F494543

General Info

Members Datasets Scaffolds Average Seq Length
1522 594 1447 252

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100651167|Ga0307416_1006511671
Length 297
Sequence VAIRARILDRTPFRATSFTDVTHLKDLPLHTLQFYATAPYPCSYLPDRQARSQVATPSHLIHNDAYSDLVLSGFRRSGMFTYRPYCDGCRACIPLRVLANSFRPTRSQRRAAKQHSDLQARVLKLCFVPEHYQLYLRYQNGRHAGGGMDHDSIDQYTQFLLQSRVNSRLVEFRETLADGSAGALKMVSILDVLNDGISAVYTFYEPDARAAPGHPKQANGLLGEQQEQAVPSVGTSSTGYGTYSVLWQIEQARKLGLPHVYLGYWIERSPKMHYKARFSPHEVLVDGHWQPSSDFTR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
13 2643221570 Acidovorax sp. Root568 Isolate Unclassified
14 2643221585 Pelomonas sp. Root662 Isolate Unclassified
15 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
16 2643221596 Acidovorax sp. Root70 Isolate Unclassified
17 2643221609 Acidovorax sp. Root217 Isolate Unclassified
18 2643221611 Acidovorax sp. Root219 Isolate Unclassified
19 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
20 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
21 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
22 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
23 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
24 2643221652 Acidovorax sp. Root402 Isolate Unclassified
25 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
26 2643221656 Pelomonas sp. Root405 Isolate Unclassified
27 2643221658 Variovorax sp. Root411 Isolate Unclassified
28 2643221660 Methylibium sp. Root1272 Isolate Unclassified
29 2643221672 Variovorax sp. Root434 Isolate Unclassified
30 2643221683 Variovorax sp. Root473 Isolate Unclassified
31 2643221717 Acidovorax sp. Root267 Isolate Unclassified
32 2721755523 Delftia sp. HK171 Isolate Unclassified
33 2738541277 Variovorax sp. GV051 Isolate Unclassified
34 2738541307 Variovorax sp. GV008 Isolate Unclassified
35 2738541337 Pelomonas sp. BT06 Isolate Unclassified
36 2738543012 Acidovorax sp. CF301 Isolate Unclassified
37 2738543013 Variovorax sp. BT01 Isolate Unclassified
38 2738543019 Variovorax sp. GV040 Isolate Unclassified
39 2816332133 Acidovorax radicis 2721A Isolate Unclassified
40 2818991446 Variovorax sp. 1180 Isolate Unclassified
41 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
42 2831864461 Roseateles noduli HZ7 Isolate Nodule
43 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
44 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
45 2842677519 Variovorax sp. R-72495 Isolate Unclassified
46 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
47 2842733646 Variovorax sp. R-72446 Isolate Unclassified
48 2842747753 Variovorax sp. R-72060 Isolate Unclassified
49 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
50 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
51 2885198086 Variovorax sp. 679 Isolate Unclassified
52 2885211737 Variovorax sp. 553 Isolate Unclassified
53 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
54 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
55 2899924645 Variovorax sp. 369 Isolate Unclassified
56 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
57 2904456579 Variovorax sp. 2002 Isolate Unclassified
58 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
59 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
60 2928037797 Variovorax sp. 1126 Isolate Unclassified
61 2928044640 Variovorax sp. 1128 Isolate Unclassified
62 2928051484 Variovorax sp. 1133 Isolate Unclassified
63 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
64 2928070936 Variovorax gossypii 1167 Isolate Unclassified
65 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
66 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
67 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
68 2929520902 Variovorax beijingensis 502 Isolate Unclassified
69 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
70 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
71 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
72 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
73 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
74 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
75 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
76 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
77 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
78 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
79 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
80 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
81 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
82 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
83 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
84 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
87 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
88 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
89 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
90 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
91 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
92 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
93 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
94 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
95 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
96 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
97 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
98 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
99 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
100 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
101 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
102 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
103 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
104 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
105 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
109 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
110 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
111 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
112 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
113 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
114 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
115 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
116 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
117 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
118 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
119 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
120 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
121 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
122 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
123 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
124 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
125 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
126 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
127 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
128 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
129 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
130 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
131 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
132 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
133 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
134 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
135 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
139 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
140 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
143 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
146 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
147 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
148 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
149 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
150 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
151 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
152 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
153 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
156 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
157 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
158 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
159 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
160 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
161 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
162 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
163 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
164 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
165 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
166 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
167 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
168 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
169 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
170 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
171 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
172 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
173 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
174 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
175 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
176 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
177 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
178 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
179 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
181 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
182 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
183 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
184 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
185 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
187 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
188 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
189 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
190 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
202 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
203 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
204 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
205 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
206 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
207 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
215 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
216 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
217 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
218 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
219 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
220 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
221 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
222 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
223 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
224 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
225 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
226 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
231 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
233 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
234 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
235 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
238 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
239 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
246 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
248 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
251 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
312 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
314 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
316 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
317 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
322 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
323 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
324 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
325 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
326 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
327 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
328 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
329 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
330 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
331 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
332 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
333 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
334 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
335 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
336 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
337 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
338 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
339 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
340 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
341 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
342 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
343 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
344 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
345 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
346 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
347 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
348 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
349 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
350 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
351 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
352 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
353 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
354 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
355 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
356 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
357 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
358 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
359 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
360 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
361 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
362 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
363 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
364 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
365 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
366 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
367 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
368 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
369 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
370 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
371 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
372 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
373 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
374 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
375 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
376 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
377 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
378 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
379 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
380 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
381 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
382 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
383 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
384 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
385 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
386 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
387 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
388 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
389 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
390 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
391 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
392 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
393 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
394 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
395 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
396 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
397 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
398 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
399 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
400 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
401 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
402 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
403 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
404 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
405 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
406 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
407 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
408 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
409 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
410 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
411 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
412 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
413 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
414 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
415 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
416 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
417 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
418 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
419 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
420 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
421 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
422 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
423 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
424 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
425 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
426 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
427 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
428 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
429 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
430 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
431 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
432 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
433 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
434 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
435 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
436 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
437 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
438 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
439 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
440 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
441 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
442 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
443 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
444 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
445 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
449 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
450 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
451 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
452 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
453 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
454 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
455 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
456 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
457 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
458 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
459 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
460 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
461 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
462 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
463 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
464 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
465 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
466 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
467 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
468 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
469 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
470 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
471 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
472 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
473 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
474 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
475 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
476 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
477 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
478 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
479 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
480 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
481 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
482 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
483 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
484 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
485 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
486 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
487 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
488 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
489 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
490 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
491 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
492 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
493 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
494 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
495 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
496 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
497 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
498 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
499 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
500 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
501 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
502 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
503 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
504 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
505 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
506 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
507 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
508 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
509 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
510 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
511 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
512 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
513 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
514 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
515 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
516 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
517 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
518 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
519 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
520 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
521 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
522 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
524 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
525 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
532 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
533 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
534 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
535 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
536 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
537 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
538 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
539 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
540 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
541 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
542 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
543 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
544 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
545 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
546 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
547 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
548 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
549 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
550 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
551 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
552 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
553 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
554 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
555 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
556 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
557 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
558 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
559 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
560 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
561 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
562 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
563 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
564 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
565 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
566 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
567 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
568 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
569 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
570 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
571 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
572 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
573 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
574 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
575 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
576 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
577 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
578 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
579 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
580 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
581 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
582 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
583 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
584 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
585 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
586 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
587 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
588 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
589 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
590 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
591 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
592 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
593 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
594 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0.13
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.84
Nodule 0.72
Rhizoplane 2.76
Rhizosphere 61.3
Stem 0
Stem Tuber 0
Unclassified 10.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006036 3300001979 Bacteria 5064
2 JGI25156J39149_1000023 3300002705 Bacteria 146831
3 JGI25156J39149_1000076 3300002705 Bacteria 76265
4 JGI25156J39149_1020167 3300002705 Bacteria 1182
5 JGI25154J39366_1000036 3300002738 Bacteria 161697
6 JGI25154J39366_1003428 3300002738 Bacteria 3334
7 JGI25157J39369_1000023 3300002741 Bacteria 161697
8 JGI25157J39369_1000037 3300002741 Bacteria 131578
9 JGI25152J39213_1003031 3300002773 Bacteria 5931
10 JGI25150J39212_1000786 3300002774 Bacteria 10849
11 JGI25150J39212_1000926 3300002774 Bacteria 9519
12 JGI25150J39212_1004277 3300002774 Bacteria 3200
13 JGI25150J39212_1018853 3300002774 Bacteria 1092
14 JGI25159J45721_1001003 3300002987 Bacteria 12169
15 JGI25159J45721_1001012 3300002987 Bacteria 12115
16 JGI25159J45721_1003283 3300002987 Bacteria 5788
17 JGI25159J45721_1005159 3300002987 Bacteria 4138
18 JGI25151J46595_10006139 3300003187 Bacteria 6093
19 JGI25151J46595_10006404 3300003187 Bacteria 5919
20 JGI25151J46595_10007826 3300003187 Bacteria 5196
21 JGI25151J46595_10011776 3300003187 Bacteria 4007
22 JGI25153J46596_10001674 3300003215 Bacteria 13142
23 JGI25153J46596_10004013 3300003215 Bacteria 8029
24 JGI25153J46596_10006457 3300003215 Bacteria 5919
25 rootH1_10011082 3300003316 Bacteria 8546
26 rootH1_10011082 3300003323 Bacteria 4834
27 rootH1_10027198 3300003316 Bacteria 2915
28 rootH1_10027198 3300003323 Bacteria 7953
29 rootH2_10074078 3300003320 Bacteria 2171
30 rootL2_10001938 3300003322 Bacteria 15746
31 rootL2_10006242 3300003322 Bacteria 24377
32 rootL2_10044024 3300003322 Bacteria 1320
33 rootH1_10129911 3300003323 Bacteria 2585
34 JGI25160J50197_1000213 3300003354 Bacteria 47438
35 JGI25160J50197_1004586 3300003354 Bacteria 5950
36 JGI25160J50197_1004770 3300003354 Bacteria 5788
37 JGI25161J50226_1000015 3300003374 Bacteria 183773
38 JGI25161J50226_1001902 3300003374 Bacteria 5790
39 JGI25161J50226_1007034 3300003374 Bacteria 1949
40 Ga0006562J51391_1011384 3300003578 Bacteria 2760
41 Ga0055539_1000180 3300003752 Bacteria 53702
42 Ga0055539_1003887 3300003752 Bacteria 2029
43 Ga0055533_1000169 3300003756 Bacteria 59989
44 Ga0055525_1000011 3300003759 Bacteria 503124
45 Ga0055525_1000046 3300003759 Bacteria 261587
46 Ga0055525_1000526 3300003759 Bacteria 18471
47 Ga0055535_1000177 3300003761 Bacteria 68502
48 Ga0055535_1000364 3300003761 Bacteria 43640
49 Ga0055542_1000114 3300003762 Bacteria 107058
50 Ga0055529_1000346 3300003763 Bacteria 51499
51 Ga0055526_1001196 3300003771 Bacteria 18739
52 Ga0055526_1001574 3300003771 Bacteria 16051
53 Ga0055526_1003300 3300003771 Bacteria 10343
54 Ga0055526_1007041 3300003771 Bacteria 5948
55 Ga0055526_1007087 3300003771 Bacteria 5919
56 Ga0055526_1007561 3300003771 Bacteria 5614
57 Ga0055537_1000034 3300003773 Bacteria 98043
58 Ga0055537_1000484 3300003773 Bacteria 24629
59 Ga0055537_1000706 3300003773 Bacteria 17336
60 Ga0055537_1002598 3300003773 Bacteria 5919
61 Ga0055537_1004288 3300003773 Bacteria 4111
62 Ga0055524_1000016 3300003775 Bacteria 244926
63 Ga0055524_1000182 3300003775 Bacteria 70730
64 Ga0055524_1000595 3300003775 Bacteria 26127
65 Ga0055524_1005088 3300003775 Bacteria 5948
66 Ga0055524_1005130 3300003775 Bacteria 5919
67 Ga0055536_1001639 3300003781 Bacteria 13320
68 Ga0055536_1002703 3300003781 Bacteria 9841
69 Ga0055536_1003538 3300003781 Bacteria 8362
70 Ga0055536_1008603 3300003781 Bacteria 4355
71 Ga0055536_1036564 3300003781 Bacteria 1213
72 Ga0055534_1000406 3300003784 Bacteria 26436
73 Ga0055534_1001233 3300003784 Bacteria 10619
74 Ga0055534_1001253 3300003784 Bacteria 10465
75 Ga0055534_1002208 3300003784 Bacteria 6908
76 Ga0055534_1002991 3300003784 Bacteria 5569
77 Ga0055528_1000813 3300003790 Bacteria 21449
78 Ga0055528_1002347 3300003790 Bacteria 10240
79 Ga0055528_1005459 3300003790 Bacteria 5919
80 Ga0055528_1009318 3300003790 Bacteria 4111
81 Ga0055530_10000243 3300003791 Bacteria 49150
82 Ga0055530_10000777 3300003791 Bacteria 26621
83 Ga0055530_10003939 3300003791 Bacteria 8036
84 Ga0055530_10005794 3300003791 Bacteria 5736
85 Ga0055540_1000031 3300003792 Bacteria 177859
86 Ga0055540_1000233 3300003792 Bacteria 51303
87 Ga0055540_1001252 3300003792 Bacteria 15535
88 Ga0055540_1001662 3300003792 Bacteria 12890
89 Ga0055540_1002289 3300003792 Bacteria 10317
90 Ga0055540_1011016 3300003792 Bacteria 2955
91 Ga0055540_1031528 3300003792 Bacteria 1217
92 Ga0055531_10000172 3300003794 Bacteria 72762
93 Ga0055531_10000358 3300003794 Bacteria 44456
94 Ga0055531_10002682 3300003794 Bacteria 11725
95 Ga0055531_10005309 3300003794 Bacteria 7562
96 Ga0055531_10005963 3300003794 Bacteria 7002
97 Ga0055531_10006250 3300003794 Bacteria 6799
98 Ga0055531_10028801 3300003794 Bacteria 1906
99 Ga0055543_1000608 3300004625 Bacteria 19383
100 Ga0055543_1000748 3300004625 Bacteria 16355
101 Ga0055543_1005165 3300004625 Bacteria 3386
102 Ga0055543_1015830 3300004625 Bacteria 1444
103 Ga0065165_1000181 3300005262 Bacteria 110867
104 Ga0065165_1000230 3300005262 Bacteria 97470
105 Ga0065165_1001066 3300005262 Bacteria 32802
106 Ga0065165_1003702 3300005262 Bacteria 10364
107 Ga0065165_1019433 3300005262 Bacteria 2425
108 Ga0065165_1021019 3300005262 Bacteria 2277
109 Ga0065704_10118735 3300005289 Bacteria 1810
110 Ga0065707_10085220 3300005295 Bacteria 6339
111 Ga0070658_10037209 3300005327 Bacteria 3922
112 Ga0070658_10228945 3300005327 Bacteria 1573
113 Ga0070676_10014095 3300005328 Bacteria 4388
114 Ga0070676_10109041 3300005328 Bacteria 1721
115 Ga0070683_100007080 3300005329 Bacteria 9445
116 Ga0070690_100000674 3300005330 Bacteria 17423
117 Ga0070690_100096685 3300005330 Bacteria 1952
118 Ga0070670_100001588 3300005331 Bacteria 18336
119 Ga0070670_100007193 3300005331 Bacteria 9425
120 Ga0070670_100042246 3300005331 Bacteria 3919
121 Ga0070670_100137157 3300005331 Bacteria 2114
122 Ga0070670_100146701 3300005331 Bacteria 2041
123 Ga0070677_10000616 3300005333 Bacteria 11978
124 Ga0070677_10011451 3300005333 Bacteria 3059
125 Ga0068869_100009616 3300005334 Bacteria 6280
126 Ga0068869_100020870 3300005334 Bacteria 4499
127 Ga0068869_100079183 3300005334 Bacteria 2449
128 Ga0068869_100160705 3300005334 Bacteria 1749
129 Ga0068869_100490802 3300005334 Bacteria 1024
130 Ga0070666_10006295 3300005335 Bacteria 7300
131 Ga0070666_10114086 3300005335 Bacteria 1870
132 Ga0070666_10335833 3300005335 Bacteria 1079
133 Ga0070680_100002051 3300005336 Bacteria 14856
134 Ga0070682_100172320 3300005337 Bacteria 1505
135 Ga0068868_100001668 3300005338 Bacteria 15169
136 Ga0068868_100003096 3300005338 Bacteria 11572
137 Ga0068868_100003572 3300005338 Bacteria 10831
138 Ga0068868_100127576 3300005338 Bacteria 2079
139 Ga0070660_100008509 3300005339 Bacteria 7179
140 Ga0070660_100027599 3300005339 Bacteria 4238
141 Ga0070660_100062158 3300005339 Bacteria 2900
142 Ga0070689_100116230 3300005340 Bacteria 2133
143 Ga0070691_10211197 3300005341 Bacteria 1024
144 Ga0070687_100020311 3300005343 Bacteria 3104
145 Ga0070661_100002048 3300005344 Bacteria 13895
146 Ga0070661_100031099 3300005344 Bacteria 3859
147 Ga0070661_100214500 3300005344 Bacteria 1474
148 Ga0070692_10208835 3300005345 Bacteria 1148
149 Ga0070668_100023518 3300005347 Bacteria 4661
150 Ga0070668_100065066 3300005347 Bacteria 2828
151 Ga0070668_100121311 3300005347 Bacteria 2090
152 Ga0070669_100055294 3300005353 Bacteria 2908
153 Ga0070669_100099413 3300005353 Bacteria 2193
154 Ga0070669_100103198 3300005353 Bacteria 2154
155 Ga0070675_100000941 3300005354 Bacteria 20742
156 Ga0070675_100002761 3300005354 Bacteria 13196
157 Ga0070675_100012995 3300005354 Bacteria 6538
158 Ga0070675_100025238 3300005354 Bacteria 4764
159 Ga0070675_100028517 3300005354 Bacteria 4493
160 Ga0070675_100059896 3300005354 Bacteria 3142
161 Ga0070675_100217028 3300005354 Bacteria 1664
162 Ga0070675_100297307 3300005354 Bacteria 1422
163 Ga0070671_100005745 3300005355 Bacteria 9880
164 Ga0070671_100011544 3300005355 Bacteria 7104
165 Ga0070671_100054749 3300005355 Bacteria 3317
166 Ga0070671_100070434 3300005355 Bacteria 2917
167 Ga0070674_100023714 3300005356 Bacteria 3975
168 Ga0070674_100053542 3300005356 Bacteria 2787
169 Ga0070674_100114654 3300005356 Bacteria 1985
170 Ga0070673_100001255 3300005364 Bacteria 14729
171 Ga0070673_100003101 3300005364 Bacteria 10291
172 Ga0070673_100004666 3300005364 Bacteria 8699
173 Ga0070673_100035122 3300005364 Bacteria 3799
174 Ga0070673_100072816 3300005364 Bacteria 2764
175 Ga0070673_100483671 3300005364 Bacteria 1118
176 Ga0070688_100011717 3300005365 Bacteria 4886
177 Ga0070688_100238868 3300005365 Bacteria 1288
178 Ga0070659_100000684 3300005366 Bacteria 24663
179 Ga0070659_100021253 3300005366 Bacteria 4938
180 Ga0070659_100036638 3300005366 Bacteria 3824
181 Ga0070659_100116188 3300005366 Bacteria 2163
182 Ga0070667_100002698 3300005367 Bacteria 15368
183 Ga0070667_100004949 3300005367 Bacteria 11163
184 Ga0070667_100021567 3300005367 Bacteria 5347
185 Ga0070667_100083474 3300005367 Bacteria 2737
186 Ga0070667_100141133 3300005367 Bacteria 2110
187 Ga0070667_100171475 3300005367 Bacteria 1916
188 Ga0070667_100192436 3300005367 Bacteria 1807
189 Ga0070667_100203620 3300005367 Bacteria 1757
190 Ga0070667_100238931 3300005367 Bacteria 1621
191 Ga0070667_100272803 3300005367 Bacteria 1517
192 Ga0070714_100247327 3300005435 Bacteria 1648
193 Ga0070713_101274416 3300005436 Bacteria 712
194 Ga0070700_100015415 3300005441 Bacteria 4333
195 Ga0070700_100210155 3300005441 Bacteria 1372
196 Ga0070663_100000172 3300005455 Bacteria 32702
197 Ga0070663_100023744 3300005455 Bacteria 4115
198 Ga0070663_100371403 3300005455 Bacteria 1163
199 Ga0070678_100049891 3300005456 Bacteria 3023
200 Ga0070678_100083026 3300005456 Bacteria 2434
201 Ga0070678_100110138 3300005456 Bacteria 2153
202 Ga0070678_100156816 3300005456 Bacteria 1840
203 Ga0070678_100197838 3300005456 Bacteria 1657
204 Ga0070678_100378795 3300005456 Bacteria 1224
205 Ga0070662_100000858 3300005457 Bacteria 18683
206 Ga0070662_100013398 3300005457 Bacteria 5456
207 Ga0070662_100055488 3300005457 Bacteria 2874
208 Ga0070662_100089516 3300005457 Bacteria 2308
209 Ga0068867_100000070 3300005459 Bacteria 61892
210 Ga0068867_100000587 3300005459 Bacteria 24119
211 Ga0068867_100035855 3300005459 Bacteria 3599
212 Ga0068867_100075085 3300005459 Bacteria 2535
213 Ga0068867_100079661 3300005459 Bacteria 2465
214 Ga0068867_100708956 3300005459 Bacteria 889
215 Ga0070685_10088868 3300005466 Bacteria 1867
216 Ga0070685_10301435 3300005466 Bacteria 1080
217 Ga0070706_100012812 3300005467 Bacteria 7761
218 Ga0070706_100780930 3300005467 Bacteria 884
219 Ga0070707_100034845 3300005468 Bacteria 4800
220 Ga0070679_100006631 3300005530 Bacteria 10794
221 Ga0070684_100031525 3300005535 Bacteria 4513
222 Ga0070684_100070877 3300005535 Bacteria 3068
223 Ga0068853_100014437 3300005539 Bacteria 6467
224 Ga0068853_100055955 3300005539 Bacteria 3400
225 Ga0068853_100071386 3300005539 Bacteria 3024
226 Ga0068853_100127746 3300005539 Bacteria 2272
227 Ga0068853_100218231 3300005539 Bacteria 1741
228 Ga0068853_100484200 3300005539 Bacteria 1167
229 Ga0068853_100484281 3300005539 Bacteria 1166
230 Ga0068853_100523590 3300005539 Bacteria 1121
231 Ga0068853_100547719 3300005539 Bacteria 1096
232 Ga0068853_100641456 3300005539 Bacteria 1010
233 Ga0068853_100913355 3300005539 Bacteria 843
234 Ga0070672_100000249 3300005543 Bacteria 30273
235 Ga0070672_100004411 3300005543 Bacteria 9209
236 Ga0070672_100006413 3300005543 Bacteria 7908
237 Ga0070672_100009784 3300005543 Bacteria 6624
238 Ga0070672_100031950 3300005543 Bacteria 3968
239 Ga0070672_100073981 3300005543 Bacteria 2717
240 Ga0070672_100081573 3300005543 Bacteria 2593
241 Ga0070672_100089667 3300005543 Bacteria 2478
242 Ga0070672_100089747 3300005543 Bacteria 2477
243 Ga0070672_100155866 3300005543 Bacteria 1892
244 Ga0070672_100232637 3300005543 Bacteria 1548
245 Ga0070686_100338066 3300005544 Bacteria 1127
246 Ga0070665_100011217 3300005548 Bacteria 9061
247 Ga0070665_100015059 3300005548 Bacteria 7763
248 Ga0070665_100063615 3300005548 Bacteria 3699
249 Ga0070665_100128052 3300005548 Bacteria 2541
250 Ga0070665_100350953 3300005548 Bacteria 1481
251 Ga0068855_100002721 3300005563 Bacteria 21787
252 Ga0068855_100012472 3300005563 Bacteria 10258
253 Ga0068855_100097782 3300005563 Bacteria 3382
254 Ga0068855_100556656 3300005563 Bacteria 1241
255 Ga0068855_100584798 3300005563 Bacteria 1205
256 Ga0070664_100005782 3300005564 Bacteria 9976
257 Ga0070664_100011468 3300005564 Bacteria 7193
258 Ga0070664_100032384 3300005564 Bacteria 4372
259 Ga0070664_100083753 3300005564 Bacteria 2752
260 Ga0070664_100227897 3300005564 Bacteria 1669
261 Ga0068857_100001142 3300005577 Bacteria 20694
262 Ga0068857_100049769 3300005577 Bacteria 3717
263 Ga0068857_100056777 3300005577 Bacteria 3475
264 Ga0068857_100076126 3300005577 Bacteria 2992
265 Ga0068857_100084990 3300005577 Bacteria 2827
266 Ga0068857_100136013 3300005577 Bacteria 2219
267 Ga0068857_100343629 3300005577 Bacteria 1381
268 Ga0068854_100002016 3300005578 Bacteria 12432
269 Ga0068854_100149663 3300005578 Bacteria 1799
270 Ga0068854_100248759 3300005578 Bacteria 1419
271 Ga0068854_100311665 3300005578 Bacteria 1276
272 Ga0068856_100005635 3300005614 Bacteria 12324
273 Ga0068856_100068699 3300005614 Bacteria 3503
274 Ga0068856_100071680 3300005614 Bacteria 3430
275 Ga0068856_100443349 3300005614 Bacteria 1319
276 Ga0068856_100715511 3300005614 Bacteria 1022
277 Ga0070702_100080844 3300005615 Bacteria 1946
278 Ga0068852_100002789 3300005616 Bacteria 12102
279 Ga0068852_100007651 3300005616 Bacteria 7899
280 Ga0068852_100162604 3300005616 Bacteria 2086
281 Ga0068852_100171428 3300005616 Bacteria 2034
282 Ga0068852_100278126 3300005616 Bacteria 1613
283 Ga0068852_100555415 3300005616 Bacteria 1149
284 Ga0068859_100002993 3300005617 Bacteria 17130
285 Ga0068859_100041965 3300005617 Bacteria 4595
286 Ga0068859_100055554 3300005617 Bacteria 3984
287 Ga0068859_100329974 3300005617 Bacteria 1620
288 Ga0068864_100006013 3300005618 Bacteria 9963
289 Ga0068864_100006058 3300005618 Bacteria 9923
290 Ga0068864_100013588 3300005618 Bacteria 6749
291 Ga0068864_100122122 3300005618 Bacteria 2330
292 Ga0068864_100160401 3300005618 Bacteria 2044
293 Ga0068866_10018175 3300005718 Bacteria 3174
294 Ga0068861_100003493 3300005719 Bacteria 10439
295 Ga0068861_100021625 3300005719 Bacteria 4625
296 Ga0068861_100038355 3300005719 Bacteria 3566
297 Ga0068861_100159011 3300005719 Bacteria 1862
298 Ga0068861_100197171 3300005719 Bacteria 1687
299 Ga0068851_10059788 3300005834 Bacteria 1950
300 Ga0068851_10101715 3300005834 Bacteria 1526
301 Ga0068863_100001479 3300005841 Bacteria 23291
302 Ga0068863_100010184 3300005841 Bacteria 9142
303 Ga0068863_100052311 3300005841 Bacteria 3871
304 Ga0068863_100202960 3300005841 Bacteria 1907
305 Ga0068863_100261287 3300005841 Bacteria 1674
306 Ga0068858_100001164 3300005842 Bacteria 27258
307 Ga0068858_100003457 3300005842 Bacteria 15673
308 Ga0068858_100007880 3300005842 Bacteria 10270
309 Ga0068858_100239145 3300005842 Bacteria 1722
310 Ga0068858_100347806 3300005842 Bacteria 1420
311 Ga0068858_100441145 3300005842 Bacteria 1254
312 Ga0068860_100001400 3300005843 Bacteria 26146
313 Ga0068860_100010521 3300005843 Bacteria 9145
314 Ga0068860_100027642 3300005843 Bacteria 5461
315 Ga0068860_100147158 3300005843 Bacteria 2267
316 Ga0068860_100310715 3300005843 Bacteria 1546
317 Ga0068860_100494552 3300005843 Bacteria 1220
318 Ga0068862_100005708 3300005844 Bacteria 10383
319 Ga0068862_100046531 3300005844 Bacteria 3701
320 Ga0068862_100071372 3300005844 Bacteria 2998
321 Ga0068862_100294454 3300005844 Bacteria 1491
322 Ga0075365_10004092 3300006038 Bacteria 7664
323 Ga0075365_10096068 3300006038 Bacteria 2025
324 Ga0075365_10174636 3300006038 Bacteria 1500
325 Ga0075365_10247416 3300006038 Bacteria 1252
326 Ga0075365_10286431 3300006038 Bacteria 1159
327 Ga0075365_10344941 3300006038 Bacteria 1049
328 Ga0075368_10015034 3300006042 Bacteria 2865
329 Ga0075363_100004278 3300006048 Bacteria 6209
330 Ga0075363_100078873 3300006048 Bacteria 1798
331 Ga0075363_100134428 3300006048 Bacteria 1389
332 Ga0075364_10012737 3300006051 Bacteria 5157
333 Ga0075364_10022939 3300006051 Bacteria 3947
334 Ga0075364_10346540 3300006051 Bacteria 1012
335 Ga0075432_10007755 3300006058 Bacteria 3659
336 Ga0075432_10008480 3300006058 Bacteria 3506
337 Ga0075432_10050686 3300006058 Bacteria 1464
338 Ga0075362_10008418 3300006177 Bacteria 3942
339 Ga0075362_10015684 3300006177 Bacteria 3086
340 Ga0075362_10036898 3300006177 Bacteria 2141
341 Ga0075362_10066929 3300006177 Bacteria 1634
342 Ga0075362_10088778 3300006177 Bacteria 1432
343 Ga0075362_10091944 3300006177 Bacteria 1409
344 Ga0075362_10196340 3300006177 Bacteria 981
345 Ga0075362_10208418 3300006177 Bacteria 953
346 Ga0075367_10005261 3300006178 Bacteria 6398
347 Ga0075367_10014386 3300006178 Bacteria 4283
348 Ga0075367_10040153 3300006178 Bacteria 2731
349 Ga0075367_10051646 3300006178 Bacteria 2430
350 Ga0075367_10056457 3300006178 Bacteria 2333
351 Ga0075367_10098884 3300006178 Bacteria 1782
352 Ga0075369_10056543 3300006186 Bacteria 1705
353 Ga0075369_10075732 3300006186 Bacteria 1486
354 Ga0075366_10001141 3300006195 Bacteria 13130
355 Ga0075366_10003640 3300006195 Bacteria 8167
356 Ga0075366_10011288 3300006195 Bacteria 5041
357 Ga0075366_10018595 3300006195 Bacteria 4013
358 Ga0075366_10050467 3300006195 Bacteria 2470
359 Ga0075366_10071587 3300006195 Bacteria 2065
360 Ga0075366_10072270 3300006195 Bacteria 2055
361 Ga0075366_10083048 3300006195 Bacteria 1914
362 Ga0075366_10105250 3300006195 Bacteria 1696
363 Ga0075366_10145137 3300006195 Bacteria 1436
364 Ga0075366_10170668 3300006195 Bacteria 1319
365 Ga0075366_10185898 3300006195 Bacteria 1262
366 Ga0097621_100014909 3300006237 Bacteria 5832
367 Ga0097621_100018737 3300006237 Bacteria 5295
368 Ga0075370_10000200 3300006353 Bacteria 21094
369 Ga0075370_10003569 3300006353 Bacteria 7437
370 Ga0075370_10004970 3300006353 Bacteria 6538
371 Ga0075370_10005043 3300006353 Bacteria 6504
372 Ga0075370_10006717 3300006353 Bacteria 5803
373 Ga0075370_10007548 3300006353 Bacteria 5543
374 Ga0075370_10009819 3300006353 Bacteria 4987
375 Ga0075370_10016620 3300006353 Bacteria 3960
376 Ga0075370_10019470 3300006353 Bacteria 3697
377 Ga0075370_10038128 3300006353 Bacteria 2704
378 Ga0075370_10067947 3300006353 Bacteria 2035
379 Ga0075370_10260017 3300006353 Bacteria 1029
380 Ga0075370_10416746 3300006353 Bacteria 807
381 Ga0068871_100011778 3300006358 Bacteria 6427
382 Ga0068871_100107790 3300006358 Bacteria 2340
383 Ga0068871_100180653 3300006358 Bacteria 1813
384 Ga0068871_100256765 3300006358 Bacteria 1524
385 Ga0068871_100297967 3300006358 Bacteria 1415
386 Ga0075430_100074859 3300006846 Bacteria 2839
387 Ga0075429_100013802 3300006880 Bacteria 7006
388 Ga0075429_100100877 3300006880 Bacteria 2520
389 Ga0068865_100021548 3300006881 Bacteria 4192
390 Ga0068865_100182037 3300006881 Bacteria 1619
391 Ga0097620_100002993 3300006931 Bacteria 17130
392 Ga0097620_100041965 3300006931 Bacteria 4595
393 Ga0097620_100055553 3300006931 Bacteria 3984
394 Ga0097620_100329983 3300006931 Bacteria 1620
395 Ga0099823_1000023 3300006944 Bacteria 75509
396 Ga0079104_1000025 3300006946 Bacteria 218785
397 Ga0099826_10009182 3300006948 Bacteria 7382
398 Ga0099826_10166968 3300006948 Bacteria 1240
399 Ga0099826_10177925 3300006948 Bacteria 1187
400 Ga0105244_10014231 3300009036 Bacteria 4611
401 Ga0105240_10002099 3300009093 Bacteria 32606
402 Ga0105240_10040427 3300009093 Bacteria 5964
403 Ga0105240_10050723 3300009093 Bacteria 5229
404 Ga0105240_10052231 3300009093 Bacteria 5139
405 Ga0105240_10063922 3300009093 Bacteria 4575
406 Ga0105245_10095403 3300009098 Bacteria 2744
407 Ga0105245_10140169 3300009098 Bacteria 2276
408 Ga0105245_10371897 3300009098 Bacteria 1421
409 Ga0114129_10118444 3300009147 Bacteria 3647
410 Ga0105243_10000881 3300009148 Bacteria 28283
411 Ga0105243_10001208 3300009148 Bacteria 23242
412 Ga0105243_10003393 3300009148 Bacteria 12920
413 Ga0105243_10006952 3300009148 Bacteria 8713
414 Ga0105243_10017699 3300009148 Bacteria 5389
415 Ga0105243_10046506 3300009148 Bacteria 3414
416 Ga0105243_10064750 3300009148 Bacteria 2934
417 Ga0105243_10094187 3300009148 Bacteria 2473
418 Ga0105243_10129738 3300009148 Bacteria 2137
419 Ga0105241_10966884 3300009174 Bacteria 795
420 Ga0105242_10155515 3300009176 Bacteria 1997
421 Ga0105248_10001394 3300009177 Bacteria 26961
422 Ga0105248_10003839 3300009177 Bacteria 16654
423 Ga0105248_10074973 3300009177 Bacteria 3803
424 Ga0105248_10436192 3300009177 Bacteria 1476
425 Ga0105237_10002681 3300009545 Bacteria 21822
426 Ga0105237_10162787 3300009545 Bacteria 2230
427 Ga0105237_10241354 3300009545 Bacteria 1808
428 Ga0105238_10010268 3300009551 Bacteria 9391
429 Ga0105249_10062903 3300009553 Bacteria 3408
430 Ga0105249_10071057 3300009553 Bacteria 3215
431 Ga0105249_10093002 3300009553 Bacteria 2824
432 Ga0105249_10652667 3300009553 Bacteria 1110
433 Ga0105239_10001896 3300010375 Bacteria 27329
434 Ga0105239_10010428 3300010375 Bacteria 10391
435 Ga0105239_10047344 3300010375 Bacteria 4713
436 Ga0105239_10075364 3300010375 Bacteria 3709
437 Ga0105239_10129672 3300010375 Bacteria 2804
438 Ga0105239_10646603 3300010375 Bacteria 1208
439 Ga0105246_10283900 3300011119 Bacteria 1329
440 Ga0157317_1000084 3300012475 Bacteria 2576
441 Ga0157319_1000001 3300012497 Bacteria 423237
442 Ga0157373_10016739 3300013100 Bacteria 5344
443 Ga0157373_10032893 3300013100 Bacteria 3732
444 Ga0157371_10052068 3300013102 Bacteria 2908
445 Ga0157370_10031947 3300013104 Bacteria 5144
446 Ga0157370_10079823 3300013104 Bacteria 3081
447 Ga0157370_10383422 3300013104 Bacteria 1295
448 Ga0157369_10008315 3300013105 Bacteria 11894
449 Ga0157369_10037330 3300013105 Bacteria 5319
450 Ga0157369_10108715 3300013105 Bacteria 2949
451 Ga0157374_10219015 3300013296 Bacteria 1867
452 Ga0157374_10236678 3300013296 Bacteria 1795
453 Ga0157378_10025519 3300013297 Bacteria 5203
454 Ga0157378_10066654 3300013297 Bacteria 3225
455 Ga0157378_10196196 3300013297 Bacteria 1907
456 Ga0157378_10285517 3300013297 Bacteria 1592
457 Ga0163162_10039558 3300013306 Bacteria 4713
458 Ga0163162_10081416 3300013306 Bacteria 3308
459 Ga0163162_10202262 3300013306 Bacteria 2115
460 Ga0163162_10291647 3300013306 Bacteria 1763
461 Ga0157372_10730119 3300013307 Bacteria 1152
462 Ga0157375_10005240 3300013308 Bacteria 11251
463 Ga0157375_10040743 3300013308 Bacteria 4481
464 Ga0157375_10128748 3300013308 Bacteria 2650
465 Ga0157375_10134869 3300013308 Bacteria 2591
466 Ga0157375_10178174 3300013308 Bacteria 2276
467 Ga0157375_10453307 3300013308 Bacteria 1448
468 Ga0163163_10004818 3300014325 Bacteria 11591
469 Ga0163163_10135864 3300014325 Bacteria 2500
470 Ga0157380_10039716 3300014326 Bacteria 3661
471 Ga0157380_10126388 3300014326 Bacteria 2174
472 Ga0157380_10144000 3300014326 Bacteria 2051
473 Ga0157380_10188839 3300014326 Bacteria 1817
474 Ga0157380_10547814 3300014326 Bacteria 1134
475 Ga0182008_10000893 3300014497 Bacteria 20726
476 Ga0182008_10002052 3300014497 Bacteria 12911
477 Ga0182008_10018330 3300014497 Bacteria 3625
478 Ga0157377_10000016 3300014745 Bacteria 190613
479 Ga0157377_10000848 3300014745 Bacteria 12693
480 Ga0157379_10004851 3300014968 Bacteria 11548
481 Ga0157379_10020286 3300014968 Bacteria 5876
482 Ga0157379_10021534 3300014968 Bacteria 5708
483 Ga0157379_10023314 3300014968 Bacteria 5492
484 Ga0157379_10043364 3300014968 Bacteria 4016
485 Ga0157379_10072230 3300014968 Bacteria 3087
486 Ga0157379_10172089 3300014968 Bacteria 1955
487 Ga0157379_10258325 3300014968 Bacteria 1582
488 Ga0157376_10007038 3300014969 Bacteria 7983
489 Ga0157376_10011702 3300014969 Bacteria 6479
490 Ga0157376_10077188 3300014969 Bacteria 2849
491 Ga0157376_10085569 3300014969 Bacteria 2717
492 Ga0182006_1001088 3300015261 Bacteria 17410
493 Ga0182006_1068687 3300015261 Bacteria 1319
494 Ga0182007_10002796 3300015262 Bacteria 8504
495 Ga0183362_10001 3300015683 Bacteria 2046624
496 Ga0163161_10000193 3300017792 Bacteria 56074
497 Ga0163161_10004445 3300017792 Bacteria 9772
498 Ga0163161_10005014 3300017792 Bacteria 9213
499 Ga0163161_10034770 3300017792 Bacteria 3605
500 Ga0163161_10099189 3300017792 Bacteria 2165
501 Ga0163161_10113300 3300017792 Bacteria 2030
502 Ga0213872_10000129 3300021361 Bacteria 69032
503 Ga0213872_10017841 3300021361 Bacteria 3276
504 Ga0213872_10037201 3300021361 Bacteria 2222
505 Ga0213872_10112089 3300021361 Bacteria 1211
506 Ga0209435_100001 3300025206 Bacteria 1424171
507 Ga0209436_111100 3300025208 Bacteria 1603
508 Ga0209674_100165 3300025226 Bacteria 86006
509 Ga0209672_100157 3300025228 Bacteria 59454
510 Ga0209147_100575 3300025229 Bacteria 20578
511 Ga0209563_100005 3300025230 Bacteria 1774893
512 Ga0209563_100137 3300025230 Bacteria 87321
513 Ga0207427_101146 3300025231 Bacteria 10442
514 Ga0209258_100146 3300025242 Bacteria 163331
515 Ga0209258_100225 3300025242 Bacteria 107138
516 Ga0209258_100973 3300025242 Bacteria 13413
517 Ga0207425_1000295 3300025245 Bacteria 36319
518 Ga0207425_1000332 3300025245 Bacteria 33095
519 Ga0207425_1001492 3300025245 Bacteria 9707
520 Ga0207425_1002296 3300025245 Bacteria 6865
521 Ga0207425_1004000 3300025245 Bacteria 4532
522 Ga0209646_1000001 3300025246 Bacteria 3092932
523 Ga0209646_1000062 3300025246 Bacteria 252045
524 Ga0209026_1000003 3300025250 Bacteria 1060571
525 Ga0209026_1000026 3300025250 Bacteria 352109
526 Ga0209677_100124 3300025253 Bacteria 79576
527 Ga0209677_100191 3300025253 Bacteria 50010
528 Ga0209677_101539 3300025253 Bacteria 9834
529 Ga0209148_1000040 3300025254 Bacteria 473531
530 Ga0209759_1000001 3300025256 Bacteria 2799452
531 Ga0209759_1000050 3300025256 Bacteria 215979
532 Ga0209759_1001102 3300025256 Bacteria 17442
533 Ga0209759_1001457 3300025256 Bacteria 13288
534 Ga0209759_1007632 3300025256 Bacteria 3457
535 Ga0209759_1008489 3300025256 Bacteria 3194
536 Ga0209759_1011545 3300025256 Bacteria 2503
537 Ga0209129_1000007 3300025258 Bacteria 771325
538 Ga0209129_1000012 3300025258 Bacteria 541516
539 Ga0209129_1002839 3300025258 Bacteria 8016
540 Ga0209129_1004667 3300025258 Bacteria 5232
541 Ga0209129_1013599 3300025258 Bacteria 1782
542 Ga0209565_1000004 3300025263 Bacteria 983150
543 Ga0209565_1000085 3300025263 Bacteria 153075
544 Ga0209565_1000639 3300025263 Bacteria 22732
545 Ga0209565_1000937 3300025263 Bacteria 15341
546 Ga0209565_1005491 3300025263 Bacteria 3678
547 Ga0209565_1009634 3300025263 Bacteria 2435
548 Ga0209455_1000059 3300025272 Bacteria 339995
549 Ga0209673_1000045 3300025273 Bacteria 290531
550 Ga0209673_1000133 3300025273 Bacteria 161740
551 Ga0209673_1000304 3300025273 Bacteria 91151
552 Ga0209673_1001052 3300025273 Bacteria 31821
553 Ga0209673_1003345 3300025273 Bacteria 9586
554 Ga0209673_1003959 3300025273 Bacteria 8272
555 Ga0209673_1006737 3300025273 Bacteria 5471
556 Ga0209673_1012989 3300025273 Bacteria 3314
557 Ga0209673_1023816 3300025273 Bacteria 2074
558 Ga0209130_1000056 3300025284 Bacteria 210851
559 Ga0209130_1000070 3300025284 Bacteria 179057
560 Ga0209130_1000326 3300025284 Bacteria 54842
561 Ga0209130_1001246 3300025284 Bacteria 17803
562 Ga0209130_1004082 3300025284 Bacteria 5759
563 Ga0209675_1000083 3300025291 Bacteria 153075
564 Ga0209675_1000273 3300025291 Bacteria 49501
565 Ga0209675_1000516 3300025291 Bacteria 28507
566 Ga0209675_1001347 3300025291 Bacteria 14497
567 Ga0209675_1001834 3300025291 Bacteria 11569
568 Ga0209675_1002863 3300025291 Bacteria 8567
569 Ga0209675_1004787 3300025291 Bacteria 5884
570 Ga0209676_1000007 3300025292 Bacteria 1029371
571 Ga0209676_1000122 3300025292 Bacteria 195510
572 Ga0209676_1000268 3300025292 Bacteria 108430
573 Ga0209676_1001242 3300025292 Bacteria 26866
574 Ga0209676_1010898 3300025292 Bacteria 3729
575 Ga0209676_1011875 3300025292 Bacteria 3473
576 Ga0209025_1000073 3300025294 Bacteria 282133
577 Ga0209025_1000111 3300025294 Bacteria 218982
578 Ga0209025_1000432 3300025294 Bacteria 82875
579 Ga0209025_1002684 3300025294 Bacteria 18159
580 Ga0209025_1003907 3300025294 Bacteria 13429
581 Ga0209025_1005182 3300025294 Bacteria 10773
582 Ga0209025_1010358 3300025294 Bacteria 6324
583 Ga0209025_1010592 3300025294 Bacteria 6226
584 Ga0209025_1011455 3300025294 Bacteria 5837
585 Ga0209564_1000005 3300025295 Bacteria 1147192
586 Ga0209564_1000022 3300025295 Bacteria 555109
587 Ga0209564_1000358 3300025295 Bacteria 85036
588 Ga0209564_1000524 3300025295 Bacteria 62668
589 Ga0209564_1000594 3300025295 Bacteria 56686
590 Ga0209564_1001264 3300025295 Bacteria 27824
591 Ga0209564_1004286 3300025295 Bacteria 8843
592 Ga0209758_1000025 3300025297 Bacteria 586687
593 Ga0209758_1000356 3300025297 Bacteria 82914
594 Ga0209758_1000708 3300025297 Bacteria 49463
595 Ga0209758_1002137 3300025297 Bacteria 20841
596 Ga0209050_1000002 3300025298 Bacteria 1792849
597 Ga0209050_1000003 3300025298 Bacteria 1609245
598 Ga0209050_1000257 3300025298 Bacteria 114186
599 Ga0209050_1001024 3300025298 Bacteria 34874
600 Ga0209050_1002670 3300025298 Bacteria 14557
601 Ga0209050_1005556 3300025298 Bacteria 7857
602 Ga0209050_1011970 3300025298 Bacteria 4040
603 Ga0209050_1013717 3300025298 Bacteria 3569
604 Ga0209256_1000001 3300025299 Bacteria 2166974
605 Ga0209256_1000050 3300025299 Bacteria 308622
606 Ga0209256_1000063 3300025299 Bacteria 252716
607 Ga0209256_1000078 3300025299 Bacteria 225992
608 Ga0209256_1000742 3300025299 Bacteria 42803
609 Ga0207426_1000001 3300025302 Bacteria 1341301
610 Ga0207426_1000025 3300025302 Bacteria 532921
611 Ga0207426_1000028 3300025302 Bacteria 483955
612 Ga0209051_1000002 3300025303 Bacteria 1631846
613 Ga0209051_1000003 3300025303 Bacteria 1609245
614 Ga0209051_1000140 3300025303 Bacteria 135919
615 Ga0209051_1000155 3300025303 Bacteria 129560
616 Ga0209051_1000343 3300025303 Bacteria 69952
617 Ga0209051_1000618 3300025303 Bacteria 40891
618 Ga0209051_1000665 3300025303 Bacteria 38573
619 Ga0209051_1001527 3300025303 Bacteria 19271
620 Ga0209051_1003803 3300025303 Bacteria 9657
621 Ga0209051_1007719 3300025303 Bacteria 5833
622 Ga0209051_1008508 3300025303 Bacteria 5422
623 Ga0209051_1009349 3300025303 Bacteria 5064
624 Ga0209051_1012820 3300025303 Bacteria 4032
625 Ga0209051_1027048 3300025303 Bacteria 2295
626 Ga0209051_1066731 3300025303 Bacteria 1104
627 Ga0209257_1000002 3300025304 Bacteria 1767052
628 Ga0209257_1000012 3300025304 Bacteria 1111138
629 Ga0209257_1000017 3300025304 Bacteria 866287
630 Ga0209257_1000018 3300025304 Bacteria 836016
631 Ga0209257_1000045 3300025304 Bacteria 484429
632 Ga0209257_1000236 3300025304 Bacteria 129543
633 Ga0209257_1000333 3300025304 Bacteria 98599
634 Ga0209257_1000358 3300025304 Bacteria 93161
635 Ga0209257_1001964 3300025304 Bacteria 22160
636 Ga0209257_1005027 3300025304 Bacteria 9627
637 Ga0209257_1005357 3300025304 Bacteria 9063
638 Ga0209257_1009186 3300025304 Bacteria 5371
639 Ga0209257_1021608 3300025304 Bacteria 2330
640 Ga0209257_1040128 3300025304 Bacteria 1400
641 Ga0207696_1046952 3300025711 Bacteria 1245
642 Ga0207655_1031742 3300025728 Bacteria 2428
643 Ga0207682_10001856 3300025893 Bacteria 9625
644 Ga0207682_10003745 3300025893 Bacteria 6537
645 Ga0207682_10013067 3300025893 Bacteria 3236
646 Ga0207682_10076193 3300025893 Bacteria 1429
647 Ga0207642_10017237 3300025899 Bacteria 2742
648 Ga0207688_10027810 3300025901 Bacteria 3111
649 Ga0207688_10061796 3300025901 Bacteria 2112
650 Ga0207680_10008447 3300025903 Bacteria 5056
651 Ga0207645_10002689 3300025907 Bacteria 13852
652 Ga0207645_10037411 3300025907 Bacteria 3114
653 Ga0207643_10073167 3300025908 Bacteria 1975
654 Ga0207705_10034666 3300025909 Bacteria 3609
655 Ga0207705_10099860 3300025909 Bacteria 2134
656 Ga0207705_10270512 3300025909 Bacteria 1299
657 Ga0207684_10047582 3300025910 Bacteria 3637
658 Ga0207684_10103438 3300025910 Bacteria 2435
659 Ga0207654_10022895 3300025911 Bacteria 3339
660 Ga0207707_10218777 3300025912 Bacteria 1658
661 Ga0207695_10018539 3300025913 Bacteria 8042
662 Ga0207695_10037040 3300025913 Bacteria 5265
663 Ga0207695_10046644 3300025913 Bacteria 4592
664 Ga0207695_10096678 3300025913 Bacteria 2955
665 Ga0207695_10266144 3300025913 Bacteria 1611
666 Ga0207671_10002325 3300025914 Bacteria 20511
667 Ga0207671_10096860 3300025914 Bacteria 2230
668 Ga0207671_10304099 3300025914 Bacteria 1260
669 Ga0207660_10006938 3300025917 Bacteria 7334
670 Ga0207662_10097161 3300025918 Bacteria 1821
671 Ga0207657_10010303 3300025919 Bacteria 9332
672 Ga0207657_10011313 3300025919 Bacteria 8863
673 Ga0207657_10109360 3300025919 Bacteria 2285
674 Ga0207657_10229529 3300025919 Bacteria 1485
675 Ga0207649_10005919 3300025920 Bacteria 6628
676 Ga0207649_10210734 3300025920 Bacteria 1378
677 Ga0207652_10009264 3300025921 Bacteria 7917
678 Ga0207652_10087394 3300025921 Bacteria 2734
679 Ga0207646_10172280 3300025922 Bacteria 1954
680 Ga0207681_10015010 3300025923 Bacteria 4828
681 Ga0207681_10020476 3300025923 Bacteria 4192
682 Ga0207681_10065945 3300025923 Bacteria 2505
683 Ga0207681_10089243 3300025923 Bacteria 2197
684 Ga0207681_10090407 3300025923 Bacteria 2185
685 Ga0207681_10112910 3300025923 Bacteria 1980
686 Ga0207694_10013570 3300025924 Bacteria 6138
687 Ga0207650_10000274 3300025925 Bacteria 54226
688 Ga0207650_10005108 3300025925 Bacteria 8956
689 Ga0207650_10006156 3300025925 Bacteria 8179
690 Ga0207650_10098288 3300025925 Bacteria 2248
691 Ga0207650_10172668 3300025925 Bacteria 1719
692 Ga0207659_10001360 3300025926 Bacteria 14606
693 Ga0207659_10015029 3300025926 Bacteria 5006
694 Ga0207659_10020561 3300025926 Bacteria 4365
695 Ga0207659_10127859 3300025926 Bacteria 1957
696 Ga0207687_10064217 3300025927 Bacteria 2602
697 Ga0207687_10072680 3300025927 Bacteria 2461
698 Ga0207664_10217370 3300025929 Bacteria 1656
699 Ga0207644_10000924 3300025931 Bacteria 18658
700 Ga0207644_10014175 3300025931 Bacteria 5331
701 Ga0207690_10005848 3300025932 Bacteria 7278
702 Ga0207706_10000272 3300025933 Bacteria 56285
703 Ga0207706_10005864 3300025933 Bacteria 11427
704 Ga0207706_10042765 3300025933 Bacteria 4015
705 Ga0207706_10071708 3300025933 Bacteria 3047
706 Ga0207686_10037737 3300025934 Bacteria 2918
707 Ga0207686_10048347 3300025934 Bacteria 2634
708 Ga0207686_10214102 3300025934 Bacteria 1387
709 Ga0207709_10000159 3300025935 Bacteria 91803
710 Ga0207709_10000425 3300025935 Bacteria 40645
711 Ga0207709_10001100 3300025935 Bacteria 19836
712 Ga0207709_10002246 3300025935 Bacteria 12298
713 Ga0207709_10019731 3300025935 Bacteria 3795
714 Ga0207709_10020701 3300025935 Bacteria 3714
715 Ga0207709_10067565 3300025935 Bacteria 2256
716 Ga0207709_10162297 3300025935 Bacteria 1560
717 Ga0207709_10174758 3300025935 Bacteria 1511
718 Ga0207709_10312762 3300025935 Bacteria 1172
719 Ga0207669_10002096 3300025937 Bacteria 8456
720 Ga0207669_10162792 3300025937 Bacteria 1578
721 Ga0207704_10066684 3300025938 Bacteria 2260
722 Ga0207704_10111664 3300025938 Bacteria 1849
723 Ga0207704_10149741 3300025938 Bacteria 1645
724 Ga0207665_10153165 3300025939 Bacteria 1653
725 Ga0207691_10000715 3300025940 Bacteria 32846
726 Ga0207691_10025211 3300025940 Bacteria 5584
727 Ga0207691_10025283 3300025940 Bacteria 5576
728 Ga0207691_10039297 3300025940 Bacteria 4377
729 Ga0207691_10052011 3300025940 Bacteria 3742
730 Ga0207691_10092182 3300025940 Bacteria 2713
731 Ga0207691_10100719 3300025940 Bacteria 2578
732 Ga0207691_10212544 3300025940 Bacteria 1680
733 Ga0207691_10234410 3300025940 Bacteria 1588
734 Ga0207691_10296112 3300025940 Bacteria 1391
735 Ga0207711_10004324 3300025941 Bacteria 12137
736 Ga0207711_10006498 3300025941 Bacteria 9843
737 Ga0207711_10010519 3300025941 Bacteria 7687
738 Ga0207711_10022264 3300025941 Bacteria 5299
739 Ga0207711_10231669 3300025941 Bacteria 1692
740 Ga0207711_10640278 3300025941 Bacteria 992
741 Ga0207689_10000832 3300025942 Bacteria 29759
742 Ga0207689_10003940 3300025942 Bacteria 13512
743 Ga0207689_10031852 3300025942 Bacteria 4385
744 Ga0207689_10100576 3300025942 Bacteria 2375
745 Ga0207689_10128307 3300025942 Bacteria 2086
746 Ga0207661_10007953 3300025944 Bacteria 7559
747 Ga0207679_10003912 3300025945 Bacteria 9243
748 Ga0207679_10009078 3300025945 Bacteria 6353
749 Ga0207679_10029674 3300025945 Bacteria 3810
750 Ga0207679_10055221 3300025945 Bacteria 2926
751 Ga0207679_10059750 3300025945 Bacteria 2830
752 Ga0207679_10152036 3300025945 Bacteria 1885
753 Ga0207667_10001993 3300025949 Bacteria 25611
754 Ga0207667_10543182 3300025949 Bacteria 1176
755 Ga0207651_10000893 3300025960 Bacteria 13093
756 Ga0207651_10003094 3300025960 Bacteria 8088
757 Ga0207651_10005362 3300025960 Bacteria 6574
758 Ga0207651_10127085 3300025960 Bacteria 1944
759 Ga0207651_10201182 3300025960 Bacteria 1596
760 Ga0207651_10284486 3300025960 Bacteria 1368
761 Ga0207712_10028278 3300025961 Bacteria 3749
762 Ga0207712_10108195 3300025961 Bacteria 2080
763 Ga0207712_10449266 3300025961 Bacteria 1093
764 Ga0207712_10479238 3300025961 Bacteria 1060
765 Ga0207668_10158126 3300025972 Bacteria 1762
766 Ga0207668_10424497 3300025972 Bacteria 1129
767 Ga0207640_10063936 3300025981 Bacteria 2448
768 Ga0207640_10285210 3300025981 Bacteria 1299
769 Ga0207658_10000596 3300025986 Bacteria 32369
770 Ga0207658_10024952 3300025986 Bacteria 4183
771 Ga0207658_10031648 3300025986 Bacteria 3758
772 Ga0207658_10053233 3300025986 Bacteria 2990
773 Ga0207658_10053722 3300025986 Bacteria 2978
774 Ga0207658_10078991 3300025986 Bacteria 2516
775 Ga0207658_10134700 3300025986 Bacteria 1990
776 Ga0207658_10417520 3300025986 Bacteria 1182
777 Ga0207658_10689502 3300025986 Bacteria 923
778 Ga0207677_10004499 3300026023 Bacteria 7497
779 Ga0207677_10004773 3300026023 Bacteria 7312
780 Ga0207677_10050885 3300026023 Bacteria 2805
781 Ga0207703_10005879 3300026035 Bacteria 9830
782 Ga0207703_10009878 3300026035 Bacteria 7486
783 Ga0207703_10066736 3300026035 Bacteria 2960
784 Ga0207703_10118572 3300026035 Bacteria 2269
785 Ga0207639_10017601 3300026041 Bacteria 5068
786 Ga0207639_10083956 3300026041 Bacteria 2529
787 Ga0207639_10206766 3300026041 Bacteria 1687
788 Ga0207639_10236597 3300026041 Bacteria 1586
789 Ga0207639_10420623 3300026041 Bacteria 1208
790 Ga0207678_10000478 3300026067 Bacteria 36328
791 Ga0207678_10184766 3300026067 Bacteria 1780
792 Ga0207678_10216388 3300026067 Bacteria 1639
793 Ga0207678_10235881 3300026067 Bacteria 1566
794 Ga0207708_10074781 3300026075 Bacteria 2597
795 Ga0207702_10000573 3300026078 Bacteria 40848
796 Ga0207702_10048355 3300026078 Bacteria 3587
797 Ga0207702_10386985 3300026078 Bacteria 1346
798 Ga0207641_10001486 3300026088 Bacteria 22946
799 Ga0207641_10064210 3300026088 Bacteria 3137
800 Ga0207641_10081066 3300026088 Bacteria 2817
801 Ga0207641_10197851 3300026088 Bacteria 1851
802 Ga0207648_10000412 3300026089 Bacteria 47573
803 Ga0207648_10001396 3300026089 Bacteria 26597
804 Ga0207648_10017331 3300026089 Bacteria 6559
805 Ga0207648_10076047 3300026089 Bacteria 2927
806 Ga0207648_10166809 3300026089 Bacteria 1946
807 Ga0207676_10002421 3300026095 Bacteria 13294
808 Ga0207676_10047349 3300026095 Bacteria 3332
809 Ga0207676_10071218 3300026095 Bacteria 2790
810 Ga0207676_10177819 3300026095 Bacteria 1860
811 Ga0207674_10001842 3300026116 Bacteria 27012
812 Ga0207674_10014163 3300026116 Bacteria 8813
813 Ga0207674_10063585 3300026116 Bacteria 3725
814 Ga0207674_10096985 3300026116 Bacteria 2933
815 Ga0207674_10152841 3300026116 Bacteria 2264
816 Ga0207674_10211435 3300026116 Bacteria 1889
817 Ga0207674_10261740 3300026116 Bacteria 1677
818 Ga0207675_100000729 3300026118 Bacteria 32615
819 Ga0207675_100023188 3300026118 Bacteria 5772
820 Ga0207675_100036720 3300026118 Bacteria 4570
821 Ga0207675_100122801 3300026118 Bacteria 2458
822 Ga0207683_10019109 3300026121 Bacteria 5848
823 Ga0207683_10044835 3300026121 Bacteria 3866
824 Ga0207683_10048487 3300026121 Bacteria 3719
825 Ga0207683_10146026 3300026121 Bacteria 2133
826 Ga0207683_10215806 3300026121 Bacteria 1747
827 Ga0207683_10236164 3300026121 Bacteria 1667
828 Ga0207683_10299912 3300026121 Bacteria 1470
829 Ga0207698_10059115 3300026142 Bacteria 2975
830 Ga0207698_10146313 3300026142 Bacteria 2044
831 Ga0207698_10256678 3300026142 Bacteria 1603
832 Ga0207698_10261724 3300026142 Bacteria 1589
833 Ga0207698_10600036 3300026142 Bacteria 1085
834 Ga0209281_1000007 3300027111 Bacteria 938265
835 Ga0209973_1006169 3300027252 Bacteria 1299
836 Ga0209389_1004479 3300027296 Bacteria 11650
837 Ga0209983_1044212 3300027665 Bacteria 967
838 Ga0209282_1000974 3300027666 Bacteria 14977
839 Ga0209813_10002277 3300027866 Bacteria 4386
840 Ga0209813_10037038 3300027866 Bacteria 1468
841 Ga0209974_10002379 3300027876 Bacteria 6821
842 Ga0209974_10005889 3300027876 Bacteria 4297
843 Ga0209974_10006645 3300027876 Bacteria 4024
844 Ga0268266_10141325 3300028379 Bacteria 2161
845 Ga0268266_10181438 3300028379 Bacteria 1917
846 Ga0268266_10305844 3300028379 Bacteria 1484
847 Ga0268266_10380996 3300028379 Bacteria 1330
848 Ga0268265_10004180 3300028380 Bacteria 10112
849 Ga0268265_10024728 3300028380 Bacteria 4254
850 Ga0268265_10059385 3300028380 Bacteria 2925
851 Ga0268265_10152579 3300028380 Bacteria 1950
852 Ga0268264_10006835 3300028381 Bacteria 9581
853 Ga0268264_10032321 3300028381 Bacteria 4293
854 Ga0268264_10114353 3300028381 Bacteria 2369
855 Ga0268264_10218763 3300028381 Bacteria 1752
856 Ga0265336_10000119 3300028666 Bacteria 59232
857 Ga0307517_10010987 3300028786 Bacteria 12591
858 Ga0307517_10091779 3300028786 Bacteria 2477
859 Ga0307515_10000026 3300028794 Bacteria 382411
860 Ga0307515_10000051 3300028794 Bacteria 272100
861 Ga0307515_10000132 3300028794 Bacteria 176547
862 Ga0307515_10000305 3300028794 Bacteria 121634
863 Ga0307515_10000484 3300028794 Bacteria 94947
864 Ga0307515_10002898 3300028794 Bacteria 36447
865 Ga0307515_10004253 3300028794 Bacteria 29706
866 Ga0307515_10006880 3300028794 Bacteria 22609
867 Ga0307515_10013694 3300028794 Bacteria 15113
868 Ga0307515_10025690 3300028794 Bacteria 10178
869 Ga0307515_10038818 3300028794 Bacteria 7601
870 Ga0307515_10103254 3300028794 Bacteria 3419
871 Ga0307515_10245956 3300028794 Bacteria 1550
872 Ga0265324_10009959 3300029957 Bacteria 3691
873 Ga0307512_10024522 3300030522 Bacteria 5365
874 Ga0307512_10139156 3300030522 Bacteria 1491
875 Ga0316177_1080934 3300030731 Bacteria 8980
876 Ga0316176_1095897 3300030732 Bacteria 4269
877 Ga0314311_1024127 3300030733 Bacteria 4598
878 Ga0316178_1082049 3300030735 Bacteria 4647
879 Ga0316180_1101534 3300030736 Bacteria 6197
880 Ga0316181_1045650 3300030744 Bacteria 1844
881 Ga0316182_1369050 3300030745 Bacteria 4107
882 Ga0265330_10000117 3300031235 Bacteria 63961
883 Ga0265332_10000002 3300031238 Bacteria 709510
884 Ga0265332_10000003 3300031238 Bacteria 482849
885 Ga0265327_10034893 3300031251 Bacteria 2786
886 Ga0307513_10000010 3300031456 Bacteria 360812
887 Ga0307513_10000121 3300031456 Bacteria 109551
888 Ga0307513_10015459 3300031456 Bacteria 9251
889 Ga0307513_10039983 3300031456 Bacteria 5191
890 Ga0307513_10055587 3300031456 Bacteria 4234
891 Ga0307513_10064266 3300031456 Bacteria 3868
892 Ga0307513_10177002 3300031456 Bacteria 2002
893 Ga0307513_10447257 3300031456 Bacteria 1017
894 Ga0307509_10001286 3300031507 Bacteria 42598
895 Ga0307509_10010432 3300031507 Bacteria 11388
896 Ga0307509_10013769 3300031507 Bacteria 9545
897 Ga0307509_10047789 3300031507 Bacteria 4601
898 Ga0307509_10067207 3300031507 Bacteria 3756
899 Ga0307509_10076047 3300031507 Bacteria 3485
900 Ga0307509_10391707 3300031507 Bacteria 1099
901 Ga0307408_100000046 3300031548 Bacteria 167686
902 Ga0307408_100001875 3300031548 Bacteria 15319
903 Ga0307408_100158321 3300031548 Bacteria 1796
904 Ga0307408_100321109 3300031548 Bacteria 1304
905 Ga0307408_100330796 3300031548 Bacteria 1286
906 Ga0307508_10000098 3300031616 Bacteria 103295
907 Ga0307508_10000159 3300031616 Bacteria 81150
908 Ga0307508_10030208 3300031616 Bacteria 4896
909 Ga0307508_10259421 3300031616 Bacteria 1333
910 Ga0307514_10002245 3300031649 Bacteria 20619
911 Ga0307514_10006986 3300031649 Bacteria 9760
912 Ga0307514_10008269 3300031649 Bacteria 8878
913 Ga0307514_10020555 3300031649 Bacteria 5388
914 Ga0307514_10181998 3300031649 Bacteria 1353
915 Ga0265314_10000012 3300031711 Bacteria 415184
916 Ga0265314_10009417 3300031711 Bacteria 8237
917 Ga0265314_10148724 3300031711 Bacteria 1439
918 Ga0307516_10002826 3300031730 Bacteria 22886
919 Ga0307516_10003066 3300031730 Bacteria 21791
920 Ga0307516_10003335 3300031730 Bacteria 20773
921 Ga0307516_10004343 3300031730 Bacteria 17529
922 Ga0307516_10004865 3300031730 Bacteria 16368
923 Ga0307516_10030498 3300031730 Bacteria 5440
924 Ga0307516_10126309 3300031730 Bacteria 2342
925 Ga0307516_10212700 3300031730 Bacteria 1647
926 Ga0307516_10311992 3300031730 Bacteria 1246
927 Ga0307405_10004366 3300031731 Bacteria 6671
928 Ga0307405_10011565 3300031731 Bacteria 4634
929 Ga0307405_10060774 3300031731 Bacteria 2385
930 Ga0307405_10098181 3300031731 Bacteria 1957
931 Ga0307405_10106064 3300031731 Bacteria 1894
932 Ga0307413_10008901 3300031824 Bacteria 4770
933 Ga0307410_10233286 3300031852 Bacteria 1422
934 Ga0307406_10000864 3300031901 Bacteria 17063
935 Ga0307406_10001340 3300031901 Bacteria 13827
936 Ga0307407_10426587 3300031903 Bacteria 957
937 Ga0307412_10051102 3300031911 Bacteria 2730
938 Ga0307412_10112312 3300031911 Bacteria 1948
939 Ga0307412_10134142 3300031911 Bacteria 1803
940 Ga0307412_10142282 3300031911 Bacteria 1758
941 Ga0307412_10181879 3300031911 Bacteria 1582
942 Ga0307409_100001393 3300031995 Bacteria 11806
943 Ga0307416_100069123 3300032002 Bacteria 2921
944 Ga0307416_100271559 3300032002 Bacteria 1665
945 Ga0307416_100388184 3300032002 Bacteria 1429
946 Ga0307416_100651167 3300032002 Bacteria 1138
947 Ga0307414_10222178 3300032004 Bacteria 1551
948 Ga0307411_10002107 3300032005 Bacteria 8588
949 Ga0307411_10002164 3300032005 Bacteria 8530
950 Ga0307411_10010018 3300032005 Bacteria 5024
951 Ga0307411_10084274 3300032005 Bacteria 2198
952 Ga0307411_10165412 3300032005 Bacteria 1662
953 Ga0307411_10332514 3300032005 Bacteria 1231
954 Ga0307415_100166848 3300032126 Bacteria 1713
955 Ga0307415_100515827 3300032126 Bacteria 1048
956 Ga0307507_10064389 3300033179 Bacteria 3384
957 Ga0307510_10002924 3300033180 Bacteria 19645
958 Ga0307510_10109577 3300033180 Bacteria 2509
959 Ga0307510_10115880 3300033180 Bacteria 2403
960 Ga0373950_0001730 3300034818 Bacteria 2896
961 Ga0373950_0018591 3300034818 Bacteria 1207
962 Ga0373959_0021287 3300034820 Bacteria 1244
963 Ga0373938_0041786 3300034957 Bacteria 1021
964 Ga0373940_0029217 3300035088 Bacteria 1459
965 Ga0373944_0036019 3300035089 Bacteria 1510
966 Ga0373939_0000134 3300035114 Bacteria 21407
967 Ga0373939_0044851 3300035114 Bacteria 1347
968 Ga0373954_0096772 3300035118 Bacteria 1422
969 Ga0373960_0000060 3300035121 Bacteria 15087
970 Ga0373943_0071869 3300035170 Bacteria 1754
971 Ga0373943_0204047 3300035170 Bacteria 1095
972 Ga0373961_0060848 3300035241 Bacteria 1145
973 Ga0373962_0010649 3300035242 Bacteria 2297
974 Ga0373931_0001710 3300035691 Bacteria 9516
975 Ga0373931_0001894 3300035691 Bacteria 9145
976 Ga0373931_0009130 3300035691 Bacteria 4732
977 Ga0373931_0055604 3300035691 Bacteria 2118
978 Ga0373931_0068429 3300035691 Bacteria 1933
979 Ga0373927_0093092 3300035695 Bacteria 1958
980 Ga0373927_0102238 3300035695 Bacteria 1864
981 Ga0373933_0110964 3300035724 Bacteria 1711
982 Ga0373947_0067563 3300035725 Bacteria 2184
983 Ga0373937_0191548 3300036401 Bacteria 1921
984 Ga0373925_0011126 3300037068 Bacteria 6526
985 Ga0373925_0056736 3300037068 Bacteria 2934
986 Ga0395899_0002154 3300037312 Bacteria 16160
987 Ga0395899_0019128 3300037312 Bacteria 5205
988 Ga0395900_0002425 3300037418 Bacteria 20543
989 Ga0395900_0020959 3300037418 Bacteria 6680
990 Ga0395900_0149133 3300037418 Bacteria 2390
991 Ga0395900_0160620 3300037418 Bacteria 2292
992 Ga0395900_0403195 3300037418 Bacteria 1331
993 Ga0395898_0002961 3300037466 Bacteria 19303
994 Ga0395898_0008634 3300037466 Bacteria 10749
995 Ga0395898_0022008 3300037466 Bacteria 6457
996 Ga0395898_0134229 3300037466 Bacteria 2370
997 Ga0395898_0222657 3300037466 Bacteria 1799
998 Ga0395905_0000180 3300037471 Bacteria 100693
999 Ga0395905_0001081 3300037471 Bacteria 34294
1000 Ga0395905_0002881 3300037471 Bacteria 18795
1001 Ga0395905_0006990 3300037471 Bacteria 11280
1002 Ga0395905_0010125 3300037471 Bacteria 9191
1003 Ga0395905_0013384 3300037471 Bacteria 7860
1004 Ga0395905_0013704 3300037471 Bacteria 7764
1005 Ga0395905_0028419 3300037471 Bacteria 5272
1006 Ga0395905_0028506 3300037471 Bacteria 5263
1007 Ga0395905_0037378 3300037471 Bacteria 4559
1008 Ga0395905_0080020 3300037471 Bacteria 3062
1009 Ga0395905_0104308 3300037471 Bacteria 2661
1010 Ga0395905_0192568 3300037471 Bacteria 1912
1011 Ga0395905_0360945 3300037471 Bacteria 1345
1012 Ga0395905_0435910 3300037471 Bacteria 1207
1013 Ga0395905_0683946 3300037471 Bacteria 928
1014 Ga0395901_0001599 3300038443 Bacteria 23451
1015 Ga0395901_0047353 3300038443 Bacteria 4464
1016 Ga0395901_0085362 3300038443 Bacteria 3300
1017 Ga0395901_0122449 3300038443 Bacteria 2733
1018 Ga0395901_0216962 3300038443 Bacteria 2000
1019 Ga0436365_1256270 3300039437 Bacteria 3724
1020 Ga0436361_0029649 3300039447 Bacteria 14101
1021 Ga0436361_0257745 3300039447 Bacteria 4192
1022 Ga0436361_0362737 3300039447 Bacteria 5180
1023 Ga0436361_0650099 3300039447 Bacteria 16105
1024 Ga0436363_0690192 3300039450 Bacteria 995
1025 Ga0439436_0003791 3300041404 Bacteria 4624
1026 Ga0439436_0013490 3300041404 Bacteria 2470
1027 Ga0439438_033972 3300041405 Bacteria 1345
1028 Ga0439439_0031011 3300041406 Bacteria 1361
1029 Ga0439447_009182 3300041407 Bacteria 3014
1030 Ga0439447_012418 3300041407 Bacteria 2448
1031 Ga0439461_0005365 3300041410 Bacteria 2181
1032 Ga0439466_0003451 3300041411 Bacteria 6130
1033 Ga0439466_0016582 3300041411 Bacteria 2660
1034 Ga0439465_0000072 3300041413 Bacteria 22229
1035 Ga0451797_0933919 3300041453 Bacteria 1115
1036 Ga0451798_0843930 3300041458 Bacteria 1054
1037 Ga0451802_0937156 3300041460 Bacteria 1017
1038 Ga0451804_0897864 3300041463 Bacteria 1368
1039 Ga0451807_1692089 3300041486 Bacteria 1245
1040 Ga0451833_1270813 3300041491 Bacteria 2084
1041 Ga0439431_0000235 3300041997 Bacteria 11239
1042 Ga0439431_0005013 3300041997 Bacteria 2917
1043 Ga0439431_0023603 3300041997 Bacteria 1490
1044 Ga0439433_0000055 3300041999 Bacteria 13711
1045 Ga0439433_0013981 3300041999 Bacteria 1765
1046 Ga0439441_036863 3300042001 Bacteria 968
1047 Ga0439442_001375 3300042002 Bacteria 4817
1048 Ga0439445_0000190 3300042004 Bacteria 11147
1049 Ga0439445_0008876 3300042004 Bacteria 2361
1050 Ga0439445_0034439 3300042004 Bacteria 1327
1051 Ga0439432_016345 3300042006 Bacteria 2499
1052 Ga0439432_023674 3300042006 Bacteria 2021
1053 Ga0439449_0000135 3300042007 Bacteria 24942
1054 Ga0439449_0000254 3300042007 Bacteria 19110
1055 Ga0439449_0001356 3300042007 Bacteria 9597
1056 Ga0439449_0005738 3300042007 Bacteria 4746
1057 Ga0439452_008527 3300042010 Bacteria 3080
1058 Ga0439452_009437 3300042010 Bacteria 2873
1059 Ga0439454_005533 3300042011 Bacteria 1512
1060 Ga0439455_0057914 3300042012 Bacteria 1023
1061 Ga0439457_005620 3300042014 Bacteria 3133
1062 Ga0439457_008935 3300042014 Bacteria 2346
1063 Ga0439462_0002085 3300042015 Bacteria 4588
1064 Ga0439462_0028647 3300042015 Bacteria 1473
1065 Ga0450911_001002 3300042115 Bacteria 7287
1066 Ga0450919_000793 3300042121 Bacteria 4057
1067 Ga0450919_004251 3300042121 Bacteria 1756
1068 Ga0450921_003883 3300042123 Bacteria 1071
1069 Ga0450923_004122 3300042125 Bacteria 2260
1070 Ga0450888_000157 3300042126 Bacteria 5848
1071 Ga0450890_000648 3300042127 Bacteria 5062
1072 Ga0450890_000968 3300042127 Bacteria 4171
1073 Ga0450891_003105 3300042129 Bacteria 1627
1074 Ga0450896_021139 3300042133 Bacteria 955
1075 Ga0450889_002440 3300042144 Bacteria 1854
1076 Ga0450906_000642 3300042145 Bacteria 7461
1077 Ga0450906_001202 3300042145 Bacteria 5717
1078 Ga0450907_019534 3300042146 Bacteria 1136
1079 Ga0439446_0003368 3300042156 Bacteria 3958
1080 Ga0439446_0072822 3300042156 Bacteria 1054
1081 Ga0439458_0032050 3300042157 Bacteria 1255
1082 Ga0450908_007998 3300042184 Bacteria 1983
1083 Ga0450908_013037 3300042184 Bacteria 1501
1084 Ga0450909_000922 3300042185 Bacteria 4029
1085 Ga0439434_0004125 3300042435 Bacteria 4244
1086 Ga0439434_0029442 3300042435 Bacteria 1665
1087 Ga0439434_0182603 3300042435 Bacteria 703
1088 Ga0439435_0051716 3300042436 Bacteria 1178
1089 Ga0439459_0003787 3300042438 Bacteria 2418
1090 Ga0439459_0006496 3300042438 Bacteria 1949
1091 Ga0439464_0033716 3300042439 Bacteria 1442
1092 Ga0450916_008020 3300042530 Bacteria 1278
1093 Ga0450916_022175 3300042530 Bacteria 879
1094 Ga0450918_000282 3300042531 Bacteria 11519
1095 Ga0450918_000287 3300042531 Bacteria 11389
1096 Ga0450893_0001086 3300042532 Bacteria 4088
1097 Ga0450893_0006610 3300042532 Bacteria 1877
1098 Ga0450893_0032490 3300042532 Bacteria 934
1099 Ga0451577_0000114 3300042876 Bacteria 175957
1100 Ga0451577_0003543 3300042876 Bacteria 17252
1101 Ga0466969_0000017 3300044656 Bacteria 103792
1102 Ga0466969_0002322 3300044656 Bacteria 10152
1103 Ga0466969_0025097 3300044656 Bacteria 3065
1104 Ga0466969_0062655 3300044656 Bacteria 1804
1105 Ga0466969_0192857 3300044656 Bacteria 930
1106 Ga0466972_0000564 3300044658 Bacteria 18111
1107 Ga0466972_0090890 3300044658 Bacteria 1448
1108 Ga0453683_0002295 3300044673 Bacteria 15067
1109 Ga0466965_0002967 3300044683 Bacteria 7350
1110 Ga0466965_0018420 3300044683 Bacteria 3347
1111 Ga0466965_0024197 3300044683 Bacteria 2935
1112 Ga0466965_0045731 3300044683 Bacteria 2166
1113 Ga0466966_0002454 3300044684 Bacteria 12119
1114 Ga0466966_0003862 3300044684 Bacteria 9890
1115 Ga0466966_0004685 3300044684 Bacteria 8999
1116 Ga0466966_0005496 3300044684 Bacteria 8326
1117 Ga0466961_0000655 3300044693 Bacteria 21750
1118 Ga0466961_0005740 3300044693 Bacteria 7854
1119 Ga0466961_0012612 3300044693 Bacteria 5412
1120 Ga0466961_0016936 3300044693 Bacteria 4683
1121 Ga0466961_0046507 3300044693 Bacteria 2775
1122 Ga0466963_0085744 3300044694 Bacteria 2138
1123 Ga0466963_0390195 3300044694 Bacteria 981
1124 Ga0466964_0004693 3300044706 Bacteria 5050
1125 Ga0466964_0055191 3300044706 Bacteria 1640
1126 Ga0453684_0001710 3300044712 Bacteria 59044
1127 Ga0453684_0071583 3300044712 Bacteria 4383
1128 Ga0453684_0115887 3300044712 Bacteria 3246
1129 Ga0453684_0441023 3300044712 Bacteria 1451
1130 Ga0453684_0514284 3300044712 Bacteria 1324
1131 Ga0453684_0698711 3300044712 Bacteria 1102
1132 Ga0466971_0011261 3300044719 Bacteria 3918
1133 Ga0466971_0084266 3300044719 Bacteria 1451
1134 Ga0466971_0166188 3300044719 Bacteria 1034
1135 Ga0466968_0010399 3300044735 Bacteria 3606
1136 Ga0466968_0013533 3300044735 Bacteria 3208
1137 Ga0466970_0004901 3300044765 Bacteria 6610
1138 Ga0466970_0026951 3300044765 Bacteria 3013
1139 Ga0466970_0091123 3300044765 Bacteria 1654
1140 Ga0466957_0005869 3300044842 Bacteria 6916
1141 Ga0466957_0147629 3300044842 Bacteria 1519
1142 Ga0466957_0156894 3300044842 Bacteria 1475
1143 Ga0466960_0049038 3300044901 Bacteria 2031
1144 Ga0466960_0063358 3300044901 Bacteria 1820
1145 Ga0466960_0115367 3300044901 Bacteria 1400
1146 Ga0466959_0000285 3300045049 Bacteria 30873
1147 Ga0466959_0044517 3300045049 Bacteria 3270
1148 Ga0466959_0046888 3300045049 Bacteria 3180
1149 Ga0466959_0101685 3300045049 Bacteria 2057
1150 Ga0451576_0003831 3300045051 Bacteria 20210
1151 Ga0451576_0019880 3300045051 Bacteria 7324
1152 Ga0451576_0078482 3300045051 Bacteria 3436
1153 Ga0451576_0112992 3300045051 Bacteria 2827
1154 Ga0466958_0399212 3300045836 Bacteria 888
1155 Ga0466967_0011318 3300045976 Bacteria 6747
1156 Ga0466967_0353253 3300045976 Bacteria 1423
1157 Ga0495592_0000205 3300046454 Bacteria 50544
1158 Ga0495603_0143090 3300046455 Bacteria 1391
1159 Ga0495629_0018591 3300046459 Bacteria 4969
1160 Ga0495629_0425583 3300046459 Bacteria 901
1161 Ga0495638_0083200 3300046460 Bacteria 1939
1162 Ga0495638_0324682 3300046460 Bacteria 821
1163 Ga0495651_0115987 3300046462 Bacteria 1974
1164 Ga0495650_0010155 3300046471 Bacteria 5279
1165 Ga0495639_0007016 3300046475 Bacteria 4844
1166 Ga0495583_0000585 3300046506 Bacteria 49928
1167 Ga0495606_0005296 3300046507 Bacteria 12423
1168 Ga0495606_0110943 3300046507 Bacteria 1655
1169 Ga0495610_0019044 3300046512 Bacteria 3855
1170 Ga0495610_0020856 3300046512 Bacteria 3623
1171 Ga0495610_0022310 3300046512 Bacteria 3465
1172 Ga0495620_0024574 3300046515 Bacteria 2863
1173 Ga0495620_0062267 3300046515 Bacteria 1550
1174 Ga0495620_0094695 3300046515 Bacteria 1195
1175 Ga0495628_0141802 3300046516 Bacteria 1834
1176 Ga0495631_0000228 3300046518 Bacteria 38440
1177 Ga0495632_0003624 3300046519 Bacteria 10853
1178 Ga0495632_0009453 3300046519 Bacteria 5884
1179 Ga0495632_0034350 3300046519 Bacteria 2596
1180 Ga0495632_0106960 3300046519 Bacteria 1315
1181 Ga0495637_0003270 3300046520 Bacteria 8620
1182 Ga0495643_0149582 3300046522 Bacteria 1157
1183 Ga0495663_0015892 3300046525 Bacteria 2125
1184 Ga0495642_0099720 3300046528 Bacteria 1235
1185 Ga0495654_0065348 3300046530 Bacteria 1737
1186 Ga0495586_0007585 3300046535 Bacteria 5791
1187 Ga0495586_0259785 3300046535 Bacteria 992
1188 Ga0495587_0448678 3300046536 Bacteria 715
1189 Ga0495621_0007544 3300046539 Bacteria 3225
1190 Ga0495597_0002614 3300046542 Bacteria 11205
1191 Ga0495597_0004594 3300046542 Bacteria 7533
1192 Ga0495645_0013074 3300046543 Bacteria 5864
1193 Ga0495656_0000184 3300046615 Bacteria 22413
1194 Ga0495656_0027396 3300046615 Bacteria 2276
1195 Ga0495668_0020891 3300046616 Bacteria 3760
1196 Ga0495611_0086522 3300046648 Bacteria 1446
1197 Ga0495625_0000044 3300046660 Bacteria 203855
1198 Ga0495625_0002218 3300046660 Bacteria 21465
1199 Ga0495625_0051677 3300046660 Bacteria 2946
1200 Ga0495625_0068099 3300046660 Bacteria 2503
1201 Ga0495625_0094976 3300046660 Bacteria 2056
1202 Ga0495625_0107409 3300046660 Bacteria 1910
1203 Ga0495625_0163982 3300046660 Bacteria 1487
1204 Ga0495659_0028103 3300046664 Bacteria 1945
1205 Ga0495588_0035371 3300046674 Bacteria 2531
1206 Ga0495588_0054081 3300046674 Bacteria 2071
1207 Ga0495588_0223682 3300046674 Bacteria 993
1208 Ga0495599_0174270 3300046678 Bacteria 1327
1209 Ga0495646_0108946 3300046680 Bacteria 1579
1210 Ga0495647_0005157 3300046681 Bacteria 4278
1211 Ga0495647_0094437 3300046681 Bacteria 1231
1212 Ga0495658_0015865 3300046683 Bacteria 3872
1213 Ga0495658_0319442 3300046683 Bacteria 984
1214 Ga0495624_0137503 3300046690 Bacteria 1497
1215 Ga0495670_0024793 3300046691 Bacteria 2965
1216 Ga0495671_0008121 3300046692 Bacteria 5925
1217 Ga0495671_0073676 3300046692 Bacteria 1676
1218 Ga0495649_0007041 3300046694 Bacteria 6922
1219 Ga0495649_0008123 3300046694 Bacteria 6333
1220 Ga0495589_0068403 3300046794 Bacteria 1737
1221 Ga0495600_0127367 3300046809 Bacteria 1656
1222 Ga0495660_0016584 3300046810 Bacteria 4247
1223 Ga0495660_0064686 3300046810 Bacteria 1954
1224 Ga0495674_0229460 3300047319 Bacteria 1532
1225 Ga0495676_0171497 3300047321 Bacteria 1526
1226 Ga0495676_0226337 3300047321 Bacteria 1286
1227 Ga0495687_000473 3300047443 Bacteria 48762
1228 Ga0495687_010018 3300047443 Bacteria 5236
1229 Ga0495681_0195136 3300047470 Bacteria 824
1230 Ga0495684_0017249 3300047471 Bacteria 5558
1231 Ga0495684_0073961 3300047471 Bacteria 2589
1232 Ga0495686_0003630 3300047472 Bacteria 13244
1233 Ga0495686_0007475 3300047472 Bacteria 8186
1234 Ga0495686_0066710 3300047472 Bacteria 2223
1235 Ga0495686_0068404 3300047472 Bacteria 2191
1236 Ga0495593_0083841 3300047673 Bacteria 1646
1237 Ga0495615_0041037 3300048090 Bacteria 1155
1238 Ga0495626_0076323 3300048091 Bacteria 1496
1239 Ga0496100_0004910 3300048903 Bacteria 7144
1240 Ga0496101_0039108 3300048904 Bacteria 3371
1241 Ga0496102_0008536 3300048905 Bacteria 8785
1242 Ga0496102_0012505 3300048905 Bacteria 7349
1243 Ga0496102_0420090 3300048905 Bacteria 1256
1244 Ga0496103_0029430 3300048906 Bacteria 3338
1245 Ga0496103_0236788 3300048906 Bacteria 1174
1246 Ga0496104_0008803 3300048907 Bacteria 8972
1247 Ga0496104_0008971 3300048907 Bacteria 8892
1248 Ga0496104_0365663 3300048907 Bacteria 1355
1249 Ga0496104_0549326 3300048907 Bacteria 1066
1250 Ga0496105_0007444 3300048908 Bacteria 8474
1251 Ga0496105_0085811 3300048908 Bacteria 2601
1252 Ga0496105_0397226 3300048908 Bacteria 1095
1253 Ga0496106_0022491 3300048909 Bacteria 4684
1254 Ga0496106_0025809 3300048909 Bacteria 4372
1255 Ga0496107_0307227 3300048910 Bacteria 1180
1256 Ga0496108_0131728 3300048911 Bacteria 2149
1257 Ga0496108_0147760 3300048911 Bacteria 2027
1258 Ga0496108_0252414 3300048911 Bacteria 1534
1259 Ga0496108_0489376 3300048911 Bacteria 1074
1260 Ga0496109_0098397 3300048912 Bacteria 2712
1261 Ga0496109_0209722 3300048912 Bacteria 1832
1262 Ga0496109_0355405 3300048912 Bacteria 1384
1263 Ga0496109_0369296 3300048912 Bacteria 1355
1264 Ga0496109_0548450 3300048912 Bacteria 1091
1265 Ga0496110_0023240 3300048913 Bacteria 5271
1266 Ga0496111_0030189 3300048914 Bacteria 3855
1267 Ga0496111_0053968 3300048914 Bacteria 2904
1268 Ga0496112_0013286 3300048915 Bacteria 7601
1269 Ga0496112_0264853 3300048915 Bacteria 1668
1270 Ga0496113_0019299 3300048916 Bacteria 4766
1271 Ga0496114_0254296 3300048917 Bacteria 1546
1272 Ga0496115_0005962 3300048918 Bacteria 8894
1273 Ga0496116_0011622 3300048919 Bacteria 7266
1274 Ga0496116_0053310 3300048919 Bacteria 2672
1275 Ga0496117_0035938 3300048920 Bacteria 3713
1276 Ga0496118_0023095 3300048921 Bacteria 5415
1277 Ga0496118_0031236 3300048921 Bacteria 4420
1278 Ga0496118_0034548 3300048921 Bacteria 4122
1279 Ga0496121_0017655 3300048924 Bacteria 7267
1280 Ga0496121_0061301 3300048924 Bacteria 3087
1281 Ga0496121_0186898 3300048924 Bacteria 1489
1282 Ga0496122_0000034 3300048925 Bacteria 320661
1283 Ga0496122_0069305 3300048925 Bacteria 2526
1284 Ga0496122_0128058 3300048925 Bacteria 1620
1285 Ga0496123_0000141 3300048926 Bacteria 147111
1286 Ga0496123_0081613 3300048926 Bacteria 1964
1287 Ga0496123_0140925 3300048926 Bacteria 1318
1288 Ga0496124_0016806 3300048927 Bacteria 6935
1289 Ga0496124_0023318 3300048927 Bacteria 5651
1290 Ga0496124_0072208 3300048927 Bacteria 2858
1291 Ga0496124_0106277 3300048927 Bacteria 2266
1292 Ga0496124_0117899 3300048927 Bacteria 2126
1293 Ga0496125_0002204 3300048928 Bacteria 25990
1294 Ga0496125_0016741 3300048928 Bacteria 7030
1295 Ga0496125_0027383 3300048928 Bacteria 5167
1296 Ga0496125_0198958 3300048928 Bacteria 1314
1297 Ga0496126_0030523 3300048929 Bacteria 5104
1298 Ga0496126_0067784 3300048929 Bacteria 3188
1299 Ga0496126_0072855 3300048929 Bacteria 3055
1300 Ga0496126_0280036 3300048929 Bacteria 1382
1301 Ga0501309_014454 3300049129 Bacteria 1060
1302 Ga0501298_038442 3300049521 Bacteria 964
1303 Ga0501300_009381 3300049523 Bacteria 1427
1304 Ga0501031_0044698 3300049568 Bacteria 2890
1305 Ga0501034_0187644 3300049571 Bacteria 2030
1306 Ga0501043_0000149 3300049579 Bacteria 65122
1307 Ga0501046_0000092 3300049580 Bacteria 97456
1308 Ga0501047_0000028 3300049581 Bacteria 220279
1309 Ga0501047_0037145 3300049581 Bacteria 4709
1310 Ga0501047_0159212 3300049581 Bacteria 2130
1311 Ga0501048_0000097 3300049582 Bacteria 47728
1312 Ga0501198_000039 3300049649 Bacteria 47786
1313 Ga0501211_001068 3300049658 Bacteria 2895
1314 Ga0501222_000043 3300049662 Bacteria 47790
1315 Ga0501222_001756 3300049662 Bacteria 3009
1316 Ga0501223_019701 3300049663 Bacteria 1325
1317 Ga0501249_001402 3300049679 Bacteria 4983
1318 Ga0501253_015674 3300049683 Bacteria 1249
1319 Ga0501221_005867 3300049704 Bacteria 2063
1320 Ga0501225_0005658 3300049705 Bacteria 3663
1321 Ga0501080_0037120 3300049742 Bacteria 4549
1322 Ga0501262_000305 3300049759 Bacteria 5989
1323 Ga0501263_002339 3300049760 Bacteria 1922
1324 Ga0501265_001954 3300049762 Bacteria 2350
1325 Ga0501266_000210 3300049763 Bacteria 7611
1326 Ga0501267_002105 3300049764 Bacteria 1767
1327 Ga0501279_004739 3300049775 Bacteria 1786
1328 Ga0501035_0036476 3300049822 Bacteria 4456
1329 Ga0501044_0071742 3300049823 Bacteria 3521
1330 Ga0501045_0002894 3300049824 Bacteria 11731
1331 nmdc:mga03683_104008_c1 3300050489 Bacteria 1250
1332 nmdc:mga03683_10428_c1 3300050489 Bacteria 3333
1333 nmdc:mga03683_11744_c1 3300050489 Bacteria 3182
1334 nmdc:mga03683_27041_c1 3300050489 Bacteria 2269
1335 nmdc:mga03683_4370_c1 3300050489 Bacteria 4684
1336 nmdc:mga03683_51468_c1 3300050489 Bacteria 1719
1337 nmdc:mga03683_9155_c1 3300050489 Bacteria 3510
1338 nmdc:mga03n38_11598_c1 3300050490 Bacteria 3290
1339 nmdc:mga03n38_50977_c1 3300050490 Bacteria 1846
1340 nmdc:mga00v17_13234_c1 3300050491 Bacteria 4573
1341 nmdc:mga00v17_40775_c1 3300050491 Bacteria 2786
1342 nmdc:mga00v17_40979_c1 3300050491 Bacteria 2779
1343 nmdc:mga0yw44_164081_c1 3300050492 Bacteria 1456
1344 nmdc:mga0yw44_69875_c1 3300050492 Bacteria 2176
1345 nmdc:mga0k408_1107_c1 3300050493 Bacteria 14758
1346 nmdc:mga0k408_11730_c1 3300050493 Bacteria 4780
1347 nmdc:mga0k408_133236_c1 3300050493 Bacteria 1476
1348 nmdc:mga0k408_13369_c1 3300050493 Bacteria 4500
1349 nmdc:mga0k408_17075_c1 3300050493 Bacteria 4037
1350 nmdc:mga0k408_171182_c1 3300050493 Bacteria 1294
1351 nmdc:mga0k408_17184_c1 3300050493 Bacteria 4027
1352 nmdc:mga0k408_33077_c1 3300050493 Bacteria 2956
1353 nmdc:mga0k408_37931_c1 3300050493 Bacteria 2767
1354 nmdc:mga0k408_387263_c1 3300050493 Bacteria 832
1355 nmdc:mga0k408_50451_c1 3300050493 Bacteria 2409
1356 nmdc:mga0k408_53199_c1 3300050493 Bacteria 2346
1357 nmdc:mga0k408_56887_c1 3300050493 Bacteria 2270
1358 nmdc:mga0k408_6452_c1 3300050493 Bacteria 6256
1359 nmdc:mga0k408_74008_c1 3300050493 Bacteria 1990
1360 nmdc:mga0k408_7826_c1 3300050493 Bacteria 5713
1361 nmdc:mga0k408_80770_c1 3300050493 Bacteria 1903
1362 nmdc:mga0k408_81161_c1 3300050493 Bacteria 1899
1363 nmdc:mga0k408_91859_c1 3300050493 Bacteria 1784
1364 nmdc:mga06z11_155402_c1 3300050494 Bacteria 1304
1365 nmdc:mga06z11_259120_c1 3300050494 Bacteria 1026
1366 nmdc:mga06z11_29452_c1 3300050494 Bacteria 1639
1367 nmdc:mga06z11_62720_c1 3300050494 Bacteria 1506
1368 nmdc:mga04h51_44314_c1 3300050495 Bacteria 1466
1369 nmdc:mga04h51_45950_c1 3300050495 Bacteria 1446
1370 nmdc:mga07m45_11799_c1 3300050496 Bacteria 4600
1371 nmdc:mga07m45_1441_c1 3300050496 Bacteria 10910
1372 nmdc:mga07m45_1644_c1 3300050496 Bacteria 5094
1373 nmdc:mga07m45_17064_c2 3300050496 Bacteria 2919
1374 nmdc:mga07m45_18324_c1 3300050496 Bacteria 3777
1375 nmdc:mga07m45_208560_c1 3300050496 Bacteria 1137
1376 nmdc:mga07m45_220_c1 3300050496 Bacteria 22633
1377 nmdc:mga07m45_23119_c1 3300050496 Bacteria 3396
1378 nmdc:mga07m45_24416_c1 3300050496 Bacteria 3311
1379 nmdc:mga07m45_246000_c1 3300050496 Bacteria 1041
1380 nmdc:mga07m45_36783_c1 3300050496 Bacteria 2728
1381 nmdc:mga07m45_4099_c1 3300050496 Bacteria 7110
1382 nmdc:mga07m45_66194_c1 3300050496 Bacteria 2052
1383 nmdc:mga07m45_8131_c1 3300050496 Bacteria 5377
1384 nmdc:mga07m45_85631_c1 3300050496 Bacteria 1802
1385 nmdc:mga07m45_98223_c1 3300050496 Bacteria 1681
1386 nmdc:mga05p37_129068_c1 3300050507 Bacteria 3103
1387 nmdc:mga09592_965_c1 3300050508 Bacteria 22699
1388 nmdc:mga0qj67_175370_c1 3300050509 Bacteria 1741
1389 nmdc:mga08y16_552283_c1 3300050511 Bacteria 1165
1390 nmdc:mga0sz30_127678_c1 3300050516 Bacteria 1119
1391 nmdc:mga0sz30_13382_c1 3300050516 Bacteria 3212
1392 nmdc:mga0sz30_18248_c1 3300050516 Bacteria 2806
1393 Ga0500610_0000863 3300053079 Bacteria 9710
1394 Ga0500610_0027623 3300053079 Bacteria 2851
1395 Ga0500610_0114083 3300053079 Bacteria 1386
1396 Ga0500635_0000129 3300053080 Bacteria 44308
1397 Ga0495619_0042460 3300053085 Bacteria 2978
1398 Ga0500578_0001034 3300053086 Bacteria 30428
1399 Ga0500578_0197124 3300053086 Bacteria 1234
1400 Ga0500583_0088168 3300053092 Bacteria 1508
1401 Ga0500651_0000097 3300053093 Bacteria 53876
1402 Ga0500651_0003537 3300053093 Bacteria 8548
1403 Ga0500651_0018573 3300053093 Bacteria 4306
1404 Ga0500571_000190 3300053110 Bacteria 22258
1405 Ga0500593_000570 3300053117 Bacteria 14182
1406 Ga0500593_001079 3300053117 Bacteria 9847
1407 Ga0500594_0000766 3300053118 Bacteria 6842
1408 Ga0500594_0001531 3300053118 Bacteria 5031
1409 Ga0500597_087377 3300053120 Bacteria 1354
1410 Ga0500607_002610 3300053121 Bacteria 14302
1411 Ga0500618_032668 3300053125 Bacteria 1217
1412 Ga0500628_001693 3300053129 Bacteria 3726
1413 Ga0500652_000757 3300053131 Bacteria 10901
1414 Ga0500652_138434 3300053131 Bacteria 1014
1415 Ga0500655_008878 3300053133 Bacteria 1808
1416 Ga0500658_0000521 3300053134 Bacteria 16260
1417 Ga0500658_0000753 3300053134 Bacteria 13371
1418 Ga0500658_0002272 3300053134 Bacteria 7435
1419 Ga0500658_0002796 3300053134 Bacteria 6699
1420 Ga0500658_0180596 3300053134 Bacteria 961
1421 Ga0500559_0000134 3300053136 Bacteria 56963
1422 Ga0500559_0002741 3300053136 Bacteria 8942
1423 Ga0500568_0003370 3300053139 Bacteria 8931
1424 Ga0500568_0015423 3300053139 Bacteria 3422
1425 Ga0500573_0050389 3300053140 Bacteria 2395
1426 Ga0500590_044082 3300053148 Bacteria 2285
1427 Ga0500616_0043647 3300053153 Bacteria 2396
1428 Ga0500616_0077624 3300053153 Bacteria 1676
1429 Ga0500619_000137 3300053154 Bacteria 18737
1430 Ga0500622_0001329 3300053156 Bacteria 20074
1431 Ga0500622_0011384 3300053156 Bacteria 4846
1432 Ga0500622_0024467 3300053156 Bacteria 3192
1433 Ga0500627_0001008 3300053158 Bacteria 7675
1434 Ga0500633_0081403 3300053160 Bacteria 1172
1435 Ga0500634_0015124 3300053161 Bacteria 4090
1436 Ga0500634_0031872 3300053161 Bacteria 2875
1437 Ga0500636_0015073 3300053177 Bacteria 4551
1438 Ga0500625_019956 3300053729 Bacteria 3153
1439 Ga0500645_010276 3300053730 Bacteria 3104
1440 Ga0500645_019674 3300053730 Bacteria 2098
1441 Ga0500596_016460 3300053735 Bacteria 1111
1442 Ga0500661_006420 3300055283 Bacteria 2187
1443 Ga0500661_022231 3300055283 Bacteria 1124
1444 Ga0590071_001197 3300059421 Bacteria 7016
1445 Ga0466962_0003867 3300061719 Bacteria 7154
1446 Ga0466962_0022710 3300061719 Bacteria 3015
1447 Ga0466962_0067867 3300061719 Bacteria 1703

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0025809 Ga0496106_0025809_3435_4124 211
2 3300047472 Ga0495686_0068404 Ga0495686_0068404_1096_1785 212
3 3300042435 Ga0439434_0182603 Ga0439434_0182603_10_684 213
4 3300005436 Ga0070713_101274416 Ga0070713_1012744161 215
5 3300025972 Ga0207668_10424497 Ga0207668_104244972 215
6 3300035118 Ga0373954_0096772 Ga0373954_0096772_56_721 216
7 3300046536 Ga0495587_0448678 Ga0495587_0448678_13_690 216
8 3300048912 Ga0496109_0548450 Ga0496109_0548450_69_746 216
9 3300049658 Ga0501211_001068 Ga0501211_001068_26_703 216
10 3300005578 Ga0068854_100248759 Ga0068854_1002487591 217
11 3300006178 Ga0075367_10098884 Ga0075367_100988842 217
12 3300027866 Ga0209813_10002277 Ga0209813_100022771 217
13 3300031456 Ga0307513_10447257 Ga0307513_104472572 217
14 3300031730 Ga0307516_10126309 Ga0307516_101263092 217
15 3300050493 nmdc:mga0k408_13369_c1 nmdc:mga0k408_13369_c1_2865_3560 217
16 3300050493 nmdc:mga0k408_17075_c1 nmdc:mga0k408_17075_c1_1898_2596 217
17 3300050494 nmdc:mga06z11_29452_c1 nmdc:mga06z11_29452_c1_432_1127 217
18 3300053730 Ga0500645_010276 Ga0500645_010276_2109_2810 217
19 3300003781 Ga0055536_1008603 Ga0055536_10086034 220
20 3300037312 Ga0395899_0002154 Ga0395899_0002154_4146_4823 221
21 3300037466 Ga0395898_0022008 Ga0395898_0022008_48_725 221
22 3300037466 Ga0395898_0222657 Ga0395898_0222657_46_723 221
23 3300038443 Ga0395901_0216962 Ga0395901_0216962_865_1542 221
24 iso_pu_bacteria 2831864461 2831868553 230
25 iso_pu_bacteria 2886848708 2886848966 230
26 iso_pu_bacteria 2886848708 2886854666 230
27 3300053153 Ga0500616_0043647 Ga0500616_0043647_1054_1785 232
28 iso_pu_bacteria 2643221544 2643745806 232
29 iso_pu_bacteria 2643221585 2643936883 232
30 iso_pu_bacteria 2643221656 2644318048 232
31 3300050493 nmdc:mga0k408_6452_c1 nmdc:mga0k408_6452_c1_16_726 233
32 3300003320 rootH2_10074078 rootH2_100740782 234
33 3300003322 rootL2_10001938 rootL2_100019387 234
34 3300003323 rootH1_10129911 rootH1_101299112 234
35 3300003771 Ga0055526_1001574 Ga0055526_10015744 234
36 3300003775 Ga0055524_1000595 Ga0055524_100059523 234
37 3300003794 Ga0055531_10006250 Ga0055531_100062507 234
38 3300003794 Ga0055531_10028801 Ga0055531_100288012 234
39 3300004625 Ga0055543_1015830 Ga0055543_10158302 234
40 3300005262 Ga0065165_1000181 Ga0065165_100018127 234
41 3300006944 Ga0099823_1000023 Ga0099823_100002311 234
42 3300012475 Ga0157317_1000084 Ga0157317_10000842 234
43 3300012497 Ga0157319_1000001 Ga0157319_1000001308 234
44 3300025273 Ga0209673_1006737 Ga0209673_10067374 234
45 3300025273 Ga0209673_1012989 Ga0209673_10129895 234
46 3300025273 Ga0209673_1023816 Ga0209673_10238162 234
47 3300025295 Ga0209564_1000005 Ga0209564_1000005172 234
48 3300025298 Ga0209050_1013717 Ga0209050_10137172 234
49 3300025299 Ga0209256_1000078 Ga0209256_100007840 234
50 3300025299 Ga0209256_1000742 Ga0209256_10007424 234
51 3300025303 Ga0209051_1008508 Ga0209051_10085082 234
52 3300025304 Ga0209257_1000358 Ga0209257_100035863 234
53 3300025304 Ga0209257_1005027 Ga0209257_10050277 234
54 3300025940 Ga0207691_10212544 Ga0207691_102125442 234
55 3300027296 Ga0209389_1004479 Ga0209389_10044794 234
56 3300042011 Ga0439454_005533 Ga0439454_005533_721_1446 234
57 3300042127 Ga0450890_000968 Ga0450890_000968_86_811 234
58 3300042436 Ga0439435_0051716 Ga0439435_0051716_61_786 234
59 3300042438 Ga0439459_0003787 Ga0439459_0003787_1638_2363 234
60 3300044694 Ga0466963_0390195 Ga0466963_0390195_85_810 234
61 3300046460 Ga0495638_0324682 Ga0495638_0324682_46_771 234
62 3300048091 Ga0495626_0076323 Ga0495626_0076323_723_1469 234
63 3300048927 Ga0496124_0016806 Ga0496124_0016806_3837_4562 234
64 3300048929 Ga0496126_0067784 Ga0496126_0067784_1202_1927 234
65 3300053156 Ga0500622_0024467 Ga0500622_0024467_546_1271 234
66 iso_pu_bacteria 2643221639 2644221723 234
67 iso_pu_bacteria 2738541337 2739058503 234
68 3300003759 Ga0055525_1000011 Ga0055525_1000011458 235
69 3300003759 Ga0055525_1000046 Ga0055525_100004646 235
70 3300025230 Ga0209563_100005 Ga0209563_100005784 235
71 3300042876 Ga0451577_0000114 Ga0451577_0000114_25486_26211 235
72 3300044712 Ga0453684_0001710 Ga0453684_0001710_25551_26276 235
73 3300045051 Ga0451576_0003831 Ga0451576_0003831_14398_15123 235
74 iso_pu_bacteria 2643221646 2644257499 235
75 iso_pu_bacteria 2928115317 2928115964 235
76 3300003316 rootH1_10011082 rootH1_100110825 236
77 3300003322 rootL2_10006242 rootL2_100062424 236
78 3300003794 Ga0055531_10000172 Ga0055531_1000017219 236
79 3300005262 Ga0065165_1000230 Ga0065165_100023049 236
80 3300009148 Ga0105243_10064750 Ga0105243_100647504 236
81 3300025303 Ga0209051_1001527 Ga0209051_100152719 236
82 3300025304 Ga0209257_1000017 Ga0209257_1000017472 236
83 3300025935 Ga0207709_10067565 Ga0207709_100675653 236
84 3300031548 Ga0307408_100000046 Ga0307408_100000046144 236
85 3300032005 Ga0307411_10002107 Ga0307411_100021078 236
86 3300037471 Ga0395905_0001081 Ga0395905_0001081_7765_8499 236
87 3300044712 Ga0453684_0514284 Ga0453684_0514284_430_1164 236
88 3300044712 Ga0453684_0698711 Ga0453684_0698711_309_1043 236
89 3300045051 Ga0451576_0112992 Ga0451576_0112992_520_1251 236
90 3300049129 Ga0501309_014454 Ga0501309_014454_219_953 236
91 3300049523 Ga0501300_009381 Ga0501300_009381_291_1025 236
92 3300049662 Ga0501222_001756 Ga0501222_001756_1547_2281 236
93 3300049663 Ga0501223_019701 Ga0501223_019701_575_1309 236
94 3300049683 Ga0501253_015674 Ga0501253_015674_182_916 236
95 3300049704 Ga0501221_005867 Ga0501221_005867_859_1593 236
96 3300049762 Ga0501265_001954 Ga0501265_001954_1035_1769 236
97 3300049764 Ga0501267_002105 Ga0501267_002105_559_1293 236
98 iso_pu_bacteria 2721755523 2722882646 236
99 iso_pu_bacteria 2839138175 2839143267 236
100 iso_pu_bacteria 2585428058 2587734802 237
101 iso_pu_bacteria 2585428062 2587760232 237
102 iso_pu_bacteria 2588253510 2588295380 237
103 3300005614 Ga0068856_100068699 Ga0068856_1000686994 238
104 3300006195 Ga0075366_10001141 Ga0075366_1000114110 238
105 3300026078 Ga0207702_10048355 Ga0207702_100483552 238
106 3300031649 Ga0307514_10006986 Ga0307514_100069864 238
107 3300042004 Ga0439445_0034439 Ga0439445_0034439_133_876 238
108 3300050493 nmdc:mga0k408_1107_c1 nmdc:mga0k408_1107_c1_10463_11203 238
109 iso_pu_bacteria 2881101125 2881101729 238
110 3300003761 Ga0055535_1000177 Ga0055535_100017754 239
111 3300003763 Ga0055529_1000346 Ga0055529_100034627 239
112 3300005337 Ga0070682_100172320 Ga0070682_1001723202 239
113 3300005455 Ga0070663_100000172 Ga0070663_1000001727 239
114 3300009147 Ga0114129_10118444 Ga0114129_101184445 239
115 3300021361 Ga0213872_10000129 Ga0213872_1000012965 239
116 3300021361 Ga0213872_10017841 Ga0213872_100178414 239
117 3300021361 Ga0213872_10037201 Ga0213872_100372013 239
118 3300021361 Ga0213872_10112089 Ga0213872_101120892 239
119 3300025242 Ga0209258_100146 Ga0209258_100146145 239
120 3300025256 Ga0209759_1001457 Ga0209759_10014579 239
121 3300025272 Ga0209455_1000059 Ga0209455_1000059145 239
122 3300026067 Ga0207678_10000478 Ga0207678_100004788 239
123 3300031235 Ga0265330_10000117 Ga0265330_1000011758 239
124 3300031238 Ga0265332_10000002 Ga0265332_10000002383 239
125 3300031456 Ga0307513_10000010 Ga0307513_10000010272 239
126 3300031711 Ga0265314_10000012 Ga0265314_100000122 239
127 3300039447 Ga0436361_0029649 Ga0436361_0029649_2200_2946 239
128 3300039447 Ga0436361_0257745 Ga0436361_0257745_3031_3774 239
129 3300039447 Ga0436361_0362737 Ga0436361_0362737_1340_2083 239
130 3300039447 Ga0436361_0650099 Ga0436361_0650099_13709_14455 239
131 3300046660 Ga0495625_0163982 Ga0495625_0163982_524_1261 239
132 3300050507 nmdc:mga05p37_129068_c1 nmdc:mga05p37_129068_c1_62_793 239
133 iso_pu_bacteria 2585428057 2587730065 239
134 iso_pu_bacteria 2643221660 2644340065 239
135 iso_pu_bacteria 2738543012 2739244706 239
136 iso_pu_bacteria 2816332133 2816475087 239
137 iso_pu_bacteria 2842718218 2842719796 239
138 3300003792 Ga0055540_1011016 Ga0055540_10110162 240
139 3300003794 Ga0055531_10000358 Ga0055531_1000035822 240
140 3300005355 Ga0070671_100011544 Ga0070671_1000115445 240
141 3300005356 Ga0070674_100023714 Ga0070674_1000237143 240
142 3300005539 Ga0068853_100913355 Ga0068853_1009133551 240
143 3300005719 Ga0068861_100159011 Ga0068861_1001590112 240
144 3300005841 Ga0068863_100261287 Ga0068863_1002612872 240
145 3300005844 Ga0068862_100071372 Ga0068862_1000713722 240
146 3300005844 Ga0068862_100294454 Ga0068862_1002944542 240
147 3300006353 Ga0075370_10019470 Ga0075370_100194703 240
148 3300006846 Ga0075430_100074859 Ga0075430_1000748592 240
149 3300006880 Ga0075429_100013802 Ga0075429_1000138023 240
150 3300006946 Ga0079104_1000025 Ga0079104_100002596 240
151 3300009148 Ga0105243_10000881 Ga0105243_1000088115 240
152 3300009148 Ga0105243_10017699 Ga0105243_100176994 240
153 3300009148 Ga0105243_10046506 Ga0105243_100465062 240
154 3300009176 Ga0105242_10155515 Ga0105242_101555152 240
155 3300009177 Ga0105248_10001394 Ga0105248_1000139419 240
156 3300009553 Ga0105249_10062903 Ga0105249_100629032 240
157 3300025303 Ga0209051_1000140 Ga0209051_100014071 240
158 3300025303 Ga0209051_1012820 Ga0209051_10128204 240
159 3300025304 Ga0209257_1000012 Ga0209257_1000012769 240
160 3300025304 Ga0209257_1000045 Ga0209257_1000045175 240
161 3300025711 Ga0207696_1046952 Ga0207696_10469522 240
162 3300025910 Ga0207684_10047582 Ga0207684_100475821 240
163 3300025934 Ga0207686_10214102 Ga0207686_102141022 240
164 3300025935 Ga0207709_10000159 Ga0207709_1000015961 240
165 3300025935 Ga0207709_10020701 Ga0207709_100207014 240
166 3300025935 Ga0207709_10312762 Ga0207709_103127622 240
167 3300025940 Ga0207691_10296112 Ga0207691_102961121 240
168 3300025941 Ga0207711_10010519 Ga0207711_100105192 240
169 3300025961 Ga0207712_10028278 Ga0207712_100282784 240
170 3300025961 Ga0207712_10449266 Ga0207712_104492661 240
171 3300026088 Ga0207641_10197851 Ga0207641_101978512 240
172 3300027111 Ga0209281_1000007 Ga0209281_1000007125 240
173 3300027876 Ga0209974_10006645 Ga0209974_100066455 240
174 3300028380 Ga0268265_10059385 Ga0268265_100593853 240
175 3300031507 Ga0307509_10391707 Ga0307509_103917072 240
176 3300031730 Ga0307516_10004865 Ga0307516_1000486513 240
177 3300031730 Ga0307516_10311992 Ga0307516_103119922 240
178 3300034818 Ga0373950_0001730 Ga0373950_0001730_260_1009 240
179 3300035088 Ga0373940_0029217 Ga0373940_0029217_343_1092 240
180 3300035114 Ga0373939_0000134 Ga0373939_0000134_17588_18337 240
181 3300035121 Ga0373960_0000060 Ga0373960_0000060_11207_11956 240
182 3300035241 Ga0373961_0060848 Ga0373961_0060848_328_1077 240
183 3300035691 Ga0373931_0001710 Ga0373931_0001710_6502_7245 240
184 3300035691 Ga0373931_0009130 Ga0373931_0009130_3483_4232 240
185 3300037471 Ga0395905_0006990 Ga0395905_0006990_3325_4062 240
186 3300037471 Ga0395905_0028506 Ga0395905_0028506_295_1032 240
187 3300037471 Ga0395905_0104308 Ga0395905_0104308_1458_2213 240
188 3300042126 Ga0450888_000157 Ga0450888_000157_313_1062 240
189 3300042127 Ga0450890_000648 Ga0450890_000648_938_1687 240
190 3300042144 Ga0450889_002440 Ga0450889_002440_182_931 240
191 3300042530 Ga0450916_008020 Ga0450916_008020_456_1205 240
192 3300042532 Ga0450893_0006610 Ga0450893_0006610_272_1021 240
193 3300044719 Ga0466971_0166188 Ga0466971_0166188_180_914 240
194 3300046507 Ga0495606_0110943 Ga0495606_0110943_827_1570 240
195 3300048907 Ga0496104_0365663 Ga0496104_0365663_445_1182 240
196 3300048911 Ga0496108_0147760 Ga0496108_0147760_922_1659 240
197 3300048912 Ga0496109_0098397 Ga0496109_0098397_1570_2307 240
198 3300048915 Ga0496112_0013286 Ga0496112_0013286_2330_3067 240
199 3300048916 Ga0496113_0019299 Ga0496113_0019299_3423_4160 240
200 3300049568 Ga0501031_0044698 Ga0501031_0044698_1431_2171 240
201 3300049579 Ga0501043_0000149 Ga0501043_0000149_28835_29572 240
202 3300049580 Ga0501046_0000092 Ga0501046_0000092_35687_36424 240
203 3300049581 Ga0501047_0000028 Ga0501047_0000028_190882_191619 240
204 3300049582 Ga0501048_0000097 Ga0501048_0000097_28229_28966 240
205 3300049649 Ga0501198_000039 Ga0501198_000039_45602_46342 240
206 3300049662 Ga0501222_000043 Ga0501222_000043_45602_46342 240
207 3300049763 Ga0501266_000210 Ga0501266_000210_5363_6109 240
208 3300049824 Ga0501045_0002894 Ga0501045_0002894_10636_11373 240
209 3300050493 nmdc:mga0k408_387263_c1 nmdc:mga0k408_387263_c1_22_759 240
210 3300050496 nmdc:mga07m45_4099_c1 nmdc:mga07m45_4099_c1_2548_3297 240
211 3300050508 nmdc:mga09592_965_c1 nmdc:mga09592_965_c1_1391_2131 240
212 3300050509 nmdc:mga0qj67_175370_c1 nmdc:mga0qj67_175370_c1_340_1080 240
213 3300053148 Ga0500590_044082 Ga0500590_044082_259_996 240
214 iso_pu_bacteria 2511231002 2511245226 240
215 iso_pu_bacteria 2643221592 2643971682 240
216 iso_pu_bacteria 2643221625 2644139767 240
217 iso_pu_bacteria 2643221648 2644272595 240
218 iso_pu_bacteria 2842733646 2842735188 240
219 iso_pu_bacteria 2842747753 2842751068 240
220 iso_pu_bacteria 2974320154 2974323873 240
221 3300003215 JGI25153J46596_10001674 JGI25153J46596_100016743 241
222 3300003771 Ga0055526_1001196 Ga0055526_10011967 241
223 3300003775 Ga0055524_1000182 Ga0055524_100018256 241
224 3300003791 Ga0055530_10003939 Ga0055530_100039394 241
225 3300003792 Ga0055540_1000233 Ga0055540_10002335 241
226 3300005262 Ga0065165_1001066 Ga0065165_100106612 241
227 3300005328 Ga0070676_10109041 Ga0070676_101090411 241
228 3300005339 Ga0070660_100062158 Ga0070660_1000621583 241
229 3300005344 Ga0070661_100002048 Ga0070661_1000020487 241
230 3300005347 Ga0070668_100121311 Ga0070668_1001213111 241
231 3300005366 Ga0070659_100000684 Ga0070659_10000068418 241
232 3300005366 Ga0070659_100036638 Ga0070659_1000366383 241
233 3300005456 Ga0070678_100378795 Ga0070678_1003787952 241
234 3300005467 Ga0070706_100780930 Ga0070706_1007809301 241
235 3300005539 Ga0068853_100547719 Ga0068853_1005477191 241
236 3300005543 Ga0070672_100155866 Ga0070672_1001558661 241
237 3300005564 Ga0070664_100011468 Ga0070664_1000114683 241
238 3300005616 Ga0068852_100278126 Ga0068852_1002781262 241
239 3300006038 Ga0075365_10174636 Ga0075365_101746362 241
240 3300006048 Ga0075363_100134428 Ga0075363_1001344282 241
241 3300006178 Ga0075367_10014386 Ga0075367_100143864 241
242 3300006195 Ga0075366_10083048 Ga0075366_100830482 241
243 3300006195 Ga0075366_10145137 Ga0075366_101451372 241
244 3300006353 Ga0075370_10067947 Ga0075370_100679472 241
245 3300009093 Ga0105240_10050723 Ga0105240_100507233 241
246 3300009098 Ga0105245_10371897 Ga0105245_103718972 241
247 3300009545 Ga0105237_10002681 Ga0105237_1000268111 241
248 3300009551 Ga0105238_10010268 Ga0105238_100102683 241
249 3300010375 Ga0105239_10001896 Ga0105239_1000189614 241
250 3300025245 Ga0207425_1000332 Ga0207425_100033227 241
251 3300025256 Ga0209759_1001102 Ga0209759_10011028 241
252 3300025258 Ga0209129_1000012 Ga0209129_1000012499 241
253 3300025273 Ga0209673_1003959 Ga0209673_10039598 241
254 3300025295 Ga0209564_1000022 Ga0209564_100002215 241
255 3300025297 Ga0209758_1000356 Ga0209758_100035663 241
256 3300025297 Ga0209758_1000708 Ga0209758_100070815 241
257 3300025298 Ga0209050_1002670 Ga0209050_10026708 241
258 3300025303 Ga0209051_1000155 Ga0209051_10001556 241
259 3300025304 Ga0209257_1000236 Ga0209257_10002366 241
260 3300025304 Ga0209257_1040128 Ga0209257_10401282 241
261 3300025909 Ga0207705_10034666 Ga0207705_100346664 241
262 3300025909 Ga0207705_10270512 Ga0207705_102705122 241
263 3300025913 Ga0207695_10037040 Ga0207695_100370405 241
264 3300025914 Ga0207671_10002325 Ga0207671_1000232518 241
265 3300025919 Ga0207657_10010303 Ga0207657_100103034 241
266 3300025919 Ga0207657_10229529 Ga0207657_102295292 241
267 3300025920 Ga0207649_10005919 Ga0207649_100059195 241
268 3300025924 Ga0207694_10013570 Ga0207694_100135702 241
269 3300025932 Ga0207690_10005848 Ga0207690_100058484 241
270 3300025933 Ga0207706_10071708 Ga0207706_100717084 241
271 3300025945 Ga0207679_10003912 Ga0207679_100039126 241
272 3300025961 Ga0207712_10479238 Ga0207712_104792382 241
273 3300026041 Ga0207639_10083956 Ga0207639_100839563 241
274 3300026067 Ga0207678_10235881 Ga0207678_102358812 241
275 3300027252 Ga0209973_1006169 Ga0209973_10061692 241
276 3300027876 Ga0209974_10002379 Ga0209974_100023793 241
277 3300027876 Ga0209974_10005889 Ga0209974_100058892 241
278 3300028786 Ga0307517_10091779 Ga0307517_100917792 241
279 3300028794 Ga0307515_10000026 Ga0307515_10000026110 241
280 3300028794 Ga0307515_10000051 Ga0307515_10000051200 241
281 3300028794 Ga0307515_10000132 Ga0307515_1000013252 241
282 3300028794 Ga0307515_10000305 Ga0307515_1000030518 241
283 3300028794 Ga0307515_10038818 Ga0307515_100388187 241
284 3300031456 Ga0307513_10015459 Ga0307513_100154594 241
285 3300031507 Ga0307509_10010432 Ga0307509_1001043211 241
286 3300031616 Ga0307508_10000098 Ga0307508_1000009811 241
287 3300031649 Ga0307514_10008269 Ga0307514_100082693 241
288 3300031730 Ga0307516_10004343 Ga0307516_1000434318 241
289 3300031911 Ga0307412_10112312 Ga0307412_101123122 241
290 3300034820 Ga0373959_0021287 Ga0373959_0021287_268_1020 241
291 3300035691 Ga0373931_0068429 Ga0373931_0068429_499_1251 241
292 3300037471 Ga0395905_0683946 Ga0395905_0683946_82_831 241
293 3300039450 Ga0436363_0690192 Ga0436363_0690192_49_792 241
294 3300041458 Ga0451798_0843930 Ga0451798_0843930_296_1036 241
295 3300041463 Ga0451804_0897864 Ga0451804_0897864_433_1173 241
296 3300041486 Ga0451807_1692089 Ga0451807_1692089_215_955 241
297 3300042004 Ga0439445_0008876 Ga0439445_0008876_385_1131 241
298 3300042012 Ga0439455_0057914 Ga0439455_0057914_201_950 241
299 3300042115 Ga0450911_001002 Ga0450911_001002_3637_4383 241
300 3300042121 Ga0450919_000793 Ga0450919_000793_1269_2015 241
301 3300042435 Ga0439434_0029442 Ga0439434_0029442_759_1520 241
302 3300042531 Ga0450918_000287 Ga0450918_000287_5934_6680 241
303 3300044656 Ga0466969_0000017 Ga0466969_0000017_44656_45405 241
304 3300044684 Ga0466966_0002454 Ga0466966_0002454_8444_9193 241
305 3300044712 Ga0453684_0441023 Ga0453684_0441023_268_1008 241
306 3300044765 Ga0466970_0091123 Ga0466970_0091123_359_1108 241
307 3300045049 Ga0466959_0101685 Ga0466959_0101685_686_1435 241
308 3300045976 Ga0466967_0353253 Ga0466967_0353253_151_924 241
309 3300046460 Ga0495638_0083200 Ga0495638_0083200_746_1486 241
310 3300046471 Ga0495650_0010155 Ga0495650_0010155_646_1386 241
311 3300046519 Ga0495632_0009453 Ga0495632_0009453_174_914 241
312 3300046525 Ga0495663_0015892 Ga0495663_0015892_845_1594 241
313 3300046528 Ga0495642_0099720 Ga0495642_0099720_158_907 241
314 3300046674 Ga0495588_0223682 Ga0495588_0223682_159_908 241
315 3300046683 Ga0495658_0319442 Ga0495658_0319442_89_826 241
316 3300048905 Ga0496102_0008536 Ga0496102_0008536_739_1476 241
317 3300048907 Ga0496104_0549326 Ga0496104_0549326_134_886 241
318 3300048924 Ga0496121_0017655 Ga0496121_0017655_2887_3633 241
319 3300048928 Ga0496125_0016741 Ga0496125_0016741_4220_4966 241
320 3300048929 Ga0496126_0280036 Ga0496126_0280036_235_981 241
321 3300049521 Ga0501298_038442 Ga0501298_038442_87_866 241
322 3300050490 nmdc:mga03n38_50977_c1 nmdc:mga03n38_50977_c1_333_1073 241
323 3300050492 nmdc:mga0yw44_69875_c1 nmdc:mga0yw44_69875_c1_1211_1948 241
324 3300050493 nmdc:mga0k408_133236_c1 nmdc:mga0k408_133236_c1_438_1178 241
325 3300050493 nmdc:mga0k408_53199_c1 nmdc:mga0k408_53199_c1_1197_1949 241
326 3300050496 nmdc:mga07m45_85631_c1 nmdc:mga07m45_85631_c1_972_1712 241
327 3300053092 Ga0500583_0088168 Ga0500583_0088168_634_1404 241
328 3300053093 Ga0500651_0003537 Ga0500651_0003537_2141_2881 241
329 3300053117 Ga0500593_001079 Ga0500593_001079_3662_4399 241
330 3300053131 Ga0500652_000757 Ga0500652_000757_7179_7919 241
331 3300053134 Ga0500658_0180596 Ga0500658_0180596_109_873 241
332 3300053139 Ga0500568_0015423 Ga0500568_0015423_2507_3247 241
333 3300053154 Ga0500619_000137 Ga0500619_000137_11284_12021 241
334 3300053156 Ga0500622_0001329 Ga0500622_0001329_12334_13074 241
335 iso_pu_bacteria 2547132374 2548498588 241
336 iso_pu_bacteria 2643221570 2643865409 241
337 iso_pu_bacteria 2643221596 2643990613 241
338 iso_pu_bacteria 2643221652 2644296116 241
339 iso_pu_bacteria 2643221717 2644649323 241
340 iso_pu_bacteria 2894023352 2894025684 241
341 iso_pu_bacteria 2939631187 2939636096 241
342 iso_pu_bacteria 2990710928 2990711996 241
343 3300002705 JGI25156J39149_1000076 JGI25156J39149_10000768 242
344 3300002705 JGI25156J39149_1020167 JGI25156J39149_10201672 242
345 3300002738 JGI25154J39366_1003428 JGI25154J39366_10034283 242
346 3300002741 JGI25157J39369_1000037 JGI25157J39369_100003795 242
347 3300003316 rootH1_10027198 rootH1_100271984 242
348 3300003752 Ga0055539_1000180 Ga0055539_100018035 242
349 3300003752 Ga0055539_1003887 Ga0055539_10038872 242
350 3300003756 Ga0055533_1000169 Ga0055533_10001699 242
351 3300003759 Ga0055525_1000526 Ga0055525_100052611 242
352 3300005327 Ga0070658_10228945 Ga0070658_102289452 242
353 3300005328 Ga0070676_10014095 Ga0070676_100140952 242
354 3300005330 Ga0070690_100096685 Ga0070690_1000966852 242
355 3300005331 Ga0070670_100137157 Ga0070670_1001371573 242
356 3300005334 Ga0068869_100009616 Ga0068869_1000096167 242
357 3300005338 Ga0068868_100003572 Ga0068868_10000357211 242
358 3300005338 Ga0068868_100127576 Ga0068868_1001275762 242
359 3300005354 Ga0070675_100028517 Ga0070675_1000285174 242
360 3300005364 Ga0070673_100001255 Ga0070673_1000012558 242
361 3300005364 Ga0070673_100035122 Ga0070673_1000351225 242
362 3300005364 Ga0070673_100483671 Ga0070673_1004836712 242
363 3300005367 Ga0070667_100141133 Ga0070667_1001411332 242
364 3300005367 Ga0070667_100272803 Ga0070667_1002728032 242
365 3300005459 Ga0068867_100035855 Ga0068867_1000358552 242
366 3300005535 Ga0070684_100070877 Ga0070684_1000708772 242
367 3300005539 Ga0068853_100071386 Ga0068853_1000713862 242
368 3300005543 Ga0070672_100009784 Ga0070672_1000097846 242
369 3300005548 Ga0070665_100011217 Ga0070665_10001121711 242
370 3300005563 Ga0068855_100002721 Ga0068855_1000027219 242
371 3300005563 Ga0068855_100584798 Ga0068855_1005847982 242
372 3300005577 Ga0068857_100001142 Ga0068857_1000011428 242
373 3300005577 Ga0068857_100056777 Ga0068857_1000567775 242
374 3300005578 Ga0068854_100002016 Ga0068854_1000020162 242
375 3300005614 Ga0068856_100005635 Ga0068856_1000056353 242
376 3300005618 Ga0068864_100006013 Ga0068864_1000060138 242
377 3300005719 Ga0068861_100038355 Ga0068861_1000383553 242
378 3300005841 Ga0068863_100010184 Ga0068863_1000101845 242
379 3300005842 Ga0068858_100441145 Ga0068858_1004411452 242
380 3300006177 Ga0075362_10066929 Ga0075362_100669292 242
381 3300006358 Ga0068871_100180653 Ga0068871_1001806532 242
382 3300009093 Ga0105240_10040427 Ga0105240_100404274 242
383 3300009093 Ga0105240_10063922 Ga0105240_100639223 242
384 3300009174 Ga0105241_10966884 Ga0105241_109668841 242
385 3300010375 Ga0105239_10010428 Ga0105239_100104284 242
386 3300013105 Ga0157369_10108715 Ga0157369_101087153 242
387 3300013296 Ga0157374_10219015 Ga0157374_102190153 242
388 3300013297 Ga0157378_10066654 Ga0157378_100666543 242
389 3300014968 Ga0157379_10258325 Ga0157379_102583252 242
390 3300014969 Ga0157376_10077188 Ga0157376_100771882 242
391 3300025226 Ga0209674_100165 Ga0209674_10016526 242
392 3300025230 Ga0209563_100137 Ga0209563_10013726 242
393 3300025231 Ga0207427_101146 Ga0207427_1011465 242
394 3300025242 Ga0209258_100973 Ga0209258_1009734 242
395 3300025246 Ga0209646_1000062 Ga0209646_1000062192 242
396 3300025250 Ga0209026_1000026 Ga0209026_100002620 242
397 3300025253 Ga0209677_100124 Ga0209677_10012460 242
398 3300025253 Ga0209677_100191 Ga0209677_10019139 242
399 3300025253 Ga0209677_101539 Ga0209677_1015393 242
400 3300025256 Ga0209759_1000050 Ga0209759_1000050161 242
401 3300025256 Ga0209759_1007632 Ga0209759_10076322 242
402 3300025256 Ga0209759_1008489 Ga0209759_10084892 242
403 3300025893 Ga0207682_10076193 Ga0207682_100761932 242
404 3300025907 Ga0207645_10002689 Ga0207645_1000268911 242
405 3300025911 Ga0207654_10022895 Ga0207654_100228953 242
406 3300025913 Ga0207695_10018539 Ga0207695_100185394 242
407 3300025913 Ga0207695_10046644 Ga0207695_100466442 242
408 3300025925 Ga0207650_10098288 Ga0207650_100982884 242
409 3300025926 Ga0207659_10015029 Ga0207659_100150294 242
410 3300025927 Ga0207687_10072680 Ga0207687_100726802 242
411 3300025935 Ga0207709_10174758 Ga0207709_101747582 242
412 3300025940 Ga0207691_10100719 Ga0207691_101007194 242
413 3300025942 Ga0207689_10031852 Ga0207689_100318522 242
414 3300025942 Ga0207689_10128307 Ga0207689_101283072 242
415 3300025949 Ga0207667_10001993 Ga0207667_100019937 242
416 3300025960 Ga0207651_10000893 Ga0207651_100008934 242
417 3300025960 Ga0207651_10201182 Ga0207651_102011822 242
418 3300026023 Ga0207677_10004499 Ga0207677_100044994 242
419 3300026023 Ga0207677_10050885 Ga0207677_100508852 242
420 3300026035 Ga0207703_10118572 Ga0207703_101185721 242
421 3300026078 Ga0207702_10000573 Ga0207702_1000057320 242
422 3300026089 Ga0207648_10017331 Ga0207648_100173317 242
423 3300026116 Ga0207674_10001842 Ga0207674_1000184211 242
424 3300026116 Ga0207674_10152841 Ga0207674_101528412 242
425 3300026116 Ga0207674_10261740 Ga0207674_102617402 242
426 3300026118 Ga0207675_100122801 Ga0207675_1001228012 242
427 3300027665 Ga0209983_1044212 Ga0209983_10442122 242
428 3300028666 Ga0265336_10000119 Ga0265336_1000011941 242
429 3300028794 Ga0307515_10004253 Ga0307515_100042532 242
430 3300028794 Ga0307515_10006880 Ga0307515_100068808 242
431 3300028794 Ga0307515_10013694 Ga0307515_100136946 242
432 3300029957 Ga0265324_10009959 Ga0265324_100099593 242
433 3300030522 Ga0307512_10024522 Ga0307512_100245222 242
434 3300030522 Ga0307512_10139156 Ga0307512_101391562 242
435 3300031456 Ga0307513_10177002 Ga0307513_101770022 242
436 3300031507 Ga0307509_10001286 Ga0307509_100012867 242
437 3300031507 Ga0307509_10013769 Ga0307509_100137696 242
438 3300031507 Ga0307509_10067207 Ga0307509_100672072 242
439 3300031507 Ga0307509_10076047 Ga0307509_100760474 242
440 3300031548 Ga0307408_100321109 Ga0307408_1003211092 242
441 3300031616 Ga0307508_10000159 Ga0307508_1000015947 242
442 3300031649 Ga0307514_10020555 Ga0307514_100205552 242
443 3300031730 Ga0307516_10003066 Ga0307516_100030662 242
444 3300031730 Ga0307516_10003335 Ga0307516_1000333520 242
445 3300031730 Ga0307516_10030498 Ga0307516_100304983 242
446 3300031730 Ga0307516_10212700 Ga0307516_102127002 242
447 3300032005 Ga0307411_10165412 Ga0307411_101654122 242
448 3300033179 Ga0307507_10064389 Ga0307507_100643892 242
449 3300033180 Ga0307510_10002924 Ga0307510_100029247 242
450 3300033180 Ga0307510_10109577 Ga0307510_101095772 242
451 3300034818 Ga0373950_0018591 Ga0373950_0018591_260_1024 242
452 3300035691 Ga0373931_0055604 Ga0373931_0055604_1277_2041 242
453 3300037466 Ga0395898_0134229 Ga0395898_0134229_1499_2254 242
454 3300038443 Ga0395901_0001599 Ga0395901_0001599_21198_21953 242
455 3300041453 Ga0451797_0933919 Ga0451797_0933919_285_1058 242
456 3300041460 Ga0451802_0937156 Ga0451802_0937156_113_853 242
457 3300041491 Ga0451833_1270813 Ga0451833_1270813_88_828 242
458 3300044656 Ga0466969_0025097 Ga0466969_0025097_1071_1826 242
459 3300044658 Ga0466972_0090890 Ga0466972_0090890_66_878 242
460 3300044683 Ga0466965_0018420 Ga0466965_0018420_2302_3057 242
461 3300044683 Ga0466965_0024197 Ga0466965_0024197_977_1723 242
462 3300044683 Ga0466965_0045731 Ga0466965_0045731_1060_1803 242
463 3300044693 Ga0466961_0000655 Ga0466961_0000655_16048_16803 242
464 3300044706 Ga0466964_0055191 Ga0466964_0055191_143_898 242
465 3300044719 Ga0466971_0011261 Ga0466971_0011261_1672_2427 242
466 3300044735 Ga0466968_0010399 Ga0466968_0010399_928_1686 242
467 3300044735 Ga0466968_0013533 Ga0466968_0013533_1283_2056 242
468 3300044842 Ga0466957_0147629 Ga0466957_0147629_84_839 242
469 3300044901 Ga0466960_0049038 Ga0466960_0049038_906_1652 242
470 3300044901 Ga0466960_0063358 Ga0466960_0063358_960_1715 242
471 3300045049 Ga0466959_0044517 Ga0466959_0044517_1364_2119 242
472 3300046454 Ga0495592_0000205 Ga0495592_0000205_43953_44735 242
473 3300046506 Ga0495583_0000585 Ga0495583_0000585_19854_20609 242
474 3300046507 Ga0495606_0005296 Ga0495606_0005296_9984_10739 242
475 3300046512 Ga0495610_0019044 Ga0495610_0019044_92_868 242
476 3300046512 Ga0495610_0020856 Ga0495610_0020856_1685_2425 242
477 3300046515 Ga0495620_0024574 Ga0495620_0024574_1672_2448 242
478 3300046515 Ga0495620_0062267 Ga0495620_0062267_359_1099 242
479 3300046519 Ga0495632_0106960 Ga0495632_0106960_295_1035 242
480 3300046616 Ga0495668_0020891 Ga0495668_0020891_2214_2969 242
481 3300046660 Ga0495625_0002218 Ga0495625_0002218_16090_16830 242
482 3300046660 Ga0495625_0051677 Ga0495625_0051677_1367_2122 242
483 3300046690 Ga0495624_0137503 Ga0495624_0137503_415_1179 242
484 3300046692 Ga0495671_0073676 Ga0495671_0073676_231_980 242
485 3300046694 Ga0495649_0008123 Ga0495649_0008123_2807_3562 242
486 3300046794 Ga0495589_0068403 Ga0495589_0068403_899_1654 242
487 3300047321 Ga0495676_0171497 Ga0495676_0171497_513_1277 242
488 3300047472 Ga0495686_0003630 Ga0495686_0003630_130_906 242
489 3300047472 Ga0495686_0007475 Ga0495686_0007475_4920_5675 242
490 3300047472 Ga0495686_0066710 Ga0495686_0066710_631_1371 242
491 3300047673 Ga0495593_0083841 Ga0495593_0083841_369_1133 242
492 3300049760 Ga0501263_002339 Ga0501263_002339_301_1041 242
493 3300050493 nmdc:mga0k408_171182_c1 nmdc:mga0k408_171182_c1_124_879 242
494 3300050493 nmdc:mga0k408_81161_c1 nmdc:mga0k408_81161_c1_645_1385 242
495 3300053080 Ga0500635_0000129 Ga0500635_0000129_42645_43400 242
496 3300053086 Ga0500578_0197124 Ga0500578_0197124_322_1077 242
497 3300053093 Ga0500651_0018573 Ga0500651_0018573_2463_3239 242
498 3300053118 Ga0500594_0001531 Ga0500594_0001531_1485_2261 242
499 3300053134 Ga0500658_0002796 Ga0500658_0002796_3104_3844 242
500 3300053136 Ga0500559_0000134 Ga0500559_0000134_20901_21677 242
501 3300053156 Ga0500622_0011384 Ga0500622_0011384_636_1412 242
502 3300053177 Ga0500636_0015073 Ga0500636_0015073_339_1094 242
503 3300055283 Ga0500661_006420 Ga0500661_006420_1337_2092 242
504 3300059421 Ga0590071_001197 Ga0590071_001197_3342_4112 242
505 iso_pu_bacteria 2643221609 2644062605 242
506 iso_pu_bacteria 2643221611 2644076369 242
507 iso_pu_bacteria 2643221654 2644302003 242
508 iso_pu_bacteria 2643221683 2644468070 242
509 iso_pu_bacteria 2738543013 2739250732 242
510 iso_pu_bacteria 2842677519 2842678935 242
511 iso_pu_bacteria 2885192300 2885192387 242
512 iso_pu_bacteria 2919462493 2919467523 242
513 iso_pu_bacteria 2945945610 2945947628 242
514 iso_pu_bacteria 2954767861 2954772528 242
515 3300005327 Ga0070658_10037209 Ga0070658_100372092 243
516 3300005329 Ga0070683_100007080 Ga0070683_10000708012 243
517 3300005331 Ga0070670_100042246 Ga0070670_1000422464 243
518 3300005331 Ga0070670_100146701 Ga0070670_1001467011 243
519 3300005333 Ga0070677_10011451 Ga0070677_100114514 243
520 3300005334 Ga0068869_100020870 Ga0068869_1000208705 243
521 3300005335 Ga0070666_10114086 Ga0070666_101140861 243
522 3300005335 Ga0070666_10335833 Ga0070666_103358331 243
523 3300005336 Ga0070680_100002051 Ga0070680_1000020517 243
524 3300005338 Ga0068868_100003096 Ga0068868_1000030962 243
525 3300005339 Ga0070660_100008509 Ga0070660_1000085099 243
526 3300005339 Ga0070660_100027599 Ga0070660_1000275992 243
527 3300005340 Ga0070689_100116230 Ga0070689_1001162304 243
528 3300005343 Ga0070687_100020311 Ga0070687_1000203115 243
529 3300005344 Ga0070661_100031099 Ga0070661_1000310992 243
530 3300005344 Ga0070661_100214500 Ga0070661_1002145002 243
531 3300005347 Ga0070668_100023518 Ga0070668_1000235186 243
532 3300005353 Ga0070669_100055294 Ga0070669_1000552944 243
533 3300005354 Ga0070675_100000941 Ga0070675_10000094113 243
534 3300005354 Ga0070675_100059896 Ga0070675_1000598963 243
535 3300005355 Ga0070671_100070434 Ga0070671_1000704344 243
536 3300005356 Ga0070674_100053542 Ga0070674_1000535423 243
537 3300005364 Ga0070673_100072816 Ga0070673_1000728164 243
538 3300005366 Ga0070659_100021253 Ga0070659_1000212533 243
539 3300005367 Ga0070667_100004949 Ga0070667_10000494912 243
540 3300005367 Ga0070667_100238931 Ga0070667_1002389312 243
541 3300005441 Ga0070700_100210155 Ga0070700_1002101552 243
542 3300005455 Ga0070663_100023744 Ga0070663_1000237446 243
543 3300005456 Ga0070678_100156816 Ga0070678_1001568163 243
544 3300005457 Ga0070662_100000858 Ga0070662_10000085811 243
545 3300005457 Ga0070662_100013398 Ga0070662_1000133984 243
546 3300005457 Ga0070662_100089516 Ga0070662_1000895162 243
547 3300005459 Ga0068867_100000070 Ga0068867_1000000705 243
548 3300005459 Ga0068867_100075085 Ga0068867_1000750852 243
549 3300005459 Ga0068867_100079661 Ga0068867_1000796612 243
550 3300005530 Ga0070679_100006631 Ga0070679_10000663114 243
551 3300005535 Ga0070684_100031525 Ga0070684_1000315253 243
552 3300005539 Ga0068853_100014437 Ga0068853_1000144379 243
553 3300005539 Ga0068853_100127746 Ga0068853_1001277462 243
554 3300005539 Ga0068853_100641456 Ga0068853_1006414562 243
555 3300005543 Ga0070672_100004411 Ga0070672_10000441111 243
556 3300005543 Ga0070672_100006413 Ga0070672_1000064137 243
557 3300005543 Ga0070672_100232637 Ga0070672_1002326372 243
558 3300005544 Ga0070686_100338066 Ga0070686_1003380661 243
559 3300005548 Ga0070665_100350953 Ga0070665_1003509532 243
560 3300005564 Ga0070664_100005782 Ga0070664_1000057825 243
561 3300005577 Ga0068857_100049769 Ga0068857_1000497695 243
562 3300005577 Ga0068857_100076126 Ga0068857_1000761262 243
563 3300005577 Ga0068857_100084990 Ga0068857_1000849902 243
564 3300005578 Ga0068854_100311665 Ga0068854_1003116652 243
565 3300005614 Ga0068856_100071680 Ga0068856_1000716805 243
566 3300005616 Ga0068852_100002789 Ga0068852_10000278913 243
567 3300005616 Ga0068852_100171428 Ga0068852_1001714282 243
568 3300005616 Ga0068852_100555415 Ga0068852_1005554152 243
569 3300005617 Ga0068859_100041965 Ga0068859_1000419655 243
570 3300005617 Ga0068859_100055554 Ga0068859_1000555542 243
571 3300005618 Ga0068864_100122122 Ga0068864_1001221223 243
572 3300005618 Ga0068864_100160401 Ga0068864_1001604012 243
573 3300005718 Ga0068866_10018175 Ga0068866_100181753 243
574 3300005719 Ga0068861_100003493 Ga0068861_1000034933 243
575 3300005719 Ga0068861_100197171 Ga0068861_1001971713 243
576 3300005841 Ga0068863_100052311 Ga0068863_1000523114 243
577 3300005841 Ga0068863_100202960 Ga0068863_1002029602 243
578 3300005842 Ga0068858_100003457 Ga0068858_10000345711 243
579 3300005842 Ga0068858_100007880 Ga0068858_1000078804 243
580 3300005843 Ga0068860_100010521 Ga0068860_10001052111 243
581 3300005843 Ga0068860_100027642 Ga0068860_1000276423 243
582 3300005843 Ga0068860_100147158 Ga0068860_1001471582 243
583 3300005844 Ga0068862_100046531 Ga0068862_1000465314 243
584 3300006038 Ga0075365_10344941 Ga0075365_103449412 243
585 3300006195 Ga0075366_10105250 Ga0075366_101052502 243
586 3300006237 Ga0097621_100018737 Ga0097621_1000187376 243
587 3300006358 Ga0068871_100107790 Ga0068871_1001077902 243
588 3300006358 Ga0068871_100297967 Ga0068871_1002979672 243
589 3300006881 Ga0068865_100021548 Ga0068865_1000215484 243
590 3300006931 Ga0097620_100041965 Ga0097620_1000419655 243
591 3300006931 Ga0097620_100055553 Ga0097620_1000555532 243
592 3300009098 Ga0105245_10095403 Ga0105245_100954033 243
593 3300009148 Ga0105243_10001208 Ga0105243_100012083 243
594 3300009148 Ga0105243_10094187 Ga0105243_100941874 243
595 3300009148 Ga0105243_10129738 Ga0105243_101297382 243
596 3300009177 Ga0105248_10003839 Ga0105248_1000383918 243
597 3300009545 Ga0105237_10162787 Ga0105237_101627874 243
598 3300009553 Ga0105249_10071057 Ga0105249_100710573 243
599 3300010375 Ga0105239_10075364 Ga0105239_100753646 243
600 3300013100 Ga0157373_10016739 Ga0157373_100167394 243
601 3300013104 Ga0157370_10383422 Ga0157370_103834222 243
602 3300013105 Ga0157369_10008315 Ga0157369_100083159 243
603 3300013296 Ga0157374_10236678 Ga0157374_102366782 243
604 3300013297 Ga0157378_10196196 Ga0157378_101961963 243
605 3300013306 Ga0163162_10081416 Ga0163162_100814164 243
606 3300013308 Ga0157375_10005240 Ga0157375_1000524016 243
607 3300013308 Ga0157375_10040743 Ga0157375_100407434 243
608 3300013308 Ga0157375_10178174 Ga0157375_101781742 243
609 3300013308 Ga0157375_10453307 Ga0157375_104533072 243
610 3300014325 Ga0163163_10135864 Ga0163163_101358644 243
611 3300014326 Ga0157380_10039716 Ga0157380_100397163 243
612 3300014326 Ga0157380_10126388 Ga0157380_101263882 243
613 3300014326 Ga0157380_10144000 Ga0157380_101440003 243
614 3300014326 Ga0157380_10547814 Ga0157380_105478141 243
615 3300014745 Ga0157377_10000016 Ga0157377_1000001678 243
616 3300014745 Ga0157377_10000848 Ga0157377_1000084813 243
617 3300014968 Ga0157379_10004851 Ga0157379_100048515 243
618 3300014968 Ga0157379_10020286 Ga0157379_100202867 243
619 3300014968 Ga0157379_10072230 Ga0157379_100722302 243
620 3300014968 Ga0157379_10172089 Ga0157379_101720893 243
621 3300014969 Ga0157376_10007038 Ga0157376_100070384 243
622 3300017792 Ga0163161_10099189 Ga0163161_100991893 243
623 3300025893 Ga0207682_10003745 Ga0207682_100037456 243
624 3300025899 Ga0207642_10017237 Ga0207642_100172374 243
625 3300025901 Ga0207688_10027810 Ga0207688_100278104 243
626 3300025907 Ga0207645_10037411 Ga0207645_100374113 243
627 3300025912 Ga0207707_10218777 Ga0207707_102187772 243
628 3300025917 Ga0207660_10006938 Ga0207660_100069385 243
629 3300025919 Ga0207657_10011313 Ga0207657_100113135 243
630 3300025920 Ga0207649_10210734 Ga0207649_102107342 243
631 3300025921 Ga0207652_10009264 Ga0207652_100092649 243
632 3300025923 Ga0207681_10015010 Ga0207681_100150102 243
633 3300025923 Ga0207681_10020476 Ga0207681_100204763 243
634 3300025923 Ga0207681_10090407 Ga0207681_100904072 243
635 3300025925 Ga0207650_10006156 Ga0207650_100061569 243
636 3300025926 Ga0207659_10127859 Ga0207659_101278593 243
637 3300025927 Ga0207687_10064217 Ga0207687_100642173 243
638 3300025931 Ga0207644_10000924 Ga0207644_1000092411 243
639 3300025933 Ga0207706_10000272 Ga0207706_1000027222 243
640 3300025933 Ga0207706_10005864 Ga0207706_1000586412 243
641 3300025934 Ga0207686_10037737 Ga0207686_100377374 243
642 3300025934 Ga0207686_10048347 Ga0207686_100483472 243
643 3300025935 Ga0207709_10002246 Ga0207709_100022463 243
644 3300025935 Ga0207709_10019731 Ga0207709_100197316 243
645 3300025935 Ga0207709_10162297 Ga0207709_101622972 243
646 3300025938 Ga0207704_10066684 Ga0207704_100666843 243
647 3300025938 Ga0207704_10111664 Ga0207704_101116642 243
648 3300025938 Ga0207704_10149741 Ga0207704_101497412 243
649 3300025939 Ga0207665_10153165 Ga0207665_101531652 243
650 3300025940 Ga0207691_10000715 Ga0207691_1000071536 243
651 3300025940 Ga0207691_10052011 Ga0207691_100520113 243
652 3300025941 Ga0207711_10004324 Ga0207711_100043244 243
653 3300025941 Ga0207711_10006498 Ga0207711_1000649814 243
654 3300025942 Ga0207689_10000832 Ga0207689_1000083222 243
655 3300025942 Ga0207689_10003940 Ga0207689_100039404 243
656 3300025944 Ga0207661_10007953 Ga0207661_1000795310 243
657 3300025945 Ga0207679_10009078 Ga0207679_1000907810 243
658 3300025945 Ga0207679_10152036 Ga0207679_101520362 243
659 3300025961 Ga0207712_10108195 Ga0207712_101081952 243
660 3300025972 Ga0207668_10158126 Ga0207668_101581263 243
661 3300025981 Ga0207640_10285210 Ga0207640_102852102 243
662 3300025986 Ga0207658_10024952 Ga0207658_100249523 243
663 3300025986 Ga0207658_10031648 Ga0207658_100316483 243
664 3300025986 Ga0207658_10417520 Ga0207658_104175202 243
665 3300026035 Ga0207703_10009878 Ga0207703_100098786 243
666 3300026035 Ga0207703_10066736 Ga0207703_100667364 243
667 3300026041 Ga0207639_10206766 Ga0207639_102067662 243
668 3300026041 Ga0207639_10420623 Ga0207639_104206232 243
669 3300026088 Ga0207641_10064210 Ga0207641_100642102 243
670 3300026088 Ga0207641_10081066 Ga0207641_100810662 243
671 3300026089 Ga0207648_10000412 Ga0207648_100004125 243
672 3300026095 Ga0207676_10071218 Ga0207676_100712182 243
673 3300026095 Ga0207676_10177819 Ga0207676_101778192 243
674 3300026116 Ga0207674_10063585 Ga0207674_100635856 243
675 3300026118 Ga0207675_100000729 Ga0207675_10000072918 243
676 3300026118 Ga0207675_100036720 Ga0207675_1000367203 243
677 3300026121 Ga0207683_10299912 Ga0207683_102999121 243
678 3300026142 Ga0207698_10059115 Ga0207698_100591152 243
679 3300026142 Ga0207698_10256678 Ga0207698_102566783 243
680 3300028379 Ga0268266_10181438 Ga0268266_101814383 243
681 3300028380 Ga0268265_10024728 Ga0268265_100247284 243
682 3300028380 Ga0268265_10152579 Ga0268265_101525793 243
683 3300028381 Ga0268264_10006835 Ga0268264_100068354 243
684 3300028381 Ga0268264_10114353 Ga0268264_101143532 243
685 3300028381 Ga0268264_10218763 Ga0268264_102187631 243
686 3300028794 Ga0307515_10000484 Ga0307515_1000048448 243
687 3300028794 Ga0307515_10103254 Ga0307515_101032544 243
688 3300031456 Ga0307513_10055587 Ga0307513_100555874 243
689 3300031507 Ga0307509_10047789 Ga0307509_100477896 243
690 3300031616 Ga0307508_10030208 Ga0307508_100302085 243
691 3300031649 Ga0307514_10002245 Ga0307514_100022454 243
692 3300031711 Ga0265314_10148724 Ga0265314_101487242 243
693 3300031731 Ga0307405_10098181 Ga0307405_100981813 243
694 3300031995 Ga0307409_100001393 Ga0307409_1000013935 243
695 3300032002 Ga0307416_100388184 Ga0307416_1003881842 243
696 3300032005 Ga0307411_10002164 Ga0307411_1000216410 243
697 3300034957 Ga0373938_0041786 Ga0373938_0041786_73_819 243
698 3300035114 Ga0373939_0044851 Ga0373939_0044851_81_827 243
699 3300035170 Ga0373943_0071869 Ga0373943_0071869_683_1429 243
700 3300035170 Ga0373943_0204047 Ga0373943_0204047_62_808 243
701 3300035242 Ga0373962_0010649 Ga0373962_0010649_110_856 243
702 3300035691 Ga0373931_0001894 Ga0373931_0001894_5846_6592 243
703 3300035724 Ga0373933_0110964 Ga0373933_0110964_881_1627 243
704 3300039437 Ga0436365_1256270 Ga0436365_1256270_2490_3236 243
705 3300041997 Ga0439431_0023603 Ga0439431_0023603_490_1242 243
706 3300042156 Ga0439446_0072822 Ga0439446_0072822_109_861 243
707 3300044658 Ga0466972_0000564 Ga0466972_0000564_14258_15010 243
708 3300045051 Ga0451576_0019880 Ga0451576_0019880_5603_6349 243
709 3300045051 Ga0451576_0078482 Ga0451576_0078482_612_1355 243
710 3300046455 Ga0495603_0143090 Ga0495603_0143090_531_1277 243
711 3300046459 Ga0495629_0425583 Ga0495629_0425583_64_810 243
712 3300046681 Ga0495647_0094437 Ga0495647_0094437_50_796 243
713 3300047471 Ga0495684_0073961 Ga0495684_0073961_584_1330 243
714 3300048090 Ga0495615_0041037 Ga0495615_0041037_98_847 243
715 3300048905 Ga0496102_0420090 Ga0496102_0420090_166_912 243
716 3300048906 Ga0496103_0236788 Ga0496103_0236788_322_1068 243
717 3300048908 Ga0496105_0397226 Ga0496105_0397226_165_911 243
718 3300048909 Ga0496106_0022491 Ga0496106_0022491_931_1677 243
719 3300048910 Ga0496107_0307227 Ga0496107_0307227_47_793 243
720 3300048911 Ga0496108_0252414 Ga0496108_0252414_141_887 243
721 3300048912 Ga0496109_0369296 Ga0496109_0369296_270_1016 243
722 3300048913 Ga0496110_0023240 Ga0496110_0023240_4138_4884 243
723 3300048914 Ga0496111_0053968 Ga0496111_0053968_771_1517 243
724 3300048917 Ga0496114_0254296 Ga0496114_0254296_98_844 243
725 3300048918 Ga0496115_0005962 Ga0496115_0005962_7926_8672 243
726 3300049823 Ga0501044_0071742 Ga0501044_0071742_2660_3403 243
727 3300050493 nmdc:mga0k408_37931_c1 nmdc:mga0k408_37931_c1_643_1440 243
728 3300050493 nmdc:mga0k408_50451_c1 nmdc:mga0k408_50451_c1_1144_1893 243
729 3300050511 nmdc:mga08y16_552283_c1 nmdc:mga08y16_552283_c1_115_861 243
730 3300053086 Ga0500578_0001034 Ga0500578_0001034_8922_9668 243
731 3300053117 Ga0500593_000570 Ga0500593_000570_10689_11474 243
732 3300002705 JGI25156J39149_1000023 JGI25156J39149_100002350 244
733 3300002738 JGI25154J39366_1000036 JGI25154J39366_1000036108 244
734 3300002741 JGI25157J39369_1000023 JGI25157J39369_100002350 244
735 3300002774 JGI25150J39212_1000786 JGI25150J39212_10007869 244
736 3300002774 JGI25150J39212_1004277 JGI25150J39212_10042773 244
737 3300002987 JGI25159J45721_1001003 JGI25159J45721_10010039 244
738 3300002987 JGI25159J45721_1001012 JGI25159J45721_10010129 244
739 3300003187 JGI25151J46595_10007826 JGI25151J46595_100078263 244
740 3300003187 JGI25151J46595_10011776 JGI25151J46595_100117763 244
741 3300003354 JGI25160J50197_1000213 JGI25160J50197_100021335 244
742 3300003374 JGI25161J50226_1000015 JGI25161J50226_1000015108 244
743 3300003771 Ga0055526_1003300 Ga0055526_10033008 244
744 3300003771 Ga0055526_1007561 Ga0055526_10075612 244
745 3300003773 Ga0055537_1000034 Ga0055537_10000347 244
746 3300003773 Ga0055537_1000706 Ga0055537_100070611 244
747 3300003775 Ga0055524_1000016 Ga0055524_1000016137 244
748 3300003784 Ga0055534_1002208 Ga0055534_10022081 244
749 3300003790 Ga0055528_1002347 Ga0055528_10023474 244
750 3300003791 Ga0055530_10000243 Ga0055530_1000024327 244
751 3300003792 Ga0055540_1000031 Ga0055540_1000031146 244
752 3300004625 Ga0055543_1000608 Ga0055543_100060814 244
753 3300005262 Ga0065165_1021019 Ga0065165_10210192 244
754 3300005295 Ga0065707_10085220 Ga0065707_100852202 244
755 3300005330 Ga0070690_100000674 Ga0070690_1000006747 244
756 3300005331 Ga0070670_100001588 Ga0070670_10000158811 244
757 3300005331 Ga0070670_100007193 Ga0070670_1000071935 244
758 3300005333 Ga0070677_10000616 Ga0070677_100006162 244
759 3300005334 Ga0068869_100079183 Ga0068869_1000791832 244
760 3300005335 Ga0070666_10006295 Ga0070666_100062955 244
761 3300005338 Ga0068868_100001668 Ga0068868_10000166815 244
762 3300005345 Ga0070692_10208835 Ga0070692_102088352 244
763 3300005347 Ga0070668_100065066 Ga0070668_1000650663 244
764 3300005353 Ga0070669_100099413 Ga0070669_1000994132 244
765 3300005353 Ga0070669_100103198 Ga0070669_1001031982 244
766 3300005354 Ga0070675_100002761 Ga0070675_1000027616 244
767 3300005354 Ga0070675_100012995 Ga0070675_1000129956 244
768 3300005354 Ga0070675_100025238 Ga0070675_1000252386 244
769 3300005355 Ga0070671_100005745 Ga0070671_1000057456 244
770 3300005355 Ga0070671_100054749 Ga0070671_1000547492 244
771 3300005364 Ga0070673_100003101 Ga0070673_1000031012 244
772 3300005364 Ga0070673_100004666 Ga0070673_1000046666 244
773 3300005365 Ga0070688_100011717 Ga0070688_1000117176 244
774 3300005365 Ga0070688_100238868 Ga0070688_1002388682 244
775 3300005367 Ga0070667_100083474 Ga0070667_1000834742 244
776 3300005367 Ga0070667_100171475 Ga0070667_1001714753 244
777 3300005367 Ga0070667_100192436 Ga0070667_1001924362 244
778 3300005441 Ga0070700_100015415 Ga0070700_1000154154 244
779 3300005455 Ga0070663_100371403 Ga0070663_1003714032 244
780 3300005456 Ga0070678_100049891 Ga0070678_1000498915 244
781 3300005456 Ga0070678_100083026 Ga0070678_1000830262 244
782 3300005456 Ga0070678_100110138 Ga0070678_1001101382 244
783 3300005459 Ga0068867_100000587 Ga0068867_10000058724 244
784 3300005466 Ga0070685_10088868 Ga0070685_100888683 244
785 3300005467 Ga0070706_100012812 Ga0070706_1000128128 244
786 3300005468 Ga0070707_100034845 Ga0070707_1000348454 244
787 3300005539 Ga0068853_100484281 Ga0068853_1004842811 244
788 3300005539 Ga0068853_100523590 Ga0068853_1005235901 244
789 3300005543 Ga0070672_100000249 Ga0070672_10000024915 244
790 3300005543 Ga0070672_100031950 Ga0070672_1000319503 244
791 3300005543 Ga0070672_100073981 Ga0070672_1000739813 244
792 3300005543 Ga0070672_100081573 Ga0070672_1000815733 244
793 3300005543 Ga0070672_100089747 Ga0070672_1000897472 244
794 3300005548 Ga0070665_100128052 Ga0070665_1001280522 244
795 3300005564 Ga0070664_100227897 Ga0070664_1002278972 244
796 3300005614 Ga0068856_100715511 Ga0068856_1007155111 244
797 3300005615 Ga0070702_100080844 Ga0070702_1000808443 244
798 3300005617 Ga0068859_100002993 Ga0068859_10000299316 244
799 3300005617 Ga0068859_100329974 Ga0068859_1003299742 244
800 3300005618 Ga0068864_100006058 Ga0068864_10000605810 244
801 3300005618 Ga0068864_100013588 Ga0068864_1000135887 244
802 3300005719 Ga0068861_100021625 Ga0068861_1000216253 244
803 3300005834 Ga0068851_10101715 Ga0068851_101017151 244
804 3300005841 Ga0068863_100001479 Ga0068863_1000014798 244
805 3300005842 Ga0068858_100001164 Ga0068858_10000116410 244
806 3300005842 Ga0068858_100239145 Ga0068858_1002391452 244
807 3300005842 Ga0068858_100347806 Ga0068858_1003478062 244
808 3300005843 Ga0068860_100001400 Ga0068860_10000140010 244
809 3300005843 Ga0068860_100310715 Ga0068860_1003107152 244
810 3300005843 Ga0068860_100494552 Ga0068860_1004945522 244
811 3300005844 Ga0068862_100005708 Ga0068862_1000057083 244
812 3300006038 Ga0075365_10004092 Ga0075365_100040924 244
813 3300006038 Ga0075365_10096068 Ga0075365_100960682 244
814 3300006038 Ga0075365_10247416 Ga0075365_102474161 244
815 3300006042 Ga0075368_10015034 Ga0075368_100150342 244
816 3300006051 Ga0075364_10012737 Ga0075364_100127375 244
817 3300006177 Ga0075362_10008418 Ga0075362_100084183 244
818 3300006177 Ga0075362_10208418 Ga0075362_102084181 244
819 3300006178 Ga0075367_10040153 Ga0075367_100401533 244
820 3300006178 Ga0075367_10056457 Ga0075367_100564572 244
821 3300006195 Ga0075366_10003640 Ga0075366_100036407 244
822 3300006195 Ga0075366_10170668 Ga0075366_101706681 244
823 3300006195 Ga0075366_10185898 Ga0075366_101858981 244
824 3300006237 Ga0097621_100014909 Ga0097621_1000149096 244
825 3300006353 Ga0075370_10009819 Ga0075370_100098192 244
826 3300006353 Ga0075370_10016620 Ga0075370_100166204 244
827 3300006358 Ga0068871_100011778 Ga0068871_1000117787 244
828 3300006358 Ga0068871_100256765 Ga0068871_1002567652 244
829 3300006880 Ga0075429_100100877 Ga0075429_1001008772 244
830 3300006881 Ga0068865_100182037 Ga0068865_1001820371 244
831 3300006931 Ga0097620_100002993 Ga0097620_10000299316 244
832 3300006931 Ga0097620_100329983 Ga0097620_1003299832 244
833 3300006948 Ga0099826_10166968 Ga0099826_101669682 244
834 3300009177 Ga0105248_10074973 Ga0105248_100749733 244
835 3300009177 Ga0105248_10436192 Ga0105248_104361922 244
836 3300009553 Ga0105249_10093002 Ga0105249_100930022 244
837 3300013297 Ga0157378_10025519 Ga0157378_100255192 244
838 3300013306 Ga0163162_10039558 Ga0163162_100395584 244
839 3300013306 Ga0163162_10202262 Ga0163162_102022623 244
840 3300013308 Ga0157375_10128748 Ga0157375_101287483 244
841 3300014325 Ga0163163_10004818 Ga0163163_100048187 244
842 3300014326 Ga0157380_10188839 Ga0157380_101888392 244
843 3300014497 Ga0182008_10000893 Ga0182008_1000089315 244
844 3300014968 Ga0157379_10021534 Ga0157379_100215343 244
845 3300014968 Ga0157379_10023314 Ga0157379_100233142 244
846 3300014968 Ga0157379_10043364 Ga0157379_100433641 244
847 3300014969 Ga0157376_10011702 Ga0157376_100117025 244
848 3300014969 Ga0157376_10085569 Ga0157376_100855691 244
849 3300017792 Ga0163161_10034770 Ga0163161_100347702 244
850 3300017792 Ga0163161_10113300 Ga0163161_101133002 244
851 3300025206 Ga0209435_100001 Ga0209435_100001354 244
852 3300025245 Ga0207425_1001492 Ga0207425_10014923 244
853 3300025245 Ga0207425_1004000 Ga0207425_10040005 244
854 3300025246 Ga0209646_1000001 Ga0209646_1000001723 244
855 3300025250 Ga0209026_1000003 Ga0209026_1000003354 244
856 3300025256 Ga0209759_1000001 Ga0209759_1000001354 244
857 3300025256 Ga0209759_1011545 Ga0209759_10115452 244
858 3300025258 Ga0209129_1004667 Ga0209129_10046672 244
859 3300025263 Ga0209565_1000004 Ga0209565_1000004256 244
860 3300025263 Ga0209565_1000639 Ga0209565_10006399 244
861 3300025273 Ga0209673_1000045 Ga0209673_1000045115 244
862 3300025284 Ga0209130_1000056 Ga0209130_100005684 244
863 3300025284 Ga0209130_1001246 Ga0209130_100124612 244
864 3300025291 Ga0209675_1000273 Ga0209675_100027322 244
865 3300025291 Ga0209675_1001834 Ga0209675_10018344 244
866 3300025292 Ga0209676_1000007 Ga0209676_1000007796 244
867 3300025292 Ga0209676_1010898 Ga0209676_10108982 244
868 3300025294 Ga0209025_1002684 Ga0209025_100268417 244
869 3300025294 Ga0209025_1003907 Ga0209025_10039074 244
870 3300025294 Ga0209025_1005182 Ga0209025_10051827 244
871 3300025294 Ga0209025_1011455 Ga0209025_10114557 244
872 3300025295 Ga0209564_1000358 Ga0209564_100035869 244
873 3300025295 Ga0209564_1001264 Ga0209564_100126423 244
874 3300025295 Ga0209564_1004286 Ga0209564_10042865 244
875 3300025298 Ga0209050_1000003 Ga0209050_1000003711 244
876 3300025298 Ga0209050_1000257 Ga0209050_10002576 244
877 3300025298 Ga0209050_1011970 Ga0209050_10119703 244
878 3300025299 Ga0209256_1000001 Ga0209256_1000001711 244
879 3300025302 Ga0207426_1000025 Ga0207426_1000025238 244
880 3300025303 Ga0209051_1000003 Ga0209051_1000003711 244
881 3300025303 Ga0209051_1009349 Ga0209051_10093494 244
882 3300025303 Ga0209051_1066731 Ga0209051_10667311 244
883 3300025304 Ga0209257_1000018 Ga0209257_1000018711 244
884 3300025304 Ga0209257_1021608 Ga0209257_10216083 244
885 3300025893 Ga0207682_10001856 Ga0207682_100018563 244
886 3300025893 Ga0207682_10013067 Ga0207682_100130673 244
887 3300025901 Ga0207688_10061796 Ga0207688_100617962 244
888 3300025903 Ga0207680_10008447 Ga0207680_100084474 244
889 3300025908 Ga0207643_10073167 Ga0207643_100731673 244
890 3300025909 Ga0207705_10099860 Ga0207705_100998602 244
891 3300025910 Ga0207684_10103438 Ga0207684_101034382 244
892 3300025918 Ga0207662_10097161 Ga0207662_100971613 244
893 3300025922 Ga0207646_10172280 Ga0207646_101722802 244
894 3300025923 Ga0207681_10065945 Ga0207681_100659452 244
895 3300025923 Ga0207681_10089243 Ga0207681_100892432 244
896 3300025923 Ga0207681_10112910 Ga0207681_101129103 244
897 3300025925 Ga0207650_10000274 Ga0207650_100002749 244
898 3300025925 Ga0207650_10005108 Ga0207650_100051085 244
899 3300025925 Ga0207650_10172668 Ga0207650_101726682 244
900 3300025926 Ga0207659_10001360 Ga0207659_1000136011 244
901 3300025926 Ga0207659_10020561 Ga0207659_100205612 244
902 3300025931 Ga0207644_10014175 Ga0207644_100141756 244
903 3300025937 Ga0207669_10002096 Ga0207669_100020969 244
904 3300025940 Ga0207691_10025211 Ga0207691_100252117 244
905 3300025940 Ga0207691_10025283 Ga0207691_100252834 244
906 3300025940 Ga0207691_10039297 Ga0207691_100392973 244
907 3300025940 Ga0207691_10092182 Ga0207691_100921822 244
908 3300025941 Ga0207711_10022264 Ga0207711_100222646 244
909 3300025941 Ga0207711_10231669 Ga0207711_102316692 244
910 3300025942 Ga0207689_10100576 Ga0207689_101005762 244
911 3300025945 Ga0207679_10055221 Ga0207679_100552212 244
912 3300025960 Ga0207651_10003094 Ga0207651_100030947 244
913 3300025960 Ga0207651_10005362 Ga0207651_100053625 244
914 3300025960 Ga0207651_10127085 Ga0207651_101270853 244
915 3300025986 Ga0207658_10053233 Ga0207658_100532333 244
916 3300025986 Ga0207658_10078991 Ga0207658_100789912 244
917 3300025986 Ga0207658_10689502 Ga0207658_106895022 244
918 3300026023 Ga0207677_10004773 Ga0207677_100047735 244
919 3300026035 Ga0207703_10005879 Ga0207703_1000587910 244
920 3300026067 Ga0207678_10184766 Ga0207678_101847663 244
921 3300026075 Ga0207708_10074781 Ga0207708_100747813 244
922 3300026088 Ga0207641_10001486 Ga0207641_1000148617 244
923 3300026089 Ga0207648_10001396 Ga0207648_100013964 244
924 3300026089 Ga0207648_10076047 Ga0207648_100760473 244
925 3300026095 Ga0207676_10002421 Ga0207676_100024213 244
926 3300026095 Ga0207676_10047349 Ga0207676_100473494 244
927 3300026118 Ga0207675_100023188 Ga0207675_1000231883 244
928 3300026121 Ga0207683_10019109 Ga0207683_100191096 244
929 3300026121 Ga0207683_10048487 Ga0207683_100484874 244
930 3300026121 Ga0207683_10236164 Ga0207683_102361642 244
931 3300026142 Ga0207698_10146313 Ga0207698_101463133 244
932 3300026142 Ga0207698_10600036 Ga0207698_106000361 244
933 3300028379 Ga0268266_10380996 Ga0268266_103809962 244
934 3300028380 Ga0268265_10004180 Ga0268265_1000418012 244
935 3300028381 Ga0268264_10032321 Ga0268264_100323212 244
936 3300028794 Ga0307515_10025690 Ga0307515_100256907 244
937 3300028794 Ga0307515_10245956 Ga0307515_102459562 244
938 3300031456 Ga0307513_10039983 Ga0307513_100399833 244
939 3300031548 Ga0307408_100001875 Ga0307408_10000187510 244
940 3300031711 Ga0265314_10009417 Ga0265314_100094175 244
941 3300031731 Ga0307405_10004366 Ga0307405_100043664 244
942 3300031824 Ga0307413_10008901 Ga0307413_100089013 244
943 3300031901 Ga0307406_10001340 Ga0307406_100013406 244
944 3300031911 Ga0307412_10181879 Ga0307412_101818792 244
945 3300032002 Ga0307416_100271559 Ga0307416_1002715592 244
946 3300032005 Ga0307411_10010018 Ga0307411_100100184 244
947 3300032126 Ga0307415_100166848 Ga0307415_1001668482 244
948 3300035089 Ga0373944_0036019 Ga0373944_0036019_482_1297 244
949 3300035695 Ga0373927_0102238 Ga0373927_0102238_441_1256 244
950 3300035725 Ga0373947_0067563 Ga0373947_0067563_57_806 244
951 3300036401 Ga0373937_0191548 Ga0373937_0191548_611_1360 244
952 3300037068 Ga0373925_0011126 Ga0373925_0011126_4752_5567 244
953 3300037471 Ga0395905_0013384 Ga0395905_0013384_1613_2365 244
954 3300042001 Ga0439441_036863 Ga0439441_036863_172_918 244
955 3300042015 Ga0439462_0028647 Ga0439462_0028647_421_1167 244
956 3300042123 Ga0450921_003883 Ga0450921_003883_275_1021 244
957 3300042129 Ga0450891_003105 Ga0450891_003105_660_1406 244
958 3300042184 Ga0450908_013037 Ga0450908_013037_167_913 244
959 3300042438 Ga0439459_0006496 Ga0439459_0006496_448_1194 244
960 3300042439 Ga0439464_0033716 Ga0439464_0033716_205_966 244
961 3300042530 Ga0450916_022175 Ga0450916_022175_38_787 244
962 3300044673 Ga0453683_0002295 Ga0453683_0002295_11494_12240 244
963 3300044684 Ga0466966_0003862 Ga0466966_0003862_1744_2538 244
964 3300044684 Ga0466966_0005496 Ga0466966_0005496_5928_6695 244
965 3300044693 Ga0466961_0012612 Ga0466961_0012612_3976_4743 244
966 3300044694 Ga0466963_0085744 Ga0466963_0085744_308_1075 244
967 3300044706 Ga0466964_0004693 Ga0466964_0004693_2290_3057 244
968 3300044712 Ga0453684_0071583 Ga0453684_0071583_1112_1867 244
969 3300044719 Ga0466971_0084266 Ga0466971_0084266_647_1441 244
970 3300044765 Ga0466970_0004901 Ga0466970_0004901_678_1517 244
971 3300044842 Ga0466957_0156894 Ga0466957_0156894_249_1016 244
972 3300045049 Ga0466959_0000285 Ga0466959_0000285_1020_1787 244
973 3300045976 Ga0466967_0011318 Ga0466967_0011318_2699_3466 244
974 3300046459 Ga0495629_0018591 Ga0495629_0018591_25_774 244
975 3300046515 Ga0495620_0094695 Ga0495620_0094695_379_1143 244
976 3300046516 Ga0495628_0141802 Ga0495628_0141802_793_1542 244
977 3300046543 Ga0495645_0013074 Ga0495645_0013074_412_1161 244
978 3300046681 Ga0495647_0005157 Ga0495647_0005157_3158_3907 244
979 3300047319 Ga0495674_0229460 Ga0495674_0229460_554_1303 244
980 3300047471 Ga0495684_0017249 Ga0495684_0017249_1157_1906 244
981 3300048907 Ga0496104_0008971 Ga0496104_0008971_5212_5979 244
982 3300048908 Ga0496105_0085811 Ga0496105_0085811_658_1425 244
983 3300048911 Ga0496108_0131728 Ga0496108_0131728_556_1305 244
984 3300048912 Ga0496109_0209722 Ga0496109_0209722_998_1747 244
985 3300048912 Ga0496109_0355405 Ga0496109_0355405_172_939 244
986 3300048925 Ga0496122_0000034 Ga0496122_0000034_299126_299872 244
987 3300048926 Ga0496123_0000141 Ga0496123_0000141_49782_50528 244
988 3300048927 Ga0496124_0023318 Ga0496124_0023318_368_1114 244
989 3300049581 Ga0501047_0159212 Ga0501047_0159212_328_1074 244
990 3300049775 Ga0501279_004739 Ga0501279_004739_674_1429 244
991 3300049822 Ga0501035_0036476 Ga0501035_0036476_1587_2354 244
992 3300050489 nmdc:mga03683_10428_c1 nmdc:mga03683_10428_c1_2111_2896 244
993 3300050492 nmdc:mga0yw44_164081_c1 nmdc:mga0yw44_164081_c1_573_1322 244
994 3300050493 nmdc:mga0k408_33077_c1 nmdc:mga0k408_33077_c1_1112_1870 244
995 3300050493 nmdc:mga0k408_74008_c1 nmdc:mga0k408_74008_c1_253_1038 244
996 3300050493 nmdc:mga0k408_80770_c1 nmdc:mga0k408_80770_c1_1079_1882 244
997 3300050493 nmdc:mga0k408_91859_c1 nmdc:mga0k408_91859_c1_366_1136 244
998 3300050496 nmdc:mga07m45_98223_c1 nmdc:mga07m45_98223_c1_815_1570 244
999 3300053085 Ga0495619_0042460 Ga0495619_0042460_2206_2955 244
1000 3300053136 Ga0500559_0002741 Ga0500559_0002741_4091_4837 244
1001 3300053140 Ga0500573_0050389 Ga0500573_0050389_590_1336 244
1002 3300053730 Ga0500645_019674 Ga0500645_019674_998_1786 244
1003 3300061719 Ga0466962_0003867 Ga0466962_0003867_4850_5653 244
1004 3300061719 Ga0466962_0022710 Ga0466962_0022710_463_1230 244
1005 iso_pu_bacteria 2945909444 2945911451 244
1006 iso_pu_bacteria 2945984333 2945986241 244
1007 3300003792 Ga0055540_1031528 Ga0055540_10315281 245
1008 3300005289 Ga0065704_10118735 Ga0065704_101187352 245
1009 3300005334 Ga0068869_100160705 Ga0068869_1001607052 245
1010 3300005341 Ga0070691_10211197 Ga0070691_102111972 245
1011 3300005367 Ga0070667_100002698 Ga0070667_10000269811 245
1012 3300005367 Ga0070667_100203620 Ga0070667_1002036202 245
1013 3300005435 Ga0070714_100247327 Ga0070714_1002473271 245
1014 3300005459 Ga0068867_100708956 Ga0068867_1007089561 245
1015 3300005466 Ga0070685_10301435 Ga0070685_103014351 245
1016 3300005539 Ga0068853_100484200 Ga0068853_1004842002 245
1017 3300005563 Ga0068855_100012472 Ga0068855_1000124729 245
1018 3300005563 Ga0068855_100097782 Ga0068855_1000977823 245
1019 3300005578 Ga0068854_100149663 Ga0068854_1001496632 245
1020 3300005614 Ga0068856_100443349 Ga0068856_1004433491 245
1021 3300005616 Ga0068852_100007651 Ga0068852_1000076519 245
1022 3300006048 Ga0075363_100078873 Ga0075363_1000788733 245
1023 3300006177 Ga0075362_10015684 Ga0075362_100156843 245
1024 3300006178 Ga0075367_10005261 Ga0075367_100052618 245
1025 3300006178 Ga0075367_10051646 Ga0075367_100516463 245
1026 3300006195 Ga0075366_10018595 Ga0075366_100185952 245
1027 3300006353 Ga0075370_10007548 Ga0075370_100075485 245
1028 3300006353 Ga0075370_10038128 Ga0075370_100381283 245
1029 3300009093 Ga0105240_10002099 Ga0105240_100020998 245
1030 3300009093 Ga0105240_10052231 Ga0105240_100522314 245
1031 3300009098 Ga0105245_10140169 Ga0105245_101401691 245
1032 3300010375 Ga0105239_10129672 Ga0105239_101296724 245
1033 3300010375 Ga0105239_10646603 Ga0105239_106466032 245
1034 3300013297 Ga0157378_10285517 Ga0157378_102855172 245
1035 3300013308 Ga0157375_10134869 Ga0157375_101348693 245
1036 3300025303 Ga0209051_1007719 Ga0209051_10077197 245
1037 3300025913 Ga0207695_10096678 Ga0207695_100966782 245
1038 3300025913 Ga0207695_10266144 Ga0207695_102661442 245
1039 3300025914 Ga0207671_10304099 Ga0207671_103040992 245
1040 3300025921 Ga0207652_10087394 Ga0207652_100873942 245
1041 3300025929 Ga0207664_10217370 Ga0207664_102173701 245
1042 3300025941 Ga0207711_10640278 Ga0207711_106402781 245
1043 3300025960 Ga0207651_10284486 Ga0207651_102844862 245
1044 3300025986 Ga0207658_10000596 Ga0207658_1000059627 245
1045 3300025986 Ga0207658_10134700 Ga0207658_101347002 245
1046 3300026067 Ga0207678_10216388 Ga0207678_102163882 245
1047 3300026078 Ga0207702_10386985 Ga0207702_103869851 245
1048 3300026089 Ga0207648_10166809 Ga0207648_101668092 245
1049 3300026116 Ga0207674_10014163 Ga0207674_100141637 245
1050 3300026116 Ga0207674_10096985 Ga0207674_100969852 245
1051 3300028786 Ga0307517_10010987 Ga0307517_100109878 245
1052 3300031456 Ga0307513_10064266 Ga0307513_100642663 245
1053 3300031548 Ga0307408_100158321 Ga0307408_1001583212 245
1054 3300031616 Ga0307508_10259421 Ga0307508_102594212 245
1055 3300031730 Ga0307516_10002826 Ga0307516_100028267 245
1056 3300032126 Ga0307415_100515827 Ga0307415_1005158271 245
1057 3300033180 Ga0307510_10115880 Ga0307510_101158802 245
1058 3300035695 Ga0373927_0093092 Ga0373927_0093092_935_1708 245
1059 3300037068 Ga0373925_0056736 Ga0373925_0056736_1757_2530 245
1060 3300037312 Ga0395899_0019128 Ga0395899_0019128_3180_3929 245
1061 3300037418 Ga0395900_0002425 Ga0395900_0002425_13009_13758 245
1062 3300037418 Ga0395900_0020959 Ga0395900_0020959_892_1644 245
1063 3300037418 Ga0395900_0149133 Ga0395900_0149133_675_1424 245
1064 3300037418 Ga0395900_0160620 Ga0395900_0160620_1455_2267 245
1065 3300037418 Ga0395900_0403195 Ga0395900_0403195_547_1296 245
1066 3300037466 Ga0395898_0002961 Ga0395898_0002961_4433_5182 245
1067 3300037466 Ga0395898_0008634 Ga0395898_0008634_9916_10668 245
1068 3300037471 Ga0395905_0000180 Ga0395905_0000180_7683_8432 245
1069 3300037471 Ga0395905_0002881 Ga0395905_0002881_10140_10892 245
1070 3300037471 Ga0395905_0010125 Ga0395905_0010125_2492_3241 245
1071 3300037471 Ga0395905_0013704 Ga0395905_0013704_584_1366 245
1072 3300037471 Ga0395905_0028419 Ga0395905_0028419_3737_4486 245
1073 3300037471 Ga0395905_0037378 Ga0395905_0037378_3673_4422 245
1074 3300037471 Ga0395905_0080020 Ga0395905_0080020_259_1008 245
1075 3300037471 Ga0395905_0192568 Ga0395905_0192568_1035_1814 245
1076 3300037471 Ga0395905_0360945 Ga0395905_0360945_168_917 245
1077 3300037471 Ga0395905_0435910 Ga0395905_0435910_334_1095 245
1078 3300038443 Ga0395901_0047353 Ga0395901_0047353_1121_1870 245
1079 3300038443 Ga0395901_0085362 Ga0395901_0085362_88_837 245
1080 3300038443 Ga0395901_0122449 Ga0395901_0122449_591_1343 245
1081 3300042007 Ga0439449_0005738 Ga0439449_0005738_3795_4544 245
1082 3300042532 Ga0450893_0032490 Ga0450893_0032490_27_788 245
1083 3300042876 Ga0451577_0003543 Ga0451577_0003543_2054_2809 245
1084 3300044656 Ga0466969_0002322 Ga0466969_0002322_7493_8242 245
1085 3300044656 Ga0466969_0062655 Ga0466969_0062655_268_1017 245
1086 3300044656 Ga0466969_0192857 Ga0466969_0192857_31_840 245
1087 3300044683 Ga0466965_0002967 Ga0466965_0002967_1681_2484 245
1088 3300044684 Ga0466966_0004685 Ga0466966_0004685_4882_5631 245
1089 3300044693 Ga0466961_0005740 Ga0466961_0005740_2839_3588 245
1090 3300044693 Ga0466961_0016936 Ga0466961_0016936_1300_2118 245
1091 3300044693 Ga0466961_0046507 Ga0466961_0046507_498_1247 245
1092 3300044765 Ga0466970_0026951 Ga0466970_0026951_2092_2841 245
1093 3300044842 Ga0466957_0005869 Ga0466957_0005869_4024_4842 245
1094 3300045049 Ga0466959_0046888 Ga0466959_0046888_2256_3074 245
1095 3300045836 Ga0466958_0399212 Ga0466958_0399212_76_825 245
1096 3300046462 Ga0495651_0115987 Ga0495651_0115987_118_882 245
1097 3300046519 Ga0495632_0003624 Ga0495632_0003624_4824_5603 245
1098 3300046519 Ga0495632_0034350 Ga0495632_0034350_715_1488 245
1099 3300046535 Ga0495586_0007585 Ga0495586_0007585_4197_5015 245
1100 3300046542 Ga0495597_0002614 Ga0495597_0002614_3237_4016 245
1101 3300046542 Ga0495597_0004594 Ga0495597_0004594_4616_5386 245
1102 3300046648 Ga0495611_0086522 Ga0495611_0086522_512_1291 245
1103 3300046660 Ga0495625_0094976 Ga0495625_0094976_841_1620 245
1104 3300046694 Ga0495649_0007041 Ga0495649_0007041_6101_6880 245
1105 3300046810 Ga0495660_0016584 Ga0495660_0016584_970_1749 245
1106 3300047443 Ga0495687_000473 Ga0495687_000473_24583_25362 245
1107 3300047443 Ga0495687_010018 Ga0495687_010018_2779_3558 245
1108 3300048925 Ga0496122_0069305 Ga0496122_0069305_1469_2236 245
1109 3300048927 Ga0496124_0117899 Ga0496124_0117899_301_1068 245
1110 3300048928 Ga0496125_0002204 Ga0496125_0002204_8985_9752 245
1111 3300048929 Ga0496126_0030523 Ga0496126_0030523_1943_2710 245
1112 3300049581 Ga0501047_0037145 Ga0501047_0037145_2577_3326 245
1113 3300049742 Ga0501080_0037120 Ga0501080_0037120_805_1554 245
1114 3300050489 nmdc:mga03683_104008_c1 nmdc:mga03683_104008_c1_216_965 245
1115 3300050489 nmdc:mga03683_11744_c1 nmdc:mga03683_11744_c1_787_1566 245
1116 3300050489 nmdc:mga03683_4370_c1 nmdc:mga03683_4370_c1_2580_3362 245
1117 3300050491 nmdc:mga00v17_40775_c1 nmdc:mga00v17_40775_c1_939_1721 245
1118 3300050493 nmdc:mga0k408_11730_c1 nmdc:mga0k408_11730_c1_755_1534 245
1119 3300050493 nmdc:mga0k408_17184_c1 nmdc:mga0k408_17184_c1_1839_2621 245
1120 3300050494 nmdc:mga06z11_155402_c1 nmdc:mga06z11_155402_c1_115_894 245
1121 3300050495 nmdc:mga04h51_45950_c1 nmdc:mga04h51_45950_c1_636_1418 245
1122 3300050496 nmdc:mga07m45_11799_c1 nmdc:mga07m45_11799_c1_1233_2015 245
1123 3300050496 nmdc:mga07m45_18324_c1 nmdc:mga07m45_18324_c1_1387_2169 245
1124 3300050496 nmdc:mga07m45_220_c1 nmdc:mga07m45_220_c1_13599_14381 245
1125 3300050496 nmdc:mga07m45_23119_c1 nmdc:mga07m45_23119_c1_2237_3016 245
1126 3300050496 nmdc:mga07m45_66194_c1 nmdc:mga07m45_66194_c1_125_931 245
1127 3300050496 nmdc:mga07m45_8131_c1 nmdc:mga07m45_8131_c1_3243_4022 245
1128 3300050516 nmdc:mga0sz30_13382_c1 nmdc:mga0sz30_13382_c1_1376_2158 245
1129 3300053129 Ga0500628_001693 Ga0500628_001693_265_1059 245
1130 3300053131 Ga0500652_138434 Ga0500652_138434_189_953 245
1131 3300053134 Ga0500658_0002272 Ga0500658_0002272_3761_4540 245
1132 3300055283 Ga0500661_022231 Ga0500661_022231_252_1046 245
1133 3300061719 Ga0466962_0067867 Ga0466962_0067867_443_1192 245
1134 iso_pu_bacteria 2513020051 2513229568 245
1135 iso_pu_bacteria 2599185214 2599623543 245
1136 iso_pu_bacteria 2599185226 2599671839 245
1137 iso_pu_bacteria 2599185227 2599681148 245
1138 iso_pu_bacteria 2599185229 2599693448 245
1139 iso_pu_bacteria 2643221628 2644160715 245
1140 iso_pu_bacteria 2643221658 2644327515 245
1141 iso_pu_bacteria 2643221672 2644401569 245
1142 iso_pu_bacteria 2738541277 2738717621 245
1143 iso_pu_bacteria 2738541307 2738879236 245
1144 iso_pu_bacteria 2738543019 2739278307 245
1145 iso_pu_bacteria 2818991446 2819597110 245
1146 iso_pu_bacteria 2831265667 2831266229 245
1147 iso_pu_bacteria 2838054893 2838057661 245
1148 iso_pu_bacteria 2885198086 2885204345 245
1149 iso_pu_bacteria 2885211737 2885217998 245
1150 iso_pu_bacteria 2899924645 2899930149 245
1151 iso_pu_bacteria 2904449895 2904456179 245
1152 iso_pu_bacteria 2904456579 2904457729 245
1153 iso_pu_bacteria 2904541872 2904543483 245
1154 iso_pu_bacteria 2928037797 2928039262 245
1155 iso_pu_bacteria 2928044640 2928045133 245
1156 iso_pu_bacteria 2928051484 2928052939 245
1157 iso_pu_bacteria 2928064002 2928064390 245
1158 iso_pu_bacteria 2928070936 2928071844 245
1159 iso_pu_bacteria 2928084124 2928084220 245
1160 iso_pu_bacteria 2929160207 2929162982 245
1161 iso_pu_bacteria 2929520902 2929527228 245
1162 iso_pu_bacteria 2945972063 2945977509 245
1163 3300003322 rootL2_10044024 rootL2_100440242 246
1164 3300003773 Ga0055537_1000484 Ga0055537_10004844 246
1165 3300003781 Ga0055536_1001639 Ga0055536_10016393 246
1166 3300003784 Ga0055534_1000406 Ga0055534_100040623 246
1167 3300003784 Ga0055534_1001233 Ga0055534_10012339 246
1168 3300003790 Ga0055528_1000813 Ga0055528_100081318 246
1169 3300003792 Ga0055540_1001252 Ga0055540_10012529 246
1170 3300005334 Ga0068869_100490802 Ga0068869_1004908022 246
1171 3300005354 Ga0070675_100217028 Ga0070675_1002170282 246
1172 3300005354 Ga0070675_100297307 Ga0070675_1002973072 246
1173 3300005356 Ga0070674_100114654 Ga0070674_1001146542 246
1174 3300005367 Ga0070667_100021567 Ga0070667_1000215672 246
1175 3300005456 Ga0070678_100197838 Ga0070678_1001978382 246
1176 3300005457 Ga0070662_100055488 Ga0070662_1000554881 246
1177 3300005543 Ga0070672_100089667 Ga0070672_1000896673 246
1178 3300005548 Ga0070665_100015059 Ga0070665_1000150593 246
1179 3300005548 Ga0070665_100063615 Ga0070665_1000636153 246
1180 3300005564 Ga0070664_100032384 Ga0070664_1000323845 246
1181 3300005577 Ga0068857_100136013 Ga0068857_1001360132 246
1182 3300006051 Ga0075364_10022939 Ga0075364_100229391 246
1183 3300006058 Ga0075432_10007755 Ga0075432_100077554 246
1184 3300006058 Ga0075432_10050686 Ga0075432_100506862 246
1185 3300006177 Ga0075362_10088778 Ga0075362_100887782 246
1186 3300006177 Ga0075362_10091944 Ga0075362_100919442 246
1187 3300006195 Ga0075366_10050467 Ga0075366_100504673 246
1188 3300006195 Ga0075366_10071587 Ga0075366_100715871 246
1189 3300006353 Ga0075370_10003569 Ga0075370_100035697 246
1190 3300006353 Ga0075370_10005043 Ga0075370_100050432 246
1191 3300006353 Ga0075370_10006717 Ga0075370_100067173 246
1192 3300006353 Ga0075370_10416746 Ga0075370_104167461 246
1193 3300006948 Ga0099826_10009182 Ga0099826_100091826 246
1194 3300006948 Ga0099826_10177925 Ga0099826_101779252 246
1195 3300009148 Ga0105243_10006952 Ga0105243_100069523 246
1196 3300009553 Ga0105249_10652667 Ga0105249_106526671 246
1197 3300013306 Ga0163162_10291647 Ga0163162_102916472 246
1198 3300014497 Ga0182008_10002052 Ga0182008_100020524 246
1199 3300015261 Ga0182006_1068687 Ga0182006_10686872 246
1200 3300015262 Ga0182007_10002796 Ga0182007_100027964 246
1201 3300015683 Ga0183362_10001 Ga0183362_100011067 246
1202 3300017792 Ga0163161_10005014 Ga0163161_100050148 246
1203 3300025263 Ga0209565_1000085 Ga0209565_1000085125 246
1204 3300025273 Ga0209673_1001052 Ga0209673_100105210 246
1205 3300025273 Ga0209673_1003345 Ga0209673_10033456 246
1206 3300025284 Ga0209130_1004082 Ga0209130_10040826 246
1207 3300025291 Ga0209675_1000083 Ga0209675_1000083125 246
1208 3300025291 Ga0209675_1001347 Ga0209675_10013479 246
1209 3300025292 Ga0209676_1000268 Ga0209676_100026856 246
1210 3300025303 Ga0209051_1000343 Ga0209051_100034356 246
1211 3300025303 Ga0209051_1003803 Ga0209051_10038036 246
1212 3300025304 Ga0209257_1005357 Ga0209257_10053573 246
1213 3300025304 Ga0209257_1009186 Ga0209257_10091862 246
1214 3300025935 Ga0207709_10000425 Ga0207709_1000042531 246
1215 3300025937 Ga0207669_10162792 Ga0207669_101627922 246
1216 3300025940 Ga0207691_10234410 Ga0207691_102344102 246
1217 3300025945 Ga0207679_10059750 Ga0207679_100597502 246
1218 3300025986 Ga0207658_10053722 Ga0207658_100537223 246
1219 3300026121 Ga0207683_10044835 Ga0207683_100448354 246
1220 3300026121 Ga0207683_10146026 Ga0207683_101460262 246
1221 3300026121 Ga0207683_10215806 Ga0207683_102158062 246
1222 3300027666 Ga0209282_1000974 Ga0209282_10009746 246
1223 3300028379 Ga0268266_10141325 Ga0268266_101413252 246
1224 3300028379 Ga0268266_10305844 Ga0268266_103058442 246
1225 3300028794 Ga0307515_10002898 Ga0307515_100028987 246
1226 3300030731 Ga0316177_1080934 Ga0316177_10809345 246
1227 3300030732 Ga0316176_1095897 Ga0316176_10958973 246
1228 3300030733 Ga0314311_1024127 Ga0314311_10241273 246
1229 3300030735 Ga0316178_1082049 Ga0316178_10820494 246
1230 3300030736 Ga0316180_1101534 Ga0316180_11015343 246
1231 3300030744 Ga0316181_1045650 Ga0316181_10456502 246
1232 3300030745 Ga0316182_1369050 Ga0316182_13690503 246
1233 3300031238 Ga0265332_10000003 Ga0265332_10000003228 246
1234 3300031251 Ga0265327_10034893 Ga0265327_100348932 246
1235 3300031456 Ga0307513_10000121 Ga0307513_1000012159 246
1236 3300031731 Ga0307405_10011565 Ga0307405_100115654 246
1237 3300031731 Ga0307405_10060774 Ga0307405_100607742 246
1238 3300031731 Ga0307405_10106064 Ga0307405_101060642 246
1239 3300031852 Ga0307410_10233286 Ga0307410_102332861 246
1240 3300031903 Ga0307407_10426587 Ga0307407_104265872 246
1241 3300031911 Ga0307412_10051102 Ga0307412_100511022 246
1242 3300031911 Ga0307412_10134142 Ga0307412_101341422 246
1243 3300031911 Ga0307412_10142282 Ga0307412_101422822 246
1244 3300032002 Ga0307416_100069123 Ga0307416_1000691232 246
1245 3300032004 Ga0307414_10222178 Ga0307414_102221781 246
1246 3300032005 Ga0307411_10084274 Ga0307411_100842742 246
1247 3300032005 Ga0307411_10332514 Ga0307411_103325142 246
1248 3300041404 Ga0439436_0003791 Ga0439436_0003791_1546_2295 246
1249 3300041404 Ga0439436_0013490 Ga0439436_0013490_817_1566 246
1250 3300041405 Ga0439438_033972 Ga0439438_033972_428_1177 246
1251 3300041406 Ga0439439_0031011 Ga0439439_0031011_209_958 246
1252 3300041407 Ga0439447_009182 Ga0439447_009182_309_1058 246
1253 3300041407 Ga0439447_012418 Ga0439447_012418_62_811 246
1254 3300041410 Ga0439461_0005365 Ga0439461_0005365_1174_1923 246
1255 3300041411 Ga0439466_0003451 Ga0439466_0003451_2578_3327 246
1256 3300041411 Ga0439466_0016582 Ga0439466_0016582_410_1159 246
1257 3300041413 Ga0439465_0000072 Ga0439465_0000072_11873_12622 246
1258 3300041997 Ga0439431_0000235 Ga0439431_0000235_9768_10517 246
1259 3300041997 Ga0439431_0005013 Ga0439431_0005013_2005_2754 246
1260 3300041999 Ga0439433_0000055 Ga0439433_0000055_4893_5642 246
1261 3300041999 Ga0439433_0013981 Ga0439433_0013981_607_1356 246
1262 3300042002 Ga0439442_001375 Ga0439442_001375_1242_1991 246
1263 3300042004 Ga0439445_0000190 Ga0439445_0000190_7486_8235 246
1264 3300042006 Ga0439432_016345 Ga0439432_016345_496_1245 246
1265 3300042006 Ga0439432_023674 Ga0439432_023674_1007_1756 246
1266 3300042007 Ga0439449_0000135 Ga0439449_0000135_9906_10655 246
1267 3300042007 Ga0439449_0000254 Ga0439449_0000254_14878_15627 246
1268 3300042007 Ga0439449_0001356 Ga0439449_0001356_4793_5542 246
1269 3300042010 Ga0439452_008527 Ga0439452_008527_393_1142 246
1270 3300042010 Ga0439452_009437 Ga0439452_009437_1943_2692 246
1271 3300042014 Ga0439457_005620 Ga0439457_005620_1892_2641 246
1272 3300042014 Ga0439457_008935 Ga0439457_008935_1436_2185 246
1273 3300042015 Ga0439462_0002085 Ga0439462_0002085_3723_4472 246
1274 3300042121 Ga0450919_004251 Ga0450919_004251_432_1181 246
1275 3300042125 Ga0450923_004122 Ga0450923_004122_1197_1946 246
1276 3300042133 Ga0450896_021139 Ga0450896_021139_16_765 246
1277 3300042145 Ga0450906_000642 Ga0450906_000642_95_844 246
1278 3300042145 Ga0450906_001202 Ga0450906_001202_628_1377 246
1279 3300042146 Ga0450907_019534 Ga0450907_019534_147_896 246
1280 3300042156 Ga0439446_0003368 Ga0439446_0003368_366_1115 246
1281 3300042157 Ga0439458_0032050 Ga0439458_0032050_145_921 246
1282 3300042184 Ga0450908_007998 Ga0450908_007998_536_1285 246
1283 3300042185 Ga0450909_000922 Ga0450909_000922_1430_2179 246
1284 3300042435 Ga0439434_0004125 Ga0439434_0004125_1346_2095 246
1285 3300042531 Ga0450918_000282 Ga0450918_000282_6946_7695 246
1286 3300042532 Ga0450893_0001086 Ga0450893_0001086_1013_1762 246
1287 3300044712 Ga0453684_0115887 Ga0453684_0115887_1399_2169 246
1288 3300044901 Ga0466960_0115367 Ga0466960_0115367_307_1056 246
1289 3300046475 Ga0495639_0007016 Ga0495639_0007016_1343_2092 246
1290 3300046522 Ga0495643_0149582 Ga0495643_0149582_126_908 246
1291 3300046535 Ga0495586_0259785 Ga0495586_0259785_150_899 246
1292 3300046539 Ga0495621_0007544 Ga0495621_0007544_1389_2138 246
1293 3300046615 Ga0495656_0000184 Ga0495656_0000184_14409_15158 246
1294 3300046615 Ga0495656_0027396 Ga0495656_0027396_562_1311 246
1295 3300046674 Ga0495588_0035371 Ga0495588_0035371_256_1005 246
1296 3300046678 Ga0495599_0174270 Ga0495599_0174270_491_1240 246
1297 3300046680 Ga0495646_0108946 Ga0495646_0108946_365_1147 246
1298 3300046809 Ga0495600_0127367 Ga0495600_0127367_264_1013 246
1299 3300048903 Ga0496100_0004910 Ga0496100_0004910_1757_2506 246
1300 3300048905 Ga0496102_0012505 Ga0496102_0012505_6105_6854 246
1301 3300048906 Ga0496103_0029430 Ga0496103_0029430_2142_2891 246
1302 3300048907 Ga0496104_0008803 Ga0496104_0008803_7743_8492 246
1303 3300048908 Ga0496105_0007444 Ga0496105_0007444_5473_6222 246
1304 3300048911 Ga0496108_0489376 Ga0496108_0489376_122_871 246
1305 3300048914 Ga0496111_0030189 Ga0496111_0030189_2152_2901 246
1306 3300048915 Ga0496112_0264853 Ga0496112_0264853_86_835 246
1307 3300049571 Ga0501034_0187644 Ga0501034_0187644_856_1662 246
1308 3300049679 Ga0501249_001402 Ga0501249_001402_977_1726 246
1309 3300049705 Ga0501225_0005658 Ga0501225_0005658_1225_1974 246
1310 3300049759 Ga0501262_000305 Ga0501262_000305_967_1716 246
1311 3300050489 nmdc:mga03683_51468_c1 nmdc:mga03683_51468_c1_44_850 246
1312 3300050491 nmdc:mga00v17_40979_c1 nmdc:mga00v17_40979_c1_1147_1896 246
1313 3300050493 nmdc:mga0k408_56887_c1 nmdc:mga0k408_56887_c1_999_1748 246
1314 3300050493 nmdc:mga0k408_7826_c1 nmdc:mga0k408_7826_c1_1950_2699 246
1315 3300050496 nmdc:mga07m45_1644_c1 nmdc:mga07m45_1644_c1_2023_2772 246
1316 3300050496 nmdc:mga07m45_24416_c1 nmdc:mga07m45_24416_c1_1427_2176 246
1317 3300050496 nmdc:mga07m45_246000_c1 nmdc:mga07m45_246000_c1_117_866 246
1318 3300050496 nmdc:mga07m45_36783_c1 nmdc:mga07m45_36783_c1_1122_1877 246
1319 3300017792 Ga0163161_10000193 Ga0163161_1000019355 248
1320 3300046520 Ga0495637_0003270 Ga0495637_0003270_5488_6237 248
1321 3300046660 Ga0495625_0068099 Ga0495625_0068099_580_1329 248
1322 3300046664 Ga0495659_0028103 Ga0495659_0028103_868_1617 248
1323 3300046691 Ga0495670_0024793 Ga0495670_0024793_1992_2741 248
1324 3300046692 Ga0495671_0008121 Ga0495671_0008121_2145_2894 248
1325 3300046810 Ga0495660_0064686 Ga0495660_0064686_1056_1805 248
1326 3300047470 Ga0495681_0195136 Ga0495681_0195136_17_766 248
1327 3300053079 Ga0500610_0000863 Ga0500610_0000863_8944_9693 248
1328 3300053079 Ga0500610_0027623 Ga0500610_0027623_18_767 248
1329 3300053079 Ga0500610_0114083 Ga0500610_0114083_199_948 248
1330 3300053121 Ga0500607_002610 Ga0500607_002610_6535_7284 248
1331 3300053158 Ga0500627_0001008 Ga0500627_0001008_2966_3715 248
1332 3300053160 Ga0500633_0081403 Ga0500633_0081403_50_799 248
1333 3300053161 Ga0500634_0031872 Ga0500634_0031872_1409_2158 248
1334 3300001979 JGI24740J21852_10006036 JGI24740J21852_100060363 249
1335 3300002773 JGI25152J39213_1003031 JGI25152J39213_10030313 249
1336 3300002774 JGI25150J39212_1000926 JGI25150J39212_10009264 249
1337 3300002774 JGI25150J39212_1018853 JGI25150J39212_10188532 249
1338 3300002987 JGI25159J45721_1003283 JGI25159J45721_10032833 249
1339 3300002987 JGI25159J45721_1005159 JGI25159J45721_10051592 249
1340 3300003187 JGI25151J46595_10006139 JGI25151J46595_100061393 249
1341 3300003187 JGI25151J46595_10006404 JGI25151J46595_100064043 249
1342 3300003215 JGI25153J46596_10004013 JGI25153J46596_100040133 249
1343 3300003215 JGI25153J46596_10006457 JGI25153J46596_100064573 249
1344 3300003354 JGI25160J50197_1004586 JGI25160J50197_10045863 249
1345 3300003354 JGI25160J50197_1004770 JGI25160J50197_10047703 249
1346 3300003374 JGI25161J50226_1001902 JGI25161J50226_10019023 249
1347 3300003374 JGI25161J50226_1007034 JGI25161J50226_10070341 249
1348 3300003578 Ga0006562J51391_1011384 Ga0006562J51391_10113843 249
1349 3300003761 Ga0055535_1000364 Ga0055535_100036411 249
1350 3300003762 Ga0055542_1000114 Ga0055542_100011434 249
1351 3300003771 Ga0055526_1007041 Ga0055526_10070413 249
1352 3300003771 Ga0055526_1007087 Ga0055526_10070873 249
1353 3300003773 Ga0055537_1002598 Ga0055537_10025983 249
1354 3300003773 Ga0055537_1004288 Ga0055537_10042883 249
1355 3300003775 Ga0055524_1005088 Ga0055524_10050883 249
1356 3300003775 Ga0055524_1005130 Ga0055524_10051303 249
1357 3300003781 Ga0055536_1002703 Ga0055536_10027037 249
1358 3300003781 Ga0055536_1003538 Ga0055536_10035386 249
1359 3300003781 Ga0055536_1036564 Ga0055536_10365641 249
1360 3300003784 Ga0055534_1001253 Ga0055534_10012539 249
1361 3300003784 Ga0055534_1002991 Ga0055534_10029913 249
1362 3300003790 Ga0055528_1005459 Ga0055528_10054593 249
1363 3300003790 Ga0055528_1009318 Ga0055528_10093183 249
1364 3300003791 Ga0055530_10000777 Ga0055530_100007776 249
1365 3300003791 Ga0055530_10005794 Ga0055530_100057942 249
1366 3300003792 Ga0055540_1001662 Ga0055540_10016626 249
1367 3300003792 Ga0055540_1002289 Ga0055540_10022893 249
1368 3300003794 Ga0055531_10002682 Ga0055531_100026825 249
1369 3300003794 Ga0055531_10005309 Ga0055531_100053094 249
1370 3300003794 Ga0055531_10005963 Ga0055531_100059634 249
1371 3300004625 Ga0055543_1000748 Ga0055543_100074813 249
1372 3300004625 Ga0055543_1005165 Ga0055543_10051653 249
1373 3300005262 Ga0065165_1003702 Ga0065165_10037029 249
1374 3300005262 Ga0065165_1019433 Ga0065165_10194333 249
1375 3300005366 Ga0070659_100116188 Ga0070659_1001161882 249
1376 3300005539 Ga0068853_100055955 Ga0068853_1000559553 249
1377 3300005539 Ga0068853_100218231 Ga0068853_1002182312 249
1378 3300005563 Ga0068855_100556656 Ga0068855_1005566562 249
1379 3300005564 Ga0070664_100083753 Ga0070664_1000837533 249
1380 3300005577 Ga0068857_100343629 Ga0068857_1003436292 249
1381 3300005616 Ga0068852_100162604 Ga0068852_1001626041 249
1382 3300005834 Ga0068851_10059788 Ga0068851_100597882 249
1383 3300006038 Ga0075365_10286431 Ga0075365_102864312 249
1384 3300006048 Ga0075363_100004278 Ga0075363_1000042782 249
1385 3300006051 Ga0075364_10346540 Ga0075364_103465401 249
1386 3300006058 Ga0075432_10008480 Ga0075432_100084803 249
1387 3300006177 Ga0075362_10036898 Ga0075362_100368983 249
1388 3300006177 Ga0075362_10196340 Ga0075362_101963402 249
1389 3300006186 Ga0075369_10056543 Ga0075369_100565432 249
1390 3300006186 Ga0075369_10075732 Ga0075369_100757322 249
1391 3300006195 Ga0075366_10011288 Ga0075366_100112882 249
1392 3300006195 Ga0075366_10072270 Ga0075366_100722702 249
1393 3300006353 Ga0075370_10000200 Ga0075370_100002005 249
1394 3300006353 Ga0075370_10004970 Ga0075370_100049706 249
1395 3300006353 Ga0075370_10260017 Ga0075370_102600171 249
1396 3300009036 Ga0105244_10014231 Ga0105244_100142313 249
1397 3300009148 Ga0105243_10003393 Ga0105243_100033933 249
1398 3300009545 Ga0105237_10241354 Ga0105237_102413542 249
1399 3300010375 Ga0105239_10047344 Ga0105239_100473442 249
1400 3300011119 Ga0105246_10283900 Ga0105246_102839002 249
1401 3300013100 Ga0157373_10032893 Ga0157373_100328932 249
1402 3300013102 Ga0157371_10052068 Ga0157371_100520683 249
1403 3300013104 Ga0157370_10031947 Ga0157370_100319474 249
1404 3300013104 Ga0157370_10079823 Ga0157370_100798232 249
1405 3300013105 Ga0157369_10037330 Ga0157369_100373304 249
1406 3300013307 Ga0157372_10730119 Ga0157372_107301191 249
1407 3300014497 Ga0182008_10018330 Ga0182008_100183301 249
1408 3300015261 Ga0182006_1001088 Ga0182006_10010885 249
1409 3300017792 Ga0163161_10004445 Ga0163161_100044455 249
1410 3300025208 Ga0209436_111100 Ga0209436_1111002 249
1411 3300025228 Ga0209672_100157 Ga0209672_10015752 249
1412 3300025229 Ga0209147_100575 Ga0209147_10057515 249
1413 3300025242 Ga0209258_100225 Ga0209258_10022535 249
1414 3300025245 Ga0207425_1000295 Ga0207425_100029517 249
1415 3300025245 Ga0207425_1002296 Ga0207425_10022963 249
1416 3300025254 Ga0209148_1000040 Ga0209148_1000040443 249
1417 3300025258 Ga0209129_1000007 Ga0209129_1000007350 249
1418 3300025258 Ga0209129_1002839 Ga0209129_10028393 249
1419 3300025258 Ga0209129_1013599 Ga0209129_10135992 249
1420 3300025263 Ga0209565_1000937 Ga0209565_10009375 249
1421 3300025263 Ga0209565_1005491 Ga0209565_10054913 249
1422 3300025263 Ga0209565_1009634 Ga0209565_10096342 249
1423 3300025273 Ga0209673_1000133 Ga0209673_1000133105 249
1424 3300025273 Ga0209673_1000304 Ga0209673_100030492 249
1425 3300025284 Ga0209130_1000070 Ga0209130_1000070187 249
1426 3300025284 Ga0209130_1000326 Ga0209130_100032611 249
1427 3300025291 Ga0209675_1000516 Ga0209675_100051610 249
1428 3300025291 Ga0209675_1002863 Ga0209675_10028634 249
1429 3300025291 Ga0209675_1004787 Ga0209675_10047875 249
1430 3300025292 Ga0209676_1000122 Ga0209676_1000122172 249
1431 3300025292 Ga0209676_1001242 Ga0209676_10012429 249
1432 3300025292 Ga0209676_1011875 Ga0209676_10118753 249
1433 3300025294 Ga0209025_1000073 Ga0209025_1000073292 249
1434 3300025294 Ga0209025_1000111 Ga0209025_1000111186 249
1435 3300025294 Ga0209025_1000432 Ga0209025_100043277 249
1436 3300025294 Ga0209025_1010358 Ga0209025_10103583 249
1437 3300025294 Ga0209025_1010592 Ga0209025_10105923 249
1438 3300025295 Ga0209564_1000524 Ga0209564_100052410 249
1439 3300025295 Ga0209564_1000594 Ga0209564_100059410 249
1440 3300025297 Ga0209758_1000025 Ga0209758_1000025176 249
1441 3300025297 Ga0209758_1002137 Ga0209758_10021373 249
1442 3300025298 Ga0209050_1000002 Ga0209050_10000021597 249
1443 3300025298 Ga0209050_1001024 Ga0209050_10010247 249
1444 3300025298 Ga0209050_1005556 Ga0209050_10055563 249
1445 3300025299 Ga0209256_1000050 Ga0209256_1000050242 249
1446 3300025299 Ga0209256_1000063 Ga0209256_100006361 249
1447 3300025302 Ga0207426_1000001 Ga0207426_1000001461 249
1448 3300025302 Ga0207426_1000028 Ga0207426_1000028279 249
1449 3300025303 Ga0209051_1000002 Ga0209051_10000021367 249
1450 3300025303 Ga0209051_1000618 Ga0209051_100061810 249
1451 3300025303 Ga0209051_1000665 Ga0209051_100066534 249
1452 3300025303 Ga0209051_1027048 Ga0209051_10270483 249
1453 3300025304 Ga0209257_1000002 Ga0209257_10000021508 249
1454 3300025304 Ga0209257_1000333 Ga0209257_100033333 249
1455 3300025304 Ga0209257_1001964 Ga0209257_100196414 249
1456 3300025728 Ga0207655_1031742 Ga0207655_10317422 249
1457 3300025914 Ga0207671_10096860 Ga0207671_100968602 249
1458 3300025919 Ga0207657_10109360 Ga0207657_101093603 249
1459 3300025933 Ga0207706_10042765 Ga0207706_100427652 249
1460 3300025935 Ga0207709_10001100 Ga0207709_100011009 249
1461 3300025945 Ga0207679_10029674 Ga0207679_100296744 249
1462 3300025949 Ga0207667_10543182 Ga0207667_105431822 249
1463 3300025981 Ga0207640_10063936 Ga0207640_100639363 249
1464 3300026041 Ga0207639_10017601 Ga0207639_100176013 249
1465 3300026041 Ga0207639_10236597 Ga0207639_102365972 249
1466 3300026116 Ga0207674_10211435 Ga0207674_102114352 249
1467 3300026142 Ga0207698_10261724 Ga0207698_102617242 249
1468 3300027866 Ga0209813_10037038 Ga0209813_100370382 249
1469 3300031548 Ga0307408_100330796 Ga0307408_1003307962 249
1470 3300031649 Ga0307514_10181998 Ga0307514_101819981 249
1471 3300031901 Ga0307406_10000864 Ga0307406_1000086411 249
1472 3300032002 Ga0307416_100651167 Ga0307416_1006511671 249
1473 3300046512 Ga0495610_0022310 Ga0495610_0022310_1756_2505 249
1474 3300046518 Ga0495631_0000228 Ga0495631_0000228_8883_9632 249
1475 3300046530 Ga0495654_0065348 Ga0495654_0065348_506_1255 249
1476 3300046660 Ga0495625_0000044 Ga0495625_0000044_197068_197901 249
1477 3300046660 Ga0495625_0107409 Ga0495625_0107409_497_1246 249
1478 3300046674 Ga0495588_0054081 Ga0495588_0054081_352_1101 249
1479 3300046683 Ga0495658_0015865 Ga0495658_0015865_643_1392 249
1480 3300047321 Ga0495676_0226337 Ga0495676_0226337_162_911 249
1481 3300048904 Ga0496101_0039108 Ga0496101_0039108_542_1336 249
1482 3300048919 Ga0496116_0011622 Ga0496116_0011622_1739_2557 249
1483 3300048919 Ga0496116_0053310 Ga0496116_0053310_1570_2403 249
1484 3300048920 Ga0496117_0035938 Ga0496117_0035938_163_912 249
1485 3300048921 Ga0496118_0023095 Ga0496118_0023095_2624_3373 249
1486 3300048921 Ga0496118_0031236 Ga0496118_0031236_2235_3068 249
1487 3300048921 Ga0496118_0034548 Ga0496118_0034548_1372_2121 249
1488 3300048924 Ga0496121_0061301 Ga0496121_0061301_1920_2669 249
1489 3300048924 Ga0496121_0186898 Ga0496121_0186898_355_1173 249
1490 3300048925 Ga0496122_0128058 Ga0496122_0128058_544_1293 249
1491 3300048926 Ga0496123_0081613 Ga0496123_0081613_419_1237 249
1492 3300048926 Ga0496123_0140925 Ga0496123_0140925_259_1008 249
1493 3300048927 Ga0496124_0072208 Ga0496124_0072208_580_1329 249
1494 3300048927 Ga0496124_0106277 Ga0496124_0106277_1389_2138 249
1495 3300048928 Ga0496125_0027383 Ga0496125_0027383_1482_2231 249
1496 3300048928 Ga0496125_0198958 Ga0496125_0198958_265_1014 249
1497 3300048929 Ga0496126_0072855 Ga0496126_0072855_1980_2729 249
1498 3300050489 nmdc:mga03683_27041_c1 nmdc:mga03683_27041_c1_169_918 249
1499 3300050489 nmdc:mga03683_9155_c1 nmdc:mga03683_9155_c1_1803_2636 249
1500 3300050490 nmdc:mga03n38_11598_c1 nmdc:mga03n38_11598_c1_2126_2959 249
1501 3300050491 nmdc:mga00v17_13234_c1 nmdc:mga00v17_13234_c1_2914_3747 249
1502 3300050494 nmdc:mga06z11_259120_c1 nmdc:mga06z11_259120_c1_173_949 249
1503 3300050494 nmdc:mga06z11_62720_c1 nmdc:mga06z11_62720_c1_214_1047 249
1504 3300050495 nmdc:mga04h51_44314_c1 nmdc:mga04h51_44314_c1_279_1055 249
1505 3300050496 nmdc:mga07m45_1441_c1 nmdc:mga07m45_1441_c1_3392_4168 249
1506 3300050496 nmdc:mga07m45_17064_c2 nmdc:mga07m45_17064_c2_1449_2282 249
1507 3300050496 nmdc:mga07m45_208560_c1 nmdc:mga07m45_208560_c1_93_842 249
1508 3300050516 nmdc:mga0sz30_127678_c1 nmdc:mga0sz30_127678_c1_63_896 249
1509 3300050516 nmdc:mga0sz30_18248_c1 nmdc:mga0sz30_18248_c1_1392_2141 249
1510 3300053093 Ga0500651_0000097 Ga0500651_0000097_20477_21226 249
1511 3300053110 Ga0500571_000190 Ga0500571_000190_12634_13383 249
1512 3300053118 Ga0500594_0000766 Ga0500594_0000766_4360_5109 249
1513 3300053120 Ga0500597_087377 Ga0500597_087377_459_1208 249
1514 3300053125 Ga0500618_032668 Ga0500618_032668_373_1122 249
1515 3300053133 Ga0500655_008878 Ga0500655_008878_289_1038 249
1516 3300053134 Ga0500658_0000521 Ga0500658_0000521_6213_6962 249
1517 3300053134 Ga0500658_0000753 Ga0500658_0000753_3358_4107 249
1518 3300053139 Ga0500568_0003370 Ga0500568_0003370_1170_1919 249
1519 3300053153 Ga0500616_0077624 Ga0500616_0077624_62_811 249
1520 3300053161 Ga0500634_0015124 Ga0500634_0015124_293_1042 249
1521 3300053729 Ga0500625_019956 Ga0500625_019956_2147_2980 249
1522 3300053735 Ga0500596_016460 Ga0500596_016460_87_920 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04376

ATE_N

Arginine-tRNA-protein transferase, N terminus

40

110

0.99

PF04377

ATE_C

Arginine-tRNA-protein transferase, C terminus

232

285

0.95

PF04377

ATE_C

Arginine-tRNA-protein transferase, C terminus

130

214

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iuf-assembly1.cif.gz_B crystal structure of anti-crispr protein acrva5 0.8171 165 209
7wg4-assembly1.cif.gz_A dvaa-klate1 0.8031 28 246
7wg1-assembly2.cif.gz_B dvaa-klate1 0.7709 28 246
7wfx-assembly2.cif.gz_B evaa-klate1 0.7701 28 246
8j6v-assembly9.cif.gz_C structure of yeast arginyl-trna-protein transferase 1 0.7665 27 243
ID Description Score Start End Superfamily
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7082 112 232 3.40.50.1820
af_Q9C776_322_467_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6959 111 237 3.40.630.30
af_O06136_158_460_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6953 71 218 3.40.630.30
af_P90914_254_388_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6905 111 232 3.40.630.30
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6833 112 232 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C8TK06-F1-model_v4 deleted 0.905 7 243
AF-A0A0B0EJN1-F1-model_v4 Putative arginyl-tRNA--protein transferase (EC 2.3.2.8) 0.9004 12 243 GO:0004057
GO:0005737
AF-A0A370ASX8-F1-model_v4 Arginyltransferase (EC 2.3.2.8) 0.9001 12 243 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A3M1DUD1-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.8992 12 243 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A7Y3J0Z5-F1-model_v4 Arginyltransferase (EC 2.3.2.8) 0.8985 13 243 GO:0004057
GO:0005737

Feature Viewer

pLDDT pTM Quality
84.88 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map