570
1400 Ga0501067_0018521 3300049583 Bacteria 3856
1401 Ga0501068_0010007 3300049584 Bacteria 5318
1402 Ga0501070_0093507 3300049586 Bacteria 2487
1403 Ga0501075_0003015 3300049591 Bacteria 11249
1404 Ga0501075_0169796 3300049591 Bacteria 1664
1405 Ga0501077_0000012 3300049593 Bacteria 96777
1406 Ga0501198_000644 3300049649 Bacteria 4333
1407 Ga0501202_000421 3300049652 Bacteria 5950
1408 Ga0501202_016392 3300049652 Bacteria 1437
1409 Ga0501206_017830 3300049653 Bacteria 996
1410 Ga0501207_000063 3300049654 Bacteria 8180
1411 Ga0501216_004854 3300049660 Bacteria 2009
1412 Ga0501217_037872 3300049661 Bacteria 1216
1413 Ga0501224_000404 3300049664 Bacteria 5147
1414 Ga0501227_000859 3300049665 Bacteria 6628
1415 Ga0501227_014153 3300049665 Bacteria 1767
1416 Ga0501235_011614 3300049669 Bacteria 1931
1417 Ga0501240_014945 3300049673 Bacteria 1097
1418 Ga0501242_006512 3300049674 Bacteria 1332
1419 Ga0501246_005099 3300049676 Bacteria 1095
1420 Ga0501247_004673 3300049677 Bacteria 1506
1421 Ga0501257_003394 3300049686 Bacteria 3416
1422 Ga0501259_001855 3300049688 Bacteria 3501
1423 Ga0501221_015125 3300049704 Bacteria 1444
1424 Ga0501225_0001584 3300049705 Bacteria 7126
1425 Ga0501225_0031701 3300049705 Bacteria 1454
1426 Ga0501245_012808 3300049708 Bacteria 1235
1427 Ga0501079_0049753 3300049741 Bacteria 3235
1428 Ga0501079_0206260 3300049741 Bacteria 1535
1429 Ga0501080_0151215 3300049742 Bacteria 2145
1430 Ga0501081_0018724 3300049743 Bacteria 4600
1431 Ga0501083_0000164 3300049744 Bacteria 43596
1432 Ga0501263_002446 3300049760 Bacteria 1893
1433 Ga0501035_0003696 3300049822 Bacteria 14585
1434 Ga0501035_0081607 3300049822 Bacteria 2854
1435 Ga0501044_0000734 3300049823 Bacteria 39508
1436 Ga0501045_0268687 3300049824 Bacteria 1270
1437 Ga0501212_003055 3300049851 Bacteria 2071
1438 nmdc:mga05p37_10079_c1 3300050507 Bacteria 11216
1439 nmdc:mga05p37_125437_c1 3300050507 Bacteria 3153
1440 nmdc:mga05p37_135148_c1 3300050507 Bacteria 3025
1441 nmdc:mga05p37_162237_c1 3300050507 Bacteria 2729
1442 nmdc:mga05p37_165938_c1 3300050507 Bacteria 2695
1443 nmdc:mga05p37_205445_c1 3300050507 Bacteria 2383
1444 nmdc:mga05p37_26161_c1 3300050507 Bacteria 7094
1445 nmdc:mga05p37_33004_c1 3300050507 Bacteria 6338
1446 nmdc:mga05p37_335386_c1 3300050507 Bacteria 1785
1447 nmdc:mga05p37_342220_c1 3300050507 Bacteria 1763
1448 nmdc:mga05p37_3703_c1 3300050507 Bacteria 17879
1449 nmdc:mga05p37_392954_c1 3300050507 Bacteria 1621
1450 nmdc:mga05p37_412049_c1 3300050507 Bacteria 1575
1451 nmdc:mga05p37_490172_c1 3300050507 Bacteria 1413
1452 nmdc:mga05p37_513_c1 3300050507 Bacteria 42797
1453 nmdc:mga05p37_52823_c1 3300050507 Bacteria 4997
1454 nmdc:mga09592_108934_c1 3300050508 Unclassified 2376
1455 nmdc:mga09592_144383_c1 3300050508 Bacteria 2052
1456 nmdc:mga09592_1976_c1 3300050508 Bacteria 16534
1457 nmdc:mga09592_210978_c1 3300050508 Bacteria 1682
1458 nmdc:mga09592_257791_c1 3300050508 Bacteria 1512
1459 nmdc:mga09592_5355_c1 3300050508 Bacteria 10429
1460 nmdc:mga0qj67_129469_c1 3300050509 Bacteria 2044
1461 nmdc:mga0qj67_133368_c1 3300050509 Bacteria 2012
1462 nmdc:mga0qj67_46657_c1 3300050509 Bacteria 3421
1463 nmdc:mga0qj67_504783_c1 3300050509 Bacteria 972
1464 nmdc:mga0qj67_537765_c1 3300050509 Bacteria 938
1465 nmdc:mga0qj67_7191_c1 3300050509 Bacteria 8215
1466 nmdc:mga0qj67_72562_c1 3300050509 Bacteria 2749
1467 nmdc:mga06r32_116313_c1 3300050510 Bacteria 2634
1468 nmdc:mga06r32_14286_c1 3300050510 Bacteria 7201
1469 nmdc:mga06r32_15459_c1 3300050510 Bacteria 6928
1470 nmdc:mga06r32_176997_c1 3300050510 Bacteria 2118
1471 nmdc:mga06r32_206883_c1 3300050510 Bacteria 1950
1472 nmdc:mga06r32_2293_c1 3300050510 Bacteria 17120
1473 nmdc:mga06r32_261886_c1 3300050510 Bacteria 1717
1474 nmdc:mga06r32_2819_c1 3300050510 Bacteria 15587
1475 nmdc:mga06r32_57083_c1 3300050510 Bacteria 3750
1476 nmdc:mga08y16_11031_c1 3300050511 Bacteria 9489
1477 nmdc:mga08y16_16384_c1 3300050511 Bacteria 7793
1478 nmdc:mga08y16_170747_c1 3300050511 Bacteria 2259
1479 nmdc:mga08y16_375819_c1 3300050511 Bacteria 1457
1480 nmdc:mga08y16_385303_c1 3300050511 Bacteria 1436
1481 nmdc:mga08y16_4691_c1 3300050511 Bacteria 14244
1482 nmdc:mga08y16_543114_c1 3300050511 Bacteria 1177
1483 nmdc:mga08y16_6359_c1 3300050511 Bacteria 12390
1484 nmdc:mga08y16_65874_c1 3300050511 Bacteria 3781
1485 nmdc:mga08y16_8504_c1 3300050511 Bacteria 10748
1486 nmdc:mga08y16_89790_c1 3300050511 Bacteria 3202
1487 nmdc:mga08y16_96584_c1 3300050511 Bacteria 3077
1488 nmdc:mga08y16_972_c1 3300050511 Bacteria 27899
1489 nmdc:mga0n895_10005_c1 3300050512 Bacteria 8348
1490 nmdc:mga0n895_112264_c1 3300050512 Bacteria 2742
1491 nmdc:mga0n895_12360_c1 3300050512 Bacteria 7656
1492 nmdc:mga0n895_12780_c1 3300050512 Bacteria 7540
1493 nmdc:mga0n895_191271_c1 3300050512 Bacteria 2077
1494 nmdc:mga0n895_291352_c1 3300050512 Bacteria 1655
1495 nmdc:mga0n895_308232_c1 3300050512 Bacteria 1605
1496 nmdc:mga0n895_34461_c1 3300050512 Bacteria 4873
1497 nmdc:mga0n895_34518_c1 3300050512 Bacteria 4870
1498 nmdc:mga0n895_676979_c1 3300050512 Bacteria 1029
1499 nmdc:mga0n895_7620_c1 3300050512 Bacteria 9307
1500 nmdc:mga0rr50_107229_c1 3300050513 Bacteria 2205
1501 nmdc:mga0rr50_142696_c1 3300050513 Bacteria 1928
1502 nmdc:mga0rr50_246_c1 3300050513 Bacteria 29415
1503 nmdc:mga0rr50_93806_c1 3300050513 Bacteria 2342
1504 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
1505 nmdc:mga08x19_252861_c1 3300050514 Bacteria 1217
1506 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
1507 nmdc:mga0a205_109520_c1 3300050515 Bacteria 2660
1508 nmdc:mga0a205_146809_c1 3300050515 Bacteria 2259
1509 nmdc:mga0a205_24963_c1 3300050515 Bacteria 5690
1510 nmdc:mga0a205_276288_c1 3300050515 Bacteria 1556
1511 nmdc:mga0a205_29641_c1 3300050515 Bacteria 5238
1512 nmdc:mga0a205_30286_c1 3300050515 Bacteria 5180
1513 nmdc:mga0a205_3651_c1 3300050515 Bacteria 7434
1514 nmdc:mga0a205_60217_c2 3300050515 Bacteria 1571
1515 nmdc:mga0a205_64323_c1 3300050515 Bacteria 3543
1516 Ga0500635_0001461 3300053080 Bacteria 5682
1517 Ga0495619_0023892 3300053085 Bacteria 3919
1518 Ga0500566_0003319 3300053094 Bacteria 9624
1519 Ga0500628_000285 3300053129 Bacteria 9652
1520 Ga0500585_037085 3300053144 Bacteria 1706
1521 Ga0500645_009659 3300053730 Bacteria 3232
1522 Ga0590071_024473 3300059421 Bacteria 1431
1523 Ga0501082_0000054 3300060353 Bacteria 82015
1524 Ga0501082_0019509 3300060353 Bacteria 5845
1525 Ga0530510_0024090 3300061734 Bacteria 4342
1526 Ga0530510_0188966 3300061734 Bacteria 1529

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100273737 Ga0068862_1002737372 266
2 3300031727 Ga0316576_10050237 Ga0316576_100502374 268
3 3300046514 Ga0495618_0011418 Ga0495618_0011418_4051_4947 273
4 3300046535 Ga0495586_0121251 Ga0495586_0121251_257_1153 273
5 3300046663 Ga0495635_0063066 Ga0495635_0063066_396_1292 273
6 3300047322 Ga0495680_0216792 Ga0495680_0216792_418_1314 273
7 3300047471 Ga0495684_0040067 Ga0495684_0040067_496_1392 273
8 3300031691 Ga0316579_10048190 Ga0316579_100481902 276
9 3300031733 Ga0316577_10025435 Ga0316577_100254352 276
10 3300036647 Ga0316582_0146527 Ga0316582_0146527_237_1094 276
11 3300036712 Ga0316584_0031073 Ga0316584_0031073_1243_2100 276
12 3300002459 JGI24751J29686_10000249 JGI24751J29686_1000024916 278
13 3300005331 Ga0070670_100000118 Ga0070670_1000001185 278
14 3300005406 Ga0070703_10020438 Ga0070703_100204382 278
15 3300005549 Ga0070704_100045309 Ga0070704_1000453094 278
16 3300006847 Ga0075431_100193070 Ga0075431_1001930702 278
17 3300009094 Ga0111539_10002573 Ga0111539_1000257320 278
18 3300009094 Ga0111539_10135472 Ga0111539_101354721 278
19 3300009148 Ga0105243_10313798 Ga0105243_103137981 278
20 3300014325 Ga0163163_10013319 Ga0163163_100133193 278
21 3300025925 Ga0207650_10000046 Ga0207650_10000046138 278
22 3300026075 Ga0207708_10076229 Ga0207708_100762292 278
23 3300031728 Ga0316578_10002294 Ga0316578_100022942 278
24 3300045051 Ga0451576_0144316 Ga0451576_0144316_916_1767 278
25 3300047318 Ga0495636_0030618 Ga0495636_0030618_992_1849 278
26 3300050511 nmdc:mga08y16_375819_c1 nmdc:mga08y16_375819_c1_581_1438 278
27 3300050511 nmdc:mga08y16_6359_c1 nmdc:mga08y16_6359_c1_8776_9648 278
28 3300025937 Ga0207669_10108225 Ga0207669_101082252 279
29 3300025939 Ga0207665_10023103 Ga0207665_100231032 279
30 3300031691 Ga0316579_10004959 Ga0316579_100049592 279
31 3300031728 Ga0316578_10037065 Ga0316578_100370652 279
32 3300031733 Ga0316577_10059337 Ga0316577_100593372 279
33 3300031901 Ga0307406_10150223 Ga0307406_101502232 279
34 3300036647 Ga0316582_0010937 Ga0316582_0010937_2576_3421 279
35 3300037588 Ga0316581_0025895 Ga0316581_0025895_452_1297 279
36 3300039437 Ga0436365_0609386 Ga0436365_0609386_298_1155 279
37 3300039453 Ga0436362_0984254 Ga0436362_0984254_189769_190710 279
38 3300049591 Ga0501075_0169796 Ga0501075_0169796_495_1349 279
39 3300049741 Ga0501079_0206260 Ga0501079_0206260_630_1484 279
40 3300053730 Ga0500645_009659 Ga0500645_009659_1717_2562 279
41 3300005293 Ga0065715_10100462 Ga0065715_101004622 280
42 3300005293 Ga0065715_10185327 Ga0065715_101853272 280
43 3300005333 Ga0070677_10066622 Ga0070677_100666222 280
44 3300005334 Ga0068869_100240922 Ga0068869_1002409221 280
45 3300005336 Ga0070680_100271412 Ga0070680_1002714122 280
46 3300005337 Ga0070682_100000007 Ga0070682_100000007145 280
47 3300005338 Ga0068868_100002955 Ga0068868_1000029555 280
48 3300005340 Ga0070689_100021268 Ga0070689_1000212682 280
49 3300005441 Ga0070700_100033371 Ga0070700_1000333711 280
50 3300005444 Ga0070694_100004899 Ga0070694_1000048996 280
51 3300005445 Ga0070708_100003559 Ga0070708_1000035592 280
52 3300005536 Ga0070697_100136708 Ga0070697_1001367081 280
53 3300005543 Ga0070672_100002792 Ga0070672_1000027928 280
54 3300005547 Ga0070693_100069928 Ga0070693_1000699282 280
55 3300005617 Ga0068859_100256651 Ga0068859_1002566512 280
56 3300005618 Ga0068864_100000028 Ga0068864_10000002884 280
57 3300005840 Ga0068870_10002726 Ga0068870_100027263 280
58 3300005842 Ga0068858_100000351 Ga0068858_10000035119 280
59 3300006178 Ga0075367_10054189 Ga0075367_100541892 280
60 3300006846 Ga0075430_100565355 Ga0075430_1005653551 280
61 3300006852 Ga0075433_10006336 Ga0075433_100063365 280
62 3300006871 Ga0075434_100002739 Ga0075434_10000273910 280
63 3300006880 Ga0075429_100002126 Ga0075429_1000021269 280
64 3300006880 Ga0075429_100147567 Ga0075429_1001475672 280
65 3300006881 Ga0068865_100148602 Ga0068865_1001486022 280
66 3300006931 Ga0097620_100256645 Ga0097620_1002566452 280
67 3300009093 Ga0105240_10018010 Ga0105240_100180105 280
68 3300009098 Ga0105245_10003014 Ga0105245_1000301411 280
69 3300009098 Ga0105245_10003399 Ga0105245_100033998 280
70 3300009147 Ga0114129_10157646 Ga0114129_101576465 280
71 3300009176 Ga0105242_10014925 Ga0105242_100149253 280
72 3300013100 Ga0157373_10126532 Ga0157373_101265322 280
73 3300013297 Ga0157378_10003809 Ga0157378_100038093 280
74 3300013297 Ga0157378_10183159 Ga0157378_101831592 280
75 3300013306 Ga0163162_10009322 Ga0163162_1000932213 280
76 3300013308 Ga0157375_10000005 Ga0157375_1000000553 280
77 3300021384 Ga0213876_10003099 Ga0213876_100030993 280
78 3300025893 Ga0207682_10066920 Ga0207682_100669202 280
79 3300025904 Ga0207647_10012246 Ga0207647_100122462 280
80 3300025913 Ga0207695_10118693 Ga0207695_101186932 280
81 3300025917 Ga0207660_10196181 Ga0207660_101961812 280
82 3300025922 Ga0207646_10081521 Ga0207646_100815212 280
83 3300025927 Ga0207687_10000199 Ga0207687_100001998 280
84 3300025927 Ga0207687_10000637 Ga0207687_100006377 280
85 3300025936 Ga0207670_10000785 Ga0207670_100007854 280
86 3300025938 Ga0207704_10288899 Ga0207704_102888992 280
87 3300025940 Ga0207691_10005878 Ga0207691_100058784 280
88 3300025986 Ga0207658_10164781 Ga0207658_101647812 280
89 3300026023 Ga0207677_10000038 Ga0207677_1000003864 280
90 3300026035 Ga0207703_10000543 Ga0207703_1000054318 280
91 3300026095 Ga0207676_10000002 Ga0207676_10000002138 280
92 3300026118 Ga0207675_100027465 Ga0207675_1000274653 280
93 3300028556 Ga0265337_1000672 Ga0265337_100067212 280
94 3300028563 Ga0265319_1000209 Ga0265319_100020918 280
95 3300028573 Ga0265334_10012453 Ga0265334_100124532 280
96 3300028666 Ga0265336_10005141 Ga0265336_100051413 280
97 3300028794 Ga0307515_10025750 Ga0307515_100257504 280
98 3300028800 Ga0265338_10000261 Ga0265338_1000026145 280
99 3300028800 Ga0265338_10005713 Ga0265338_100057138 280
100 3300031240 Ga0265320_10004686 Ga0265320_100046866 280
101 3300031241 Ga0265325_10008441 Ga0265325_100084413 280
102 3300031247 Ga0265340_10035207 Ga0265340_100352072 280
103 3300031344 Ga0265316_10033105 Ga0265316_100331055 280
104 3300031344 Ga0265316_10064461 Ga0265316_100644612 280
105 3300031344 Ga0265316_10216106 Ga0265316_102161062 280
106 3300031595 Ga0265313_10002095 Ga0265313_1000209512 280
107 3300031691 Ga0316579_10009745 Ga0316579_100097453 280
108 3300031712 Ga0265342_10003183 Ga0265342_100031833 280
109 3300031852 Ga0307410_10052045 Ga0307410_100520452 280
110 3300031995 Ga0307409_100033168 Ga0307409_1000331684 280
111 3300032005 Ga0307411_10004631 Ga0307411_100046313 280
112 3300036712 Ga0316584_0099329 Ga0316584_0099329_1187_2032 280
113 3300036712 Ga0316584_0221576 Ga0316584_0221576_507_1355 280
114 3300039437 Ga0436365_0895411 Ga0436365_0895411_6068_6919 280
115 3300041494 Ga0451837_1835074 Ga0451837_1835074_282_1139 280
116 3300042876 Ga0451577_0001383 Ga0451577_0001383_17842_18702 280
117 3300042876 Ga0451577_0023988 Ga0451577_0023988_2314_3168 280
118 3300042876 Ga0451577_0561081 Ga0451577_0561081_23_874 280
119 3300044673 Ga0453683_0090403 Ga0453683_0090403_595_1449 280
120 3300044712 Ga0453684_0000004 Ga0453684_0000004_636829_637689 280
121 3300044712 Ga0453684_0049251 Ga0453684_0049251_2437_3291 280
122 3300044712 Ga0453684_0125393 Ga0453684_0125393_2087_2935 280
123 3300044712 Ga0453684_0497642 Ga0453684_0497642_388_1236 280
124 3300044735 Ga0466968_0011627 Ga0466968_0011627_206_1063 280
125 3300050507 nmdc:mga05p37_135148_c1 nmdc:mga05p37_135148_c1_1632_2477 280
126 3300050508 nmdc:mga09592_1976_c1 nmdc:mga09592_1976_c1_10652_11497 280
127 3300050509 nmdc:mga0qj67_537765_c1 nmdc:mga0qj67_537765_c1_49_894 280
128 3300050515 nmdc:mga0a205_29641_c1 nmdc:mga0a205_29641_c1_3828_4697 280
129 2162886006 SwRhRL3b_contig_2561847 SwRhRL3b_0922.00000300 281
130 3300002239 JGI24034J26672_10000005 JGI24034J26672_10000005190 281
131 3300002987 JGI25159J45721_1015439 JGI25159J45721_10154392 281
132 3300003187 JGI25151J46595_10003245 JGI25151J46595_100032454 281
133 3300003187 JGI25151J46595_10010930 JGI25151J46595_100109303 281
134 3300003323 rootH1_10160702 rootH1_101607022 281
135 3300003751 Ga0055538_1000128 Ga0055538_100012836 281
136 3300003758 Ga0055532_1002260 Ga0055532_10022603 281
137 3300003790 Ga0055528_1004453 Ga0055528_10044533 281
138 3300005289 Ga0065704_10085743 Ga0065704_100857433 281
139 3300005289 Ga0065704_10165084 Ga0065704_101650842 281
140 3300005289 Ga0065704_10201625 Ga0065704_102016252 281
141 3300005290 Ga0065712_10067741 Ga0065712_1006774160 281
142 3300005290 Ga0065712_10092799 Ga0065712_100927992 281
143 3300005293 Ga0065715_10017326 Ga0065715_100173262 281
144 3300005293 Ga0065715_10089000 Ga0065715_1008900011 281
145 3300005293 Ga0065715_10089598 Ga0065715_100895989 281
146 3300005293 Ga0065715_10124152 Ga0065715_101241522 281
147 3300005295 Ga0065707_10001483 Ga0065707_100014835 281
148 3300005295 Ga0065707_10093821 Ga0065707_100938215 281
149 3300005295 Ga0065707_10095917 Ga0065707_100959171 281
150 3300005295 Ga0065707_10111856 Ga0065707_101118562 281
151 3300005295 Ga0065707_10155041 Ga0065707_101550411 281
152 3300005327 Ga0070658_10041880 Ga0070658_100418804 281
153 3300005327 Ga0070658_10118424 Ga0070658_101184242 281
154 3300005328 Ga0070676_10009312 Ga0070676_100093124 281
155 3300005329 Ga0070683_100007595 Ga0070683_1000075958 281
156 3300005329 Ga0070683_100017774 Ga0070683_1000177744 281
157 3300005329 Ga0070683_100190087 Ga0070683_1001900872 281
158 3300005329 Ga0070683_100214295 Ga0070683_1002142952 281
159 3300005330 Ga0070690_100001189 Ga0070690_10000118910 281
160 3300005330 Ga0070690_100017664 Ga0070690_1000176643 281
161 3300005330 Ga0070690_100028961 Ga0070690_1000289614 281
162 3300005330 Ga0070690_100086527 Ga0070690_1000865273 281
163 3300005330 Ga0070690_100087534 Ga0070690_1000875342 281
164 3300005330 Ga0070690_100108794 Ga0070690_1001087942 281
165 3300005330 Ga0070690_100385971 Ga0070690_1003859712 281
166 3300005331 Ga0070670_100017304 Ga0070670_1000173045 281
167 3300005331 Ga0070670_100122037 Ga0070670_1001220372 281
168 3300005331 Ga0070670_100324305 Ga0070670_1003243051 281
169 3300005333 Ga0070677_10030271 Ga0070677_100302712 281
170 3300005334 Ga0068869_100041527 Ga0068869_1000415273 281
171 3300005334 Ga0068869_100042834 Ga0068869_1000428342 281
172 3300005334 Ga0068869_100044303 Ga0068869_1000443033 281
173 3300005334 Ga0068869_100110681 Ga0068869_1001106812 281
174 3300005334 Ga0068869_100211380 Ga0068869_1002113802 281
175 3300005335 Ga0070666_10002354 Ga0070666_100023546 281
176 3300005335 Ga0070666_10006000 Ga0070666_100060006 281
177 3300005335 Ga0070666_10066628 Ga0070666_100666282 281
178 3300005335 Ga0070666_10272846 Ga0070666_102728461 281
179 3300005336 Ga0070680_100000106 Ga0070680_10000010637 281
180 3300005336 Ga0070680_100017984 Ga0070680_1000179842 281
181 3300005336 Ga0070680_100019737 Ga0070680_1000197375 281
182 3300005336 Ga0070680_100030090 Ga0070680_1000300904 281
183 3300005336 Ga0070680_100043957 Ga0070680_1000439572 281
184 3300005337 Ga0070682_100000068 Ga0070682_10000006818 281
185 3300005337 Ga0070682_100000499 Ga0070682_10000049912 281
186 3300005337 Ga0070682_100013159 Ga0070682_1000131594 281
187 3300005337 Ga0070682_100018240 Ga0070682_1000182405 281
188 3300005337 Ga0070682_100053147 Ga0070682_1000531472 281
189 3300005338 Ga0068868_100069916 Ga0068868_1000699162 281
190 3300005338 Ga0068868_100126653 Ga0068868_1001266532 281
191 3300005338 Ga0068868_100401151 Ga0068868_1004011512 281
192 3300005339 Ga0070660_100039616 Ga0070660_1000396162 281
193 3300005339 Ga0070660_100408979 Ga0070660_1004089791 281
194 3300005340 Ga0070689_100000370 Ga0070689_10000037010 281
195 3300005340 Ga0070689_100008593 Ga0070689_1000085933 281
196 3300005340 Ga0070689_100014656 Ga0070689_1000146562 281
197 3300005340 Ga0070689_100046932 Ga0070689_1000469322 281
198 3300005340 Ga0070689_100084498 Ga0070689_1000844982 281
199 3300005340 Ga0070689_100089611 Ga0070689_1000896113 281
200 3300005340 Ga0070689_100135866 Ga0070689_1001358662 281
201 3300005340 Ga0070689_100193725 Ga0070689_1001937252 281
202 3300005340 Ga0070689_100199915 Ga0070689_1001999152 281
203 3300005340 Ga0070689_100493705 Ga0070689_1004937052 281
204 3300005341 Ga0070691_10047060 Ga0070691_100470602 281
205 3300005343 Ga0070687_100049167 Ga0070687_1000491673 281
206 3300005343 Ga0070687_100172200 Ga0070687_1001722002 281
207 3300005344 Ga0070661_100019697 Ga0070661_1000196972 281
208 3300005344 Ga0070661_100043122 Ga0070661_1000431222 281
209 3300005344 Ga0070661_100053013 Ga0070661_1000530133 281
210 3300005344 Ga0070661_100072860 Ga0070661_1000728602 281
211 3300005344 Ga0070661_100389036 Ga0070661_1003890362 281
212 3300005345 Ga0070692_10004491 Ga0070692_100044912 281
213 3300005345 Ga0070692_10024794 Ga0070692_100247942 281
214 3300005345 Ga0070692_10090768 Ga0070692_100907682 281
215 3300005347 Ga0070668_100013245 Ga0070668_1000132455 281
216 3300005347 Ga0070668_100014996 Ga0070668_1000149964 281
217 3300005347 Ga0070668_100184932 Ga0070668_1001849322 281
218 3300005353 Ga0070669_100000025 Ga0070669_10000002530 281
219 3300005353 Ga0070669_100022956 Ga0070669_1000229562 281
220 3300005353 Ga0070669_100030989 Ga0070669_1000309893 281
221 3300005353 Ga0070669_100048993 Ga0070669_1000489933 281
222 3300005353 Ga0070669_100084711 Ga0070669_1000847112 281
223 3300005353 Ga0070669_100122511 Ga0070669_1001225112 281
224 3300005353 Ga0070669_100340159 Ga0070669_1003401592 281
225 3300005354 Ga0070675_100004398 Ga0070675_1000043986 281
226 3300005354 Ga0070675_100016644 Ga0070675_1000166446 281
227 3300005354 Ga0070675_100020751 Ga0070675_1000207514 281
228 3300005354 Ga0070675_100035978 Ga0070675_1000359784 281
229 3300005354 Ga0070675_100191245 Ga0070675_1001912452 281
230 3300005354 Ga0070675_100217565 Ga0070675_1002175652 281
231 3300005355 Ga0070671_100003656 Ga0070671_1000036563 281
232 3300005355 Ga0070671_100007241 Ga0070671_1000072416 281
233 3300005355 Ga0070671_100026590 Ga0070671_1000265903 281
234 3300005355 Ga0070671_100104436 Ga0070671_1001044362 281
235 3300005355 Ga0070671_100164851 Ga0070671_1001648512 281
236 3300005355 Ga0070671_100532957 Ga0070671_1005329571 281
237 3300005356 Ga0070674_100404820 Ga0070674_1004048202 281
238 3300005364 Ga0070673_100025347 Ga0070673_1000253473 281
239 3300005364 Ga0070673_100152690 Ga0070673_1001526902 281
240 3300005364 Ga0070673_100163719 Ga0070673_1001637192 281
241 3300005364 Ga0070673_100491942 Ga0070673_1004919421 281
242 3300005365 Ga0070688_100001731 Ga0070688_1000017318 281
243 3300005365 Ga0070688_100019228 Ga0070688_1000192282 281
244 3300005365 Ga0070688_100049902 Ga0070688_1000499022 281
245 3300005365 Ga0070688_100064350 Ga0070688_1000643502 281
246 3300005365 Ga0070688_100078384 Ga0070688_1000783843 281
247 3300005365 Ga0070688_100188645 Ga0070688_1001886451 281
248 3300005366 Ga0070659_100002916 Ga0070659_1000029165 281
249 3300005366 Ga0070659_100032555 Ga0070659_1000325552 281
250 3300005367 Ga0070667_100033014 Ga0070667_1000330145 281
251 3300005367 Ga0070667_100066761 Ga0070667_1000667613 281
252 3300005367 Ga0070667_100083571 Ga0070667_1000835712 281
253 3300005367 Ga0070667_100087771 Ga0070667_1000877712 281
254 3300005367 Ga0070667_100145207 Ga0070667_1001452072 281
255 3300005367 Ga0070667_100238099 Ga0070667_1002380992 281
256 3300005367 Ga0070667_100294515 Ga0070667_1002945151 281
257 3300005406 Ga0070703_10000100 Ga0070703_1000010033 281
258 3300005406 Ga0070703_10002606 Ga0070703_100026063 281
259 3300005434 Ga0070709_10081155 Ga0070709_100811552 281
260 3300005435 Ga0070714_100014141 Ga0070714_1000141416 281
261 3300005435 Ga0070714_100047153 Ga0070714_1000471533 281
262 3300005435 Ga0070714_100076132 Ga0070714_1000761322 281
263 3300005436 Ga0070713_100007921 Ga0070713_1000079216 281
264 3300005437 Ga0070710_10054143 Ga0070710_100541432 281
265 3300005438 Ga0070701_10027300 Ga0070701_100273002 281
266 3300005438 Ga0070701_10035805 Ga0070701_100358052 281
267 3300005438 Ga0070701_10059772 Ga0070701_100597722 281
268 3300005438 Ga0070701_10142361 Ga0070701_101423612 281
269 3300005438 Ga0070701_10231624 Ga0070701_102316241 281
270 3300005440 Ga0070705_100208251 Ga0070705_1002082511 281
271 3300005441 Ga0070700_100000115 Ga0070700_10000011533 281
272 3300005441 Ga0070700_100105912 Ga0070700_1001059122 281
273 3300005441 Ga0070700_100267913 Ga0070700_1002679131 281
274 3300005444 Ga0070694_100014229 Ga0070694_1000142295 281
275 3300005444 Ga0070694_100028193 Ga0070694_1000281932 281
276 3300005444 Ga0070694_100057904 Ga0070694_1000579043 281
277 3300005444 Ga0070694_100106887 Ga0070694_1001068872 281
278 3300005444 Ga0070694_100294519 Ga0070694_1002945191 281
279 3300005445 Ga0070708_100000002 Ga0070708_10000000274 281
280 3300005445 Ga0070708_100000055 Ga0070708_10000005558 281
281 3300005445 Ga0070708_100021637 Ga0070708_1000216374 281
282 3300005445 Ga0070708_100140599 Ga0070708_1001405993 281
283 3300005445 Ga0070708_100149329 Ga0070708_1001493294 281
284 3300005445 Ga0070708_100274574 Ga0070708_1002745742 281
285 3300005455 Ga0070663_100051578 Ga0070663_1000515781 281
286 3300005456 Ga0070678_100233191 Ga0070678_1002331911 281
287 3300005456 Ga0070678_100357154 Ga0070678_1003571541 281
288 3300005456 Ga0070678_100549703 Ga0070678_1005497031 281
289 3300005457 Ga0070662_100010051 Ga0070662_1000100513 281
290 3300005457 Ga0070662_100016946 Ga0070662_1000169464 281
291 3300005457 Ga0070662_100102488 Ga0070662_1001024882 281
292 3300005457 Ga0070662_100188373 Ga0070662_1001883732 281
293 3300005457 Ga0070662_100559688 Ga0070662_1005596881 281
294 3300005458 Ga0070681_10000162 Ga0070681_1000016240 281
295 3300005458 Ga0070681_10002912 Ga0070681_100029123 281
296 3300005458 Ga0070681_10008791 Ga0070681_100087912 281
297 3300005458 Ga0070681_10048760 Ga0070681_100487602 281
298 3300005458 Ga0070681_10051476 Ga0070681_100514765 281
299 3300005458 Ga0070681_10115920 Ga0070681_101159203 281
300 3300005458 Ga0070681_10147453 Ga0070681_101474532 281
301 3300005458 Ga0070681_10149313 Ga0070681_101493132 281
302 3300005458 Ga0070681_10218846 Ga0070681_102188462 281
303 3300005459 Ga0068867_100016073 Ga0068867_1000160732 281
304 3300005459 Ga0068867_100058175 Ga0068867_1000581753 281
305 3300005459 Ga0068867_100161804 Ga0068867_1001618042 281
306 3300005459 Ga0068867_100373986 Ga0068867_1003739862 281
307 3300005459 Ga0068867_100634927 Ga0068867_1006349271 281
308 3300005466 Ga0070685_10013125 Ga0070685_100131254 281
309 3300005466 Ga0070685_10056932 Ga0070685_100569322 281
310 3300005466 Ga0070685_10065351 Ga0070685_100653512 281
311 3300005466 Ga0070685_10100505 Ga0070685_101005052 281
312 3300005467 Ga0070706_100000032 Ga0070706_10000003220 281
313 3300005467 Ga0070706_100006681 Ga0070706_1000066819 281
314 3300005467 Ga0070706_100011928 Ga0070706_1000119286 281
315 3300005467 Ga0070706_100014045 Ga0070706_1000140456 281
316 3300005467 Ga0070706_100034341 Ga0070706_1000343414 281
317 3300005467 Ga0070706_100053844 Ga0070706_1000538443 281
318 3300005467 Ga0070706_100058355 Ga0070706_1000583552 281
319 3300005467 Ga0070706_100081341 Ga0070706_1000813413 281
320 3300005467 Ga0070706_100083530 Ga0070706_1000835302 281
321 3300005467 Ga0070706_100106755 Ga0070706_1001067552 281
322 3300005468 Ga0070707_100001111 Ga0070707_10000111114 281
323 3300005468 Ga0070707_100011439 Ga0070707_10001143910 281
324 3300005468 Ga0070707_100197757 Ga0070707_1001977572 281
325 3300005468 Ga0070707_100206665 Ga0070707_1002066652 281
326 3300005468 Ga0070707_100226635 Ga0070707_1002266352 281
327 3300005468 Ga0070707_100568433 Ga0070707_1005684331 281
328 3300005471 Ga0070698_100004139 Ga0070698_1000041391 281
329 3300005471 Ga0070698_100009625 Ga0070698_1000096259 281
330 3300005471 Ga0070698_100017187 Ga0070698_1000171874 281
331 3300005471 Ga0070698_100019053 Ga0070698_1000190532 281
332 3300005471 Ga0070698_100025311 Ga0070698_1000253116 281
333 3300005471 Ga0070698_100061277 Ga0070698_1000612774 281
334 3300005471 Ga0070698_100071458 Ga0070698_1000714583 281
335 3300005471 Ga0070698_100087349 Ga0070698_1000873493 281
336 3300005471 Ga0070698_100110067 Ga0070698_1001100672 281
337 3300005518 Ga0070699_100000027 Ga0070699_10000002796 281
338 3300005518 Ga0070699_100003796 Ga0070699_1000037967 281
339 3300005518 Ga0070699_100015881 Ga0070699_1000158815 281
340 3300005518 Ga0070699_100072552 Ga0070699_1000725523 281
341 3300005530 Ga0070679_100000011 Ga0070679_10000001160 281
342 3300005530 Ga0070679_100000837 Ga0070679_10000083712 281
343 3300005530 Ga0070679_100016973 Ga0070679_1000169735 281
344 3300005530 Ga0070679_100020724 Ga0070679_1000207244 281
345 3300005530 Ga0070679_100087076 Ga0070679_1000870762 281
346 3300005530 Ga0070679_100139147 Ga0070679_1001391472 281
347 3300005530 Ga0070679_100162961 Ga0070679_1001629612 281
348 3300005530 Ga0070679_100366979 Ga0070679_1003669792 281
349 3300005535 Ga0070684_100002044 Ga0070684_10000204410 281
350 3300005535 Ga0070684_100143089 Ga0070684_1001430892 281
351 3300005535 Ga0070684_100145165 Ga0070684_1001451652 281
352 3300005535 Ga0070684_100199324 Ga0070684_1001993242 281
353 3300005536 Ga0070697_100000071 Ga0070697_10000007155 281
354 3300005536 Ga0070697_100000762 Ga0070697_10000076213 281
355 3300005536 Ga0070697_100031926 Ga0070697_1000319262 281
356 3300005536 Ga0070697_100057598 Ga0070697_1000575982 281
357 3300005536 Ga0070697_100064982 Ga0070697_1000649822 281
358 3300005536 Ga0070697_100112707 Ga0070697_1001127072 281
359 3300005536 Ga0070697_100196444 Ga0070697_1001964443 281
360 3300005536 Ga0070697_100198578 Ga0070697_1001985782 281
361 3300005539 Ga0068853_100015219 Ga0068853_1000152194 281
362 3300005539 Ga0068853_100057900 Ga0068853_1000579002 281
363 3300005539 Ga0068853_100196795 Ga0068853_1001967952 281
364 3300005539 Ga0068853_100303176 Ga0068853_1003031762 281
365 3300005539 Ga0068853_100318452 Ga0068853_1003184522 281
366 3300005539 Ga0068853_100396245 Ga0068853_1003962452 281
367 3300005543 Ga0070672_100007194 Ga0070672_1000071945 281
368 3300005543 Ga0070672_100591869 Ga0070672_1005918691 281
369 3300005544 Ga0070686_100003636 Ga0070686_1000036369 281
370 3300005544 Ga0070686_100015394 Ga0070686_1000153945 281
371 3300005544 Ga0070686_100084693 Ga0070686_1000846932 281
372 3300005544 Ga0070686_100106327 Ga0070686_1001063272 281
373 3300005544 Ga0070686_100141200 Ga0070686_1001412001 281
374 3300005544 Ga0070686_100222799 Ga0070686_1002227991 281
375 3300005544 Ga0070686_100322203 Ga0070686_1003222032 281
376 3300005544 Ga0070686_100340863 Ga0070686_1003408631 281
377 3300005545 Ga0070695_100000181 Ga0070695_10000018131 281
378 3300005545 Ga0070695_100089860 Ga0070695_1000898602 281
379 3300005545 Ga0070695_100106293 Ga0070695_1001062931 281
380 3300005545 Ga0070695_100122069 Ga0070695_1001220692 281
381 3300005545 Ga0070695_100188323 Ga0070695_1001883231 281
382 3300005545 Ga0070695_100218820 Ga0070695_1002188202 281
383 3300005546 Ga0070696_100013547 Ga0070696_1000135476 281
384 3300005546 Ga0070696_100190112 Ga0070696_1001901121 281
385 3300005546 Ga0070696_100316562 Ga0070696_1003165621 281
386 3300005547 Ga0070693_100001794 Ga0070693_1000017944 281
387 3300005547 Ga0070693_100008823 Ga0070693_1000088233 281
388 3300005548 Ga0070665_100000235 Ga0070665_1000002357 281
389 3300005548 Ga0070665_100071363 Ga0070665_1000713633 281
390 3300005548 Ga0070665_100072656 Ga0070665_1000726562 281
391 3300005548 Ga0070665_100116730 Ga0070665_1001167302 281
392 3300005548 Ga0070665_100231472 Ga0070665_1002314722 281
393 3300005549 Ga0070704_100021872 Ga0070704_1000218722 281
394 3300005549 Ga0070704_100026305 Ga0070704_1000263052 281
395 3300005549 Ga0070704_100052894 Ga0070704_1000528943 281
396 3300005549 Ga0070704_100068594 Ga0070704_1000685943 281
397 3300005549 Ga0070704_100172871 Ga0070704_1001728712 281
398 3300005549 Ga0070704_100180690 Ga0070704_1001806902 281
399 3300005549 Ga0070704_100314539 Ga0070704_1003145392 281
400 3300005549 Ga0070704_100340015 Ga0070704_1003400151 281
401 3300005563 Ga0068855_100007946 Ga0068855_1000079465 281
402 3300005563 Ga0068855_100224657 Ga0068855_1002246572 281
403 3300005563 Ga0068855_100291688 Ga0068855_1002916881 281
404 3300005564 Ga0070664_100000151 Ga0070664_10000015140 281
405 3300005564 Ga0070664_100034054 Ga0070664_1000340543 281
406 3300005564 Ga0070664_100047012 Ga0070664_1000470122 281
407 3300005564 Ga0070664_100113417 Ga0070664_1001134172 281
408 3300005564 Ga0070664_100247131 Ga0070664_1002471312 281
409 3300005577 Ga0068857_100014851 Ga0068857_1000148512 281
410 3300005577 Ga0068857_100015095 Ga0068857_1000150954 281
411 3300005577 Ga0068857_100039911 Ga0068857_1000399112 281
412 3300005577 Ga0068857_100057452 Ga0068857_1000574524 281
413 3300005577 Ga0068857_100138324 Ga0068857_1001383242 281
414 3300005577 Ga0068857_100154199 Ga0068857_1001541992 281
415 3300005578 Ga0068854_100297331 Ga0068854_1002973312 281
416 3300005578 Ga0068854_100497905 Ga0068854_1004979052 281
417 3300005614 Ga0068856_100075594 Ga0068856_1000755943 281
418 3300005615 Ga0070702_100072526 Ga0070702_1000725262 281
419 3300005615 Ga0070702_100153932 Ga0070702_1001539322 281
420 3300005616 Ga0068852_100033378 Ga0068852_1000333784 281
421 3300005616 Ga0068852_100305278 Ga0068852_1003052782 281
422 3300005617 Ga0068859_100002426 Ga0068859_10000242613 281
423 3300005617 Ga0068859_100023962 Ga0068859_1000239622 281
424 3300005617 Ga0068859_100025986 Ga0068859_1000259862 281
425 3300005617 Ga0068859_100029833 Ga0068859_1000298332 281
426 3300005617 Ga0068859_100041257 Ga0068859_1000412572 281
427 3300005617 Ga0068859_100050130 Ga0068859_1000501303 281
428 3300005617 Ga0068859_100054294 Ga0068859_1000542944 281
429 3300005617 Ga0068859_100068754 Ga0068859_1000687542 281
430 3300005617 Ga0068859_100177932 Ga0068859_1001779322 281
431 3300005617 Ga0068859_100246081 Ga0068859_1002460812 281
432 3300005617 Ga0068859_100850290 Ga0068859_1008502901 281
433 3300005618 Ga0068864_100003410 Ga0068864_1000034102 281
434 3300005618 Ga0068864_100024879 Ga0068864_1000248794 281
435 3300005618 Ga0068864_100133354 Ga0068864_1001333541 281
436 3300005618 Ga0068864_100220859 Ga0068864_1002208591 281
437 3300005618 Ga0068864_100317165 Ga0068864_1003171652 281
438 3300005618 Ga0068864_100799645 Ga0068864_1007996451 281
439 3300005718 Ga0068866_10129167 Ga0068866_101291672 281
440 3300005719 Ga0068861_100008836 Ga0068861_1000088363 281
441 3300005719 Ga0068861_100022159 Ga0068861_1000221594 281
442 3300005719 Ga0068861_100024073 Ga0068861_1000240732 281
443 3300005719 Ga0068861_100075647 Ga0068861_1000756473 281
444 3300005834 Ga0068851_10001543 Ga0068851_100015439 281
445 3300005834 Ga0068851_10170558 Ga0068851_101705582 281
446 3300005840 Ga0068870_10003324 Ga0068870_100033244 281
447 3300005840 Ga0068870_10262306 Ga0068870_102623061 281
448 3300005841 Ga0068863_100003203 Ga0068863_10000320313 281
449 3300005841 Ga0068863_100039671 Ga0068863_1000396712 281
450 3300005841 Ga0068863_100146109 Ga0068863_1001461092 281
451 3300005841 Ga0068863_100239112 Ga0068863_1002391122 281
452 3300005841 Ga0068863_100282003 Ga0068863_1002820032 281
453 3300005841 Ga0068863_100326425 Ga0068863_1003264252 281
454 3300005842 Ga0068858_100000026 Ga0068858_10000002653 281
455 3300005842 Ga0068858_100006584 Ga0068858_1000065845 281
456 3300005842 Ga0068858_100009315 Ga0068858_1000093159 281
457 3300005842 Ga0068858_100017723 Ga0068858_1000177233 281
458 3300005842 Ga0068858_100070697 Ga0068858_1000706972 281
459 3300005842 Ga0068858_100111875 Ga0068858_1001118752 281
460 3300005842 Ga0068858_100436526 Ga0068858_1004365261 281
461 3300005842 Ga0068858_100484358 Ga0068858_1004843582 281
462 3300005842 Ga0068858_100617087 Ga0068858_1006170871 281
463 3300005843 Ga0068860_100003298 Ga0068860_1000032986 281
464 3300005843 Ga0068860_100011315 Ga0068860_1000113155 281
465 3300005843 Ga0068860_100043929 Ga0068860_1000439294 281
466 3300005843 Ga0068860_100088407 Ga0068860_1000884073 281
467 3300005843 Ga0068860_100524821 Ga0068860_1005248212 281
468 3300005844 Ga0068862_100024156 Ga0068862_1000241566 281
469 3300005844 Ga0068862_100034324 Ga0068862_1000343245 281
470 3300005844 Ga0068862_100070982 Ga0068862_1000709822 281
471 3300005844 Ga0068862_100078544 Ga0068862_1000785442 281
472 3300005844 Ga0068862_100158827 Ga0068862_1001588272 281
473 3300005937 Ga0081455_10031556 Ga0081455_100315565 281
474 3300005985 Ga0081539_10001016 Ga0081539_1000101632 281
475 3300005985 Ga0081539_10001250 Ga0081539_1000125013 281
476 3300005985 Ga0081539_10001451 Ga0081539_1000145123 281
477 3300006028 Ga0070717_10257013 Ga0070717_102570132 281
478 3300006028 Ga0070717_10468450 Ga0070717_104684502 281
479 3300006173 Ga0070716_100060839 Ga0070716_1000608392 281
480 3300006175 Ga0070712_100066671 Ga0070712_1000666712 281
481 3300006175 Ga0070712_100513096 Ga0070712_1005130961 281
482 3300006177 Ga0075362_10056618 Ga0075362_100566182 281
483 3300006237 Ga0097621_100008589 Ga0097621_1000085895 281
484 3300006237 Ga0097621_100013095 Ga0097621_1000130952 281
485 3300006237 Ga0097621_100079182 Ga0097621_1000791823 281
486 3300006358 Ga0068871_100003336 Ga0068871_1000033366 281
487 3300006358 Ga0068871_100005112 Ga0068871_1000051125 281
488 3300006358 Ga0068871_100007247 Ga0068871_1000072477 281
489 3300006358 Ga0068871_100101319 Ga0068871_1001013192 281
490 3300006358 Ga0068871_100246335 Ga0068871_1002463352 281
491 3300006844 Ga0075428_100039803 Ga0075428_1000398035 281
492 3300006844 Ga0075428_100096706 Ga0075428_1000967063 281
493 3300006844 Ga0075428_100102316 Ga0075428_1001023162 281
494 3300006844 Ga0075428_100159066 Ga0075428_1001590663 281
495 3300006844 Ga0075428_100197549 Ga0075428_1001975492 281
496 3300006844 Ga0075428_100215353 Ga0075428_1002153532 281
497 3300006844 Ga0075428_100265703 Ga0075428_1002657032 281
498 3300006844 Ga0075428_100295436 Ga0075428_1002954362 281
499 3300006846 Ga0075430_100004742 Ga0075430_1000047427 281
500 3300006846 Ga0075430_100037824 Ga0075430_1000378242 281
501 3300006846 Ga0075430_100039080 Ga0075430_1000390802 281
502 3300006846 Ga0075430_100117575 Ga0075430_1001175752 281
503 3300006846 Ga0075430_100157892 Ga0075430_1001578922 281
504 3300006846 Ga0075430_100218579 Ga0075430_1002185792 281
505 3300006846 Ga0075430_100255503 Ga0075430_1002555032 281
506 3300006846 Ga0075430_100573671 Ga0075430_1005736711 281
507 3300006847 Ga0075431_100007693 Ga0075431_1000076932 281
508 3300006847 Ga0075431_100012361 Ga0075431_1000123615 281
509 3300006847 Ga0075431_100016034 Ga0075431_1000160345 281
510 3300006847 Ga0075431_100021854 Ga0075431_1000218542 281
511 3300006847 Ga0075431_100033151 Ga0075431_1000331513 281
512 3300006847 Ga0075431_100058636 Ga0075431_1000586364 281
513 3300006847 Ga0075431_100070019 Ga0075431_1000700194 281
514 3300006847 Ga0075431_100128719 Ga0075431_1001287193 281
515 3300006847 Ga0075431_100213558 Ga0075431_1002135583 281
516 3300006847 Ga0075431_100448237 Ga0075431_1004482372 281
517 3300006847 Ga0075431_100510414 Ga0075431_1005104142 281
518 3300006852 Ga0075433_10001773 Ga0075433_100017735 281
519 3300006852 Ga0075433_10019641 Ga0075433_100196415 281
520 3300006852 Ga0075433_10041752 Ga0075433_100417523 281
521 3300006852 Ga0075433_10067121 Ga0075433_100671213 281
522 3300006852 Ga0075433_10070825 Ga0075433_100708251 281
523 3300006852 Ga0075433_10239276 Ga0075433_102392762 281
524 3300006852 Ga0075433_10306957 Ga0075433_103069572 281
525 3300006852 Ga0075433_10494193 Ga0075433_104941932 281
526 3300006871 Ga0075434_100005810 Ga0075434_1000058102 281
527 3300006871 Ga0075434_100008913 Ga0075434_1000089137 281
528 3300006871 Ga0075434_100011502 Ga0075434_1000115027 281
529 3300006871 Ga0075434_100012838 Ga0075434_1000128385 281
530 3300006871 Ga0075434_100022525 Ga0075434_1000225258 281
531 3300006871 Ga0075434_100036500 Ga0075434_1000365002 281
532 3300006871 Ga0075434_100036722 Ga0075434_1000367223 281
533 3300006871 Ga0075434_100272266 Ga0075434_1002722662 281
534 3300006871 Ga0075434_100298580 Ga0075434_1002985803 281
535 3300006871 Ga0075434_100507267 Ga0075434_1005072672 281
536 3300006871 Ga0075434_100565060 Ga0075434_1005650602 281
537 3300006880 Ga0075429_100009408 Ga0075429_1000094084 281
538 3300006880 Ga0075429_100015327 Ga0075429_1000153277 281
539 3300006880 Ga0075429_100054294 Ga0075429_1000542943 281
540 3300006880 Ga0075429_100087995 Ga0075429_1000879952 281
541 3300006880 Ga0075429_100148532 Ga0075429_1001485322 281
542 3300006880 Ga0075429_100150287 Ga0075429_1001502872 281
543 3300006880 Ga0075429_100216844 Ga0075429_1002168442 281
544 3300006880 Ga0075429_100298091 Ga0075429_1002980912 281
545 3300006881 Ga0068865_100009971 Ga0068865_1000099712 281
546 3300006881 Ga0068865_100127972 Ga0068865_1001279722 281
547 3300006881 Ga0068865_100171568 Ga0068865_1001715682 281
548 3300006881 Ga0068865_100241745 Ga0068865_1002417451 281
549 3300006914 Ga0075436_100014980 Ga0075436_1000149802 281
550 3300006914 Ga0075436_100036990 Ga0075436_1000369903 281
551 3300006914 Ga0075436_100109000 Ga0075436_1001090003 281
552 3300006914 Ga0075436_100149731 Ga0075436_1001497312 281
553 3300006931 Ga0097620_100002426 Ga0097620_10000242613 281
554 3300006931 Ga0097620_100023962 Ga0097620_1000239622 281
555 3300006931 Ga0097620_100025986 Ga0097620_1000259862 281
556 3300006931 Ga0097620_100029833 Ga0097620_1000298332 281
557 3300006931 Ga0097620_100041258 Ga0097620_1000412582 281
558 3300006931 Ga0097620_100050131 Ga0097620_1000501313 281
559 3300006931 Ga0097620_100054295 Ga0097620_1000542952 281
560 3300006931 Ga0097620_100068753 Ga0097620_1000687534 281
561 3300006931 Ga0097620_100177932 Ga0097620_1001779323 281
562 3300006931 Ga0097620_100246069 Ga0097620_1002460692 281
563 3300006931 Ga0097620_100325968 Ga0097620_1003259682 281
564 3300006931 Ga0097620_100340663 Ga0097620_1003406632 281
565 3300006931 Ga0097620_100850254 Ga0097620_1008502541 281
566 3300007076 Ga0075435_100000796 Ga0075435_1000007968 281
567 3300007076 Ga0075435_100031745 Ga0075435_1000317455 281
568 3300007076 Ga0075435_100068526 Ga0075435_1000685263 281
569 3300007076 Ga0075435_100098635 Ga0075435_1000986352 281
570 3300007076 Ga0075435_100245964 Ga0075435_1002459642 281
571 3300007076 Ga0075435_100371460 Ga0075435_1003714601 281
572 3300009011 Ga0105251_10001754 Ga0105251_100017545 281
573 3300009011 Ga0105251_10006311 Ga0105251_100063113 281
574 3300009036 Ga0105244_10001582 Ga0105244_100015825 281
575 3300009036 Ga0105244_10069154 Ga0105244_100691542 281
576 3300009092 Ga0105250_10005529 Ga0105250_100055292 281
577 3300009092 Ga0105250_10007779 Ga0105250_100077792 281
578 3300009092 Ga0105250_10011891 Ga0105250_100118913 281
579 3300009092 Ga0105250_10013893 Ga0105250_100138932 281
580 3300009093 Ga0105240_10085674 Ga0105240_100856744 281
581 3300009093 Ga0105240_10222247 Ga0105240_102222472 281
582 3300009093 Ga0105240_10225010 Ga0105240_102250102 281
583 3300009093 Ga0105240_10367905 Ga0105240_103679051 281
584 3300009094 Ga0111539_10006722 Ga0111539_100067223 281
585 3300009094 Ga0111539_10007608 Ga0111539_100076089 281
586 3300009094 Ga0111539_10011422 Ga0111539_100114222 281
587 3300009094 Ga0111539_10014333 Ga0111539_100143338 281
588 3300009094 Ga0111539_10020389 Ga0111539_100203896 281
589 3300009094 Ga0111539_10064168 Ga0111539_100641683 281
590 3300009094 Ga0111539_10295950 Ga0111539_102959502 281
591 3300009094 Ga0111539_10459538 Ga0111539_104595382 281
592 3300009094 Ga0111539_10606754 Ga0111539_106067542 281
593 3300009098 Ga0105245_10000032 Ga0105245_1000003277 281
594 3300009098 Ga0105245_10089774 Ga0105245_100897742 281
595 3300009098 Ga0105245_10107542 Ga0105245_101075423 281
596 3300009098 Ga0105245_10345557 Ga0105245_103455572 281
597 3300009098 Ga0105245_10611054 Ga0105245_106110542 281
598 3300009101 Ga0105247_10000022 Ga0105247_10000022201 281
599 3300009101 Ga0105247_10007606 Ga0105247_100076067 281
600 3300009101 Ga0105247_10027597 Ga0105247_100275973 281
601 3300009101 Ga0105247_10034565 Ga0105247_100345652 281
602 3300009147 Ga0114129_10000109 Ga0114129_1000010965 281
603 3300009147 Ga0114129_10000132 Ga0114129_1000013212 281
604 3300009147 Ga0114129_10005210 Ga0114129_1000521012 281
605 3300009147 Ga0114129_10009658 Ga0114129_100096585 281
606 3300009147 Ga0114129_10013515 Ga0114129_1001351511 281
607 3300009147 Ga0114129_10021043 Ga0114129_100210433 281
608 3300009147 Ga0114129_10029541 Ga0114129_100295419 281
609 3300009147 Ga0114129_10036803 Ga0114129_100368037 281
610 3300009147 Ga0114129_10038463 Ga0114129_100384635 281
611 3300009147 Ga0114129_10040292 Ga0114129_100402922 281
612 3300009147 Ga0114129_10059546 Ga0114129_100595463 281
613 3300009147 Ga0114129_10094124 Ga0114129_100941244 281
614 3300009147 Ga0114129_10104519 Ga0114129_101045193 281
615 3300009147 Ga0114129_10120296 Ga0114129_101202963 281
616 3300009147 Ga0114129_10139010 Ga0114129_101390103 281
617 3300009147 Ga0114129_10357204 Ga0114129_103572042 281
618 3300009147 Ga0114129_10408387 Ga0114129_104083872 281
619 3300009147 Ga0114129_10464028 Ga0114129_104640282 281
620 3300009147 Ga0114129_10741034 Ga0114129_107410341 281
621 3300009147 Ga0114129_10862091 Ga0114129_108620912 281
622 3300009147 Ga0114129_10921241 Ga0114129_109212411 281
623 3300009148 Ga0105243_10000084 Ga0105243_1000008422 281
624 3300009148 Ga0105243_10001349 Ga0105243_1000134916 281
625 3300009148 Ga0105243_10009094 Ga0105243_100090942 281
626 3300009148 Ga0105243_10056402 Ga0105243_100564025 281
627 3300009148 Ga0105243_10074263 Ga0105243_100742635 281
628 3300009148 Ga0105243_10146208 Ga0105243_101462082 281
629 3300009148 Ga0105243_10150143 Ga0105243_101501432 281
630 3300009148 Ga0105243_10274821 Ga0105243_102748212 281
631 3300009148 Ga0105243_10427435 Ga0105243_104274351 281
632 3300009148 Ga0105243_10438141 Ga0105243_104381411 281
633 3300009174 Ga0105241_10000078 Ga0105241_1000007825 281
634 3300009174 Ga0105241_10061489 Ga0105241_100614894 281
635 3300009174 Ga0105241_10074370 Ga0105241_100743702 281
636 3300009174 Ga0105241_10198432 Ga0105241_101984322 281
637 3300009176 Ga0105242_10000026 Ga0105242_1000002666 281
638 3300009176 Ga0105242_10001968 Ga0105242_100019682 281
639 3300009176 Ga0105242_10062958 Ga0105242_100629582 281
640 3300009176 Ga0105242_10158505 Ga0105242_101585052 281
641 3300009176 Ga0105242_10288208 Ga0105242_102882082 281
642 3300009177 Ga0105248_10001763 Ga0105248_100017638 281
643 3300009177 Ga0105248_10001828 Ga0105248_100018285 281
644 3300009177 Ga0105248_10021123 Ga0105248_100211239 281
645 3300009177 Ga0105248_10025148 Ga0105248_100251483 281
646 3300009177 Ga0105248_10026661 Ga0105248_100266615 281
647 3300009177 Ga0105248_10036469 Ga0105248_100364694 281
648 3300009177 Ga0105248_10101581 Ga0105248_101015812 281
649 3300009177 Ga0105248_10172299 Ga0105248_101722992 281
650 3300009177 Ga0105248_10225172 Ga0105248_102251723 281
651 3300009177 Ga0105248_10249522 Ga0105248_102495221 281
652 3300009177 Ga0105248_10343156 Ga0105248_103431563 281
653 3300009177 Ga0105248_10741840 Ga0105248_107418401 281
654 3300009545 Ga0105237_10007870 Ga0105237_100078706 281
655 3300009545 Ga0105237_10175459 Ga0105237_101754592 281
656 3300009545 Ga0105237_10182253 Ga0105237_101822533 281
657 3300009545 Ga0105237_10240327 Ga0105237_102403272 281
658 3300009545 Ga0105237_10532318 Ga0105237_105323182 281
659 3300009551 Ga0105238_10000082 Ga0105238_1000008271 281
660 3300009551 Ga0105238_10336272 Ga0105238_103362722 281
661 3300009553 Ga0105249_10000924 Ga0105249_1000092415 281
662 3300009553 Ga0105249_10025738 Ga0105249_100257382 281
663 3300009553 Ga0105249_10033172 Ga0105249_100331723 281
664 3300009553 Ga0105249_10033291 Ga0105249_100332913 281
665 3300009553 Ga0105249_10050480 Ga0105249_100504804 281
666 3300009553 Ga0105249_10078211 Ga0105249_100782113 281
667 3300009553 Ga0105249_10564467 Ga0105249_105644671 281
668 3300010375 Ga0105239_10010092 Ga0105239_1001009210 281
669 3300010375 Ga0105239_10234599 Ga0105239_102345992 281
670 3300010375 Ga0105239_10254532 Ga0105239_102545322 281
671 3300011119 Ga0105246_10003254 Ga0105246_100032546 281
672 3300011119 Ga0105246_10036510 Ga0105246_100365103 281
673 3300011119 Ga0105246_10329027 Ga0105246_103290271 281
674 3300013100 Ga0157373_10143336 Ga0157373_101433362 281
675 3300013102 Ga0157371_10008643 Ga0157371_100086434 281
676 3300013102 Ga0157371_10079982 Ga0157371_100799822 281
677 3300013102 Ga0157371_10448802 Ga0157371_104488021 281
678 3300013104 Ga0157370_10106379 Ga0157370_101063793 281
679 3300013105 Ga0157369_10085077 Ga0157369_100850772 281
680 3300013296 Ga0157374_10028399 Ga0157374_100283992 281
681 3300013296 Ga0157374_10072591 Ga0157374_100725914 281
682 3300013296 Ga0157374_10075774 Ga0157374_100757742 281
683 3300013296 Ga0157374_10145138 Ga0157374_101451382 281
684 3300013296 Ga0157374_10416285 Ga0157374_104162851 281
685 3300013297 Ga0157378_10000011 Ga0157378_1000001132 281
686 3300013297 Ga0157378_10010486 Ga0157378_100104864 281
687 3300013297 Ga0157378_10010551 Ga0157378_100105513 281
688 3300013297 Ga0157378_10034466 Ga0157378_100344661 281
689 3300013297 Ga0157378_10055440 Ga0157378_100554402 281
690 3300013297 Ga0157378_10059977 Ga0157378_100599773 281
691 3300013297 Ga0157378_10099627 Ga0157378_100996273 281
692 3300013297 Ga0157378_10475637 Ga0157378_104756372 281
693 3300013306 Ga0163162_10001026 Ga0163162_1000102610 281
694 3300013306 Ga0163162_10019961 Ga0163162_100199616 281
695 3300013306 Ga0163162_10065850 Ga0163162_100658503 281
696 3300013306 Ga0163162_10070726 Ga0163162_100707263 281
697 3300013306 Ga0163162_10141863 Ga0163162_101418634 281
698 3300013306 Ga0163162_10160377 Ga0163162_101603772 281
699 3300013306 Ga0163162_10176637 Ga0163162_101766372 281
700 3300013306 Ga0163162_10247327 Ga0163162_102473272 281
701 3300013306 Ga0163162_10299507 Ga0163162_102995072 281
702 3300013306 Ga0163162_10917087 Ga0163162_109170872 281
703 3300013307 Ga0157372_10006976 Ga0157372_100069766 281
704 3300013307 Ga0157372_10112732 Ga0157372_101127323 281
705 3300013307 Ga0157372_10119384 Ga0157372_101193843 281
706 3300013307 Ga0157372_10143645 Ga0157372_101436453 281
707 3300013307 Ga0157372_10474434 Ga0157372_104744342 281
708 3300013307 Ga0157372_10530745 Ga0157372_105307452 281
709 3300013308 Ga0157375_10001113 Ga0157375_100011135 281
710 3300013308 Ga0157375_10004719 Ga0157375_100047195 281
711 3300013308 Ga0157375_10015067 Ga0157375_100150674 281
712 3300013308 Ga0157375_10143818 Ga0157375_101438184 281
713 3300014325 Ga0163163_10003051 Ga0163163_1000305111 281
714 3300014325 Ga0163163_10009313 Ga0163163_100093137 281
715 3300014325 Ga0163163_10049417 Ga0163163_100494173 281
716 3300014325 Ga0163163_10058018 Ga0163163_100580184 281
717 3300014325 Ga0163163_10155208 Ga0163163_101552082 281
718 3300014325 Ga0163163_10166194 Ga0163163_101661942 281
719 3300014325 Ga0163163_10245573 Ga0163163_102455732 281
720 3300014325 Ga0163163_10303182 Ga0163163_103031821 281
721 3300014326 Ga0157380_10018412 Ga0157380_100184123 281
722 3300014326 Ga0157380_10057401 Ga0157380_100574015 281
723 3300014326 Ga0157380_10127459 Ga0157380_101274592 281
724 3300014326 Ga0157380_10359181 Ga0157380_103591812 281
725 3300014326 Ga0157380_10388669 Ga0157380_103886692 281
726 3300014745 Ga0157377_10028026 Ga0157377_100280264 281
727 3300014745 Ga0157377_10043637 Ga0157377_100436372 281
728 3300014745 Ga0157377_10096999 Ga0157377_100969992 281
729 3300014745 Ga0157377_10108428 Ga0157377_101084282 281
730 3300014968 Ga0157379_10009043 Ga0157379_100090435 281
731 3300014968 Ga0157379_10071326 Ga0157379_100713262 281
732 3300014968 Ga0157379_10385720 Ga0157379_103857202 281
733 3300014968 Ga0157379_10449279 Ga0157379_104492791 281
734 3300014968 Ga0157379_10780694 Ga0157379_107806941 281
735 3300014969 Ga0157376_10015484 Ga0157376_100154844 281
736 3300014969 Ga0157376_10063221 Ga0157376_100632213 281
737 3300014969 Ga0157376_10078118 Ga0157376_100781182 281
738 3300014969 Ga0157376_10090586 Ga0157376_100905861 281
739 3300014969 Ga0157376_10480980 Ga0157376_104809801 281
740 3300017792 Ga0163161_10019634 Ga0163161_100196343 281
741 3300017792 Ga0163161_10059316 Ga0163161_100593162 281
742 3300017792 Ga0163161_10117109 Ga0163161_101171093 281
743 3300021361 Ga0213872_10002872 Ga0213872_100028726 281
744 3300021361 Ga0213872_10052460 Ga0213872_100524603 281
745 3300025223 Ga0207672_1000027 Ga0207672_100002717 281
746 3300025224 Ga0209784_100051 Ga0209784_10005190 281
747 3300025229 Ga0209147_100099 Ga0209147_100099120 281
748 3300025229 Ga0209147_102062 Ga0209147_1020623 281
749 3300025284 Ga0209130_1000940 Ga0209130_100094016 281
750 3300025284 Ga0209130_1002628 Ga0209130_10026285 281
751 3300025284 Ga0209130_1006010 Ga0209130_10060103 281
752 3300025292 Ga0209676_1045510 Ga0209676_10455102 281
753 3300025294 Ga0209025_1000011 Ga0209025_1000011390 281
754 3300025294 Ga0209025_1001243 Ga0209025_100124324 281
755 3300025294 Ga0209025_1001377 Ga0209025_100137713 281
756 3300025294 Ga0209025_1001513 Ga0209025_100151315 281
757 3300025294 Ga0209025_1002114 Ga0209025_10021145 281
758 3300025294 Ga0209025_1003800 Ga0209025_10038008 281
759 3300025294 Ga0209025_1004437 Ga0209025_10044374 281
760 3300025294 Ga0209025_1005550 Ga0209025_100555011 281
761 3300025294 Ga0209025_1010779 Ga0209025_10107793 281
762 3300025294 Ga0209025_1013139 Ga0209025_10131395 281
763 3300025294 Ga0209025_1073124 Ga0209025_10731242 281
764 3300025315 Ga0207697_10003632 Ga0207697_100036325 281
765 3300025315 Ga0207697_10162764 Ga0207697_101627642 281
766 3300025711 Ga0207696_1000580 Ga0207696_100058010 281
767 3300025711 Ga0207696_1005627 Ga0207696_10056272 281
768 3300025711 Ga0207696_1006649 Ga0207696_10066495 281
769 3300025728 Ga0207655_1001343 Ga0207655_10013435 281
770 3300025728 Ga0207655_1038907 Ga0207655_10389072 281
771 3300025735 Ga0207713_1002044 Ga0207713_100204411 281
772 3300025735 Ga0207713_1010901 Ga0207713_10109013 281
773 3300025885 Ga0207653_10000034 Ga0207653_1000003416 281
774 3300025885 Ga0207653_10000638 Ga0207653_100006386 281
775 3300025900 Ga0207710_10000001 Ga0207710_10000001204 281
776 3300025900 Ga0207710_10000938 Ga0207710_1000093815 281
777 3300025903 Ga0207680_10091031 Ga0207680_100910312 281
778 3300025903 Ga0207680_10113576 Ga0207680_101135762 281
779 3300025904 Ga0207647_10029345 Ga0207647_100293453 281
780 3300025907 Ga0207645_10002492 Ga0207645_100024924 281
781 3300025907 Ga0207645_10015845 Ga0207645_100158454 281
782 3300025908 Ga0207643_10000914 Ga0207643_1000091417 281
783 3300025908 Ga0207643_10014032 Ga0207643_100140324 281
784 3300025908 Ga0207643_10136740 Ga0207643_101367402 281
785 3300025908 Ga0207643_10222680 Ga0207643_102226801 281
786 3300025909 Ga0207705_10131182 Ga0207705_101311822 281
787 3300025909 Ga0207705_10181682 Ga0207705_101816822 281
788 3300025910 Ga0207684_10000065 Ga0207684_1000006583 281
789 3300025910 Ga0207684_10005843 Ga0207684_100058435 281
790 3300025910 Ga0207684_10006018 Ga0207684_1000601812 281
791 3300025910 Ga0207684_10040536 Ga0207684_100405363 281
792 3300025910 Ga0207684_10041360 Ga0207684_100413604 281
793 3300025910 Ga0207684_10042463 Ga0207684_100424633 281
794 3300025910 Ga0207684_10187548 Ga0207684_101875482 281
795 3300025910 Ga0207684_10226956 Ga0207684_102269562 281
796 3300025910 Ga0207684_10384367 Ga0207684_103843672 281
797 3300025910 Ga0207684_10416376 Ga0207684_104163761 281
798 3300025911 Ga0207654_10000050 Ga0207654_1000005047 281
799 3300025911 Ga0207654_10019167 Ga0207654_100191672 281
800 3300025912 Ga0207707_10000028 Ga0207707_1000002892 281
801 3300025912 Ga0207707_10002650 Ga0207707_1000265012 281
802 3300025912 Ga0207707_10005634 Ga0207707_100056342 281
803 3300025912 Ga0207707_10017351 Ga0207707_100173513 281
804 3300025912 Ga0207707_10021789 Ga0207707_100217891 281
805 3300025912 Ga0207707_10033306 Ga0207707_100333065 281
806 3300025912 Ga0207707_10039516 Ga0207707_100395164 281
807 3300025912 Ga0207707_10331077 Ga0207707_103310772 281
808 3300025913 Ga0207695_10052375 Ga0207695_100523752 281
809 3300025914 Ga0207671_10003695 Ga0207671_1000369515 281
810 3300025914 Ga0207671_10061160 Ga0207671_100611602 281
811 3300025915 Ga0207693_10422525 Ga0207693_104225251 281
812 3300025916 Ga0207663_10034672 Ga0207663_100346722 281
813 3300025916 Ga0207663_10037893 Ga0207663_100378932 281
814 3300025917 Ga0207660_10003300 Ga0207660_1000330010 281
815 3300025917 Ga0207660_10028006 Ga0207660_100280064 281
816 3300025917 Ga0207660_10048047 Ga0207660_100480473 281
817 3300025917 Ga0207660_10050203 Ga0207660_100502033 281
818 3300025917 Ga0207660_10130611 Ga0207660_101306112 281
819 3300025917 Ga0207660_10200566 Ga0207660_102005662 281
820 3300025918 Ga0207662_10004272 Ga0207662_100042722 281
821 3300025918 Ga0207662_10068608 Ga0207662_100686082 281
822 3300025918 Ga0207662_10111523 Ga0207662_101115232 281
823 3300025919 Ga0207657_10052979 Ga0207657_100529794 281
824 3300025919 Ga0207657_10538018 Ga0207657_105380181 281
825 3300025920 Ga0207649_10011373 Ga0207649_100113732 281
826 3300025920 Ga0207649_10026623 Ga0207649_100266233 281
827 3300025920 Ga0207649_10079225 Ga0207649_100792253 281
828 3300025920 Ga0207649_10182386 Ga0207649_101823862 281
829 3300025921 Ga0207652_10000573 Ga0207652_100005738 281
830 3300025921 Ga0207652_10015858 Ga0207652_100158583 281
831 3300025921 Ga0207652_10319795 Ga0207652_103197952 281
832 3300025922 Ga0207646_10000347 Ga0207646_1000034755 281
833 3300025922 Ga0207646_10004439 Ga0207646_1000443912 281
834 3300025922 Ga0207646_10005716 Ga0207646_1000571611 281
835 3300025922 Ga0207646_10050978 Ga0207646_100509782 281
836 3300025922 Ga0207646_10118276 Ga0207646_101182763 281
837 3300025922 Ga0207646_10152925 Ga0207646_101529252 281
838 3300025922 Ga0207646_10290240 Ga0207646_102902402 281
839 3300025922 Ga0207646_10372002 Ga0207646_103720022 281
840 3300025922 Ga0207646_10426553 Ga0207646_104265531 281
841 3300025923 Ga0207681_10000018 Ga0207681_10000018233 281
842 3300025923 Ga0207681_10035223 Ga0207681_100352233 281
843 3300025923 Ga0207681_10037492 Ga0207681_100374922 281
844 3300025923 Ga0207681_10038805 Ga0207681_100388052 281
845 3300025923 Ga0207681_10101044 Ga0207681_101010442 281
846 3300025923 Ga0207681_10166374 Ga0207681_101663742 281
847 3300025923 Ga0207681_10457983 Ga0207681_104579832 281
848 3300025924 Ga0207694_10000031 Ga0207694_10000031152 281
849 3300025924 Ga0207694_10005990 Ga0207694_100059904 281
850 3300025924 Ga0207694_10053213 Ga0207694_100532133 281
851 3300025925 Ga0207650_10018187 Ga0207650_100181875 281
852 3300025925 Ga0207650_10179037 Ga0207650_101790372 281
853 3300025925 Ga0207650_10342445 Ga0207650_103424452 281
854 3300025925 Ga0207650_10349283 Ga0207650_103492832 281
855 3300025926 Ga0207659_10005311 Ga0207659_100053113 281
856 3300025926 Ga0207659_10080239 Ga0207659_100802392 281
857 3300025926 Ga0207659_10278645 Ga0207659_102786452 281
858 3300025927 Ga0207687_10000066 Ga0207687_1000006660 281
859 3300025927 Ga0207687_10071926 Ga0207687_100719262 281
860 3300025927 Ga0207687_10082448 Ga0207687_100824483 281
861 3300025927 Ga0207687_10375510 Ga0207687_103755101 281
862 3300025929 Ga0207664_10011416 Ga0207664_100114164 281
863 3300025929 Ga0207664_10089360 Ga0207664_100893603 281
864 3300025931 Ga0207644_10002401 Ga0207644_100024013 281
865 3300025931 Ga0207644_10002547 Ga0207644_1000254711 281
866 3300025931 Ga0207644_10094818 Ga0207644_100948182 281
867 3300025931 Ga0207644_10143684 Ga0207644_101436841 281
868 3300025931 Ga0207644_10182016 Ga0207644_101820162 281
869 3300025932 Ga0207690_10045153 Ga0207690_100451533 281
870 3300025932 Ga0207690_10054121 Ga0207690_100541213 281
871 3300025932 Ga0207690_10084289 Ga0207690_100842892 281
872 3300025932 Ga0207690_10174099 Ga0207690_101740992 281
873 3300025933 Ga0207706_10011037 Ga0207706_100110374 281
874 3300025933 Ga0207706_10105448 Ga0207706_101054482 281
875 3300025933 Ga0207706_10123770 Ga0207706_101237703 281
876 3300025933 Ga0207706_10216440 Ga0207706_102164402 281
877 3300025934 Ga0207686_10000015 Ga0207686_10000015110 281
878 3300025934 Ga0207686_10000581 Ga0207686_1000058115 281
879 3300025934 Ga0207686_10013241 Ga0207686_100132413 281
880 3300025934 Ga0207686_10095264 Ga0207686_100952642 281
881 3300025935 Ga0207709_10000043 Ga0207709_10000043114 281
882 3300025935 Ga0207709_10002880 Ga0207709_100028802 281
883 3300025935 Ga0207709_10003312 Ga0207709_100033126 281
884 3300025935 Ga0207709_10082766 Ga0207709_100827662 281
885 3300025935 Ga0207709_10097368 Ga0207709_100973682 281
886 3300025935 Ga0207709_10297974 Ga0207709_102979742 281
887 3300025936 Ga0207670_10000381 Ga0207670_1000038117 281
888 3300025936 Ga0207670_10002575 Ga0207670_100025753 281
889 3300025936 Ga0207670_10014845 Ga0207670_100148454 281
890 3300025936 Ga0207670_10046364 Ga0207670_100463643 281
891 3300025936 Ga0207670_10046948 Ga0207670_100469481 281
892 3300025936 Ga0207670_10049434 Ga0207670_100494343 281
893 3300025936 Ga0207670_10103374 Ga0207670_101033742 281
894 3300025936 Ga0207670_10117280 Ga0207670_101172802 281
895 3300025936 Ga0207670_10148069 Ga0207670_101480692 281
896 3300025936 Ga0207670_10260061 Ga0207670_102600611 281
897 3300025936 Ga0207670_10318811 Ga0207670_103188112 281
898 3300025937 Ga0207669_10013082 Ga0207669_100130822 281
899 3300025937 Ga0207669_10116668 Ga0207669_101166682 281
900 3300025937 Ga0207669_10196143 Ga0207669_101961432 281
901 3300025938 Ga0207704_10013627 Ga0207704_100136274 281
902 3300025938 Ga0207704_10029332 Ga0207704_100293323 281
903 3300025938 Ga0207704_10098271 Ga0207704_100982712 281
904 3300025938 Ga0207704_10353159 Ga0207704_103531592 281
905 3300025938 Ga0207704_10405354 Ga0207704_104053542 281
906 3300025939 Ga0207665_10000720 Ga0207665_1000072010 281
907 3300025939 Ga0207665_10021762 Ga0207665_100217624 281
908 3300025939 Ga0207665_10341974 Ga0207665_103419742 281
909 3300025940 Ga0207691_10000839 Ga0207691_1000083924 281
910 3300025940 Ga0207691_10010044 Ga0207691_100100443 281
911 3300025940 Ga0207691_10015656 Ga0207691_100156567 281
912 3300025940 Ga0207691_10022150 Ga0207691_100221504 281
913 3300025940 Ga0207691_10215593 Ga0207691_102155932 281
914 3300025940 Ga0207691_10303616 Ga0207691_103036162 281
915 3300025941 Ga0207711_10002751 Ga0207711_1000275110 281
916 3300025941 Ga0207711_10014196 Ga0207711_100141966 281
917 3300025941 Ga0207711_10016587 Ga0207711_100165877 281
918 3300025941 Ga0207711_10056760 Ga0207711_100567602 281
919 3300025941 Ga0207711_10065203 Ga0207711_100652033 281
920 3300025941 Ga0207711_10150084 Ga0207711_101500841 281
921 3300025941 Ga0207711_10213676 Ga0207711_102136762 281
922 3300025941 Ga0207711_10225985 Ga0207711_102259852 281
923 3300025941 Ga0207711_10253866 Ga0207711_102538661 281
924 3300025942 Ga0207689_10002876 Ga0207689_100028765 281
925 3300025942 Ga0207689_10006744 Ga0207689_1000674411 281
926 3300025942 Ga0207689_10027971 Ga0207689_100279715 281
927 3300025942 Ga0207689_10038211 Ga0207689_100382113 281
928 3300025942 Ga0207689_10045842 Ga0207689_100458423 281
929 3300025942 Ga0207689_10059455 Ga0207689_100594554 281
930 3300025944 Ga0207661_10000677 Ga0207661_100006777 281
931 3300025944 Ga0207661_10036180 Ga0207661_100361802 281
932 3300025944 Ga0207661_10076448 Ga0207661_100764482 281
933 3300025944 Ga0207661_10214643 Ga0207661_102146432 281
934 3300025945 Ga0207679_10014187 Ga0207679_100141873 281
935 3300025945 Ga0207679_10023779 Ga0207679_100237792 281
936 3300025949 Ga0207667_10018788 Ga0207667_100187887 281
937 3300025949 Ga0207667_10021568 Ga0207667_100215681 281
938 3300025949 Ga0207667_10634501 Ga0207667_106345012 281
939 3300025960 Ga0207651_10010248 Ga0207651_100102482 281
940 3300025960 Ga0207651_10120065 Ga0207651_101200652 281
941 3300025960 Ga0207651_10387634 Ga0207651_103876341 281
942 3300025961 Ga0207712_10011245 Ga0207712_100112452 281
943 3300025961 Ga0207712_10218151 Ga0207712_102181512 281
944 3300025972 Ga0207668_10008496 Ga0207668_100084964 281
945 3300025981 Ga0207640_10272955 Ga0207640_102729552 281
946 3300025986 Ga0207658_10052330 Ga0207658_100523303 281
947 3300025986 Ga0207658_10065937 Ga0207658_100659372 281
948 3300025986 Ga0207658_10105901 Ga0207658_101059012 281
949 3300025986 Ga0207658_10152078 Ga0207658_101520782 281
950 3300025986 Ga0207658_10337595 Ga0207658_103375952 281
951 3300026023 Ga0207677_10006278 Ga0207677_100062786 281
952 3300026023 Ga0207677_10110040 Ga0207677_101100402 281
953 3300026023 Ga0207677_10271874 Ga0207677_102718742 281
954 3300026035 Ga0207703_10000291 Ga0207703_1000029151 281
955 3300026035 Ga0207703_10010969 Ga0207703_100109695 281
956 3300026035 Ga0207703_10023195 Ga0207703_100231952 281
957 3300026035 Ga0207703_10024118 Ga0207703_100241185 281
958 3300026035 Ga0207703_10037543 Ga0207703_100375432 281
959 3300026035 Ga0207703_10044712 Ga0207703_100447124 281
960 3300026035 Ga0207703_10060376 Ga0207703_100603763 281
961 3300026035 Ga0207703_10113550 Ga0207703_101135502 281
962 3300026035 Ga0207703_10390129 Ga0207703_103901291 281
963 3300026041 Ga0207639_10066880 Ga0207639_100668802 281
964 3300026041 Ga0207639_10161099 Ga0207639_101610992 281
965 3300026041 Ga0207639_10167750 Ga0207639_101677502 281
966 3300026041 Ga0207639_10269403 Ga0207639_102694032 281
967 3300026067 Ga0207678_10201374 Ga0207678_102013742 281
968 3300026067 Ga0207678_10338881 Ga0207678_103388811 281
969 3300026067 Ga0207678_10414824 Ga0207678_104148242 281
970 3300026067 Ga0207678_10450124 Ga0207678_104501242 281
971 3300026075 Ga0207708_10000083 Ga0207708_1000008338 281
972 3300026075 Ga0207708_10006021 Ga0207708_100060213 281
973 3300026075 Ga0207708_10067042 Ga0207708_100670421 281
974 3300026075 Ga0207708_10120683 Ga0207708_101206832 281
975 3300026075 Ga0207708_10316542 Ga0207708_103165422 281
976 3300026078 Ga0207702_10118735 Ga0207702_101187352 281
977 3300026078 Ga0207702_10174677 Ga0207702_101746772 281
978 3300026088 Ga0207641_10004103 Ga0207641_100041039 281
979 3300026088 Ga0207641_10053884 Ga0207641_100538842 281
980 3300026088 Ga0207641_10065682 Ga0207641_100656823 281
981 3300026088 Ga0207641_10071500 Ga0207641_100715002 281
982 3300026088 Ga0207641_10101239 Ga0207641_101012392 281
983 3300026088 Ga0207641_10413972 Ga0207641_104139722 281
984 3300026088 Ga0207641_10632842 Ga0207641_106328422 281
985 3300026089 Ga0207648_10012589 Ga0207648_100125894 281
986 3300026089 Ga0207648_10040827 Ga0207648_100408272 281
987 3300026089 Ga0207648_10055080 Ga0207648_100550803 281
988 3300026089 Ga0207648_10079978 Ga0207648_100799782 281
989 3300026089 Ga0207648_10431571 Ga0207648_104315711 281
990 3300026089 Ga0207648_10511531 Ga0207648_105115311 281
991 3300026095 Ga0207676_10006852 Ga0207676_100068522 281
992 3300026095 Ga0207676_10086266 Ga0207676_100862662 281
993 3300026095 Ga0207676_10095057 Ga0207676_100950573 281
994 3300026095 Ga0207676_10224225 Ga0207676_102242252 281
995 3300026095 Ga0207676_10245503 Ga0207676_102455032 281
996 3300026116 Ga0207674_10006409 Ga0207674_100064099 281
997 3300026116 Ga0207674_10014910 Ga0207674_100149105 281
998 3300026116 Ga0207674_10035909 Ga0207674_100359094 281
999 3300026116 Ga0207674_10046039 Ga0207674_100460394 281
1000 3300026116 Ga0207674_10051334 Ga0207674_100513342 281
1001 3300026116 Ga0207674_10059494 Ga0207674_100594943 281
1002 3300026116 Ga0207674_10104541 Ga0207674_101045412 281
1003 3300026116 Ga0207674_10191696 Ga0207674_101916962 281
1004 3300026118 Ga0207675_100001016 Ga0207675_1000010164 281
1005 3300026118 Ga0207675_100001228 Ga0207675_1000012289 281
1006 3300026118 Ga0207675_100026037 Ga0207675_1000260373 281
1007 3300026118 Ga0207675_100043363 Ga0207675_1000433633 281
1008 3300026118 Ga0207675_100050184 Ga0207675_1000501842 281
1009 3300026118 Ga0207675_100075639 Ga0207675_1000756393 281
1010 3300026121 Ga0207683_10015914 Ga0207683_100159144 281
1011 3300026142 Ga0207698_10169049 Ga0207698_101690492 281
1012 3300026142 Ga0207698_10267614 Ga0207698_102676142 281
1013 3300026142 Ga0207698_10339827 Ga0207698_103398271 281
1014 3300026142 Ga0207698_10480129 Ga0207698_104801291 281
1015 3300026142 Ga0207698_10626445 Ga0207698_106264451 281
1016 3300026142 Ga0207698_10744608 Ga0207698_107446081 281
1017 3300027395 Ga0209996_1009804 Ga0209996_10098042 281
1018 3300027543 Ga0209999_1013787 Ga0209999_10137872 281
1019 3300027907 Ga0207428_10008326 Ga0207428_100083264 281
1020 3300027907 Ga0207428_10010234 Ga0207428_100102342 281
1021 3300027907 Ga0207428_10010988 Ga0207428_100109883 281
1022 3300027907 Ga0207428_10030570 Ga0207428_100305702 281
1023 3300027907 Ga0207428_10079620 Ga0207428_100796203 281
1024 3300027907 Ga0207428_10245864 Ga0207428_102458641 281
1025 3300028379 Ga0268266_10000147 Ga0268266_1000014758 281
1026 3300028379 Ga0268266_10002811 Ga0268266_100028113 281
1027 3300028379 Ga0268266_10129771 Ga0268266_101297712 281
1028 3300028380 Ga0268265_10024691 Ga0268265_100246912 281
1029 3300028380 Ga0268265_10026912 Ga0268265_100269122 281
1030 3300028380 Ga0268265_10404759 Ga0268265_104047592 281
1031 3300028381 Ga0268264_10008818 Ga0268264_100088185 281
1032 3300028381 Ga0268264_10037422 Ga0268264_100374223 281
1033 3300028381 Ga0268264_10144403 Ga0268264_101444032 281
1034 3300028381 Ga0268264_10190869 Ga0268264_101908692 281
1035 3300028381 Ga0268264_10398834 Ga0268264_103988342 281
1036 3300028381 Ga0268264_10533557 Ga0268264_105335572 281
1037 3300028573 Ga0265334_10006926 Ga0265334_100069263 281
1038 3300028577 Ga0265318_10015985 Ga0265318_100159852 281
1039 3300028654 Ga0265322_10000636 Ga0265322_1000063610 281
1040 3300028800 Ga0265338_10050309 Ga0265338_100503094 281
1041 3300028800 Ga0265338_10175017 Ga0265338_101750172 281
1042 3300030083 Ga0237817_10352 Ga0237817_103524 281
1043 3300030083 Ga0237817_10549 Ga0237817_105494 281
1044 3300031456 Ga0307513_10015284 Ga0307513_100152843 281
1045 3300031507 Ga0307509_10000024 Ga0307509_10000024119 281
1046 3300031507 Ga0307509_10026949 Ga0307509_100269493 281
1047 3300031507 Ga0307509_10273597 Ga0307509_102735972 281
1048 3300031548 Ga0307408_100135994 Ga0307408_1001359941 281
1049 3300031665 Ga0316575_10000065 Ga0316575_1000006523 281
1050 3300031665 Ga0316575_10002176 Ga0316575_100021762 281
1051 3300031665 Ga0316575_10005219 Ga0316575_100052192 281
1052 3300031691 Ga0316579_10000589 Ga0316579_100005895 281
1053 3300031691 Ga0316579_10002573 Ga0316579_100025734 281
1054 3300031691 Ga0316579_10006999 Ga0316579_100069994 281
1055 3300031691 Ga0316579_10013935 Ga0316579_100139353 281
1056 3300031691 Ga0316579_10151814 Ga0316579_101518142 281
1057 3300031711 Ga0265314_10098473 Ga0265314_100984732 281
1058 3300031727 Ga0316576_10002782 Ga0316576_100027829 281
1059 3300031727 Ga0316576_10021561 Ga0316576_100215614 281
1060 3300031727 Ga0316576_10021611 Ga0316576_100216114 281
1061 3300031727 Ga0316576_10109079 Ga0316576_101090791 281
1062 3300031727 Ga0316576_10125861 Ga0316576_101258612 281
1063 3300031727 Ga0316576_10126771 Ga0316576_101267713 281
1064 3300031727 Ga0316576_10131407 Ga0316576_101314072 281
1065 3300031728 Ga0316578_10002668 Ga0316578_100026682 281
1066 3300031728 Ga0316578_10006682 Ga0316578_100066823 281
1067 3300031728 Ga0316578_10100183 Ga0316578_101001831 281
1068 3300031728 Ga0316578_10119046 Ga0316578_101190461 281
1069 3300031728 Ga0316578_10120692 Ga0316578_101206922 281
1070 3300031728 Ga0316578_10163636 Ga0316578_101636362 281
1071 3300031733 Ga0316577_10002550 Ga0316577_100025505 281
1072 3300031733 Ga0316577_10004168 Ga0316577_100041687 281
1073 3300031733 Ga0316577_10095179 Ga0316577_100951791 281
1074 3300031733 Ga0316577_10173444 Ga0316577_101734442 281
1075 3300031824 Ga0307413_10078899 Ga0307413_100788992 281
1076 3300031824 Ga0307413_10626227 Ga0307413_106262271 281
1077 3300031852 Ga0307410_10000419 Ga0307410_100004198 281
1078 3300031852 Ga0307410_10072680 Ga0307410_100726802 281
1079 3300031901 Ga0307406_10020729 Ga0307406_100207291 281
1080 3300031901 Ga0307406_10102325 Ga0307406_101023252 281
1081 3300031901 Ga0307406_10155274 Ga0307406_101552741 281
1082 3300031901 Ga0307406_10637293 Ga0307406_106372931 281
1083 3300031903 Ga0307407_10001347 Ga0307407_100013471 281
1084 3300031903 Ga0307407_10146709 Ga0307407_101467092 281
1085 3300031911 Ga0307412_10011768 Ga0307412_100117685 281
1086 3300031911 Ga0307412_10013837 Ga0307412_100138373 281
1087 3300031995 Ga0307409_100001036 Ga0307409_1000010366 281
1088 3300031995 Ga0307409_100158905 Ga0307409_1001589052 281
1089 3300032002 Ga0307416_100000967 Ga0307416_1000009678 281
1090 3300032002 Ga0307416_100014183 Ga0307416_1000141835 281
1091 3300032002 Ga0307416_100097278 Ga0307416_1000972782 281
1092 3300032002 Ga0307416_100231658 Ga0307416_1002316582 281
1093 3300032002 Ga0307416_100535784 Ga0307416_1005357842 281
1094 3300032004 Ga0307414_10001587 Ga0307414_100015877 281
1095 3300032004 Ga0307414_10551818 Ga0307414_105518181 281
1096 3300032005 Ga0307411_10000495 Ga0307411_100004959 281
1097 3300032005 Ga0307411_10093251 Ga0307411_100932512 281
1098 3300032005 Ga0307411_10247988 Ga0307411_102479881 281
1099 3300032005 Ga0307411_10499344 Ga0307411_104993441 281
1100 3300032126 Ga0307415_100002989 Ga0307415_1000029892 281
1101 3300032126 Ga0307415_100168243 Ga0307415_1001682432 281
1102 3300032126 Ga0307415_100294112 Ga0307415_1002941121 281
1103 3300032133 Ga0316583_10001483 Ga0316583_100014831 281
1104 3300032133 Ga0316583_10003424 Ga0316583_100034244 281
1105 3300032133 Ga0316583_10019319 Ga0316583_100193192 281
1106 3300032137 Ga0316585_10010791 Ga0316585_100107911 281
1107 3300032137 Ga0316585_10011528 Ga0316585_100115282 281
1108 3300032139 Ga0316580_10002121 Ga0316580_100021211 281
1109 3300032168 Ga0316593_10119313 Ga0316593_101193131 281
1110 3300033179 Ga0307507_10156485 Ga0307507_101564852 281
1111 3300033528 Ga0316588_1009988 Ga0316588_10099882 281
1112 3300034820 Ga0373959_0000156 Ga0373959_0000156_3361_4218 281
1113 3300035083 Ga0373926_0001470 Ga0373926_0001470_607_1458 281
1114 3300035086 Ga0373934_0000557 Ga0373934_0000557_10264_11160 281
1115 3300035088 Ga0373940_0011440 Ga0373940_0011440_634_1488 281
1116 3300035090 Ga0373949_0000064 Ga0373949_0000064_6697_7572 281
1117 3300035090 Ga0373949_0027973 Ga0373949_0027973_45_905 281
1118 3300035113 Ga0373936_0000010 Ga0373936_0000010_242908_243783 281
1119 3300035117 Ga0373953_0037227 Ga0373953_0037227_178_1074 281
1120 3300035119 Ga0373956_0004354 Ga0373956_0004354_1095_1991 281
1121 3300035120 Ga0373957_0006575 Ga0373957_0006575_884_1780 281
1122 3300035170 Ga0373943_0008617 Ga0373943_0008617_1528_2379 281
1123 3300035170 Ga0373943_0050674 Ga0373943_0050674_901_1752 281
1124 3300035170 Ga0373943_0052456 Ga0373943_0052456_180_1031 281
1125 3300035172 Ga0373955_0028648 Ga0373955_0028648_647_1543 281
1126 3300035241 Ga0373961_0000189 Ga0373961_0000189_2447_3307 281
1127 3300035241 Ga0373961_0000277 Ga0373961_0000277_3426_4301 281
1128 3300035398 Ga0316574_0000175 Ga0316574_0000175_9130_9981 281
1129 3300035398 Ga0316574_0002372 Ga0316574_0002372_7488_8339 281
1130 3300035398 Ga0316574_0015002 Ga0316574_0015002_1234_2085 281
1131 3300035398 Ga0316574_0020020 Ga0316574_0020020_2266_3114 281
1132 3300035691 Ga0373931_0186035 Ga0373931_0186035_137_1000 281
1133 3300035692 Ga0373935_0000570 Ga0373935_0000570_10495_11355 281
1134 3300036401 Ga0373937_0038044 Ga0373937_0038044_911_1786 281
1135 3300036401 Ga0373937_0166776 Ga0373937_0166776_1056_1907 281
1136 3300036401 Ga0373937_0420228 Ga0373937_0420228_316_1182 281
1137 3300036647 Ga0316582_0000258 Ga0316582_0000258_8378_9229 281
1138 3300036647 Ga0316582_0001625 Ga0316582_0001625_1450_2304 281
1139 3300036647 Ga0316582_0005946 Ga0316582_0005946_2742_3593 281
1140 3300036647 Ga0316582_0025391 Ga0316582_0025391_1333_2184 281
1141 3300036647 Ga0316582_0058044 Ga0316582_0058044_940_1794 281
1142 3300036647 Ga0316582_0109753 Ga0316582_0109753_174_1028 281
1143 3300036647 Ga0316582_0135991 Ga0316582_0135991_280_1131 281
1144 3300036712 Ga0316584_0002276 Ga0316584_0002276_3922_4773 281
1145 3300036712 Ga0316584_0006415 Ga0316584_0006415_6106_6960 281
1146 3300036712 Ga0316584_0012758 Ga0316584_0012758_3547_4398 281
1147 3300036712 Ga0316584_0015436 Ga0316584_0015436_1444_2376 281
1148 3300036712 Ga0316584_0034827 Ga0316584_0034827_2668_3516 281
1149 3300036712 Ga0316584_0093682 Ga0316584_0093682_1193_2044 281
1150 3300036712 Ga0316584_0116416 Ga0316584_0116416_348_1196 281
1151 3300037068 Ga0373925_0001623 Ga0373925_0001623_3438_4304 281
1152 3300037068 Ga0373925_0023695 Ga0373925_0023695_1492_2355 281
1153 3300037068 Ga0373925_0094111 Ga0373925_0094111_866_1717 281
1154 3300037312 Ga0395899_0068270 Ga0395899_0068270_150_1007 281
1155 3300037312 Ga0395899_0172890 Ga0395899_0172890_265_1119 281
1156 3300037418 Ga0395900_0026447 Ga0395900_0026447_2276_3175 281
1157 3300037418 Ga0395900_0075081 Ga0395900_0075081_756_1610 281
1158 3300037418 Ga0395900_0237129 Ga0395900_0237129_673_1518 281
1159 3300037466 Ga0395898_0058215 Ga0395898_0058215_1576_2475 281
1160 3300037466 Ga0395898_0171076 Ga0395898_0171076_725_1579 281
1161 3300037471 Ga0395905_0008275 Ga0395905_0008275_9131_10030 281
1162 3300037471 Ga0395905_0057725 Ga0395905_0057725_629_1486 281
1163 3300037471 Ga0395905_0065722 Ga0395905_0065722_1876_2739 281
1164 3300037471 Ga0395905_0179796 Ga0395905_0179796_30_881 281
1165 3300037471 Ga0395905_0179921 Ga0395905_0179921_862_1764 281
1166 3300037588 Ga0316581_0009488 Ga0316581_0009488_964_1818 281
1167 3300037588 Ga0316581_0013227 Ga0316581_0013227_1441_2292 281
1168 3300037853 Ga0436364_0209524 Ga0436364_0209524_431_1282 281
1169 3300038443 Ga0395901_0003701 Ga0395901_0003701_4694_5593 281
1170 3300038443 Ga0395901_0433440 Ga0395901_0433440_353_1210 281
1171 3300038705 Ga0237819_00011 Ga0237819_00011_53171_54022 281
1172 3300038705 Ga0237819_00072 Ga0237819_00072_1658_2509 281
1173 3300038725 Ga0400484_03515 Ga0400484_03515_8394_9242 281
1174 3300038726 Ga0400490_35387 Ga0400490_35387_414_1262 281
1175 3300038727 Ga0400491_26103 Ga0400491_26103_217_1098 281
1176 3300038735 Ga0400485_18179 Ga0400485_18179_2200_3048 281
1177 3300038741 Ga0400488_13817 Ga0400488_13817_2226_3074 281
1178 3300038742 Ga0400486_22010 Ga0400486_22010_8061_8909 281
1179 3300038742 Ga0400486_31955 Ga0400486_31955_26176_27024 281
1180 3300038996 Ga0242420_002205 Ga0242420_002205_1198_2043 281
1181 3300039062 Ga0400483_005135 Ga0400483_005135_33408_34256 281
1182 3300039062 Ga0400483_117225 Ga0400483_117225_1340_2191 281
1183 3300039062 Ga0400483_127419 Ga0400483_127419_527_1375 281
1184 3300039062 Ga0400483_147632 Ga0400483_147632_1651_2502 281
1185 3300039062 Ga0400483_190891 Ga0400483_190891_14445_15296 281
1186 3300039062 Ga0400483_226761 Ga0400483_226761_21243_22091 281
1187 3300039093 Ga0400489_02082 Ga0400489_02082_272_1120 281
1188 3300039093 Ga0400489_31839 Ga0400489_31839_10688_11536 281
1189 3300039110 Ga0400487_64678 Ga0400487_64678_1247_2095 281
1190 3300039437 Ga0436365_1192947 Ga0436365_1192947_3381_4229 281
1191 3300039447 Ga0436361_0551962 Ga0436361_0551962_2313_3170 281
1192 3300039447 Ga0436361_0628951 Ga0436361_0628951_15176_16024 281
1193 3300039447 Ga0436361_1109690 Ga0436361_1109690_1749_2600 281
1194 3300041404 Ga0439436_0003023 Ga0439436_0003023_2914_3798 281
1195 3300041406 Ga0439439_0000069 Ga0439439_0000069_10728_11612 281
1196 3300041498 Ga0451841_1185704 Ga0451841_1185704_267_1175 281
1197 3300041505 Ga0451849_0460671 Ga0451849_0460671_2481_3389 281
1198 3300041505 Ga0451849_0476718 Ga0451849_0476718_77_925 281
1199 3300041512 Ga0451853_0197269 Ga0451853_0197269_7599_8507 281
1200 3300042007 Ga0439449_0000310 Ga0439449_0000310_8997_9881 281
1201 3300042015 Ga0439462_0000401 Ga0439462_0000401_3898_4782 281
1202 3300042015 Ga0439462_0005925 Ga0439462_0005925_648_1499 281
1203 3300042156 Ga0439446_0106332 Ga0439446_0106332_31_876 281
1204 3300042435 Ga0439434_0010303 Ga0439434_0010303_1674_2519 281
1205 3300042436 Ga0439435_0069994 Ga0439435_0069994_28_900 281
1206 3300042876 Ga0451577_0000079 Ga0451577_0000079_126089_126934 281
1207 3300042876 Ga0451577_0002426 Ga0451577_0002426_9740_10588 281
1208 3300042876 Ga0451577_0010061 Ga0451577_0010061_7551_8399 281
1209 3300042876 Ga0451577_0010261 Ga0451577_0010261_337_1185 281
1210 3300042876 Ga0451577_0011583 Ga0451577_0011583_3136_3987 281
1211 3300042876 Ga0451577_0013346 Ga0451577_0013346_3607_4458 281
1212 3300042876 Ga0451577_0036406 Ga0451577_0036406_1462_2319 281
1213 3300042876 Ga0451577_0066985 Ga0451577_0066985_1325_2179 281
1214 3300042876 Ga0451577_0073333 Ga0451577_0073333_1455_2309 281
1215 3300042876 Ga0451577_0084993 Ga0451577_0084993_149_1006 281
1216 3300042876 Ga0451577_0104422 Ga0451577_0104422_576_1472 281
1217 3300042876 Ga0451577_0133362 Ga0451577_0133362_773_1642 281
1218 3300042876 Ga0451577_0169900 Ga0451577_0169900_172_1017 281
1219 3300042876 Ga0451577_0198011 Ga0451577_0198011_722_1600 281
1220 3300042876 Ga0451577_0306749 Ga0451577_0306749_293_1141 281
1221 3300042876 Ga0451577_0572184 Ga0451577_0572184_98_943 281
1222 3300044673 Ga0453683_0000002 Ga0453683_0000002_1086286_1087140 281
1223 3300044673 Ga0453683_0000266 Ga0453683_0000266_61177_62025 281
1224 3300044673 Ga0453683_0000326 Ga0453683_0000326_55508_56356 281
1225 3300044673 Ga0453683_0000890 Ga0453683_0000890_16010_16855 281
1226 3300044673 Ga0453683_0001905 Ga0453683_0001905_4268_5113 281
1227 3300044673 Ga0453683_0003551 Ga0453683_0003551_7549_8397 281
1228 3300044673 Ga0453683_0004105 Ga0453683_0004105_8409_9254 281
1229 3300044673 Ga0453683_0008682 Ga0453683_0008682_3907_4752 281
1230 3300044673 Ga0453683_0011614 Ga0453683_0011614_2057_2908 281
1231 3300044673 Ga0453683_0063868 Ga0453683_0063868_747_1610 281
1232 3300044673 Ga0453683_0079189 Ga0453683_0079189_869_1714 281
1233 3300044673 Ga0453683_0085470 Ga0453683_0085470_249_1094 281
1234 3300044673 Ga0453683_0148772 Ga0453683_0148772_235_1080 281
1235 3300044673 Ga0453683_0172382 Ga0453683_0172382_46_894 281
1236 3300044673 Ga0453683_0179427 Ga0453683_0179427_309_1154 281
1237 3300044684 Ga0466966_0072787 Ga0466966_0072787_420_1274 281
1238 3300044684 Ga0466966_0135769 Ga0466966_0135769_611_1459 281
1239 3300044693 Ga0466961_0003085 Ga0466961_0003085_8999_9859 281
1240 3300044694 Ga0466963_0026588 Ga0466963_0026588_865_1728 281
1241 3300044712 Ga0453684_0000242 Ga0453684_0000242_131149_131994 281
1242 3300044712 Ga0453684_0000386 Ga0453684_0000386_112939_113790 281
1243 3300044712 Ga0453684_0000594 Ga0453684_0000594_40820_41665 281
1244 3300044712 Ga0453684_0001014 Ga0453684_0001014_86554_87399 281
1245 3300044712 Ga0453684_0001289 Ga0453684_0001289_71758_72606 281
1246 3300044712 Ga0453684_0007441 Ga0453684_0007441_9385_10233 281
1247 3300044712 Ga0453684_0007574 Ga0453684_0007574_15312_16160 281
1248 3300044712 Ga0453684_0009801 Ga0453684_0009801_14868_15716 281
1249 3300044712 Ga0453684_0010428 Ga0453684_0010428_2604_3449 281
1250 3300044712 Ga0453684_0031284 Ga0453684_0031284_6581_7429 281
1251 3300044712 Ga0453684_0032891 Ga0453684_0032891_1376_2230 281
1252 3300044712 Ga0453684_0035072 Ga0453684_0035072_2053_2901 281
1253 3300044712 Ga0453684_0036767 Ga0453684_0036767_591_1451 281
1254 3300044712 Ga0453684_0037929 Ga0453684_0037929_5056_5904 281
1255 3300044712 Ga0453684_0048327 Ga0453684_0048327_3700_4557 281
1256 3300044712 Ga0453684_0050277 Ga0453684_0050277_2486_3331 281
1257 3300044712 Ga0453684_0059314 Ga0453684_0059314_245_1123 281
1258 3300044712 Ga0453684_0092432 Ga0453684_0092432_1073_1951 281
1259 3300044712 Ga0453684_0092552 Ga0453684_0092552_1018_1896 281
1260 3300044712 Ga0453684_0093505 Ga0453684_0093505_739_1590 281
1261 3300044712 Ga0453684_0096351 Ga0453684_0096351_786_1637 281
1262 3300044712 Ga0453684_0136787 Ga0453684_0136787_772_1620 281
1263 3300044712 Ga0453684_0196306 Ga0453684_0196306_752_1606 281
1264 3300044712 Ga0453684_0445461 Ga0453684_0445461_471_1316 281
1265 3300044712 Ga0453684_0478244 Ga0453684_0478244_370_1221 281
1266 3300044719 Ga0466971_0111233 Ga0466971_0111233_261_1112 281
1267 3300044842 Ga0466957_0186083 Ga0466957_0186083_460_1311 281
1268 3300045049 Ga0466959_0150730 Ga0466959_0150730_613_1461 281
1269 3300045051 Ga0451576_0000321 Ga0451576_0000321_35347_36195 281
1270 3300045051 Ga0451576_0003052 Ga0451576_0003052_22389_23234 281
1271 3300045051 Ga0451576_0006382 Ga0451576_0006382_10120_10974 281
1272 3300045051 Ga0451576_0012969 Ga0451576_0012969_6542_7390 281
1273 3300045051 Ga0451576_0021802 Ga0451576_0021802_3971_4870 281
1274 3300045051 Ga0451576_0034893 Ga0451576_0034893_2763_3608 281
1275 3300045051 Ga0451576_0039031 Ga0451576_0039031_1322_2167 281
1276 3300045051 Ga0451576_0063769 Ga0451576_0063769_2294_3139 281
1277 3300045051 Ga0451576_0064909 Ga0451576_0064909_1325_2182 281
1278 3300045051 Ga0451576_0123690 Ga0451576_0123690_330_1184 281
1279 3300045051 Ga0451576_0405561 Ga0451576_0405561_58_909 281
1280 3300045976 Ga0466967_0000143 Ga0466967_0000143_24669_25520 281
1281 3300046454 Ga0495592_0058173 Ga0495592_0058173_1031_1882 281
1282 3300046454 Ga0495592_0213877 Ga0495592_0213877_124_975 281
1283 3300046459 Ga0495629_0000038 Ga0495629_0000038_55152_56018 281
1284 3300046459 Ga0495629_0002434 Ga0495629_0002434_11990_12865 281
1285 3300046459 Ga0495629_0053065 Ga0495629_0053065_501_1352 281
1286 3300046459 Ga0495629_0253945 Ga0495629_0253945_270_1121 281
1287 3300046460 Ga0495638_0059138 Ga0495638_0059138_184_1059 281
1288 3300046463 Ga0495653_0084340 Ga0495653_0084340_1104_1970 281
1289 3300046463 Ga0495653_0146320 Ga0495653_0146320_205_1101 281
1290 3300046472 Ga0495580_0214169 Ga0495580_0214169_266_1117 281
1291 3300046473 Ga0495582_0056811 Ga0495582_0056811_47_898 281
1292 3300046473 Ga0495582_0184307 Ga0495582_0184307_13_879 281
1293 3300046475 Ga0495639_0000188 Ga0495639_0000188_4208_5074 281
1294 3300046475 Ga0495639_0003211 Ga0495639_0003211_2537_3412 281
1295 3300046476 Ga0495662_0041262 Ga0495662_0041262_1060_1911 281
1296 3300046476 Ga0495662_0097280 Ga0495662_0097280_207_1052 281
1297 3300046477 Ga0495664_0265549 Ga0495664_0265549_22_873 281
1298 3300046499 Ga0495594_0058302 Ga0495594_0058302_912_1787 281
1299 3300046499 Ga0495594_0071070 Ga0495594_0071070_356_1207 281
1300 3300046511 Ga0495608_0003813 Ga0495608_0003813_7264_8160 281
1301 3300046511 Ga0495608_0008469 Ga0495608_0008469_1458_2309 281
1302 3300046516 Ga0495628_0001822 Ga0495628_0001822_6497_7393 281
1303 3300046516 Ga0495628_0026844 Ga0495628_0026844_2265_3125 281
1304 3300046516 Ga0495628_0350927 Ga0495628_0350927_174_1025 281
1305 3300046517 Ga0495630_0048918 Ga0495630_0048918_2291_3142 281
1306 3300046517 Ga0495630_0259412 Ga0495630_0259412_321_1181 281
1307 3300046519 Ga0495632_0021671 Ga0495632_0021671_242_1087 281
1308 3300046522 Ga0495643_0000016 Ga0495643_0000016_48155_49015 281
1309 3300046525 Ga0495663_0000350 Ga0495663_0000350_10750_11607 281
1310 3300046525 Ga0495663_0079763 Ga0495663_0079763_135_980 281
1311 3300046526 Ga0495666_0000032 Ga0495666_0000032_26622_27488 281
1312 3300046529 Ga0495652_0044317 Ga0495652_0044317_969_1865 281
1313 3300046529 Ga0495652_0089110 Ga0495652_0089110_1111_1962 281
1314 3300046531 Ga0495665_0001812 Ga0495665_0001812_2772_3623 281
1315 3300046531 Ga0495665_0013030 Ga0495665_0013030_1057_1908 281
1316 3300046533 Ga0495640_0024828 Ga0495640_0024828_2218_3069 281
1317 3300046535 Ga0495586_0000140 Ga0495586_0000140_20595_21461 281
1318 3300046535 Ga0495586_0018581 Ga0495586_0018581_1182_2048 281
1319 3300046535 Ga0495586_0111646 Ga0495586_0111646_551_1411 281
1320 3300046536 Ga0495587_0033448 Ga0495587_0033448_1345_2241 281
1321 3300046537 Ga0495598_0000451 Ga0495598_0000451_4537_5382 281
1322 3300046539 Ga0495621_0000925 Ga0495621_0000925_6141_6986 281
1323 3300046539 Ga0495621_0058694 Ga0495621_0058694_258_1103 281
1324 3300046559 Ga0495667_0003016 Ga0495667_0003016_8580_9440 281
1325 3300046559 Ga0495667_0015909 Ga0495667_0015909_3927_4778 281
1326 3300046559 Ga0495667_0025347 Ga0495667_0025347_2921_3772 281
1327 3300046559 Ga0495667_0025575 Ga0495667_0025575_1359_2255 281
1328 3300046615 Ga0495656_0090835 Ga0495656_0090835_536_1381 281
1329 3300046663 Ga0495635_0007993 Ga0495635_0007993_3107_3973 281
1330 3300046663 Ga0495635_0094960 Ga0495635_0094960_766_1617 281
1331 3300046663 Ga0495635_0099905 Ga0495635_0099905_608_1504 281
1332 3300046665 Ga0495661_0036609 Ga0495661_0036609_1388_2239 281
1333 3300046674 Ga0495588_0003546 Ga0495588_0003546_3110_3961 281
1334 3300046675 Ga0495657_0000848 Ga0495657_0000848_25935_26786 281
1335 3300046675 Ga0495657_0016847 Ga0495657_0016847_1961_2857 281
1336 3300046675 Ga0495657_0075480 Ga0495657_0075480_618_1469 281
1337 3300046678 Ga0495599_0013056 Ga0495599_0013056_1546_2397 281
1338 3300046678 Ga0495599_0016848 Ga0495599_0016848_3553_4449 281
1339 3300046678 Ga0495599_0032369 Ga0495599_0032369_1368_2219 281
1340 3300046680 Ga0495646_0033409 Ga0495646_0033409_2333_3184 281
1341 3300046683 Ga0495658_0046984 Ga0495658_0046984_939_1790 281
1342 3300046689 Ga0495613_0020478 Ga0495613_0020478_1968_2819 281
1343 3300046689 Ga0495613_0174080 Ga0495613_0174080_657_1508 281
1344 3300046689 Ga0495613_0189217 Ga0495613_0189217_173_1039 281
1345 3300046690 Ga0495624_0288191 Ga0495624_0288191_76_921 281
1346 3300046809 Ga0495600_0002642 Ga0495600_0002642_5094_5960 281
1347 3300046809 Ga0495600_0007108 Ga0495600_0007108_5252_6103 281
1348 3300046809 Ga0495600_0011115 Ga0495600_0011115_778_1674 281
1349 3300047315 Ga0495581_0005570 Ga0495581_0005570_4273_5139 281
1350 3300047315 Ga0495581_0006925 Ga0495581_0006925_2862_3713 281
1351 3300047315 Ga0495581_0011954 Ga0495581_0011954_3239_4114 281
1352 3300047315 Ga0495581_0243329 Ga0495581_0243329_20_871 281
1353 3300047315 Ga0495581_0297572 Ga0495581_0297572_25_876 281
1354 3300047317 Ga0495604_0012866 Ga0495604_0012866_4269_5120 281
1355 3300047318 Ga0495636_0000275 Ga0495636_0000275_1270_2130 281
1356 3300047319 Ga0495674_0081965 Ga0495674_0081965_1893_2744 281
1357 3300047321 Ga0495676_0013319 Ga0495676_0013319_1691_2557 281
1358 3300047321 Ga0495676_0047316 Ga0495676_0047316_1812_2687 281
1359 3300047321 Ga0495676_0086312 Ga0495676_0086312_104_970 281
1360 3300047321 Ga0495676_0107623 Ga0495676_0107623_349_1245 281
1361 3300047322 Ga0495680_0006701 Ga0495680_0006701_4874_5740 281
1362 3300047444 Ga0495675_0003757 Ga0495675_0003757_4444_5340 281
1363 3300047444 Ga0495675_0085133 Ga0495675_0085133_163_1014 281
1364 3300047471 Ga0495684_0009426 Ga0495684_0009426_4643_5509 281
1365 3300047471 Ga0495684_0089257 Ga0495684_0089257_767_1618 281
1366 3300047471 Ga0495684_0204411 Ga0495684_0204411_266_1162 281
1367 3300047471 Ga0495684_0371980 Ga0495684_0371980_120_995 281
1368 3300048088 Ga0495602_0158582 Ga0495602_0158582_786_1637 281
1369 3300048090 Ga0495615_0042123 Ga0495615_0042123_135_983 281
1370 3300048905 Ga0496102_0369083 Ga0496102_0369083_393_1241 281
1371 3300048905 Ga0496102_0644619 Ga0496102_0644619_36_887 281
1372 3300048906 Ga0496103_0014139 Ga0496103_0014139_3336_4181 281
1373 3300048906 Ga0496103_0114228 Ga0496103_0114228_132_992 281
1374 3300048907 Ga0496104_0147406 Ga0496104_0147406_886_1731 281
1375 3300048909 Ga0496106_0038192 Ga0496106_0038192_1446_2306 281
1376 3300048912 Ga0496109_0376911 Ga0496109_0376911_329_1174 281
1377 3300048912 Ga0496109_0436058 Ga0496109_0436058_165_1016 281
1378 3300048912 Ga0496109_0478565 Ga0496109_0478565_250_1110 281
1379 3300048913 Ga0496110_0000375 Ga0496110_0000375_20320_21171 281
1380 3300048913 Ga0496110_0003343 Ga0496110_0003343_4421_5272 281
1381 3300048913 Ga0496110_0207943 Ga0496110_0207943_179_1030 281
1382 3300048913 Ga0496110_0274967 Ga0496110_0274967_651_1496 281
1383 3300048914 Ga0496111_0009778 Ga0496111_0009778_4599_5450 281
1384 3300048915 Ga0496112_0001611 Ga0496112_0001611_12006_12857 281
1385 3300048915 Ga0496112_0007138 Ga0496112_0007138_1145_1990 281
1386 3300048915 Ga0496112_0035551 Ga0496112_0035551_2058_2903 281
1387 3300048915 Ga0496112_0245784 Ga0496112_0245784_811_1662 281
1388 3300048915 Ga0496112_0362635 Ga0496112_0362635_261_1127 281
1389 3300048916 Ga0496113_0099578 Ga0496113_0099578_25_870 281
1390 3300048916 Ga0496113_0468959 Ga0496113_0468959_40_885 281
1391 3300048918 Ga0496115_0002827 Ga0496115_0002827_8125_8973 281
1392 3300048929 Ga0496126_0128697 Ga0496126_0128697_979_1833 281
1393 3300049161 Ga0501305_004673 Ga0501305_004673_375_1226 281
1394 3300049161 Ga0501305_020982 Ga0501305_020982_16_867 281
1395 3300049521 Ga0501298_005044 Ga0501298_005044_1162_2007 281
1396 3300049522 Ga0501299_012445 Ga0501299_012445_265_1110 281
1397 3300049552 Ga0501336_000948 Ga0501336_000948_190_1041 281
1398 3300049570 Ga0501033_0199398 Ga0501033_0199398_204_1055 281
1399 3300049571 Ga0501034_0149391 Ga0501034_0149391_1002_1853 281
1400 3300049572 Ga0501036_0094733 Ga0501036_0094733_367_1212 281
1401 3300049573 Ga0501037_0029352 Ga0501037_0029352_966_1820 281
1402 3300049576 Ga0501040_0009603 Ga0501040_0009603_4976_5821 281
1403 3300049578 Ga0501042_0011877 Ga0501042_0011877_2672_3517 281
1404 3300049578 Ga0501042_0275893 Ga0501042_0275893_345_1196 281
1405 3300049581 Ga0501047_0000842 Ga0501047_0000842_24201_25052 281
1406 3300049581 Ga0501047_0136680 Ga0501047_0136680_657_1511 281
1407 3300049582 Ga0501048_0040171 Ga0501048_0040171_2351_3196 281
1408 3300049582 Ga0501048_0164702 Ga0501048_0164702_408_1265 281
1409 3300049583 Ga0501067_0018521 Ga0501067_0018521_1573_2433 281
1410 3300049584 Ga0501068_0010007 Ga0501068_0010007_1317_2177 281
1411 3300049586 Ga0501070_0093507 Ga0501070_0093507_870_1742 281
1412 3300049591 Ga0501075_0003015 Ga0501075_0003015_5904_6764 281
1413 3300049593 Ga0501077_0000012 Ga0501077_0000012_31067_31927 281
1414 3300049649 Ga0501198_000644 Ga0501198_000644_1968_2819 281
1415 3300049652 Ga0501202_000421 Ga0501202_000421_1385_2236 281
1416 3300049652 Ga0501202_016392 Ga0501202_016392_84_929 281
1417 3300049653 Ga0501206_017830 Ga0501206_017830_110_955 281
1418 3300049654 Ga0501207_000063 Ga0501207_000063_5865_6716 281
1419 3300049660 Ga0501216_004854 Ga0501216_004854_85_936 281
1420 3300049661 Ga0501217_037872 Ga0501217_037872_335_1180 281
1421 3300049664 Ga0501224_000404 Ga0501224_000404_568_1419 281
1422 3300049665 Ga0501227_000859 Ga0501227_000859_727_1578 281
1423 3300049665 Ga0501227_014153 Ga0501227_014153_808_1680 281
1424 3300049669 Ga0501235_011614 Ga0501235_011614_946_1791 281
1425 3300049673 Ga0501240_014945 Ga0501240_014945_72_923 281
1426 3300049674 Ga0501242_006512 Ga0501242_006512_450_1301 281
1427 3300049676 Ga0501246_005099 Ga0501246_005099_185_1030 281
1428 3300049677 Ga0501247_004673 Ga0501247_004673_137_982 281
1429 3300049686 Ga0501257_003394 Ga0501257_003394_574_1425 281
1430 3300049688 Ga0501259_001855 Ga0501259_001855_1546_2397 281
1431 3300049704 Ga0501221_015125 Ga0501221_015125_38_883 281
1432 3300049705 Ga0501225_0001584 Ga0501225_0001584_2497_3348 281
1433 3300049705 Ga0501225_0031701 Ga0501225_0031701_445_1332 281
1434 3300049708 Ga0501245_012808 Ga0501245_012808_12_857 281
1435 3300049741 Ga0501079_0049753 Ga0501079_0049753_2161_3006 281
1436 3300049742 Ga0501080_0151215 Ga0501080_0151215_630_1490 281
1437 3300049743 Ga0501081_0018724 Ga0501081_0018724_3385_4230 281
1438 3300049744 Ga0501083_0000164 Ga0501083_0000164_19217_20080 281
1439 3300049760 Ga0501263_002446 Ga0501263_002446_838_1725 281
1440 3300049822 Ga0501035_0003696 Ga0501035_0003696_12903_13754 281
1441 3300049822 Ga0501035_0081607 Ga0501035_0081607_704_1549 281
1442 3300049823 Ga0501044_0000734 Ga0501044_0000734_14989_15840 281
1443 3300049824 Ga0501045_0268687 Ga0501045_0268687_295_1152 281
1444 3300049851 Ga0501212_003055 Ga0501212_003055_1147_1998 281
1445 3300050507 nmdc:mga05p37_10079_c1 nmdc:mga05p37_10079_c1_2213_3085 281
1446 3300050507 nmdc:mga05p37_125437_c1 nmdc:mga05p37_125437_c1_782_1627 281
1447 3300050507 nmdc:mga05p37_162237_c1 nmdc:mga05p37_162237_c1_630_1514 281
1448 3300050507 nmdc:mga05p37_165938_c1 nmdc:mga05p37_165938_c1_1795_2646 281
1449 3300050507 nmdc:mga05p37_205445_c1 nmdc:mga05p37_205445_c1_408_1256 281
1450 3300050507 nmdc:mga05p37_26161_c1 nmdc:mga05p37_26161_c1_5631_6482 281
1451 3300050507 nmdc:mga05p37_33004_c1 nmdc:mga05p37_33004_c1_4230_5105 281
1452 3300050507 nmdc:mga05p37_335386_c1 nmdc:mga05p37_335386_c1_721_1599 281
1453 3300050507 nmdc:mga05p37_342220_c1 nmdc:mga05p37_342220_c1_96_950 281
1454 3300050507 nmdc:mga05p37_3703_c1 nmdc:mga05p37_3703_c1_10559_11404 281
1455 3300050507 nmdc:mga05p37_392954_c1 nmdc:mga05p37_392954_c1_295_1140 281
1456 3300050507 nmdc:mga05p37_412049_c1 nmdc:mga05p37_412049_c1_507_1373 281
1457 3300050507 nmdc:mga05p37_490172_c1 nmdc:mga05p37_490172_c1_428_1294 281
1458 3300050507 nmdc:mga05p37_513_c1 nmdc:mga05p37_513_c1_22800_23663 281
1459 3300050507 nmdc:mga05p37_52823_c1 nmdc:mga05p37_52823_c1_605_1456 281
1460 3300050508 nmdc:mga09592_108934_c1 nmdc:mga09592_108934_c1_1396_2241 281
1461 3300050508 nmdc:mga09592_144383_c1 nmdc:mga09592_144383_c1_953_1828 281
1462 3300050508 nmdc:mga09592_210978_c1 nmdc:mga09592_210978_c1_622_1467 281
1463 3300050508 nmdc:mga09592_257791_c1 nmdc:mga09592_257791_c1_397_1245 281
1464 3300050508 nmdc:mga09592_5355_c1 nmdc:mga09592_5355_c1_4431_5291 281
1465 3300050509 nmdc:mga0qj67_129469_c1 nmdc:mga0qj67_129469_c1_676_1524 281
1466 3300050509 nmdc:mga0qj67_133368_c1 nmdc:mga0qj67_133368_c1_338_1183 281
1467 3300050509 nmdc:mga0qj67_46657_c1 nmdc:mga0qj67_46657_c1_948_1793 281
1468 3300050509 nmdc:mga0qj67_504783_c1 nmdc:mga0qj67_504783_c1_22_906 281
1469 3300050509 nmdc:mga0qj67_7191_c1 nmdc:mga0qj67_7191_c1_6315_7187 281
1470 3300050509 nmdc:mga0qj67_72562_c1 nmdc:mga0qj67_72562_c1_1401_2246 281
1471 3300050510 nmdc:mga06r32_116313_c1 nmdc:mga06r32_116313_c1_183_1061 281
1472 3300050510 nmdc:mga06r32_14286_c1 nmdc:mga06r32_14286_c1_1442_2293 281
1473 3300050510 nmdc:mga06r32_15459_c1 nmdc:mga06r32_15459_c1_4912_5784 281
1474 3300050510 nmdc:mga06r32_176997_c1 nmdc:mga06r32_176997_c1_501_1349 281
1475 3300050510 nmdc:mga06r32_206883_c1 nmdc:mga06r32_206883_c1_819_1685 281
1476 3300050510 nmdc:mga06r32_2293_c1 nmdc:mga06r32_2293_c1_4686_5534 281
1477 3300050510 nmdc:mga06r32_261886_c1 nmdc:mga06r32_261886_c1_569_1417 281
1478 3300050510 nmdc:mga06r32_2819_c1 nmdc:mga06r32_2819_c1_5646_6506 281
1479 3300050510 nmdc:mga06r32_57083_c1 nmdc:mga06r32_57083_c1_2823_3683 281
1480 3300050511 nmdc:mga08y16_11031_c1 nmdc:mga08y16_11031_c1_6165_7046 281
1481 3300050511 nmdc:mga08y16_16384_c1 nmdc:mga08y16_16384_c1_2827_3672 281
1482 3300050511 nmdc:mga08y16_170747_c1 nmdc:mga08y16_170747_c1_145_990 281
1483 3300050511 nmdc:mga08y16_385303_c1 nmdc:mga08y16_385303_c1_153_998 281
1484 3300050511 nmdc:mga08y16_4691_c1 nmdc:mga08y16_4691_c1_3154_4137 281
1485 3300050511 nmdc:mga08y16_543114_c1 nmdc:mga08y16_543114_c1_15_875 281
1486 3300050511 nmdc:mga08y16_65874_c1 nmdc:mga08y16_65874_c1_2802_3656 281
1487 3300050511 nmdc:mga08y16_8504_c1 nmdc:mga08y16_8504_c1_6735_7634 281
1488 3300050511 nmdc:mga08y16_89790_c1 nmdc:mga08y16_89790_c1_1799_2695 281
1489 3300050511 nmdc:mga08y16_96584_c1 nmdc:mga08y16_96584_c1_718_1593 281
1490 3300050511 nmdc:mga08y16_972_c1 nmdc:mga08y16_972_c1_9715_10584 281
1491 3300050512 nmdc:mga0n895_10005_c1 nmdc:mga0n895_10005_c1_2913_3764 281
1492 3300050512 nmdc:mga0n895_112264_c1 nmdc:mga0n895_112264_c1_1847_2692 281
1493 3300050512 nmdc:mga0n895_12360_c1 nmdc:mga0n895_12360_c1_6770_7618 281
1494 3300050512 nmdc:mga0n895_12780_c1 nmdc:mga0n895_12780_c1_2270_3121 281
1495 3300050512 nmdc:mga0n895_191271_c1 nmdc:mga0n895_191271_c1_792_1643 281
1496 3300050512 nmdc:mga0n895_291352_c1 nmdc:mga0n895_291352_c1_198_1064 281
1497 3300050512 nmdc:mga0n895_308232_c1 nmdc:mga0n895_308232_c1_596_1546 281
1498 3300050512 nmdc:mga0n895_34461_c1 nmdc:mga0n895_34461_c1_1848_2693 281
1499 3300050512 nmdc:mga0n895_34518_c1 nmdc:mga0n895_34518_c1_3338_4210 281
1500 3300050512 nmdc:mga0n895_676979_c1 nmdc:mga0n895_676979_c1_126_971 281
1501 3300050512 nmdc:mga0n895_7620_c1 nmdc:mga0n895_7620_c1_53_913 281
1502 3300050513 nmdc:mga0rr50_107229_c1 nmdc:mga0rr50_107229_c1_916_1761 281
1503 3300050513 nmdc:mga0rr50_142696_c1 nmdc:mga0rr50_142696_c1_960_1850 281
1504 3300050513 nmdc:mga0rr50_246_c1 nmdc:mga0rr50_246_c1_18711_19613 281
1505 3300050513 nmdc:mga0rr50_93806_c1 nmdc:mga0rr50_93806_c1_151_996 281
1506 3300050514 nmdc:mga08x19_13_c1 nmdc:mga08x19_13_c1_52973_53875 281
1507 3300050514 nmdc:mga08x19_252861_c1 nmdc:mga08x19_252861_c1_183_1028 281
1508 3300050514 nmdc:mga08x19_48_c1 nmdc:mga08x19_48_c1_14242_15102 281
1509 3300050515 nmdc:mga0a205_109520_c1 nmdc:mga0a205_109520_c1_1062_1907 281
1510 3300050515 nmdc:mga0a205_146809_c1 nmdc:mga0a205_146809_c1_464_1309 281
1511 3300050515 nmdc:mga0a205_24963_c1 nmdc:mga0a205_24963_c1_4805_5650 281
1512 3300050515 nmdc:mga0a205_276288_c1 nmdc:mga0a205_276288_c1_195_1040 281
1513 3300050515 nmdc:mga0a205_30286_c1 nmdc:mga0a205_30286_c1_4019_5074 281
1514 3300050515 nmdc:mga0a205_3651_c1 nmdc:mga0a205_3651_c1_2169_3020 281
1515 3300050515 nmdc:mga0a205_60217_c2 nmdc:mga0a205_60217_c2_652_1497 281
1516 3300050515 nmdc:mga0a205_64323_c1 nmdc:mga0a205_64323_c1_2314_3264 281
1517 3300053080 Ga0500635_0001461 Ga0500635_0001461_3349_4224 281
1518 3300053085 Ga0495619_0023892 Ga0495619_0023892_666_1562 281
1519 3300053094 Ga0500566_0003319 Ga0500566_0003319_4420_5295 281
1520 3300053129 Ga0500628_000285 Ga0500628_000285_3761_4621 281
1521 3300053144 Ga0500585_037085 Ga0500585_037085_721_1596 281
1522 3300059421 Ga0590071_024473 Ga0590071_024473_236_1084 281
1523 3300060353 Ga0501082_0000054 Ga0501082_0000054_70916_71776 281
1524 3300060353 Ga0501082_0019509 Ga0501082_0019509_2413_3258 281
1525 3300061734 Ga0530510_0024090 Ga0530510_0024090_2807_3652 281
1526 3300061734 Ga0530510_0188966 Ga0530510_0188966_164_1021 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

184

280

1

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

4

182

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fgp-assembly1.cif.gz_B crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9938 2 33
6aa8-assembly1.cif.gz_F crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ 0.9914 3 281
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9888 4 33
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9885 3 33
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9881 3 33
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.003 5 33 3.50.50.60
4pzdE02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1.002 193 277 1.10.1040.10
4pzdB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1.001 193 277 1.10.1040.10
4kueA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1 193 277 1.10.1040.10
6acqA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1 193 277 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A519PEM2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 1.005 190 281 GO:0006631
GO:0008691
AF-A0A0C9T8E5-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase C-terminal domain-containing protein 1.004 194 281 GO:0006631
GO:0016616
AF-H9V6S3-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase C-terminal domain-containing protein 1.003 190 281 GO:0006631
GO:0016616
AF-A0A3B9B4L3-F1-model_v4 deleted 1.002 189 281
AF-A0A257ZI86-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 1.001 171 281 GO:0006631
GO:0016616

Feature Viewer

pLDDT pTM Quality
97.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map