F494543
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1522 | 594 | 1447 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100651167|Ga0307416_1006511671 |
| Length | 297 |
| Sequence | VAIRARILDRTPFRATSFTDVTHLKDLPLHTLQFYATAPYPCSYLPDRQARSQVATPSHLIHNDAYSDLVLSGFRRSGMFTYRPYCDGCRACIPLRVLANSFRPTRSQRRAAKQHSDLQARVLKLCFVPEHYQLYLRYQNGRHAGGGMDHDSIDQYTQFLLQSRVNSRLVEFRETLADGSAGALKMVSILDVLNDGISAVYTFYEPDARAAPGHPKQANGLLGEQQEQAVPSVGTSSTGYGTYSVLWQIEQARKLGLPHVYLGYWIERSPKMHYKARFSPHEVLVDGHWQPSSDFTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 9 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 10 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 11 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 12 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 13 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 14 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 15 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 16 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 17 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 18 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 19 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 20 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 21 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 22 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 23 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 24 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 25 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 26 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 27 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 28 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 29 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 30 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 31 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 32 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 33 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 34 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 35 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 36 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 37 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 38 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 39 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 40 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 41 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 42 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 43 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 44 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 45 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 46 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 47 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 48 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 49 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 50 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 51 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 52 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 53 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 54 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 55 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 56 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 57 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 58 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 59 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 60 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 61 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 62 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 63 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 64 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 65 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 66 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 67 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 68 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 69 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 70 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 71 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 72 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 73 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 74 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 75 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 76 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 77 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 78 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 79 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 80 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 81 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 82 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 83 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 84 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 85 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 86 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 87 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 88 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 89 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 90 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 91 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 92 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 93 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 95 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 96 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 97 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 100 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 101 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 102 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 103 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 104 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 105 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 106 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 107 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 109 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 110 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 111 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 112 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 119 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 123 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 125 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 136 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 145 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 150 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 151 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 155 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 157 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 158 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 159 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 161 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 162 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 163 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 164 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 165 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 166 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 167 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 168 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 169 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 170 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 171 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 172 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 173 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 174 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 175 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 176 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 177 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 178 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 179 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 181 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 182 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 183 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 184 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 185 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 187 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 188 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 189 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 203 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 204 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 216 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 220 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 221 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 222 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 224 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 225 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 234 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 235 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 238 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 239 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 242 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 244 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 247 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 250 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 312 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 314 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 316 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 322 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 323 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 324 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 325 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 326 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 327 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 328 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 329 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 330 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 331 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 332 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 333 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 334 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 335 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 336 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 337 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 338 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 339 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 340 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 341 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 342 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 343 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 344 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 345 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 346 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 347 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 348 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 349 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 350 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 351 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 352 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 353 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 354 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 355 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 356 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 357 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 358 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 359 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 360 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 361 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 362 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 363 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 364 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 365 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 366 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 367 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 368 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 369 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 370 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 371 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 372 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 373 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 374 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 375 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 376 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 377 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 378 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 379 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 380 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 381 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 382 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 383 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 384 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 385 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 386 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 387 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 388 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 389 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 390 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 391 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 392 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 393 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 394 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 395 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 396 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 397 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 398 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 399 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 400 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 401 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 402 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 403 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 404 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 405 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 406 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 407 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 408 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 409 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 410 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 411 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 412 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 413 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 414 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 415 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 416 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 417 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 418 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 419 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 420 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 421 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 422 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 423 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 424 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 425 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 426 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 427 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 428 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 429 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 430 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 431 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 432 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 433 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 434 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 435 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 436 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 437 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 438 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 439 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 440 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 441 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 442 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 443 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 444 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 445 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 446 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 447 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 498 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 499 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 500 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 501 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 502 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 503 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 504 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 505 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 506 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 507 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 508 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 509 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 510 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 511 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 512 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 513 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 514 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 515 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 516 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 517 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 518 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 519 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 520 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 521 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 522 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 524 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 525 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 532 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 533 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 534 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 535 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 536 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 537 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 538 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 539 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 541 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 542 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 543 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 544 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 545 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 546 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 547 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 548 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 549 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 550 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 551 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 552 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 553 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 554 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 555 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 556 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 557 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 559 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 560 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 561 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 562 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 564 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 566 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 567 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 568 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 570 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 571 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 573 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 574 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 575 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 576 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 577 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 579 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 580 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 581 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 582 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 583 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 584 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 585 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 586 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 587 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 588 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 589 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 590 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 591 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 592 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 593 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 594 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.81 |
| Metatranscriptomes | 0.13 |
| Isolates | 5.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.84 |
| Nodule | 0.72 |
| Rhizoplane | 2.76 |
| Rhizosphere | 61.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006036 | 3300001979 | Bacteria | 5064 |
| 2 | JGI25156J39149_1000023 | 3300002705 | Bacteria | 146831 |
| 3 | JGI25156J39149_1000076 | 3300002705 | Bacteria | 76265 |
| 4 | JGI25156J39149_1020167 | 3300002705 | Bacteria | 1182 |
| 5 | JGI25154J39366_1000036 | 3300002738 | Bacteria | 161697 |
| 6 | JGI25154J39366_1003428 | 3300002738 | Bacteria | 3334 |
| 7 | JGI25157J39369_1000023 | 3300002741 | Bacteria | 161697 |
| 8 | JGI25157J39369_1000037 | 3300002741 | Bacteria | 131578 |
| 9 | JGI25152J39213_1003031 | 3300002773 | Bacteria | 5931 |
| 10 | JGI25150J39212_1000786 | 3300002774 | Bacteria | 10849 |
| 11 | JGI25150J39212_1000926 | 3300002774 | Bacteria | 9519 |
| 12 | JGI25150J39212_1004277 | 3300002774 | Bacteria | 3200 |
| 13 | JGI25150J39212_1018853 | 3300002774 | Bacteria | 1092 |
| 14 | JGI25159J45721_1001003 | 3300002987 | Bacteria | 12169 |
| 15 | JGI25159J45721_1001012 | 3300002987 | Bacteria | 12115 |
| 16 | JGI25159J45721_1003283 | 3300002987 | Bacteria | 5788 |
| 17 | JGI25159J45721_1005159 | 3300002987 | Bacteria | 4138 |
| 18 | JGI25151J46595_10006139 | 3300003187 | Bacteria | 6093 |
| 19 | JGI25151J46595_10006404 | 3300003187 | Bacteria | 5919 |
| 20 | JGI25151J46595_10007826 | 3300003187 | Bacteria | 5196 |
| 21 | JGI25151J46595_10011776 | 3300003187 | Bacteria | 4007 |
| 22 | JGI25153J46596_10001674 | 3300003215 | Bacteria | 13142 |
| 23 | JGI25153J46596_10004013 | 3300003215 | Bacteria | 8029 |
| 24 | JGI25153J46596_10006457 | 3300003215 | Bacteria | 5919 |
| 25 | rootH1_10011082 | 3300003316 | Bacteria | 8546 |
| 26 | rootH1_10011082 | 3300003323 | Bacteria | 4834 |
| 27 | rootH1_10027198 | 3300003316 | Bacteria | 2915 |
| 28 | rootH1_10027198 | 3300003323 | Bacteria | 7953 |
| 29 | rootH2_10074078 | 3300003320 | Bacteria | 2171 |
| 30 | rootL2_10001938 | 3300003322 | Bacteria | 15746 |
| 31 | rootL2_10006242 | 3300003322 | Bacteria | 24377 |
| 32 | rootL2_10044024 | 3300003322 | Bacteria | 1320 |
| 33 | rootH1_10129911 | 3300003323 | Bacteria | 2585 |
| 34 | JGI25160J50197_1000213 | 3300003354 | Bacteria | 47438 |
| 35 | JGI25160J50197_1004586 | 3300003354 | Bacteria | 5950 |
| 36 | JGI25160J50197_1004770 | 3300003354 | Bacteria | 5788 |
| 37 | JGI25161J50226_1000015 | 3300003374 | Bacteria | 183773 |
| 38 | JGI25161J50226_1001902 | 3300003374 | Bacteria | 5790 |
| 39 | JGI25161J50226_1007034 | 3300003374 | Bacteria | 1949 |
| 40 | Ga0006562J51391_1011384 | 3300003578 | Bacteria | 2760 |
| 41 | Ga0055539_1000180 | 3300003752 | Bacteria | 53702 |
| 42 | Ga0055539_1003887 | 3300003752 | Bacteria | 2029 |
| 43 | Ga0055533_1000169 | 3300003756 | Bacteria | 59989 |
| 44 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 45 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 46 | Ga0055525_1000526 | 3300003759 | Bacteria | 18471 |
| 47 | Ga0055535_1000177 | 3300003761 | Bacteria | 68502 |
| 48 | Ga0055535_1000364 | 3300003761 | Bacteria | 43640 |
| 49 | Ga0055542_1000114 | 3300003762 | Bacteria | 107058 |
| 50 | Ga0055529_1000346 | 3300003763 | Bacteria | 51499 |
| 51 | Ga0055526_1001196 | 3300003771 | Bacteria | 18739 |
| 52 | Ga0055526_1001574 | 3300003771 | Bacteria | 16051 |
| 53 | Ga0055526_1003300 | 3300003771 | Bacteria | 10343 |
| 54 | Ga0055526_1007041 | 3300003771 | Bacteria | 5948 |
| 55 | Ga0055526_1007087 | 3300003771 | Bacteria | 5919 |
| 56 | Ga0055526_1007561 | 3300003771 | Bacteria | 5614 |
| 57 | Ga0055537_1000034 | 3300003773 | Bacteria | 98043 |
| 58 | Ga0055537_1000484 | 3300003773 | Bacteria | 24629 |
| 59 | Ga0055537_1000706 | 3300003773 | Bacteria | 17336 |
| 60 | Ga0055537_1002598 | 3300003773 | Bacteria | 5919 |
| 61 | Ga0055537_1004288 | 3300003773 | Bacteria | 4111 |
| 62 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 63 | Ga0055524_1000182 | 3300003775 | Bacteria | 70730 |
| 64 | Ga0055524_1000595 | 3300003775 | Bacteria | 26127 |
| 65 | Ga0055524_1005088 | 3300003775 | Bacteria | 5948 |
| 66 | Ga0055524_1005130 | 3300003775 | Bacteria | 5919 |
| 67 | Ga0055536_1001639 | 3300003781 | Bacteria | 13320 |
| 68 | Ga0055536_1002703 | 3300003781 | Bacteria | 9841 |
| 69 | Ga0055536_1003538 | 3300003781 | Bacteria | 8362 |
| 70 | Ga0055536_1008603 | 3300003781 | Bacteria | 4355 |
| 71 | Ga0055536_1036564 | 3300003781 | Bacteria | 1213 |
| 72 | Ga0055534_1000406 | 3300003784 | Bacteria | 26436 |
| 73 | Ga0055534_1001233 | 3300003784 | Bacteria | 10619 |
| 74 | Ga0055534_1001253 | 3300003784 | Bacteria | 10465 |
| 75 | Ga0055534_1002208 | 3300003784 | Bacteria | 6908 |
| 76 | Ga0055534_1002991 | 3300003784 | Bacteria | 5569 |
| 77 | Ga0055528_1000813 | 3300003790 | Bacteria | 21449 |
| 78 | Ga0055528_1002347 | 3300003790 | Bacteria | 10240 |
| 79 | Ga0055528_1005459 | 3300003790 | Bacteria | 5919 |
| 80 | Ga0055528_1009318 | 3300003790 | Bacteria | 4111 |
| 81 | Ga0055530_10000243 | 3300003791 | Bacteria | 49150 |
| 82 | Ga0055530_10000777 | 3300003791 | Bacteria | 26621 |
| 83 | Ga0055530_10003939 | 3300003791 | Bacteria | 8036 |
| 84 | Ga0055530_10005794 | 3300003791 | Bacteria | 5736 |
| 85 | Ga0055540_1000031 | 3300003792 | Bacteria | 177859 |
| 86 | Ga0055540_1000233 | 3300003792 | Bacteria | 51303 |
| 87 | Ga0055540_1001252 | 3300003792 | Bacteria | 15535 |
| 88 | Ga0055540_1001662 | 3300003792 | Bacteria | 12890 |
| 89 | Ga0055540_1002289 | 3300003792 | Bacteria | 10317 |
| 90 | Ga0055540_1011016 | 3300003792 | Bacteria | 2955 |
| 91 | Ga0055540_1031528 | 3300003792 | Bacteria | 1217 |
| 92 | Ga0055531_10000172 | 3300003794 | Bacteria | 72762 |
| 93 | Ga0055531_10000358 | 3300003794 | Bacteria | 44456 |
| 94 | Ga0055531_10002682 | 3300003794 | Bacteria | 11725 |
| 95 | Ga0055531_10005309 | 3300003794 | Bacteria | 7562 |
| 96 | Ga0055531_10005963 | 3300003794 | Bacteria | 7002 |
| 97 | Ga0055531_10006250 | 3300003794 | Bacteria | 6799 |
| 98 | Ga0055531_10028801 | 3300003794 | Bacteria | 1906 |
| 99 | Ga0055543_1000608 | 3300004625 | Bacteria | 19383 |
| 100 | Ga0055543_1000748 | 3300004625 | Bacteria | 16355 |
| 101 | Ga0055543_1005165 | 3300004625 | Bacteria | 3386 |
| 102 | Ga0055543_1015830 | 3300004625 | Bacteria | 1444 |
| 103 | Ga0065165_1000181 | 3300005262 | Bacteria | 110867 |
| 104 | Ga0065165_1000230 | 3300005262 | Bacteria | 97470 |
| 105 | Ga0065165_1001066 | 3300005262 | Bacteria | 32802 |
| 106 | Ga0065165_1003702 | 3300005262 | Bacteria | 10364 |
| 107 | Ga0065165_1019433 | 3300005262 | Bacteria | 2425 |
| 108 | Ga0065165_1021019 | 3300005262 | Bacteria | 2277 |
| 109 | Ga0065704_10118735 | 3300005289 | Bacteria | 1810 |
| 110 | Ga0065707_10085220 | 3300005295 | Bacteria | 6339 |
| 111 | Ga0070658_10037209 | 3300005327 | Bacteria | 3922 |
| 112 | Ga0070658_10228945 | 3300005327 | Bacteria | 1573 |
| 113 | Ga0070676_10014095 | 3300005328 | Bacteria | 4388 |
| 114 | Ga0070676_10109041 | 3300005328 | Bacteria | 1721 |
| 115 | Ga0070683_100007080 | 3300005329 | Bacteria | 9445 |
| 116 | Ga0070690_100000674 | 3300005330 | Bacteria | 17423 |
| 117 | Ga0070690_100096685 | 3300005330 | Bacteria | 1952 |
| 118 | Ga0070670_100001588 | 3300005331 | Bacteria | 18336 |
| 119 | Ga0070670_100007193 | 3300005331 | Bacteria | 9425 |
| 120 | Ga0070670_100042246 | 3300005331 | Bacteria | 3919 |
| 121 | Ga0070670_100137157 | 3300005331 | Bacteria | 2114 |
| 122 | Ga0070670_100146701 | 3300005331 | Bacteria | 2041 |
| 123 | Ga0070677_10000616 | 3300005333 | Bacteria | 11978 |
| 124 | Ga0070677_10011451 | 3300005333 | Bacteria | 3059 |
| 125 | Ga0068869_100009616 | 3300005334 | Bacteria | 6280 |
| 126 | Ga0068869_100020870 | 3300005334 | Bacteria | 4499 |
| 127 | Ga0068869_100079183 | 3300005334 | Bacteria | 2449 |
| 128 | Ga0068869_100160705 | 3300005334 | Bacteria | 1749 |
| 129 | Ga0068869_100490802 | 3300005334 | Bacteria | 1024 |
| 130 | Ga0070666_10006295 | 3300005335 | Bacteria | 7300 |
| 131 | Ga0070666_10114086 | 3300005335 | Bacteria | 1870 |
| 132 | Ga0070666_10335833 | 3300005335 | Bacteria | 1079 |
| 133 | Ga0070680_100002051 | 3300005336 | Bacteria | 14856 |
| 134 | Ga0070682_100172320 | 3300005337 | Bacteria | 1505 |
| 135 | Ga0068868_100001668 | 3300005338 | Bacteria | 15169 |
| 136 | Ga0068868_100003096 | 3300005338 | Bacteria | 11572 |
| 137 | Ga0068868_100003572 | 3300005338 | Bacteria | 10831 |
| 138 | Ga0068868_100127576 | 3300005338 | Bacteria | 2079 |
| 139 | Ga0070660_100008509 | 3300005339 | Bacteria | 7179 |
| 140 | Ga0070660_100027599 | 3300005339 | Bacteria | 4238 |
| 141 | Ga0070660_100062158 | 3300005339 | Bacteria | 2900 |
| 142 | Ga0070689_100116230 | 3300005340 | Bacteria | 2133 |
| 143 | Ga0070691_10211197 | 3300005341 | Bacteria | 1024 |
| 144 | Ga0070687_100020311 | 3300005343 | Bacteria | 3104 |
| 145 | Ga0070661_100002048 | 3300005344 | Bacteria | 13895 |
| 146 | Ga0070661_100031099 | 3300005344 | Bacteria | 3859 |
| 147 | Ga0070661_100214500 | 3300005344 | Bacteria | 1474 |
| 148 | Ga0070692_10208835 | 3300005345 | Bacteria | 1148 |
| 149 | Ga0070668_100023518 | 3300005347 | Bacteria | 4661 |
| 150 | Ga0070668_100065066 | 3300005347 | Bacteria | 2828 |
| 151 | Ga0070668_100121311 | 3300005347 | Bacteria | 2090 |
| 152 | Ga0070669_100055294 | 3300005353 | Bacteria | 2908 |
| 153 | Ga0070669_100099413 | 3300005353 | Bacteria | 2193 |
| 154 | Ga0070669_100103198 | 3300005353 | Bacteria | 2154 |
| 155 | Ga0070675_100000941 | 3300005354 | Bacteria | 20742 |
| 156 | Ga0070675_100002761 | 3300005354 | Bacteria | 13196 |
| 157 | Ga0070675_100012995 | 3300005354 | Bacteria | 6538 |
| 158 | Ga0070675_100025238 | 3300005354 | Bacteria | 4764 |
| 159 | Ga0070675_100028517 | 3300005354 | Bacteria | 4493 |
| 160 | Ga0070675_100059896 | 3300005354 | Bacteria | 3142 |
| 161 | Ga0070675_100217028 | 3300005354 | Bacteria | 1664 |
| 162 | Ga0070675_100297307 | 3300005354 | Bacteria | 1422 |
| 163 | Ga0070671_100005745 | 3300005355 | Bacteria | 9880 |
| 164 | Ga0070671_100011544 | 3300005355 | Bacteria | 7104 |
| 165 | Ga0070671_100054749 | 3300005355 | Bacteria | 3317 |
| 166 | Ga0070671_100070434 | 3300005355 | Bacteria | 2917 |
| 167 | Ga0070674_100023714 | 3300005356 | Bacteria | 3975 |
| 168 | Ga0070674_100053542 | 3300005356 | Bacteria | 2787 |
| 169 | Ga0070674_100114654 | 3300005356 | Bacteria | 1985 |
| 170 | Ga0070673_100001255 | 3300005364 | Bacteria | 14729 |
| 171 | Ga0070673_100003101 | 3300005364 | Bacteria | 10291 |
| 172 | Ga0070673_100004666 | 3300005364 | Bacteria | 8699 |
| 173 | Ga0070673_100035122 | 3300005364 | Bacteria | 3799 |
| 174 | Ga0070673_100072816 | 3300005364 | Bacteria | 2764 |
| 175 | Ga0070673_100483671 | 3300005364 | Bacteria | 1118 |
| 176 | Ga0070688_100011717 | 3300005365 | Bacteria | 4886 |
| 177 | Ga0070688_100238868 | 3300005365 | Bacteria | 1288 |
| 178 | Ga0070659_100000684 | 3300005366 | Bacteria | 24663 |
| 179 | Ga0070659_100021253 | 3300005366 | Bacteria | 4938 |
| 180 | Ga0070659_100036638 | 3300005366 | Bacteria | 3824 |
| 181 | Ga0070659_100116188 | 3300005366 | Bacteria | 2163 |
| 182 | Ga0070667_100002698 | 3300005367 | Bacteria | 15368 |
| 183 | Ga0070667_100004949 | 3300005367 | Bacteria | 11163 |
| 184 | Ga0070667_100021567 | 3300005367 | Bacteria | 5347 |
| 185 | Ga0070667_100083474 | 3300005367 | Bacteria | 2737 |
| 186 | Ga0070667_100141133 | 3300005367 | Bacteria | 2110 |
| 187 | Ga0070667_100171475 | 3300005367 | Bacteria | 1916 |
| 188 | Ga0070667_100192436 | 3300005367 | Bacteria | 1807 |
| 189 | Ga0070667_100203620 | 3300005367 | Bacteria | 1757 |
| 190 | Ga0070667_100238931 | 3300005367 | Bacteria | 1621 |
| 191 | Ga0070667_100272803 | 3300005367 | Bacteria | 1517 |
| 192 | Ga0070714_100247327 | 3300005435 | Bacteria | 1648 |
| 193 | Ga0070713_101274416 | 3300005436 | Bacteria | 712 |
| 194 | Ga0070700_100015415 | 3300005441 | Bacteria | 4333 |
| 195 | Ga0070700_100210155 | 3300005441 | Bacteria | 1372 |
| 196 | Ga0070663_100000172 | 3300005455 | Bacteria | 32702 |
| 197 | Ga0070663_100023744 | 3300005455 | Bacteria | 4115 |
| 198 | Ga0070663_100371403 | 3300005455 | Bacteria | 1163 |
| 199 | Ga0070678_100049891 | 3300005456 | Bacteria | 3023 |
| 200 | Ga0070678_100083026 | 3300005456 | Bacteria | 2434 |
| 201 | Ga0070678_100110138 | 3300005456 | Bacteria | 2153 |
| 202 | Ga0070678_100156816 | 3300005456 | Bacteria | 1840 |
| 203 | Ga0070678_100197838 | 3300005456 | Bacteria | 1657 |
| 204 | Ga0070678_100378795 | 3300005456 | Bacteria | 1224 |
| 205 | Ga0070662_100000858 | 3300005457 | Bacteria | 18683 |
| 206 | Ga0070662_100013398 | 3300005457 | Bacteria | 5456 |
| 207 | Ga0070662_100055488 | 3300005457 | Bacteria | 2874 |
| 208 | Ga0070662_100089516 | 3300005457 | Bacteria | 2308 |
| 209 | Ga0068867_100000070 | 3300005459 | Bacteria | 61892 |
| 210 | Ga0068867_100000587 | 3300005459 | Bacteria | 24119 |
| 211 | Ga0068867_100035855 | 3300005459 | Bacteria | 3599 |
| 212 | Ga0068867_100075085 | 3300005459 | Bacteria | 2535 |
| 213 | Ga0068867_100079661 | 3300005459 | Bacteria | 2465 |
| 214 | Ga0068867_100708956 | 3300005459 | Bacteria | 889 |
| 215 | Ga0070685_10088868 | 3300005466 | Bacteria | 1867 |
| 216 | Ga0070685_10301435 | 3300005466 | Bacteria | 1080 |
| 217 | Ga0070706_100012812 | 3300005467 | Bacteria | 7761 |
| 218 | Ga0070706_100780930 | 3300005467 | Bacteria | 884 |
| 219 | Ga0070707_100034845 | 3300005468 | Bacteria | 4800 |
| 220 | Ga0070679_100006631 | 3300005530 | Bacteria | 10794 |
| 221 | Ga0070684_100031525 | 3300005535 | Bacteria | 4513 |
| 222 | Ga0070684_100070877 | 3300005535 | Bacteria | 3068 |
| 223 | Ga0068853_100014437 | 3300005539 | Bacteria | 6467 |
| 224 | Ga0068853_100055955 | 3300005539 | Bacteria | 3400 |
| 225 | Ga0068853_100071386 | 3300005539 | Bacteria | 3024 |
| 226 | Ga0068853_100127746 | 3300005539 | Bacteria | 2272 |
| 227 | Ga0068853_100218231 | 3300005539 | Bacteria | 1741 |
| 228 | Ga0068853_100484200 | 3300005539 | Bacteria | 1167 |
| 229 | Ga0068853_100484281 | 3300005539 | Bacteria | 1166 |
| 230 | Ga0068853_100523590 | 3300005539 | Bacteria | 1121 |
| 231 | Ga0068853_100547719 | 3300005539 | Bacteria | 1096 |
| 232 | Ga0068853_100641456 | 3300005539 | Bacteria | 1010 |
| 233 | Ga0068853_100913355 | 3300005539 | Bacteria | 843 |
| 234 | Ga0070672_100000249 | 3300005543 | Bacteria | 30273 |
| 235 | Ga0070672_100004411 | 3300005543 | Bacteria | 9209 |
| 236 | Ga0070672_100006413 | 3300005543 | Bacteria | 7908 |
| 237 | Ga0070672_100009784 | 3300005543 | Bacteria | 6624 |
| 238 | Ga0070672_100031950 | 3300005543 | Bacteria | 3968 |
| 239 | Ga0070672_100073981 | 3300005543 | Bacteria | 2717 |
| 240 | Ga0070672_100081573 | 3300005543 | Bacteria | 2593 |
| 241 | Ga0070672_100089667 | 3300005543 | Bacteria | 2478 |
| 242 | Ga0070672_100089747 | 3300005543 | Bacteria | 2477 |
| 243 | Ga0070672_100155866 | 3300005543 | Bacteria | 1892 |
| 244 | Ga0070672_100232637 | 3300005543 | Bacteria | 1548 |
| 245 | Ga0070686_100338066 | 3300005544 | Bacteria | 1127 |
| 246 | Ga0070665_100011217 | 3300005548 | Bacteria | 9061 |
| 247 | Ga0070665_100015059 | 3300005548 | Bacteria | 7763 |
| 248 | Ga0070665_100063615 | 3300005548 | Bacteria | 3699 |
| 249 | Ga0070665_100128052 | 3300005548 | Bacteria | 2541 |
| 250 | Ga0070665_100350953 | 3300005548 | Bacteria | 1481 |
| 251 | Ga0068855_100002721 | 3300005563 | Bacteria | 21787 |
| 252 | Ga0068855_100012472 | 3300005563 | Bacteria | 10258 |
| 253 | Ga0068855_100097782 | 3300005563 | Bacteria | 3382 |
| 254 | Ga0068855_100556656 | 3300005563 | Bacteria | 1241 |
| 255 | Ga0068855_100584798 | 3300005563 | Bacteria | 1205 |
| 256 | Ga0070664_100005782 | 3300005564 | Bacteria | 9976 |
| 257 | Ga0070664_100011468 | 3300005564 | Bacteria | 7193 |
| 258 | Ga0070664_100032384 | 3300005564 | Bacteria | 4372 |
| 259 | Ga0070664_100083753 | 3300005564 | Bacteria | 2752 |
| 260 | Ga0070664_100227897 | 3300005564 | Bacteria | 1669 |
| 261 | Ga0068857_100001142 | 3300005577 | Bacteria | 20694 |
| 262 | Ga0068857_100049769 | 3300005577 | Bacteria | 3717 |
| 263 | Ga0068857_100056777 | 3300005577 | Bacteria | 3475 |
| 264 | Ga0068857_100076126 | 3300005577 | Bacteria | 2992 |
| 265 | Ga0068857_100084990 | 3300005577 | Bacteria | 2827 |
| 266 | Ga0068857_100136013 | 3300005577 | Bacteria | 2219 |
| 267 | Ga0068857_100343629 | 3300005577 | Bacteria | 1381 |
| 268 | Ga0068854_100002016 | 3300005578 | Bacteria | 12432 |
| 269 | Ga0068854_100149663 | 3300005578 | Bacteria | 1799 |
| 270 | Ga0068854_100248759 | 3300005578 | Bacteria | 1419 |
| 271 | Ga0068854_100311665 | 3300005578 | Bacteria | 1276 |
| 272 | Ga0068856_100005635 | 3300005614 | Bacteria | 12324 |
| 273 | Ga0068856_100068699 | 3300005614 | Bacteria | 3503 |
| 274 | Ga0068856_100071680 | 3300005614 | Bacteria | 3430 |
| 275 | Ga0068856_100443349 | 3300005614 | Bacteria | 1319 |
| 276 | Ga0068856_100715511 | 3300005614 | Bacteria | 1022 |
| 277 | Ga0070702_100080844 | 3300005615 | Bacteria | 1946 |
| 278 | Ga0068852_100002789 | 3300005616 | Bacteria | 12102 |
| 279 | Ga0068852_100007651 | 3300005616 | Bacteria | 7899 |
| 280 | Ga0068852_100162604 | 3300005616 | Bacteria | 2086 |
| 281 | Ga0068852_100171428 | 3300005616 | Bacteria | 2034 |
| 282 | Ga0068852_100278126 | 3300005616 | Bacteria | 1613 |
| 283 | Ga0068852_100555415 | 3300005616 | Bacteria | 1149 |
| 284 | Ga0068859_100002993 | 3300005617 | Bacteria | 17130 |
| 285 | Ga0068859_100041965 | 3300005617 | Bacteria | 4595 |
| 286 | Ga0068859_100055554 | 3300005617 | Bacteria | 3984 |
| 287 | Ga0068859_100329974 | 3300005617 | Bacteria | 1620 |
| 288 | Ga0068864_100006013 | 3300005618 | Bacteria | 9963 |
| 289 | Ga0068864_100006058 | 3300005618 | Bacteria | 9923 |
| 290 | Ga0068864_100013588 | 3300005618 | Bacteria | 6749 |
| 291 | Ga0068864_100122122 | 3300005618 | Bacteria | 2330 |
| 292 | Ga0068864_100160401 | 3300005618 | Bacteria | 2044 |
| 293 | Ga0068866_10018175 | 3300005718 | Bacteria | 3174 |
| 294 | Ga0068861_100003493 | 3300005719 | Bacteria | 10439 |
| 295 | Ga0068861_100021625 | 3300005719 | Bacteria | 4625 |
| 296 | Ga0068861_100038355 | 3300005719 | Bacteria | 3566 |
| 297 | Ga0068861_100159011 | 3300005719 | Bacteria | 1862 |
| 298 | Ga0068861_100197171 | 3300005719 | Bacteria | 1687 |
| 299 | Ga0068851_10059788 | 3300005834 | Bacteria | 1950 |
| 300 | Ga0068851_10101715 | 3300005834 | Bacteria | 1526 |
| 301 | Ga0068863_100001479 | 3300005841 | Bacteria | 23291 |
| 302 | Ga0068863_100010184 | 3300005841 | Bacteria | 9142 |
| 303 | Ga0068863_100052311 | 3300005841 | Bacteria | 3871 |
| 304 | Ga0068863_100202960 | 3300005841 | Bacteria | 1907 |
| 305 | Ga0068863_100261287 | 3300005841 | Bacteria | 1674 |
| 306 | Ga0068858_100001164 | 3300005842 | Bacteria | 27258 |
| 307 | Ga0068858_100003457 | 3300005842 | Bacteria | 15673 |
| 308 | Ga0068858_100007880 | 3300005842 | Bacteria | 10270 |
| 309 | Ga0068858_100239145 | 3300005842 | Bacteria | 1722 |
| 310 | Ga0068858_100347806 | 3300005842 | Bacteria | 1420 |
| 311 | Ga0068858_100441145 | 3300005842 | Bacteria | 1254 |
| 312 | Ga0068860_100001400 | 3300005843 | Bacteria | 26146 |
| 313 | Ga0068860_100010521 | 3300005843 | Bacteria | 9145 |
| 314 | Ga0068860_100027642 | 3300005843 | Bacteria | 5461 |
| 315 | Ga0068860_100147158 | 3300005843 | Bacteria | 2267 |
| 316 | Ga0068860_100310715 | 3300005843 | Bacteria | 1546 |
| 317 | Ga0068860_100494552 | 3300005843 | Bacteria | 1220 |
| 318 | Ga0068862_100005708 | 3300005844 | Bacteria | 10383 |
| 319 | Ga0068862_100046531 | 3300005844 | Bacteria | 3701 |
| 320 | Ga0068862_100071372 | 3300005844 | Bacteria | 2998 |
| 321 | Ga0068862_100294454 | 3300005844 | Bacteria | 1491 |
| 322 | Ga0075365_10004092 | 3300006038 | Bacteria | 7664 |
| 323 | Ga0075365_10096068 | 3300006038 | Bacteria | 2025 |
| 324 | Ga0075365_10174636 | 3300006038 | Bacteria | 1500 |
| 325 | Ga0075365_10247416 | 3300006038 | Bacteria | 1252 |
| 326 | Ga0075365_10286431 | 3300006038 | Bacteria | 1159 |
| 327 | Ga0075365_10344941 | 3300006038 | Bacteria | 1049 |
| 328 | Ga0075368_10015034 | 3300006042 | Bacteria | 2865 |
| 329 | Ga0075363_100004278 | 3300006048 | Bacteria | 6209 |
| 330 | Ga0075363_100078873 | 3300006048 | Bacteria | 1798 |
| 331 | Ga0075363_100134428 | 3300006048 | Bacteria | 1389 |
| 332 | Ga0075364_10012737 | 3300006051 | Bacteria | 5157 |
| 333 | Ga0075364_10022939 | 3300006051 | Bacteria | 3947 |
| 334 | Ga0075364_10346540 | 3300006051 | Bacteria | 1012 |
| 335 | Ga0075432_10007755 | 3300006058 | Bacteria | 3659 |
| 336 | Ga0075432_10008480 | 3300006058 | Bacteria | 3506 |
| 337 | Ga0075432_10050686 | 3300006058 | Bacteria | 1464 |
| 338 | Ga0075362_10008418 | 3300006177 | Bacteria | 3942 |
| 339 | Ga0075362_10015684 | 3300006177 | Bacteria | 3086 |
| 340 | Ga0075362_10036898 | 3300006177 | Bacteria | 2141 |
| 341 | Ga0075362_10066929 | 3300006177 | Bacteria | 1634 |
| 342 | Ga0075362_10088778 | 3300006177 | Bacteria | 1432 |
| 343 | Ga0075362_10091944 | 3300006177 | Bacteria | 1409 |
| 344 | Ga0075362_10196340 | 3300006177 | Bacteria | 981 |
| 345 | Ga0075362_10208418 | 3300006177 | Bacteria | 953 |
| 346 | Ga0075367_10005261 | 3300006178 | Bacteria | 6398 |
| 347 | Ga0075367_10014386 | 3300006178 | Bacteria | 4283 |
| 348 | Ga0075367_10040153 | 3300006178 | Bacteria | 2731 |
| 349 | Ga0075367_10051646 | 3300006178 | Bacteria | 2430 |
| 350 | Ga0075367_10056457 | 3300006178 | Bacteria | 2333 |
| 351 | Ga0075367_10098884 | 3300006178 | Bacteria | 1782 |
| 352 | Ga0075369_10056543 | 3300006186 | Bacteria | 1705 |
| 353 | Ga0075369_10075732 | 3300006186 | Bacteria | 1486 |
| 354 | Ga0075366_10001141 | 3300006195 | Bacteria | 13130 |
| 355 | Ga0075366_10003640 | 3300006195 | Bacteria | 8167 |
| 356 | Ga0075366_10011288 | 3300006195 | Bacteria | 5041 |
| 357 | Ga0075366_10018595 | 3300006195 | Bacteria | 4013 |
| 358 | Ga0075366_10050467 | 3300006195 | Bacteria | 2470 |
| 359 | Ga0075366_10071587 | 3300006195 | Bacteria | 2065 |
| 360 | Ga0075366_10072270 | 3300006195 | Bacteria | 2055 |
| 361 | Ga0075366_10083048 | 3300006195 | Bacteria | 1914 |
| 362 | Ga0075366_10105250 | 3300006195 | Bacteria | 1696 |
| 363 | Ga0075366_10145137 | 3300006195 | Bacteria | 1436 |
| 364 | Ga0075366_10170668 | 3300006195 | Bacteria | 1319 |
| 365 | Ga0075366_10185898 | 3300006195 | Bacteria | 1262 |
| 366 | Ga0097621_100014909 | 3300006237 | Bacteria | 5832 |
| 367 | Ga0097621_100018737 | 3300006237 | Bacteria | 5295 |
| 368 | Ga0075370_10000200 | 3300006353 | Bacteria | 21094 |
| 369 | Ga0075370_10003569 | 3300006353 | Bacteria | 7437 |
| 370 | Ga0075370_10004970 | 3300006353 | Bacteria | 6538 |
| 371 | Ga0075370_10005043 | 3300006353 | Bacteria | 6504 |
| 372 | Ga0075370_10006717 | 3300006353 | Bacteria | 5803 |
| 373 | Ga0075370_10007548 | 3300006353 | Bacteria | 5543 |
| 374 | Ga0075370_10009819 | 3300006353 | Bacteria | 4987 |
| 375 | Ga0075370_10016620 | 3300006353 | Bacteria | 3960 |
| 376 | Ga0075370_10019470 | 3300006353 | Bacteria | 3697 |
| 377 | Ga0075370_10038128 | 3300006353 | Bacteria | 2704 |
| 378 | Ga0075370_10067947 | 3300006353 | Bacteria | 2035 |
| 379 | Ga0075370_10260017 | 3300006353 | Bacteria | 1029 |
| 380 | Ga0075370_10416746 | 3300006353 | Bacteria | 807 |
| 381 | Ga0068871_100011778 | 3300006358 | Bacteria | 6427 |
| 382 | Ga0068871_100107790 | 3300006358 | Bacteria | 2340 |
| 383 | Ga0068871_100180653 | 3300006358 | Bacteria | 1813 |
| 384 | Ga0068871_100256765 | 3300006358 | Bacteria | 1524 |
| 385 | Ga0068871_100297967 | 3300006358 | Bacteria | 1415 |
| 386 | Ga0075430_100074859 | 3300006846 | Bacteria | 2839 |
| 387 | Ga0075429_100013802 | 3300006880 | Bacteria | 7006 |
| 388 | Ga0075429_100100877 | 3300006880 | Bacteria | 2520 |
| 389 | Ga0068865_100021548 | 3300006881 | Bacteria | 4192 |
| 390 | Ga0068865_100182037 | 3300006881 | Bacteria | 1619 |
| 391 | Ga0097620_100002993 | 3300006931 | Bacteria | 17130 |
| 392 | Ga0097620_100041965 | 3300006931 | Bacteria | 4595 |
| 393 | Ga0097620_100055553 | 3300006931 | Bacteria | 3984 |
| 394 | Ga0097620_100329983 | 3300006931 | Bacteria | 1620 |
| 395 | Ga0099823_1000023 | 3300006944 | Bacteria | 75509 |
| 396 | Ga0079104_1000025 | 3300006946 | Bacteria | 218785 |
| 397 | Ga0099826_10009182 | 3300006948 | Bacteria | 7382 |
| 398 | Ga0099826_10166968 | 3300006948 | Bacteria | 1240 |
| 399 | Ga0099826_10177925 | 3300006948 | Bacteria | 1187 |
| 400 | Ga0105244_10014231 | 3300009036 | Bacteria | 4611 |
| 401 | Ga0105240_10002099 | 3300009093 | Bacteria | 32606 |
| 402 | Ga0105240_10040427 | 3300009093 | Bacteria | 5964 |
| 403 | Ga0105240_10050723 | 3300009093 | Bacteria | 5229 |
| 404 | Ga0105240_10052231 | 3300009093 | Bacteria | 5139 |
| 405 | Ga0105240_10063922 | 3300009093 | Bacteria | 4575 |
| 406 | Ga0105245_10095403 | 3300009098 | Bacteria | 2744 |
| 407 | Ga0105245_10140169 | 3300009098 | Bacteria | 2276 |
| 408 | Ga0105245_10371897 | 3300009098 | Bacteria | 1421 |
| 409 | Ga0114129_10118444 | 3300009147 | Bacteria | 3647 |
| 410 | Ga0105243_10000881 | 3300009148 | Bacteria | 28283 |
| 411 | Ga0105243_10001208 | 3300009148 | Bacteria | 23242 |
| 412 | Ga0105243_10003393 | 3300009148 | Bacteria | 12920 |
| 413 | Ga0105243_10006952 | 3300009148 | Bacteria | 8713 |
| 414 | Ga0105243_10017699 | 3300009148 | Bacteria | 5389 |
| 415 | Ga0105243_10046506 | 3300009148 | Bacteria | 3414 |
| 416 | Ga0105243_10064750 | 3300009148 | Bacteria | 2934 |
| 417 | Ga0105243_10094187 | 3300009148 | Bacteria | 2473 |
| 418 | Ga0105243_10129738 | 3300009148 | Bacteria | 2137 |
| 419 | Ga0105241_10966884 | 3300009174 | Bacteria | 795 |
| 420 | Ga0105242_10155515 | 3300009176 | Bacteria | 1997 |
| 421 | Ga0105248_10001394 | 3300009177 | Bacteria | 26961 |
| 422 | Ga0105248_10003839 | 3300009177 | Bacteria | 16654 |
| 423 | Ga0105248_10074973 | 3300009177 | Bacteria | 3803 |
| 424 | Ga0105248_10436192 | 3300009177 | Bacteria | 1476 |
| 425 | Ga0105237_10002681 | 3300009545 | Bacteria | 21822 |
| 426 | Ga0105237_10162787 | 3300009545 | Bacteria | 2230 |
| 427 | Ga0105237_10241354 | 3300009545 | Bacteria | 1808 |
| 428 | Ga0105238_10010268 | 3300009551 | Bacteria | 9391 |
| 429 | Ga0105249_10062903 | 3300009553 | Bacteria | 3408 |
| 430 | Ga0105249_10071057 | 3300009553 | Bacteria | 3215 |
| 431 | Ga0105249_10093002 | 3300009553 | Bacteria | 2824 |
| 432 | Ga0105249_10652667 | 3300009553 | Bacteria | 1110 |
| 433 | Ga0105239_10001896 | 3300010375 | Bacteria | 27329 |
| 434 | Ga0105239_10010428 | 3300010375 | Bacteria | 10391 |
| 435 | Ga0105239_10047344 | 3300010375 | Bacteria | 4713 |
| 436 | Ga0105239_10075364 | 3300010375 | Bacteria | 3709 |
| 437 | Ga0105239_10129672 | 3300010375 | Bacteria | 2804 |
| 438 | Ga0105239_10646603 | 3300010375 | Bacteria | 1208 |
| 439 | Ga0105246_10283900 | 3300011119 | Bacteria | 1329 |
| 440 | Ga0157317_1000084 | 3300012475 | Bacteria | 2576 |
| 441 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 442 | Ga0157373_10016739 | 3300013100 | Bacteria | 5344 |
| 443 | Ga0157373_10032893 | 3300013100 | Bacteria | 3732 |
| 444 | Ga0157371_10052068 | 3300013102 | Bacteria | 2908 |
| 445 | Ga0157370_10031947 | 3300013104 | Bacteria | 5144 |
| 446 | Ga0157370_10079823 | 3300013104 | Bacteria | 3081 |
| 447 | Ga0157370_10383422 | 3300013104 | Bacteria | 1295 |
| 448 | Ga0157369_10008315 | 3300013105 | Bacteria | 11894 |
| 449 | Ga0157369_10037330 | 3300013105 | Bacteria | 5319 |
| 450 | Ga0157369_10108715 | 3300013105 | Bacteria | 2949 |
| 451 | Ga0157374_10219015 | 3300013296 | Bacteria | 1867 |
| 452 | Ga0157374_10236678 | 3300013296 | Bacteria | 1795 |
| 453 | Ga0157378_10025519 | 3300013297 | Bacteria | 5203 |
| 454 | Ga0157378_10066654 | 3300013297 | Bacteria | 3225 |
| 455 | Ga0157378_10196196 | 3300013297 | Bacteria | 1907 |
| 456 | Ga0157378_10285517 | 3300013297 | Bacteria | 1592 |
| 457 | Ga0163162_10039558 | 3300013306 | Bacteria | 4713 |
| 458 | Ga0163162_10081416 | 3300013306 | Bacteria | 3308 |
| 459 | Ga0163162_10202262 | 3300013306 | Bacteria | 2115 |
| 460 | Ga0163162_10291647 | 3300013306 | Bacteria | 1763 |
| 461 | Ga0157372_10730119 | 3300013307 | Bacteria | 1152 |
| 462 | Ga0157375_10005240 | 3300013308 | Bacteria | 11251 |
| 463 | Ga0157375_10040743 | 3300013308 | Bacteria | 4481 |
| 464 | Ga0157375_10128748 | 3300013308 | Bacteria | 2650 |
| 465 | Ga0157375_10134869 | 3300013308 | Bacteria | 2591 |
| 466 | Ga0157375_10178174 | 3300013308 | Bacteria | 2276 |
| 467 | Ga0157375_10453307 | 3300013308 | Bacteria | 1448 |
| 468 | Ga0163163_10004818 | 3300014325 | Bacteria | 11591 |
| 469 | Ga0163163_10135864 | 3300014325 | Bacteria | 2500 |
| 470 | Ga0157380_10039716 | 3300014326 | Bacteria | 3661 |
| 471 | Ga0157380_10126388 | 3300014326 | Bacteria | 2174 |
| 472 | Ga0157380_10144000 | 3300014326 | Bacteria | 2051 |
| 473 | Ga0157380_10188839 | 3300014326 | Bacteria | 1817 |
| 474 | Ga0157380_10547814 | 3300014326 | Bacteria | 1134 |
| 475 | Ga0182008_10000893 | 3300014497 | Bacteria | 20726 |
| 476 | Ga0182008_10002052 | 3300014497 | Bacteria | 12911 |
| 477 | Ga0182008_10018330 | 3300014497 | Bacteria | 3625 |
| 478 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 479 | Ga0157377_10000848 | 3300014745 | Bacteria | 12693 |
| 480 | Ga0157379_10004851 | 3300014968 | Bacteria | 11548 |
| 481 | Ga0157379_10020286 | 3300014968 | Bacteria | 5876 |
| 482 | Ga0157379_10021534 | 3300014968 | Bacteria | 5708 |
| 483 | Ga0157379_10023314 | 3300014968 | Bacteria | 5492 |
| 484 | Ga0157379_10043364 | 3300014968 | Bacteria | 4016 |
| 485 | Ga0157379_10072230 | 3300014968 | Bacteria | 3087 |
| 486 | Ga0157379_10172089 | 3300014968 | Bacteria | 1955 |
| 487 | Ga0157379_10258325 | 3300014968 | Bacteria | 1582 |
| 488 | Ga0157376_10007038 | 3300014969 | Bacteria | 7983 |
| 489 | Ga0157376_10011702 | 3300014969 | Bacteria | 6479 |
| 490 | Ga0157376_10077188 | 3300014969 | Bacteria | 2849 |
| 491 | Ga0157376_10085569 | 3300014969 | Bacteria | 2717 |
| 492 | Ga0182006_1001088 | 3300015261 | Bacteria | 17410 |
| 493 | Ga0182006_1068687 | 3300015261 | Bacteria | 1319 |
| 494 | Ga0182007_10002796 | 3300015262 | Bacteria | 8504 |
| 495 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 496 | Ga0163161_10000193 | 3300017792 | Bacteria | 56074 |
| 497 | Ga0163161_10004445 | 3300017792 | Bacteria | 9772 |
| 498 | Ga0163161_10005014 | 3300017792 | Bacteria | 9213 |
| 499 | Ga0163161_10034770 | 3300017792 | Bacteria | 3605 |
| 500 | Ga0163161_10099189 | 3300017792 | Bacteria | 2165 |
| 501 | Ga0163161_10113300 | 3300017792 | Bacteria | 2030 |
| 502 | Ga0213872_10000129 | 3300021361 | Bacteria | 69032 |
| 503 | Ga0213872_10017841 | 3300021361 | Bacteria | 3276 |
| 504 | Ga0213872_10037201 | 3300021361 | Bacteria | 2222 |
| 505 | Ga0213872_10112089 | 3300021361 | Bacteria | 1211 |
| 506 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 507 | Ga0209436_111100 | 3300025208 | Bacteria | 1603 |
| 508 | Ga0209674_100165 | 3300025226 | Bacteria | 86006 |
| 509 | Ga0209672_100157 | 3300025228 | Bacteria | 59454 |
| 510 | Ga0209147_100575 | 3300025229 | Bacteria | 20578 |
| 511 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 512 | Ga0209563_100137 | 3300025230 | Bacteria | 87321 |
| 513 | Ga0207427_101146 | 3300025231 | Bacteria | 10442 |
| 514 | Ga0209258_100146 | 3300025242 | Bacteria | 163331 |
| 515 | Ga0209258_100225 | 3300025242 | Bacteria | 107138 |
| 516 | Ga0209258_100973 | 3300025242 | Bacteria | 13413 |
| 517 | Ga0207425_1000295 | 3300025245 | Bacteria | 36319 |
| 518 | Ga0207425_1000332 | 3300025245 | Bacteria | 33095 |
| 519 | Ga0207425_1001492 | 3300025245 | Bacteria | 9707 |
| 520 | Ga0207425_1002296 | 3300025245 | Bacteria | 6865 |
| 521 | Ga0207425_1004000 | 3300025245 | Bacteria | 4532 |
| 522 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 523 | Ga0209646_1000062 | 3300025246 | Bacteria | 252045 |
| 524 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 525 | Ga0209026_1000026 | 3300025250 | Bacteria | 352109 |
| 526 | Ga0209677_100124 | 3300025253 | Bacteria | 79576 |
| 527 | Ga0209677_100191 | 3300025253 | Bacteria | 50010 |
| 528 | Ga0209677_101539 | 3300025253 | Bacteria | 9834 |
| 529 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 530 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 531 | Ga0209759_1000050 | 3300025256 | Bacteria | 215979 |
| 532 | Ga0209759_1001102 | 3300025256 | Bacteria | 17442 |
| 533 | Ga0209759_1001457 | 3300025256 | Bacteria | 13288 |
| 534 | Ga0209759_1007632 | 3300025256 | Bacteria | 3457 |
| 535 | Ga0209759_1008489 | 3300025256 | Bacteria | 3194 |
| 536 | Ga0209759_1011545 | 3300025256 | Bacteria | 2503 |
| 537 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 538 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 539 | Ga0209129_1002839 | 3300025258 | Bacteria | 8016 |
| 540 | Ga0209129_1004667 | 3300025258 | Bacteria | 5232 |
| 541 | Ga0209129_1013599 | 3300025258 | Bacteria | 1782 |
| 542 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 543 | Ga0209565_1000085 | 3300025263 | Bacteria | 153075 |
| 544 | Ga0209565_1000639 | 3300025263 | Bacteria | 22732 |
| 545 | Ga0209565_1000937 | 3300025263 | Bacteria | 15341 |
| 546 | Ga0209565_1005491 | 3300025263 | Bacteria | 3678 |
| 547 | Ga0209565_1009634 | 3300025263 | Bacteria | 2435 |
| 548 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 549 | Ga0209673_1000045 | 3300025273 | Bacteria | 290531 |
| 550 | Ga0209673_1000133 | 3300025273 | Bacteria | 161740 |
| 551 | Ga0209673_1000304 | 3300025273 | Bacteria | 91151 |
| 552 | Ga0209673_1001052 | 3300025273 | Bacteria | 31821 |
| 553 | Ga0209673_1003345 | 3300025273 | Bacteria | 9586 |
| 554 | Ga0209673_1003959 | 3300025273 | Bacteria | 8272 |
| 555 | Ga0209673_1006737 | 3300025273 | Bacteria | 5471 |
| 556 | Ga0209673_1012989 | 3300025273 | Bacteria | 3314 |
| 557 | Ga0209673_1023816 | 3300025273 | Bacteria | 2074 |
| 558 | Ga0209130_1000056 | 3300025284 | Bacteria | 210851 |
| 559 | Ga0209130_1000070 | 3300025284 | Bacteria | 179057 |
| 560 | Ga0209130_1000326 | 3300025284 | Bacteria | 54842 |
| 561 | Ga0209130_1001246 | 3300025284 | Bacteria | 17803 |
| 562 | Ga0209130_1004082 | 3300025284 | Bacteria | 5759 |
| 563 | Ga0209675_1000083 | 3300025291 | Bacteria | 153075 |
| 564 | Ga0209675_1000273 | 3300025291 | Bacteria | 49501 |
| 565 | Ga0209675_1000516 | 3300025291 | Bacteria | 28507 |
| 566 | Ga0209675_1001347 | 3300025291 | Bacteria | 14497 |
| 567 | Ga0209675_1001834 | 3300025291 | Bacteria | 11569 |
| 568 | Ga0209675_1002863 | 3300025291 | Bacteria | 8567 |
| 569 | Ga0209675_1004787 | 3300025291 | Bacteria | 5884 |
| 570 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 571 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 572 | Ga0209676_1000268 | 3300025292 | Bacteria | 108430 |
| 573 | Ga0209676_1001242 | 3300025292 | Bacteria | 26866 |
| 574 | Ga0209676_1010898 | 3300025292 | Bacteria | 3729 |
| 575 | Ga0209676_1011875 | 3300025292 | Bacteria | 3473 |
| 576 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 577 | Ga0209025_1000111 | 3300025294 | Bacteria | 218982 |
| 578 | Ga0209025_1000432 | 3300025294 | Bacteria | 82875 |
| 579 | Ga0209025_1002684 | 3300025294 | Bacteria | 18159 |
| 580 | Ga0209025_1003907 | 3300025294 | Bacteria | 13429 |
| 581 | Ga0209025_1005182 | 3300025294 | Bacteria | 10773 |
| 582 | Ga0209025_1010358 | 3300025294 | Bacteria | 6324 |
| 583 | Ga0209025_1010592 | 3300025294 | Bacteria | 6226 |
| 584 | Ga0209025_1011455 | 3300025294 | Bacteria | 5837 |
| 585 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 586 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 587 | Ga0209564_1000358 | 3300025295 | Bacteria | 85036 |
| 588 | Ga0209564_1000524 | 3300025295 | Bacteria | 62668 |
| 589 | Ga0209564_1000594 | 3300025295 | Bacteria | 56686 |
| 590 | Ga0209564_1001264 | 3300025295 | Bacteria | 27824 |
| 591 | Ga0209564_1004286 | 3300025295 | Bacteria | 8843 |
| 592 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 593 | Ga0209758_1000356 | 3300025297 | Bacteria | 82914 |
| 594 | Ga0209758_1000708 | 3300025297 | Bacteria | 49463 |
| 595 | Ga0209758_1002137 | 3300025297 | Bacteria | 20841 |
| 596 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 597 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 598 | Ga0209050_1000257 | 3300025298 | Bacteria | 114186 |
| 599 | Ga0209050_1001024 | 3300025298 | Bacteria | 34874 |
| 600 | Ga0209050_1002670 | 3300025298 | Bacteria | 14557 |
| 601 | Ga0209050_1005556 | 3300025298 | Bacteria | 7857 |
| 602 | Ga0209050_1011970 | 3300025298 | Bacteria | 4040 |
| 603 | Ga0209050_1013717 | 3300025298 | Bacteria | 3569 |
| 604 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 605 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 606 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 607 | Ga0209256_1000078 | 3300025299 | Bacteria | 225992 |
| 608 | Ga0209256_1000742 | 3300025299 | Bacteria | 42803 |
| 609 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 610 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 611 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 612 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 613 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 614 | Ga0209051_1000140 | 3300025303 | Bacteria | 135919 |
| 615 | Ga0209051_1000155 | 3300025303 | Bacteria | 129560 |
| 616 | Ga0209051_1000343 | 3300025303 | Bacteria | 69952 |
| 617 | Ga0209051_1000618 | 3300025303 | Bacteria | 40891 |
| 618 | Ga0209051_1000665 | 3300025303 | Bacteria | 38573 |
| 619 | Ga0209051_1001527 | 3300025303 | Bacteria | 19271 |
| 620 | Ga0209051_1003803 | 3300025303 | Bacteria | 9657 |
| 621 | Ga0209051_1007719 | 3300025303 | Bacteria | 5833 |
| 622 | Ga0209051_1008508 | 3300025303 | Bacteria | 5422 |
| 623 | Ga0209051_1009349 | 3300025303 | Bacteria | 5064 |
| 624 | Ga0209051_1012820 | 3300025303 | Bacteria | 4032 |
| 625 | Ga0209051_1027048 | 3300025303 | Bacteria | 2295 |
| 626 | Ga0209051_1066731 | 3300025303 | Bacteria | 1104 |
| 627 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 628 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 629 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 630 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 631 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 632 | Ga0209257_1000236 | 3300025304 | Bacteria | 129543 |
| 633 | Ga0209257_1000333 | 3300025304 | Bacteria | 98599 |
| 634 | Ga0209257_1000358 | 3300025304 | Bacteria | 93161 |
| 635 | Ga0209257_1001964 | 3300025304 | Bacteria | 22160 |
| 636 | Ga0209257_1005027 | 3300025304 | Bacteria | 9627 |
| 637 | Ga0209257_1005357 | 3300025304 | Bacteria | 9063 |
| 638 | Ga0209257_1009186 | 3300025304 | Bacteria | 5371 |
| 639 | Ga0209257_1021608 | 3300025304 | Bacteria | 2330 |
| 640 | Ga0209257_1040128 | 3300025304 | Bacteria | 1400 |
| 641 | Ga0207696_1046952 | 3300025711 | Bacteria | 1245 |
| 642 | Ga0207655_1031742 | 3300025728 | Bacteria | 2428 |
| 643 | Ga0207682_10001856 | 3300025893 | Bacteria | 9625 |
| 644 | Ga0207682_10003745 | 3300025893 | Bacteria | 6537 |
| 645 | Ga0207682_10013067 | 3300025893 | Bacteria | 3236 |
| 646 | Ga0207682_10076193 | 3300025893 | Bacteria | 1429 |
| 647 | Ga0207642_10017237 | 3300025899 | Bacteria | 2742 |
| 648 | Ga0207688_10027810 | 3300025901 | Bacteria | 3111 |
| 649 | Ga0207688_10061796 | 3300025901 | Bacteria | 2112 |
| 650 | Ga0207680_10008447 | 3300025903 | Bacteria | 5056 |
| 651 | Ga0207645_10002689 | 3300025907 | Bacteria | 13852 |
| 652 | Ga0207645_10037411 | 3300025907 | Bacteria | 3114 |
| 653 | Ga0207643_10073167 | 3300025908 | Bacteria | 1975 |
| 654 | Ga0207705_10034666 | 3300025909 | Bacteria | 3609 |
| 655 | Ga0207705_10099860 | 3300025909 | Bacteria | 2134 |
| 656 | Ga0207705_10270512 | 3300025909 | Bacteria | 1299 |
| 657 | Ga0207684_10047582 | 3300025910 | Bacteria | 3637 |
| 658 | Ga0207684_10103438 | 3300025910 | Bacteria | 2435 |
| 659 | Ga0207654_10022895 | 3300025911 | Bacteria | 3339 |
| 660 | Ga0207707_10218777 | 3300025912 | Bacteria | 1658 |
| 661 | Ga0207695_10018539 | 3300025913 | Bacteria | 8042 |
| 662 | Ga0207695_10037040 | 3300025913 | Bacteria | 5265 |
| 663 | Ga0207695_10046644 | 3300025913 | Bacteria | 4592 |
| 664 | Ga0207695_10096678 | 3300025913 | Bacteria | 2955 |
| 665 | Ga0207695_10266144 | 3300025913 | Bacteria | 1611 |
| 666 | Ga0207671_10002325 | 3300025914 | Bacteria | 20511 |
| 667 | Ga0207671_10096860 | 3300025914 | Bacteria | 2230 |
| 668 | Ga0207671_10304099 | 3300025914 | Bacteria | 1260 |
| 669 | Ga0207660_10006938 | 3300025917 | Bacteria | 7334 |
| 670 | Ga0207662_10097161 | 3300025918 | Bacteria | 1821 |
| 671 | Ga0207657_10010303 | 3300025919 | Bacteria | 9332 |
| 672 | Ga0207657_10011313 | 3300025919 | Bacteria | 8863 |
| 673 | Ga0207657_10109360 | 3300025919 | Bacteria | 2285 |
| 674 | Ga0207657_10229529 | 3300025919 | Bacteria | 1485 |
| 675 | Ga0207649_10005919 | 3300025920 | Bacteria | 6628 |
| 676 | Ga0207649_10210734 | 3300025920 | Bacteria | 1378 |
| 677 | Ga0207652_10009264 | 3300025921 | Bacteria | 7917 |
| 678 | Ga0207652_10087394 | 3300025921 | Bacteria | 2734 |
| 679 | Ga0207646_10172280 | 3300025922 | Bacteria | 1954 |
| 680 | Ga0207681_10015010 | 3300025923 | Bacteria | 4828 |
| 681 | Ga0207681_10020476 | 3300025923 | Bacteria | 4192 |
| 682 | Ga0207681_10065945 | 3300025923 | Bacteria | 2505 |
| 683 | Ga0207681_10089243 | 3300025923 | Bacteria | 2197 |
| 684 | Ga0207681_10090407 | 3300025923 | Bacteria | 2185 |
| 685 | Ga0207681_10112910 | 3300025923 | Bacteria | 1980 |
| 686 | Ga0207694_10013570 | 3300025924 | Bacteria | 6138 |
| 687 | Ga0207650_10000274 | 3300025925 | Bacteria | 54226 |
| 688 | Ga0207650_10005108 | 3300025925 | Bacteria | 8956 |
| 689 | Ga0207650_10006156 | 3300025925 | Bacteria | 8179 |
| 690 | Ga0207650_10098288 | 3300025925 | Bacteria | 2248 |
| 691 | Ga0207650_10172668 | 3300025925 | Bacteria | 1719 |
| 692 | Ga0207659_10001360 | 3300025926 | Bacteria | 14606 |
| 693 | Ga0207659_10015029 | 3300025926 | Bacteria | 5006 |
| 694 | Ga0207659_10020561 | 3300025926 | Bacteria | 4365 |
| 695 | Ga0207659_10127859 | 3300025926 | Bacteria | 1957 |
| 696 | Ga0207687_10064217 | 3300025927 | Bacteria | 2602 |
| 697 | Ga0207687_10072680 | 3300025927 | Bacteria | 2461 |
| 698 | Ga0207664_10217370 | 3300025929 | Bacteria | 1656 |
| 699 | Ga0207644_10000924 | 3300025931 | Bacteria | 18658 |
| 700 | Ga0207644_10014175 | 3300025931 | Bacteria | 5331 |
| 701 | Ga0207690_10005848 | 3300025932 | Bacteria | 7278 |
| 702 | Ga0207706_10000272 | 3300025933 | Bacteria | 56285 |
| 703 | Ga0207706_10005864 | 3300025933 | Bacteria | 11427 |
| 704 | Ga0207706_10042765 | 3300025933 | Bacteria | 4015 |
| 705 | Ga0207706_10071708 | 3300025933 | Bacteria | 3047 |
| 706 | Ga0207686_10037737 | 3300025934 | Bacteria | 2918 |
| 707 | Ga0207686_10048347 | 3300025934 | Bacteria | 2634 |
| 708 | Ga0207686_10214102 | 3300025934 | Bacteria | 1387 |
| 709 | Ga0207709_10000159 | 3300025935 | Bacteria | 91803 |
| 710 | Ga0207709_10000425 | 3300025935 | Bacteria | 40645 |
| 711 | Ga0207709_10001100 | 3300025935 | Bacteria | 19836 |
| 712 | Ga0207709_10002246 | 3300025935 | Bacteria | 12298 |
| 713 | Ga0207709_10019731 | 3300025935 | Bacteria | 3795 |
| 714 | Ga0207709_10020701 | 3300025935 | Bacteria | 3714 |
| 715 | Ga0207709_10067565 | 3300025935 | Bacteria | 2256 |
| 716 | Ga0207709_10162297 | 3300025935 | Bacteria | 1560 |
| 717 | Ga0207709_10174758 | 3300025935 | Bacteria | 1511 |
| 718 | Ga0207709_10312762 | 3300025935 | Bacteria | 1172 |
| 719 | Ga0207669_10002096 | 3300025937 | Bacteria | 8456 |
| 720 | Ga0207669_10162792 | 3300025937 | Bacteria | 1578 |
| 721 | Ga0207704_10066684 | 3300025938 | Bacteria | 2260 |
| 722 | Ga0207704_10111664 | 3300025938 | Bacteria | 1849 |
| 723 | Ga0207704_10149741 | 3300025938 | Bacteria | 1645 |
| 724 | Ga0207665_10153165 | 3300025939 | Bacteria | 1653 |
| 725 | Ga0207691_10000715 | 3300025940 | Bacteria | 32846 |
| 726 | Ga0207691_10025211 | 3300025940 | Bacteria | 5584 |
| 727 | Ga0207691_10025283 | 3300025940 | Bacteria | 5576 |
| 728 | Ga0207691_10039297 | 3300025940 | Bacteria | 4377 |
| 729 | Ga0207691_10052011 | 3300025940 | Bacteria | 3742 |
| 730 | Ga0207691_10092182 | 3300025940 | Bacteria | 2713 |
| 731 | Ga0207691_10100719 | 3300025940 | Bacteria | 2578 |
| 732 | Ga0207691_10212544 | 3300025940 | Bacteria | 1680 |
| 733 | Ga0207691_10234410 | 3300025940 | Bacteria | 1588 |
| 734 | Ga0207691_10296112 | 3300025940 | Bacteria | 1391 |
| 735 | Ga0207711_10004324 | 3300025941 | Bacteria | 12137 |
| 736 | Ga0207711_10006498 | 3300025941 | Bacteria | 9843 |
| 737 | Ga0207711_10010519 | 3300025941 | Bacteria | 7687 |
| 738 | Ga0207711_10022264 | 3300025941 | Bacteria | 5299 |
| 739 | Ga0207711_10231669 | 3300025941 | Bacteria | 1692 |
| 740 | Ga0207711_10640278 | 3300025941 | Bacteria | 992 |
| 741 | Ga0207689_10000832 | 3300025942 | Bacteria | 29759 |
| 742 | Ga0207689_10003940 | 3300025942 | Bacteria | 13512 |
| 743 | Ga0207689_10031852 | 3300025942 | Bacteria | 4385 |
| 744 | Ga0207689_10100576 | 3300025942 | Bacteria | 2375 |
| 745 | Ga0207689_10128307 | 3300025942 | Bacteria | 2086 |
| 746 | Ga0207661_10007953 | 3300025944 | Bacteria | 7559 |
| 747 | Ga0207679_10003912 | 3300025945 | Bacteria | 9243 |
| 748 | Ga0207679_10009078 | 3300025945 | Bacteria | 6353 |
| 749 | Ga0207679_10029674 | 3300025945 | Bacteria | 3810 |
| 750 | Ga0207679_10055221 | 3300025945 | Bacteria | 2926 |
| 751 | Ga0207679_10059750 | 3300025945 | Bacteria | 2830 |
| 752 | Ga0207679_10152036 | 3300025945 | Bacteria | 1885 |
| 753 | Ga0207667_10001993 | 3300025949 | Bacteria | 25611 |
| 754 | Ga0207667_10543182 | 3300025949 | Bacteria | 1176 |
| 755 | Ga0207651_10000893 | 3300025960 | Bacteria | 13093 |
| 756 | Ga0207651_10003094 | 3300025960 | Bacteria | 8088 |
| 757 | Ga0207651_10005362 | 3300025960 | Bacteria | 6574 |
| 758 | Ga0207651_10127085 | 3300025960 | Bacteria | 1944 |
| 759 | Ga0207651_10201182 | 3300025960 | Bacteria | 1596 |
| 760 | Ga0207651_10284486 | 3300025960 | Bacteria | 1368 |
| 761 | Ga0207712_10028278 | 3300025961 | Bacteria | 3749 |
| 762 | Ga0207712_10108195 | 3300025961 | Bacteria | 2080 |
| 763 | Ga0207712_10449266 | 3300025961 | Bacteria | 1093 |
| 764 | Ga0207712_10479238 | 3300025961 | Bacteria | 1060 |
| 765 | Ga0207668_10158126 | 3300025972 | Bacteria | 1762 |
| 766 | Ga0207668_10424497 | 3300025972 | Bacteria | 1129 |
| 767 | Ga0207640_10063936 | 3300025981 | Bacteria | 2448 |
| 768 | Ga0207640_10285210 | 3300025981 | Bacteria | 1299 |
| 769 | Ga0207658_10000596 | 3300025986 | Bacteria | 32369 |
| 770 | Ga0207658_10024952 | 3300025986 | Bacteria | 4183 |
| 771 | Ga0207658_10031648 | 3300025986 | Bacteria | 3758 |
| 772 | Ga0207658_10053233 | 3300025986 | Bacteria | 2990 |
| 773 | Ga0207658_10053722 | 3300025986 | Bacteria | 2978 |
| 774 | Ga0207658_10078991 | 3300025986 | Bacteria | 2516 |
| 775 | Ga0207658_10134700 | 3300025986 | Bacteria | 1990 |
| 776 | Ga0207658_10417520 | 3300025986 | Bacteria | 1182 |
| 777 | Ga0207658_10689502 | 3300025986 | Bacteria | 923 |
| 778 | Ga0207677_10004499 | 3300026023 | Bacteria | 7497 |
| 779 | Ga0207677_10004773 | 3300026023 | Bacteria | 7312 |
| 780 | Ga0207677_10050885 | 3300026023 | Bacteria | 2805 |
| 781 | Ga0207703_10005879 | 3300026035 | Bacteria | 9830 |
| 782 | Ga0207703_10009878 | 3300026035 | Bacteria | 7486 |
| 783 | Ga0207703_10066736 | 3300026035 | Bacteria | 2960 |
| 784 | Ga0207703_10118572 | 3300026035 | Bacteria | 2269 |
| 785 | Ga0207639_10017601 | 3300026041 | Bacteria | 5068 |
| 786 | Ga0207639_10083956 | 3300026041 | Bacteria | 2529 |
| 787 | Ga0207639_10206766 | 3300026041 | Bacteria | 1687 |
| 788 | Ga0207639_10236597 | 3300026041 | Bacteria | 1586 |
| 789 | Ga0207639_10420623 | 3300026041 | Bacteria | 1208 |
| 790 | Ga0207678_10000478 | 3300026067 | Bacteria | 36328 |
| 791 | Ga0207678_10184766 | 3300026067 | Bacteria | 1780 |
| 792 | Ga0207678_10216388 | 3300026067 | Bacteria | 1639 |
| 793 | Ga0207678_10235881 | 3300026067 | Bacteria | 1566 |
| 794 | Ga0207708_10074781 | 3300026075 | Bacteria | 2597 |
| 795 | Ga0207702_10000573 | 3300026078 | Bacteria | 40848 |
| 796 | Ga0207702_10048355 | 3300026078 | Bacteria | 3587 |
| 797 | Ga0207702_10386985 | 3300026078 | Bacteria | 1346 |
| 798 | Ga0207641_10001486 | 3300026088 | Bacteria | 22946 |
| 799 | Ga0207641_10064210 | 3300026088 | Bacteria | 3137 |
| 800 | Ga0207641_10081066 | 3300026088 | Bacteria | 2817 |
| 801 | Ga0207641_10197851 | 3300026088 | Bacteria | 1851 |
| 802 | Ga0207648_10000412 | 3300026089 | Bacteria | 47573 |
| 803 | Ga0207648_10001396 | 3300026089 | Bacteria | 26597 |
| 804 | Ga0207648_10017331 | 3300026089 | Bacteria | 6559 |
| 805 | Ga0207648_10076047 | 3300026089 | Bacteria | 2927 |
| 806 | Ga0207648_10166809 | 3300026089 | Bacteria | 1946 |
| 807 | Ga0207676_10002421 | 3300026095 | Bacteria | 13294 |
| 808 | Ga0207676_10047349 | 3300026095 | Bacteria | 3332 |
| 809 | Ga0207676_10071218 | 3300026095 | Bacteria | 2790 |
| 810 | Ga0207676_10177819 | 3300026095 | Bacteria | 1860 |
| 811 | Ga0207674_10001842 | 3300026116 | Bacteria | 27012 |
| 812 | Ga0207674_10014163 | 3300026116 | Bacteria | 8813 |
| 813 | Ga0207674_10063585 | 3300026116 | Bacteria | 3725 |
| 814 | Ga0207674_10096985 | 3300026116 | Bacteria | 2933 |
| 815 | Ga0207674_10152841 | 3300026116 | Bacteria | 2264 |
| 816 | Ga0207674_10211435 | 3300026116 | Bacteria | 1889 |
| 817 | Ga0207674_10261740 | 3300026116 | Bacteria | 1677 |
| 818 | Ga0207675_100000729 | 3300026118 | Bacteria | 32615 |
| 819 | Ga0207675_100023188 | 3300026118 | Bacteria | 5772 |
| 820 | Ga0207675_100036720 | 3300026118 | Bacteria | 4570 |
| 821 | Ga0207675_100122801 | 3300026118 | Bacteria | 2458 |
| 822 | Ga0207683_10019109 | 3300026121 | Bacteria | 5848 |
| 823 | Ga0207683_10044835 | 3300026121 | Bacteria | 3866 |
| 824 | Ga0207683_10048487 | 3300026121 | Bacteria | 3719 |
| 825 | Ga0207683_10146026 | 3300026121 | Bacteria | 2133 |
| 826 | Ga0207683_10215806 | 3300026121 | Bacteria | 1747 |
| 827 | Ga0207683_10236164 | 3300026121 | Bacteria | 1667 |
| 828 | Ga0207683_10299912 | 3300026121 | Bacteria | 1470 |
| 829 | Ga0207698_10059115 | 3300026142 | Bacteria | 2975 |
| 830 | Ga0207698_10146313 | 3300026142 | Bacteria | 2044 |
| 831 | Ga0207698_10256678 | 3300026142 | Bacteria | 1603 |
| 832 | Ga0207698_10261724 | 3300026142 | Bacteria | 1589 |
| 833 | Ga0207698_10600036 | 3300026142 | Bacteria | 1085 |
| 834 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 835 | Ga0209973_1006169 | 3300027252 | Bacteria | 1299 |
| 836 | Ga0209389_1004479 | 3300027296 | Bacteria | 11650 |
| 837 | Ga0209983_1044212 | 3300027665 | Bacteria | 967 |
| 838 | Ga0209282_1000974 | 3300027666 | Bacteria | 14977 |
| 839 | Ga0209813_10002277 | 3300027866 | Bacteria | 4386 |
| 840 | Ga0209813_10037038 | 3300027866 | Bacteria | 1468 |
| 841 | Ga0209974_10002379 | 3300027876 | Bacteria | 6821 |
| 842 | Ga0209974_10005889 | 3300027876 | Bacteria | 4297 |
| 843 | Ga0209974_10006645 | 3300027876 | Bacteria | 4024 |
| 844 | Ga0268266_10141325 | 3300028379 | Bacteria | 2161 |
| 845 | Ga0268266_10181438 | 3300028379 | Bacteria | 1917 |
| 846 | Ga0268266_10305844 | 3300028379 | Bacteria | 1484 |
| 847 | Ga0268266_10380996 | 3300028379 | Bacteria | 1330 |
| 848 | Ga0268265_10004180 | 3300028380 | Bacteria | 10112 |
| 849 | Ga0268265_10024728 | 3300028380 | Bacteria | 4254 |
| 850 | Ga0268265_10059385 | 3300028380 | Bacteria | 2925 |
| 851 | Ga0268265_10152579 | 3300028380 | Bacteria | 1950 |
| 852 | Ga0268264_10006835 | 3300028381 | Bacteria | 9581 |
| 853 | Ga0268264_10032321 | 3300028381 | Bacteria | 4293 |
| 854 | Ga0268264_10114353 | 3300028381 | Bacteria | 2369 |
| 855 | Ga0268264_10218763 | 3300028381 | Bacteria | 1752 |
| 856 | Ga0265336_10000119 | 3300028666 | Bacteria | 59232 |
| 857 | Ga0307517_10010987 | 3300028786 | Bacteria | 12591 |
| 858 | Ga0307517_10091779 | 3300028786 | Bacteria | 2477 |
| 859 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 860 | Ga0307515_10000051 | 3300028794 | Bacteria | 272100 |
| 861 | Ga0307515_10000132 | 3300028794 | Bacteria | 176547 |
| 862 | Ga0307515_10000305 | 3300028794 | Bacteria | 121634 |
| 863 | Ga0307515_10000484 | 3300028794 | Bacteria | 94947 |
| 864 | Ga0307515_10002898 | 3300028794 | Bacteria | 36447 |
| 865 | Ga0307515_10004253 | 3300028794 | Bacteria | 29706 |
| 866 | Ga0307515_10006880 | 3300028794 | Bacteria | 22609 |
| 867 | Ga0307515_10013694 | 3300028794 | Bacteria | 15113 |
| 868 | Ga0307515_10025690 | 3300028794 | Bacteria | 10178 |
| 869 | Ga0307515_10038818 | 3300028794 | Bacteria | 7601 |
| 870 | Ga0307515_10103254 | 3300028794 | Bacteria | 3419 |
| 871 | Ga0307515_10245956 | 3300028794 | Bacteria | 1550 |
| 872 | Ga0265324_10009959 | 3300029957 | Bacteria | 3691 |
| 873 | Ga0307512_10024522 | 3300030522 | Bacteria | 5365 |
| 874 | Ga0307512_10139156 | 3300030522 | Bacteria | 1491 |
| 875 | Ga0316177_1080934 | 3300030731 | Bacteria | 8980 |
| 876 | Ga0316176_1095897 | 3300030732 | Bacteria | 4269 |
| 877 | Ga0314311_1024127 | 3300030733 | Bacteria | 4598 |
| 878 | Ga0316178_1082049 | 3300030735 | Bacteria | 4647 |
| 879 | Ga0316180_1101534 | 3300030736 | Bacteria | 6197 |
| 880 | Ga0316181_1045650 | 3300030744 | Bacteria | 1844 |
| 881 | Ga0316182_1369050 | 3300030745 | Bacteria | 4107 |
| 882 | Ga0265330_10000117 | 3300031235 | Bacteria | 63961 |
| 883 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 884 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 885 | Ga0265327_10034893 | 3300031251 | Bacteria | 2786 |
| 886 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 887 | Ga0307513_10000121 | 3300031456 | Bacteria | 109551 |
| 888 | Ga0307513_10015459 | 3300031456 | Bacteria | 9251 |
| 889 | Ga0307513_10039983 | 3300031456 | Bacteria | 5191 |
| 890 | Ga0307513_10055587 | 3300031456 | Bacteria | 4234 |
| 891 | Ga0307513_10064266 | 3300031456 | Bacteria | 3868 |
| 892 | Ga0307513_10177002 | 3300031456 | Bacteria | 2002 |
| 893 | Ga0307513_10447257 | 3300031456 | Bacteria | 1017 |
| 894 | Ga0307509_10001286 | 3300031507 | Bacteria | 42598 |
| 895 | Ga0307509_10010432 | 3300031507 | Bacteria | 11388 |
| 896 | Ga0307509_10013769 | 3300031507 | Bacteria | 9545 |
| 897 | Ga0307509_10047789 | 3300031507 | Bacteria | 4601 |
| 898 | Ga0307509_10067207 | 3300031507 | Bacteria | 3756 |
| 899 | Ga0307509_10076047 | 3300031507 | Bacteria | 3485 |
| 900 | Ga0307509_10391707 | 3300031507 | Bacteria | 1099 |
| 901 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 902 | Ga0307408_100001875 | 3300031548 | Bacteria | 15319 |
| 903 | Ga0307408_100158321 | 3300031548 | Bacteria | 1796 |
| 904 | Ga0307408_100321109 | 3300031548 | Bacteria | 1304 |
| 905 | Ga0307408_100330796 | 3300031548 | Bacteria | 1286 |
| 906 | Ga0307508_10000098 | 3300031616 | Bacteria | 103295 |
| 907 | Ga0307508_10000159 | 3300031616 | Bacteria | 81150 |
| 908 | Ga0307508_10030208 | 3300031616 | Bacteria | 4896 |
| 909 | Ga0307508_10259421 | 3300031616 | Bacteria | 1333 |
| 910 | Ga0307514_10002245 | 3300031649 | Bacteria | 20619 |
| 911 | Ga0307514_10006986 | 3300031649 | Bacteria | 9760 |
| 912 | Ga0307514_10008269 | 3300031649 | Bacteria | 8878 |
| 913 | Ga0307514_10020555 | 3300031649 | Bacteria | 5388 |
| 914 | Ga0307514_10181998 | 3300031649 | Bacteria | 1353 |
| 915 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 916 | Ga0265314_10009417 | 3300031711 | Bacteria | 8237 |
| 917 | Ga0265314_10148724 | 3300031711 | Bacteria | 1439 |
| 918 | Ga0307516_10002826 | 3300031730 | Bacteria | 22886 |
| 919 | Ga0307516_10003066 | 3300031730 | Bacteria | 21791 |
| 920 | Ga0307516_10003335 | 3300031730 | Bacteria | 20773 |
| 921 | Ga0307516_10004343 | 3300031730 | Bacteria | 17529 |
| 922 | Ga0307516_10004865 | 3300031730 | Bacteria | 16368 |
| 923 | Ga0307516_10030498 | 3300031730 | Bacteria | 5440 |
| 924 | Ga0307516_10126309 | 3300031730 | Bacteria | 2342 |
| 925 | Ga0307516_10212700 | 3300031730 | Bacteria | 1647 |
| 926 | Ga0307516_10311992 | 3300031730 | Bacteria | 1246 |
| 927 | Ga0307405_10004366 | 3300031731 | Bacteria | 6671 |
| 928 | Ga0307405_10011565 | 3300031731 | Bacteria | 4634 |
| 929 | Ga0307405_10060774 | 3300031731 | Bacteria | 2385 |
| 930 | Ga0307405_10098181 | 3300031731 | Bacteria | 1957 |
| 931 | Ga0307405_10106064 | 3300031731 | Bacteria | 1894 |
| 932 | Ga0307413_10008901 | 3300031824 | Bacteria | 4770 |
| 933 | Ga0307410_10233286 | 3300031852 | Bacteria | 1422 |
| 934 | Ga0307406_10000864 | 3300031901 | Bacteria | 17063 |
| 935 | Ga0307406_10001340 | 3300031901 | Bacteria | 13827 |
| 936 | Ga0307407_10426587 | 3300031903 | Bacteria | 957 |
| 937 | Ga0307412_10051102 | 3300031911 | Bacteria | 2730 |
| 938 | Ga0307412_10112312 | 3300031911 | Bacteria | 1948 |
| 939 | Ga0307412_10134142 | 3300031911 | Bacteria | 1803 |
| 940 | Ga0307412_10142282 | 3300031911 | Bacteria | 1758 |
| 941 | Ga0307412_10181879 | 3300031911 | Bacteria | 1582 |
| 942 | Ga0307409_100001393 | 3300031995 | Bacteria | 11806 |
| 943 | Ga0307416_100069123 | 3300032002 | Bacteria | 2921 |
| 944 | Ga0307416_100271559 | 3300032002 | Bacteria | 1665 |
| 945 | Ga0307416_100388184 | 3300032002 | Bacteria | 1429 |
| 946 | Ga0307416_100651167 | 3300032002 | Bacteria | 1138 |
| 947 | Ga0307414_10222178 | 3300032004 | Bacteria | 1551 |
| 948 | Ga0307411_10002107 | 3300032005 | Bacteria | 8588 |
| 949 | Ga0307411_10002164 | 3300032005 | Bacteria | 8530 |
| 950 | Ga0307411_10010018 | 3300032005 | Bacteria | 5024 |
| 951 | Ga0307411_10084274 | 3300032005 | Bacteria | 2198 |
| 952 | Ga0307411_10165412 | 3300032005 | Bacteria | 1662 |
| 953 | Ga0307411_10332514 | 3300032005 | Bacteria | 1231 |
| 954 | Ga0307415_100166848 | 3300032126 | Bacteria | 1713 |
| 955 | Ga0307415_100515827 | 3300032126 | Bacteria | 1048 |
| 956 | Ga0307507_10064389 | 3300033179 | Bacteria | 3384 |
| 957 | Ga0307510_10002924 | 3300033180 | Bacteria | 19645 |
| 958 | Ga0307510_10109577 | 3300033180 | Bacteria | 2509 |
| 959 | Ga0307510_10115880 | 3300033180 | Bacteria | 2403 |
| 960 | Ga0373950_0001730 | 3300034818 | Bacteria | 2896 |
| 961 | Ga0373950_0018591 | 3300034818 | Bacteria | 1207 |
| 962 | Ga0373959_0021287 | 3300034820 | Bacteria | 1244 |
| 963 | Ga0373938_0041786 | 3300034957 | Bacteria | 1021 |
| 964 | Ga0373940_0029217 | 3300035088 | Bacteria | 1459 |
| 965 | Ga0373944_0036019 | 3300035089 | Bacteria | 1510 |
| 966 | Ga0373939_0000134 | 3300035114 | Bacteria | 21407 |
| 967 | Ga0373939_0044851 | 3300035114 | Bacteria | 1347 |
| 968 | Ga0373954_0096772 | 3300035118 | Bacteria | 1422 |
| 969 | Ga0373960_0000060 | 3300035121 | Bacteria | 15087 |
| 970 | Ga0373943_0071869 | 3300035170 | Bacteria | 1754 |
| 971 | Ga0373943_0204047 | 3300035170 | Bacteria | 1095 |
| 972 | Ga0373961_0060848 | 3300035241 | Bacteria | 1145 |
| 973 | Ga0373962_0010649 | 3300035242 | Bacteria | 2297 |
| 974 | Ga0373931_0001710 | 3300035691 | Bacteria | 9516 |
| 975 | Ga0373931_0001894 | 3300035691 | Bacteria | 9145 |
| 976 | Ga0373931_0009130 | 3300035691 | Bacteria | 4732 |
| 977 | Ga0373931_0055604 | 3300035691 | Bacteria | 2118 |
| 978 | Ga0373931_0068429 | 3300035691 | Bacteria | 1933 |
| 979 | Ga0373927_0093092 | 3300035695 | Bacteria | 1958 |
| 980 | Ga0373927_0102238 | 3300035695 | Bacteria | 1864 |
| 981 | Ga0373933_0110964 | 3300035724 | Bacteria | 1711 |
| 982 | Ga0373947_0067563 | 3300035725 | Bacteria | 2184 |
| 983 | Ga0373937_0191548 | 3300036401 | Bacteria | 1921 |
| 984 | Ga0373925_0011126 | 3300037068 | Bacteria | 6526 |
| 985 | Ga0373925_0056736 | 3300037068 | Bacteria | 2934 |
| 986 | Ga0395899_0002154 | 3300037312 | Bacteria | 16160 |
| 987 | Ga0395899_0019128 | 3300037312 | Bacteria | 5205 |
| 988 | Ga0395900_0002425 | 3300037418 | Bacteria | 20543 |
| 989 | Ga0395900_0020959 | 3300037418 | Bacteria | 6680 |
| 990 | Ga0395900_0149133 | 3300037418 | Bacteria | 2390 |
| 991 | Ga0395900_0160620 | 3300037418 | Bacteria | 2292 |
| 992 | Ga0395900_0403195 | 3300037418 | Bacteria | 1331 |
| 993 | Ga0395898_0002961 | 3300037466 | Bacteria | 19303 |
| 994 | Ga0395898_0008634 | 3300037466 | Bacteria | 10749 |
| 995 | Ga0395898_0022008 | 3300037466 | Bacteria | 6457 |
| 996 | Ga0395898_0134229 | 3300037466 | Bacteria | 2370 |
| 997 | Ga0395898_0222657 | 3300037466 | Bacteria | 1799 |
| 998 | Ga0395905_0000180 | 3300037471 | Bacteria | 100693 |
| 999 | Ga0395905_0001081 | 3300037471 | Bacteria | 34294 |
| 1000 | Ga0395905_0002881 | 3300037471 | Bacteria | 18795 |
| 1001 | Ga0395905_0006990 | 3300037471 | Bacteria | 11280 |
| 1002 | Ga0395905_0010125 | 3300037471 | Bacteria | 9191 |
| 1003 | Ga0395905_0013384 | 3300037471 | Bacteria | 7860 |
| 1004 | Ga0395905_0013704 | 3300037471 | Bacteria | 7764 |
| 1005 | Ga0395905_0028419 | 3300037471 | Bacteria | 5272 |
| 1006 | Ga0395905_0028506 | 3300037471 | Bacteria | 5263 |
| 1007 | Ga0395905_0037378 | 3300037471 | Bacteria | 4559 |
| 1008 | Ga0395905_0080020 | 3300037471 | Bacteria | 3062 |
| 1009 | Ga0395905_0104308 | 3300037471 | Bacteria | 2661 |
| 1010 | Ga0395905_0192568 | 3300037471 | Bacteria | 1912 |
| 1011 | Ga0395905_0360945 | 3300037471 | Bacteria | 1345 |
| 1012 | Ga0395905_0435910 | 3300037471 | Bacteria | 1207 |
| 1013 | Ga0395905_0683946 | 3300037471 | Bacteria | 928 |
| 1014 | Ga0395901_0001599 | 3300038443 | Bacteria | 23451 |
| 1015 | Ga0395901_0047353 | 3300038443 | Bacteria | 4464 |
| 1016 | Ga0395901_0085362 | 3300038443 | Bacteria | 3300 |
| 1017 | Ga0395901_0122449 | 3300038443 | Bacteria | 2733 |
| 1018 | Ga0395901_0216962 | 3300038443 | Bacteria | 2000 |
| 1019 | Ga0436365_1256270 | 3300039437 | Bacteria | 3724 |
| 1020 | Ga0436361_0029649 | 3300039447 | Bacteria | 14101 |
| 1021 | Ga0436361_0257745 | 3300039447 | Bacteria | 4192 |
| 1022 | Ga0436361_0362737 | 3300039447 | Bacteria | 5180 |
| 1023 | Ga0436361_0650099 | 3300039447 | Bacteria | 16105 |
| 1024 | Ga0436363_0690192 | 3300039450 | Bacteria | 995 |
| 1025 | Ga0439436_0003791 | 3300041404 | Bacteria | 4624 |
| 1026 | Ga0439436_0013490 | 3300041404 | Bacteria | 2470 |
| 1027 | Ga0439438_033972 | 3300041405 | Bacteria | 1345 |
| 1028 | Ga0439439_0031011 | 3300041406 | Bacteria | 1361 |
| 1029 | Ga0439447_009182 | 3300041407 | Bacteria | 3014 |
| 1030 | Ga0439447_012418 | 3300041407 | Bacteria | 2448 |
| 1031 | Ga0439461_0005365 | 3300041410 | Bacteria | 2181 |
| 1032 | Ga0439466_0003451 | 3300041411 | Bacteria | 6130 |
| 1033 | Ga0439466_0016582 | 3300041411 | Bacteria | 2660 |
| 1034 | Ga0439465_0000072 | 3300041413 | Bacteria | 22229 |
| 1035 | Ga0451797_0933919 | 3300041453 | Bacteria | 1115 |
| 1036 | Ga0451798_0843930 | 3300041458 | Bacteria | 1054 |
| 1037 | Ga0451802_0937156 | 3300041460 | Bacteria | 1017 |
| 1038 | Ga0451804_0897864 | 3300041463 | Bacteria | 1368 |
| 1039 | Ga0451807_1692089 | 3300041486 | Bacteria | 1245 |
| 1040 | Ga0451833_1270813 | 3300041491 | Bacteria | 2084 |
| 1041 | Ga0439431_0000235 | 3300041997 | Bacteria | 11239 |
| 1042 | Ga0439431_0005013 | 3300041997 | Bacteria | 2917 |
| 1043 | Ga0439431_0023603 | 3300041997 | Bacteria | 1490 |
| 1044 | Ga0439433_0000055 | 3300041999 | Bacteria | 13711 |
| 1045 | Ga0439433_0013981 | 3300041999 | Bacteria | 1765 |
| 1046 | Ga0439441_036863 | 3300042001 | Bacteria | 968 |
| 1047 | Ga0439442_001375 | 3300042002 | Bacteria | 4817 |
| 1048 | Ga0439445_0000190 | 3300042004 | Bacteria | 11147 |
| 1049 | Ga0439445_0008876 | 3300042004 | Bacteria | 2361 |
| 1050 | Ga0439445_0034439 | 3300042004 | Bacteria | 1327 |
| 1051 | Ga0439432_016345 | 3300042006 | Bacteria | 2499 |
| 1052 | Ga0439432_023674 | 3300042006 | Bacteria | 2021 |
| 1053 | Ga0439449_0000135 | 3300042007 | Bacteria | 24942 |
| 1054 | Ga0439449_0000254 | 3300042007 | Bacteria | 19110 |
| 1055 | Ga0439449_0001356 | 3300042007 | Bacteria | 9597 |
| 1056 | Ga0439449_0005738 | 3300042007 | Bacteria | 4746 |
| 1057 | Ga0439452_008527 | 3300042010 | Bacteria | 3080 |
| 1058 | Ga0439452_009437 | 3300042010 | Bacteria | 2873 |
| 1059 | Ga0439454_005533 | 3300042011 | Bacteria | 1512 |
| 1060 | Ga0439455_0057914 | 3300042012 | Bacteria | 1023 |
| 1061 | Ga0439457_005620 | 3300042014 | Bacteria | 3133 |
| 1062 | Ga0439457_008935 | 3300042014 | Bacteria | 2346 |
| 1063 | Ga0439462_0002085 | 3300042015 | Bacteria | 4588 |
| 1064 | Ga0439462_0028647 | 3300042015 | Bacteria | 1473 |
| 1065 | Ga0450911_001002 | 3300042115 | Bacteria | 7287 |
| 1066 | Ga0450919_000793 | 3300042121 | Bacteria | 4057 |
| 1067 | Ga0450919_004251 | 3300042121 | Bacteria | 1756 |
| 1068 | Ga0450921_003883 | 3300042123 | Bacteria | 1071 |
| 1069 | Ga0450923_004122 | 3300042125 | Bacteria | 2260 |
| 1070 | Ga0450888_000157 | 3300042126 | Bacteria | 5848 |
| 1071 | Ga0450890_000648 | 3300042127 | Bacteria | 5062 |
| 1072 | Ga0450890_000968 | 3300042127 | Bacteria | 4171 |
| 1073 | Ga0450891_003105 | 3300042129 | Bacteria | 1627 |
| 1074 | Ga0450896_021139 | 3300042133 | Bacteria | 955 |
| 1075 | Ga0450889_002440 | 3300042144 | Bacteria | 1854 |
| 1076 | Ga0450906_000642 | 3300042145 | Bacteria | 7461 |
| 1077 | Ga0450906_001202 | 3300042145 | Bacteria | 5717 |
| 1078 | Ga0450907_019534 | 3300042146 | Bacteria | 1136 |
| 1079 | Ga0439446_0003368 | 3300042156 | Bacteria | 3958 |
| 1080 | Ga0439446_0072822 | 3300042156 | Bacteria | 1054 |
| 1081 | Ga0439458_0032050 | 3300042157 | Bacteria | 1255 |
| 1082 | Ga0450908_007998 | 3300042184 | Bacteria | 1983 |
| 1083 | Ga0450908_013037 | 3300042184 | Bacteria | 1501 |
| 1084 | Ga0450909_000922 | 3300042185 | Bacteria | 4029 |
| 1085 | Ga0439434_0004125 | 3300042435 | Bacteria | 4244 |
| 1086 | Ga0439434_0029442 | 3300042435 | Bacteria | 1665 |
| 1087 | Ga0439434_0182603 | 3300042435 | Bacteria | 703 |
| 1088 | Ga0439435_0051716 | 3300042436 | Bacteria | 1178 |
| 1089 | Ga0439459_0003787 | 3300042438 | Bacteria | 2418 |
| 1090 | Ga0439459_0006496 | 3300042438 | Bacteria | 1949 |
| 1091 | Ga0439464_0033716 | 3300042439 | Bacteria | 1442 |
| 1092 | Ga0450916_008020 | 3300042530 | Bacteria | 1278 |
| 1093 | Ga0450916_022175 | 3300042530 | Bacteria | 879 |
| 1094 | Ga0450918_000282 | 3300042531 | Bacteria | 11519 |
| 1095 | Ga0450918_000287 | 3300042531 | Bacteria | 11389 |
| 1096 | Ga0450893_0001086 | 3300042532 | Bacteria | 4088 |
| 1097 | Ga0450893_0006610 | 3300042532 | Bacteria | 1877 |
| 1098 | Ga0450893_0032490 | 3300042532 | Bacteria | 934 |
| 1099 | Ga0451577_0000114 | 3300042876 | Bacteria | 175957 |
| 1100 | Ga0451577_0003543 | 3300042876 | Bacteria | 17252 |
| 1101 | Ga0466969_0000017 | 3300044656 | Bacteria | 103792 |
| 1102 | Ga0466969_0002322 | 3300044656 | Bacteria | 10152 |
| 1103 | Ga0466969_0025097 | 3300044656 | Bacteria | 3065 |
| 1104 | Ga0466969_0062655 | 3300044656 | Bacteria | 1804 |
| 1105 | Ga0466969_0192857 | 3300044656 | Bacteria | 930 |
| 1106 | Ga0466972_0000564 | 3300044658 | Bacteria | 18111 |
| 1107 | Ga0466972_0090890 | 3300044658 | Bacteria | 1448 |
| 1108 | Ga0453683_0002295 | 3300044673 | Bacteria | 15067 |
| 1109 | Ga0466965_0002967 | 3300044683 | Bacteria | 7350 |
| 1110 | Ga0466965_0018420 | 3300044683 | Bacteria | 3347 |
| 1111 | Ga0466965_0024197 | 3300044683 | Bacteria | 2935 |
| 1112 | Ga0466965_0045731 | 3300044683 | Bacteria | 2166 |
| 1113 | Ga0466966_0002454 | 3300044684 | Bacteria | 12119 |
| 1114 | Ga0466966_0003862 | 3300044684 | Bacteria | 9890 |
| 1115 | Ga0466966_0004685 | 3300044684 | Bacteria | 8999 |
| 1116 | Ga0466966_0005496 | 3300044684 | Bacteria | 8326 |
| 1117 | Ga0466961_0000655 | 3300044693 | Bacteria | 21750 |
| 1118 | Ga0466961_0005740 | 3300044693 | Bacteria | 7854 |
| 1119 | Ga0466961_0012612 | 3300044693 | Bacteria | 5412 |
| 1120 | Ga0466961_0016936 | 3300044693 | Bacteria | 4683 |
| 1121 | Ga0466961_0046507 | 3300044693 | Bacteria | 2775 |
| 1122 | Ga0466963_0085744 | 3300044694 | Bacteria | 2138 |
| 1123 | Ga0466963_0390195 | 3300044694 | Bacteria | 981 |
| 1124 | Ga0466964_0004693 | 3300044706 | Bacteria | 5050 |
| 1125 | Ga0466964_0055191 | 3300044706 | Bacteria | 1640 |
| 1126 | Ga0453684_0001710 | 3300044712 | Bacteria | 59044 |
| 1127 | Ga0453684_0071583 | 3300044712 | Bacteria | 4383 |
| 1128 | Ga0453684_0115887 | 3300044712 | Bacteria | 3246 |
| 1129 | Ga0453684_0441023 | 3300044712 | Bacteria | 1451 |
| 1130 | Ga0453684_0514284 | 3300044712 | Bacteria | 1324 |
| 1131 | Ga0453684_0698711 | 3300044712 | Bacteria | 1102 |
| 1132 | Ga0466971_0011261 | 3300044719 | Bacteria | 3918 |
| 1133 | Ga0466971_0084266 | 3300044719 | Bacteria | 1451 |
| 1134 | Ga0466971_0166188 | 3300044719 | Bacteria | 1034 |
| 1135 | Ga0466968_0010399 | 3300044735 | Bacteria | 3606 |
| 1136 | Ga0466968_0013533 | 3300044735 | Bacteria | 3208 |
| 1137 | Ga0466970_0004901 | 3300044765 | Bacteria | 6610 |
| 1138 | Ga0466970_0026951 | 3300044765 | Bacteria | 3013 |
| 1139 | Ga0466970_0091123 | 3300044765 | Bacteria | 1654 |
| 1140 | Ga0466957_0005869 | 3300044842 | Bacteria | 6916 |
| 1141 | Ga0466957_0147629 | 3300044842 | Bacteria | 1519 |
| 1142 | Ga0466957_0156894 | 3300044842 | Bacteria | 1475 |
| 1143 | Ga0466960_0049038 | 3300044901 | Bacteria | 2031 |
| 1144 | Ga0466960_0063358 | 3300044901 | Bacteria | 1820 |
| 1145 | Ga0466960_0115367 | 3300044901 | Bacteria | 1400 |
| 1146 | Ga0466959_0000285 | 3300045049 | Bacteria | 30873 |
| 1147 | Ga0466959_0044517 | 3300045049 | Bacteria | 3270 |
| 1148 | Ga0466959_0046888 | 3300045049 | Bacteria | 3180 |
| 1149 | Ga0466959_0101685 | 3300045049 | Bacteria | 2057 |
| 1150 | Ga0451576_0003831 | 3300045051 | Bacteria | 20210 |
| 1151 | Ga0451576_0019880 | 3300045051 | Bacteria | 7324 |
| 1152 | Ga0451576_0078482 | 3300045051 | Bacteria | 3436 |
| 1153 | Ga0451576_0112992 | 3300045051 | Bacteria | 2827 |
| 1154 | Ga0466958_0399212 | 3300045836 | Bacteria | 888 |
| 1155 | Ga0466967_0011318 | 3300045976 | Bacteria | 6747 |
| 1156 | Ga0466967_0353253 | 3300045976 | Bacteria | 1423 |
| 1157 | Ga0495592_0000205 | 3300046454 | Bacteria | 50544 |
| 1158 | Ga0495603_0143090 | 3300046455 | Bacteria | 1391 |
| 1159 | Ga0495629_0018591 | 3300046459 | Bacteria | 4969 |
| 1160 | Ga0495629_0425583 | 3300046459 | Bacteria | 901 |
| 1161 | Ga0495638_0083200 | 3300046460 | Bacteria | 1939 |
| 1162 | Ga0495638_0324682 | 3300046460 | Bacteria | 821 |
| 1163 | Ga0495651_0115987 | 3300046462 | Bacteria | 1974 |
| 1164 | Ga0495650_0010155 | 3300046471 | Bacteria | 5279 |
| 1165 | Ga0495639_0007016 | 3300046475 | Bacteria | 4844 |
| 1166 | Ga0495583_0000585 | 3300046506 | Bacteria | 49928 |
| 1167 | Ga0495606_0005296 | 3300046507 | Bacteria | 12423 |
| 1168 | Ga0495606_0110943 | 3300046507 | Bacteria | 1655 |
| 1169 | Ga0495610_0019044 | 3300046512 | Bacteria | 3855 |
| 1170 | Ga0495610_0020856 | 3300046512 | Bacteria | 3623 |
| 1171 | Ga0495610_0022310 | 3300046512 | Bacteria | 3465 |
| 1172 | Ga0495620_0024574 | 3300046515 | Bacteria | 2863 |
| 1173 | Ga0495620_0062267 | 3300046515 | Bacteria | 1550 |
| 1174 | Ga0495620_0094695 | 3300046515 | Bacteria | 1195 |
| 1175 | Ga0495628_0141802 | 3300046516 | Bacteria | 1834 |
| 1176 | Ga0495631_0000228 | 3300046518 | Bacteria | 38440 |
| 1177 | Ga0495632_0003624 | 3300046519 | Bacteria | 10853 |
| 1178 | Ga0495632_0009453 | 3300046519 | Bacteria | 5884 |
| 1179 | Ga0495632_0034350 | 3300046519 | Bacteria | 2596 |
| 1180 | Ga0495632_0106960 | 3300046519 | Bacteria | 1315 |
| 1181 | Ga0495637_0003270 | 3300046520 | Bacteria | 8620 |
| 1182 | Ga0495643_0149582 | 3300046522 | Bacteria | 1157 |
| 1183 | Ga0495663_0015892 | 3300046525 | Bacteria | 2125 |
| 1184 | Ga0495642_0099720 | 3300046528 | Bacteria | 1235 |
| 1185 | Ga0495654_0065348 | 3300046530 | Bacteria | 1737 |
| 1186 | Ga0495586_0007585 | 3300046535 | Bacteria | 5791 |
| 1187 | Ga0495586_0259785 | 3300046535 | Bacteria | 992 |
| 1188 | Ga0495587_0448678 | 3300046536 | Bacteria | 715 |
| 1189 | Ga0495621_0007544 | 3300046539 | Bacteria | 3225 |
| 1190 | Ga0495597_0002614 | 3300046542 | Bacteria | 11205 |
| 1191 | Ga0495597_0004594 | 3300046542 | Bacteria | 7533 |
| 1192 | Ga0495645_0013074 | 3300046543 | Bacteria | 5864 |
| 1193 | Ga0495656_0000184 | 3300046615 | Bacteria | 22413 |
| 1194 | Ga0495656_0027396 | 3300046615 | Bacteria | 2276 |
| 1195 | Ga0495668_0020891 | 3300046616 | Bacteria | 3760 |
| 1196 | Ga0495611_0086522 | 3300046648 | Bacteria | 1446 |
| 1197 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 1198 | Ga0495625_0002218 | 3300046660 | Bacteria | 21465 |
| 1199 | Ga0495625_0051677 | 3300046660 | Bacteria | 2946 |
| 1200 | Ga0495625_0068099 | 3300046660 | Bacteria | 2503 |
| 1201 | Ga0495625_0094976 | 3300046660 | Bacteria | 2056 |
| 1202 | Ga0495625_0107409 | 3300046660 | Bacteria | 1910 |
| 1203 | Ga0495625_0163982 | 3300046660 | Bacteria | 1487 |
| 1204 | Ga0495659_0028103 | 3300046664 | Bacteria | 1945 |
| 1205 | Ga0495588_0035371 | 3300046674 | Bacteria | 2531 |
| 1206 | Ga0495588_0054081 | 3300046674 | Bacteria | 2071 |
| 1207 | Ga0495588_0223682 | 3300046674 | Bacteria | 993 |
| 1208 | Ga0495599_0174270 | 3300046678 | Bacteria | 1327 |
| 1209 | Ga0495646_0108946 | 3300046680 | Bacteria | 1579 |
| 1210 | Ga0495647_0005157 | 3300046681 | Bacteria | 4278 |
| 1211 | Ga0495647_0094437 | 3300046681 | Bacteria | 1231 |
| 1212 | Ga0495658_0015865 | 3300046683 | Bacteria | 3872 |
| 1213 | Ga0495658_0319442 | 3300046683 | Bacteria | 984 |
| 1214 | Ga0495624_0137503 | 3300046690 | Bacteria | 1497 |
| 1215 | Ga0495670_0024793 | 3300046691 | Bacteria | 2965 |
| 1216 | Ga0495671_0008121 | 3300046692 | Bacteria | 5925 |
| 1217 | Ga0495671_0073676 | 3300046692 | Bacteria | 1676 |
| 1218 | Ga0495649_0007041 | 3300046694 | Bacteria | 6922 |
| 1219 | Ga0495649_0008123 | 3300046694 | Bacteria | 6333 |
| 1220 | Ga0495589_0068403 | 3300046794 | Bacteria | 1737 |
| 1221 | Ga0495600_0127367 | 3300046809 | Bacteria | 1656 |
| 1222 | Ga0495660_0016584 | 3300046810 | Bacteria | 4247 |
| 1223 | Ga0495660_0064686 | 3300046810 | Bacteria | 1954 |
| 1224 | Ga0495674_0229460 | 3300047319 | Bacteria | 1532 |
| 1225 | Ga0495676_0171497 | 3300047321 | Bacteria | 1526 |
| 1226 | Ga0495676_0226337 | 3300047321 | Bacteria | 1286 |
| 1227 | Ga0495687_000473 | 3300047443 | Bacteria | 48762 |
| 1228 | Ga0495687_010018 | 3300047443 | Bacteria | 5236 |
| 1229 | Ga0495681_0195136 | 3300047470 | Bacteria | 824 |
| 1230 | Ga0495684_0017249 | 3300047471 | Bacteria | 5558 |
| 1231 | Ga0495684_0073961 | 3300047471 | Bacteria | 2589 |
| 1232 | Ga0495686_0003630 | 3300047472 | Bacteria | 13244 |
| 1233 | Ga0495686_0007475 | 3300047472 | Bacteria | 8186 |
| 1234 | Ga0495686_0066710 | 3300047472 | Bacteria | 2223 |
| 1235 | Ga0495686_0068404 | 3300047472 | Bacteria | 2191 |
| 1236 | Ga0495593_0083841 | 3300047673 | Bacteria | 1646 |
| 1237 | Ga0495615_0041037 | 3300048090 | Bacteria | 1155 |
| 1238 | Ga0495626_0076323 | 3300048091 | Bacteria | 1496 |
| 1239 | Ga0496100_0004910 | 3300048903 | Bacteria | 7144 |
| 1240 | Ga0496101_0039108 | 3300048904 | Bacteria | 3371 |
| 1241 | Ga0496102_0008536 | 3300048905 | Bacteria | 8785 |
| 1242 | Ga0496102_0012505 | 3300048905 | Bacteria | 7349 |
| 1243 | Ga0496102_0420090 | 3300048905 | Bacteria | 1256 |
| 1244 | Ga0496103_0029430 | 3300048906 | Bacteria | 3338 |
| 1245 | Ga0496103_0236788 | 3300048906 | Bacteria | 1174 |
| 1246 | Ga0496104_0008803 | 3300048907 | Bacteria | 8972 |
| 1247 | Ga0496104_0008971 | 3300048907 | Bacteria | 8892 |
| 1248 | Ga0496104_0365663 | 3300048907 | Bacteria | 1355 |
| 1249 | Ga0496104_0549326 | 3300048907 | Bacteria | 1066 |
| 1250 | Ga0496105_0007444 | 3300048908 | Bacteria | 8474 |
| 1251 | Ga0496105_0085811 | 3300048908 | Bacteria | 2601 |
| 1252 | Ga0496105_0397226 | 3300048908 | Bacteria | 1095 |
| 1253 | Ga0496106_0022491 | 3300048909 | Bacteria | 4684 |
| 1254 | Ga0496106_0025809 | 3300048909 | Bacteria | 4372 |
| 1255 | Ga0496107_0307227 | 3300048910 | Bacteria | 1180 |
| 1256 | Ga0496108_0131728 | 3300048911 | Bacteria | 2149 |
| 1257 | Ga0496108_0147760 | 3300048911 | Bacteria | 2027 |
| 1258 | Ga0496108_0252414 | 3300048911 | Bacteria | 1534 |
| 1259 | Ga0496108_0489376 | 3300048911 | Bacteria | 1074 |
| 1260 | Ga0496109_0098397 | 3300048912 | Bacteria | 2712 |
| 1261 | Ga0496109_0209722 | 3300048912 | Bacteria | 1832 |
| 1262 | Ga0496109_0355405 | 3300048912 | Bacteria | 1384 |
| 1263 | Ga0496109_0369296 | 3300048912 | Bacteria | 1355 |
| 1264 | Ga0496109_0548450 | 3300048912 | Bacteria | 1091 |
| 1265 | Ga0496110_0023240 | 3300048913 | Bacteria | 5271 |
| 1266 | Ga0496111_0030189 | 3300048914 | Bacteria | 3855 |
| 1267 | Ga0496111_0053968 | 3300048914 | Bacteria | 2904 |
| 1268 | Ga0496112_0013286 | 3300048915 | Bacteria | 7601 |
| 1269 | Ga0496112_0264853 | 3300048915 | Bacteria | 1668 |
| 1270 | Ga0496113_0019299 | 3300048916 | Bacteria | 4766 |
| 1271 | Ga0496114_0254296 | 3300048917 | Bacteria | 1546 |
| 1272 | Ga0496115_0005962 | 3300048918 | Bacteria | 8894 |
| 1273 | Ga0496116_0011622 | 3300048919 | Bacteria | 7266 |
| 1274 | Ga0496116_0053310 | 3300048919 | Bacteria | 2672 |
| 1275 | Ga0496117_0035938 | 3300048920 | Bacteria | 3713 |
| 1276 | Ga0496118_0023095 | 3300048921 | Bacteria | 5415 |
| 1277 | Ga0496118_0031236 | 3300048921 | Bacteria | 4420 |
| 1278 | Ga0496118_0034548 | 3300048921 | Bacteria | 4122 |
| 1279 | Ga0496121_0017655 | 3300048924 | Bacteria | 7267 |
| 1280 | Ga0496121_0061301 | 3300048924 | Bacteria | 3087 |
| 1281 | Ga0496121_0186898 | 3300048924 | Bacteria | 1489 |
| 1282 | Ga0496122_0000034 | 3300048925 | Bacteria | 320661 |
| 1283 | Ga0496122_0069305 | 3300048925 | Bacteria | 2526 |
| 1284 | Ga0496122_0128058 | 3300048925 | Bacteria | 1620 |
| 1285 | Ga0496123_0000141 | 3300048926 | Bacteria | 147111 |
| 1286 | Ga0496123_0081613 | 3300048926 | Bacteria | 1964 |
| 1287 | Ga0496123_0140925 | 3300048926 | Bacteria | 1318 |
| 1288 | Ga0496124_0016806 | 3300048927 | Bacteria | 6935 |
| 1289 | Ga0496124_0023318 | 3300048927 | Bacteria | 5651 |
| 1290 | Ga0496124_0072208 | 3300048927 | Bacteria | 2858 |
| 1291 | Ga0496124_0106277 | 3300048927 | Bacteria | 2266 |
| 1292 | Ga0496124_0117899 | 3300048927 | Bacteria | 2126 |
| 1293 | Ga0496125_0002204 | 3300048928 | Bacteria | 25990 |
| 1294 | Ga0496125_0016741 | 3300048928 | Bacteria | 7030 |
| 1295 | Ga0496125_0027383 | 3300048928 | Bacteria | 5167 |
| 1296 | Ga0496125_0198958 | 3300048928 | Bacteria | 1314 |
| 1297 | Ga0496126_0030523 | 3300048929 | Bacteria | 5104 |
| 1298 | Ga0496126_0067784 | 3300048929 | Bacteria | 3188 |
| 1299 | Ga0496126_0072855 | 3300048929 | Bacteria | 3055 |
| 1300 | Ga0496126_0280036 | 3300048929 | Bacteria | 1382 |
| 1301 | Ga0501309_014454 | 3300049129 | Bacteria | 1060 |
| 1302 | Ga0501298_038442 | 3300049521 | Bacteria | 964 |
| 1303 | Ga0501300_009381 | 3300049523 | Bacteria | 1427 |
| 1304 | Ga0501031_0044698 | 3300049568 | Bacteria | 2890 |
| 1305 | Ga0501034_0187644 | 3300049571 | Bacteria | 2030 |
| 1306 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 1307 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 1308 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 1309 | Ga0501047_0037145 | 3300049581 | Bacteria | 4709 |
| 1310 | Ga0501047_0159212 | 3300049581 | Bacteria | 2130 |
| 1311 | Ga0501048_0000097 | 3300049582 | Bacteria | 47728 |
| 1312 | Ga0501198_000039 | 3300049649 | Bacteria | 47786 |
| 1313 | Ga0501211_001068 | 3300049658 | Bacteria | 2895 |
| 1314 | Ga0501222_000043 | 3300049662 | Bacteria | 47790 |
| 1315 | Ga0501222_001756 | 3300049662 | Bacteria | 3009 |
| 1316 | Ga0501223_019701 | 3300049663 | Bacteria | 1325 |
| 1317 | Ga0501249_001402 | 3300049679 | Bacteria | 4983 |
| 1318 | Ga0501253_015674 | 3300049683 | Bacteria | 1249 |
| 1319 | Ga0501221_005867 | 3300049704 | Bacteria | 2063 |
| 1320 | Ga0501225_0005658 | 3300049705 | Bacteria | 3663 |
| 1321 | Ga0501080_0037120 | 3300049742 | Bacteria | 4549 |
| 1322 | Ga0501262_000305 | 3300049759 | Bacteria | 5989 |
| 1323 | Ga0501263_002339 | 3300049760 | Bacteria | 1922 |
| 1324 | Ga0501265_001954 | 3300049762 | Bacteria | 2350 |
| 1325 | Ga0501266_000210 | 3300049763 | Bacteria | 7611 |
| 1326 | Ga0501267_002105 | 3300049764 | Bacteria | 1767 |
| 1327 | Ga0501279_004739 | 3300049775 | Bacteria | 1786 |
| 1328 | Ga0501035_0036476 | 3300049822 | Bacteria | 4456 |
| 1329 | Ga0501044_0071742 | 3300049823 | Bacteria | 3521 |
| 1330 | Ga0501045_0002894 | 3300049824 | Bacteria | 11731 |
| 1331 | nmdc:mga03683_104008_c1 | 3300050489 | Bacteria | 1250 |
| 1332 | nmdc:mga03683_10428_c1 | 3300050489 | Bacteria | 3333 |
| 1333 | nmdc:mga03683_11744_c1 | 3300050489 | Bacteria | 3182 |
| 1334 | nmdc:mga03683_27041_c1 | 3300050489 | Bacteria | 2269 |
| 1335 | nmdc:mga03683_4370_c1 | 3300050489 | Bacteria | 4684 |
| 1336 | nmdc:mga03683_51468_c1 | 3300050489 | Bacteria | 1719 |
| 1337 | nmdc:mga03683_9155_c1 | 3300050489 | Bacteria | 3510 |
| 1338 | nmdc:mga03n38_11598_c1 | 3300050490 | Bacteria | 3290 |
| 1339 | nmdc:mga03n38_50977_c1 | 3300050490 | Bacteria | 1846 |
| 1340 | nmdc:mga00v17_13234_c1 | 3300050491 | Bacteria | 4573 |
| 1341 | nmdc:mga00v17_40775_c1 | 3300050491 | Bacteria | 2786 |
| 1342 | nmdc:mga00v17_40979_c1 | 3300050491 | Bacteria | 2779 |
| 1343 | nmdc:mga0yw44_164081_c1 | 3300050492 | Bacteria | 1456 |
| 1344 | nmdc:mga0yw44_69875_c1 | 3300050492 | Bacteria | 2176 |
| 1345 | nmdc:mga0k408_1107_c1 | 3300050493 | Bacteria | 14758 |
| 1346 | nmdc:mga0k408_11730_c1 | 3300050493 | Bacteria | 4780 |
| 1347 | nmdc:mga0k408_133236_c1 | 3300050493 | Bacteria | 1476 |
| 1348 | nmdc:mga0k408_13369_c1 | 3300050493 | Bacteria | 4500 |
| 1349 | nmdc:mga0k408_17075_c1 | 3300050493 | Bacteria | 4037 |
| 1350 | nmdc:mga0k408_171182_c1 | 3300050493 | Bacteria | 1294 |
| 1351 | nmdc:mga0k408_17184_c1 | 3300050493 | Bacteria | 4027 |
| 1352 | nmdc:mga0k408_33077_c1 | 3300050493 | Bacteria | 2956 |
| 1353 | nmdc:mga0k408_37931_c1 | 3300050493 | Bacteria | 2767 |
| 1354 | nmdc:mga0k408_387263_c1 | 3300050493 | Bacteria | 832 |
| 1355 | nmdc:mga0k408_50451_c1 | 3300050493 | Bacteria | 2409 |
| 1356 | nmdc:mga0k408_53199_c1 | 3300050493 | Bacteria | 2346 |
| 1357 | nmdc:mga0k408_56887_c1 | 3300050493 | Bacteria | 2270 |
| 1358 | nmdc:mga0k408_6452_c1 | 3300050493 | Bacteria | 6256 |
| 1359 | nmdc:mga0k408_74008_c1 | 3300050493 | Bacteria | 1990 |
| 1360 | nmdc:mga0k408_7826_c1 | 3300050493 | Bacteria | 5713 |
| 1361 | nmdc:mga0k408_80770_c1 | 3300050493 | Bacteria | 1903 |
| 1362 | nmdc:mga0k408_81161_c1 | 3300050493 | Bacteria | 1899 |
| 1363 | nmdc:mga0k408_91859_c1 | 3300050493 | Bacteria | 1784 |
| 1364 | nmdc:mga06z11_155402_c1 | 3300050494 | Bacteria | 1304 |
| 1365 | nmdc:mga06z11_259120_c1 | 3300050494 | Bacteria | 1026 |
| 1366 | nmdc:mga06z11_29452_c1 | 3300050494 | Bacteria | 1639 |
| 1367 | nmdc:mga06z11_62720_c1 | 3300050494 | Bacteria | 1506 |
| 1368 | nmdc:mga04h51_44314_c1 | 3300050495 | Bacteria | 1466 |
| 1369 | nmdc:mga04h51_45950_c1 | 3300050495 | Bacteria | 1446 |
| 1370 | nmdc:mga07m45_11799_c1 | 3300050496 | Bacteria | 4600 |
| 1371 | nmdc:mga07m45_1441_c1 | 3300050496 | Bacteria | 10910 |
| 1372 | nmdc:mga07m45_1644_c1 | 3300050496 | Bacteria | 5094 |
| 1373 | nmdc:mga07m45_17064_c2 | 3300050496 | Bacteria | 2919 |
| 1374 | nmdc:mga07m45_18324_c1 | 3300050496 | Bacteria | 3777 |
| 1375 | nmdc:mga07m45_208560_c1 | 3300050496 | Bacteria | 1137 |
| 1376 | nmdc:mga07m45_220_c1 | 3300050496 | Bacteria | 22633 |
| 1377 | nmdc:mga07m45_23119_c1 | 3300050496 | Bacteria | 3396 |
| 1378 | nmdc:mga07m45_24416_c1 | 3300050496 | Bacteria | 3311 |
| 1379 | nmdc:mga07m45_246000_c1 | 3300050496 | Bacteria | 1041 |
| 1380 | nmdc:mga07m45_36783_c1 | 3300050496 | Bacteria | 2728 |
| 1381 | nmdc:mga07m45_4099_c1 | 3300050496 | Bacteria | 7110 |
| 1382 | nmdc:mga07m45_66194_c1 | 3300050496 | Bacteria | 2052 |
| 1383 | nmdc:mga07m45_8131_c1 | 3300050496 | Bacteria | 5377 |
| 1384 | nmdc:mga07m45_85631_c1 | 3300050496 | Bacteria | 1802 |
| 1385 | nmdc:mga07m45_98223_c1 | 3300050496 | Bacteria | 1681 |
| 1386 | nmdc:mga05p37_129068_c1 | 3300050507 | Bacteria | 3103 |
| 1387 | nmdc:mga09592_965_c1 | 3300050508 | Bacteria | 22699 |
| 1388 | nmdc:mga0qj67_175370_c1 | 3300050509 | Bacteria | 1741 |
| 1389 | nmdc:mga08y16_552283_c1 | 3300050511 | Bacteria | 1165 |
| 1390 | nmdc:mga0sz30_127678_c1 | 3300050516 | Bacteria | 1119 |
| 1391 | nmdc:mga0sz30_13382_c1 | 3300050516 | Bacteria | 3212 |
| 1392 | nmdc:mga0sz30_18248_c1 | 3300050516 | Bacteria | 2806 |
| 1393 | Ga0500610_0000863 | 3300053079 | Bacteria | 9710 |
| 1394 | Ga0500610_0027623 | 3300053079 | Bacteria | 2851 |
| 1395 | Ga0500610_0114083 | 3300053079 | Bacteria | 1386 |
| 1396 | Ga0500635_0000129 | 3300053080 | Bacteria | 44308 |
| 1397 | Ga0495619_0042460 | 3300053085 | Bacteria | 2978 |
| 1398 | Ga0500578_0001034 | 3300053086 | Bacteria | 30428 |
| 1399 | Ga0500578_0197124 | 3300053086 | Bacteria | 1234 |
| 1400 | Ga0500583_0088168 | 3300053092 | Bacteria | 1508 |
| 1401 | Ga0500651_0000097 | 3300053093 | Bacteria | 53876 |
| 1402 | Ga0500651_0003537 | 3300053093 | Bacteria | 8548 |
| 1403 | Ga0500651_0018573 | 3300053093 | Bacteria | 4306 |
| 1404 | Ga0500571_000190 | 3300053110 | Bacteria | 22258 |
| 1405 | Ga0500593_000570 | 3300053117 | Bacteria | 14182 |
| 1406 | Ga0500593_001079 | 3300053117 | Bacteria | 9847 |
| 1407 | Ga0500594_0000766 | 3300053118 | Bacteria | 6842 |
| 1408 | Ga0500594_0001531 | 3300053118 | Bacteria | 5031 |
| 1409 | Ga0500597_087377 | 3300053120 | Bacteria | 1354 |
| 1410 | Ga0500607_002610 | 3300053121 | Bacteria | 14302 |
| 1411 | Ga0500618_032668 | 3300053125 | Bacteria | 1217 |
| 1412 | Ga0500628_001693 | 3300053129 | Bacteria | 3726 |
| 1413 | Ga0500652_000757 | 3300053131 | Bacteria | 10901 |
| 1414 | Ga0500652_138434 | 3300053131 | Bacteria | 1014 |
| 1415 | Ga0500655_008878 | 3300053133 | Bacteria | 1808 |
| 1416 | Ga0500658_0000521 | 3300053134 | Bacteria | 16260 |
| 1417 | Ga0500658_0000753 | 3300053134 | Bacteria | 13371 |
| 1418 | Ga0500658_0002272 | 3300053134 | Bacteria | 7435 |
| 1419 | Ga0500658_0002796 | 3300053134 | Bacteria | 6699 |
| 1420 | Ga0500658_0180596 | 3300053134 | Bacteria | 961 |
| 1421 | Ga0500559_0000134 | 3300053136 | Bacteria | 56963 |
| 1422 | Ga0500559_0002741 | 3300053136 | Bacteria | 8942 |
| 1423 | Ga0500568_0003370 | 3300053139 | Bacteria | 8931 |
| 1424 | Ga0500568_0015423 | 3300053139 | Bacteria | 3422 |
| 1425 | Ga0500573_0050389 | 3300053140 | Bacteria | 2395 |
| 1426 | Ga0500590_044082 | 3300053148 | Bacteria | 2285 |
| 1427 | Ga0500616_0043647 | 3300053153 | Bacteria | 2396 |
| 1428 | Ga0500616_0077624 | 3300053153 | Bacteria | 1676 |
| 1429 | Ga0500619_000137 | 3300053154 | Bacteria | 18737 |
| 1430 | Ga0500622_0001329 | 3300053156 | Bacteria | 20074 |
| 1431 | Ga0500622_0011384 | 3300053156 | Bacteria | 4846 |
| 1432 | Ga0500622_0024467 | 3300053156 | Bacteria | 3192 |
| 1433 | Ga0500627_0001008 | 3300053158 | Bacteria | 7675 |
| 1434 | Ga0500633_0081403 | 3300053160 | Bacteria | 1172 |
| 1435 | Ga0500634_0015124 | 3300053161 | Bacteria | 4090 |
| 1436 | Ga0500634_0031872 | 3300053161 | Bacteria | 2875 |
| 1437 | Ga0500636_0015073 | 3300053177 | Bacteria | 4551 |
| 1438 | Ga0500625_019956 | 3300053729 | Bacteria | 3153 |
| 1439 | Ga0500645_010276 | 3300053730 | Bacteria | 3104 |
| 1440 | Ga0500645_019674 | 3300053730 | Bacteria | 2098 |
| 1441 | Ga0500596_016460 | 3300053735 | Bacteria | 1111 |
| 1442 | Ga0500661_006420 | 3300055283 | Bacteria | 2187 |
| 1443 | Ga0500661_022231 | 3300055283 | Bacteria | 1124 |
| 1444 | Ga0590071_001197 | 3300059421 | Bacteria | 7016 |
| 1445 | Ga0466962_0003867 | 3300061719 | Bacteria | 7154 |
| 1446 | Ga0466962_0022710 | 3300061719 | Bacteria | 3015 |
| 1447 | Ga0466962_0067867 | 3300061719 | Bacteria | 1703 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048909 | Ga0496106_0025809 | Ga0496106_0025809_3435_4124 | 211 |
| 2 | 3300047472 | Ga0495686_0068404 | Ga0495686_0068404_1096_1785 | 212 |
| 3 | 3300042435 | Ga0439434_0182603 | Ga0439434_0182603_10_684 | 213 |
| 4 | 3300005436 | Ga0070713_101274416 | Ga0070713_1012744161 | 215 |
| 5 | 3300025972 | Ga0207668_10424497 | Ga0207668_104244972 | 215 |
| 6 | 3300035118 | Ga0373954_0096772 | Ga0373954_0096772_56_721 | 216 |
| 7 | 3300046536 | Ga0495587_0448678 | Ga0495587_0448678_13_690 | 216 |
| 8 | 3300048912 | Ga0496109_0548450 | Ga0496109_0548450_69_746 | 216 |
| 9 | 3300049658 | Ga0501211_001068 | Ga0501211_001068_26_703 | 216 |
| 10 | 3300005578 | Ga0068854_100248759 | Ga0068854_1002487591 | 217 |
| 11 | 3300006178 | Ga0075367_10098884 | Ga0075367_100988842 | 217 |
| 12 | 3300027866 | Ga0209813_10002277 | Ga0209813_100022771 | 217 |
| 13 | 3300031456 | Ga0307513_10447257 | Ga0307513_104472572 | 217 |
| 14 | 3300031730 | Ga0307516_10126309 | Ga0307516_101263092 | 217 |
| 15 | 3300050493 | nmdc:mga0k408_13369_c1 | nmdc:mga0k408_13369_c1_2865_3560 | 217 |
| 16 | 3300050493 | nmdc:mga0k408_17075_c1 | nmdc:mga0k408_17075_c1_1898_2596 | 217 |
| 17 | 3300050494 | nmdc:mga06z11_29452_c1 | nmdc:mga06z11_29452_c1_432_1127 | 217 |
| 18 | 3300053730 | Ga0500645_010276 | Ga0500645_010276_2109_2810 | 217 |
| 19 | 3300003781 | Ga0055536_1008603 | Ga0055536_10086034 | 220 |
| 20 | 3300037312 | Ga0395899_0002154 | Ga0395899_0002154_4146_4823 | 221 |
| 21 | 3300037466 | Ga0395898_0022008 | Ga0395898_0022008_48_725 | 221 |
| 22 | 3300037466 | Ga0395898_0222657 | Ga0395898_0222657_46_723 | 221 |
| 23 | 3300038443 | Ga0395901_0216962 | Ga0395901_0216962_865_1542 | 221 |
| 24 | iso_pu_bacteria | 2831864461 | 2831868553 | 230 |
| 25 | iso_pu_bacteria | 2886848708 | 2886848966 | 230 |
| 26 | iso_pu_bacteria | 2886848708 | 2886854666 | 230 |
| 27 | 3300053153 | Ga0500616_0043647 | Ga0500616_0043647_1054_1785 | 232 |
| 28 | iso_pu_bacteria | 2643221544 | 2643745806 | 232 |
| 29 | iso_pu_bacteria | 2643221585 | 2643936883 | 232 |
| 30 | iso_pu_bacteria | 2643221656 | 2644318048 | 232 |
| 31 | 3300050493 | nmdc:mga0k408_6452_c1 | nmdc:mga0k408_6452_c1_16_726 | 233 |
| 32 | 3300003320 | rootH2_10074078 | rootH2_100740782 | 234 |
| 33 | 3300003322 | rootL2_10001938 | rootL2_100019387 | 234 |
| 34 | 3300003323 | rootH1_10129911 | rootH1_101299112 | 234 |
| 35 | 3300003771 | Ga0055526_1001574 | Ga0055526_10015744 | 234 |
| 36 | 3300003775 | Ga0055524_1000595 | Ga0055524_100059523 | 234 |
| 37 | 3300003794 | Ga0055531_10006250 | Ga0055531_100062507 | 234 |
| 38 | 3300003794 | Ga0055531_10028801 | Ga0055531_100288012 | 234 |
| 39 | 3300004625 | Ga0055543_1015830 | Ga0055543_10158302 | 234 |
| 40 | 3300005262 | Ga0065165_1000181 | Ga0065165_100018127 | 234 |
| 41 | 3300006944 | Ga0099823_1000023 | Ga0099823_100002311 | 234 |
| 42 | 3300012475 | Ga0157317_1000084 | Ga0157317_10000842 | 234 |
| 43 | 3300012497 | Ga0157319_1000001 | Ga0157319_1000001308 | 234 |
| 44 | 3300025273 | Ga0209673_1006737 | Ga0209673_10067374 | 234 |
| 45 | 3300025273 | Ga0209673_1012989 | Ga0209673_10129895 | 234 |
| 46 | 3300025273 | Ga0209673_1023816 | Ga0209673_10238162 | 234 |
| 47 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005172 | 234 |
| 48 | 3300025298 | Ga0209050_1013717 | Ga0209050_10137172 | 234 |
| 49 | 3300025299 | Ga0209256_1000078 | Ga0209256_100007840 | 234 |
| 50 | 3300025299 | Ga0209256_1000742 | Ga0209256_10007424 | 234 |
| 51 | 3300025303 | Ga0209051_1008508 | Ga0209051_10085082 | 234 |
| 52 | 3300025304 | Ga0209257_1000358 | Ga0209257_100035863 | 234 |
| 53 | 3300025304 | Ga0209257_1005027 | Ga0209257_10050277 | 234 |
| 54 | 3300025940 | Ga0207691_10212544 | Ga0207691_102125442 | 234 |
| 55 | 3300027296 | Ga0209389_1004479 | Ga0209389_10044794 | 234 |
| 56 | 3300042011 | Ga0439454_005533 | Ga0439454_005533_721_1446 | 234 |
| 57 | 3300042127 | Ga0450890_000968 | Ga0450890_000968_86_811 | 234 |
| 58 | 3300042436 | Ga0439435_0051716 | Ga0439435_0051716_61_786 | 234 |
| 59 | 3300042438 | Ga0439459_0003787 | Ga0439459_0003787_1638_2363 | 234 |
| 60 | 3300044694 | Ga0466963_0390195 | Ga0466963_0390195_85_810 | 234 |
| 61 | 3300046460 | Ga0495638_0324682 | Ga0495638_0324682_46_771 | 234 |
| 62 | 3300048091 | Ga0495626_0076323 | Ga0495626_0076323_723_1469 | 234 |
| 63 | 3300048927 | Ga0496124_0016806 | Ga0496124_0016806_3837_4562 | 234 |
| 64 | 3300048929 | Ga0496126_0067784 | Ga0496126_0067784_1202_1927 | 234 |
| 65 | 3300053156 | Ga0500622_0024467 | Ga0500622_0024467_546_1271 | 234 |
| 66 | iso_pu_bacteria | 2643221639 | 2644221723 | 234 |
| 67 | iso_pu_bacteria | 2738541337 | 2739058503 | 234 |
| 68 | 3300003759 | Ga0055525_1000011 | Ga0055525_1000011458 | 235 |
| 69 | 3300003759 | Ga0055525_1000046 | Ga0055525_100004646 | 235 |
| 70 | 3300025230 | Ga0209563_100005 | Ga0209563_100005784 | 235 |
| 71 | 3300042876 | Ga0451577_0000114 | Ga0451577_0000114_25486_26211 | 235 |
| 72 | 3300044712 | Ga0453684_0001710 | Ga0453684_0001710_25551_26276 | 235 |
| 73 | 3300045051 | Ga0451576_0003831 | Ga0451576_0003831_14398_15123 | 235 |
| 74 | iso_pu_bacteria | 2643221646 | 2644257499 | 235 |
| 75 | iso_pu_bacteria | 2928115317 | 2928115964 | 235 |
| 76 | 3300003316 | rootH1_10011082 | rootH1_100110825 | 236 |
| 77 | 3300003322 | rootL2_10006242 | rootL2_100062424 | 236 |
| 78 | 3300003794 | Ga0055531_10000172 | Ga0055531_1000017219 | 236 |
| 79 | 3300005262 | Ga0065165_1000230 | Ga0065165_100023049 | 236 |
| 80 | 3300009148 | Ga0105243_10064750 | Ga0105243_100647504 | 236 |
| 81 | 3300025303 | Ga0209051_1001527 | Ga0209051_100152719 | 236 |
| 82 | 3300025304 | Ga0209257_1000017 | Ga0209257_1000017472 | 236 |
| 83 | 3300025935 | Ga0207709_10067565 | Ga0207709_100675653 | 236 |
| 84 | 3300031548 | Ga0307408_100000046 | Ga0307408_100000046144 | 236 |
| 85 | 3300032005 | Ga0307411_10002107 | Ga0307411_100021078 | 236 |
| 86 | 3300037471 | Ga0395905_0001081 | Ga0395905_0001081_7765_8499 | 236 |
| 87 | 3300044712 | Ga0453684_0514284 | Ga0453684_0514284_430_1164 | 236 |
| 88 | 3300044712 | Ga0453684_0698711 | Ga0453684_0698711_309_1043 | 236 |
| 89 | 3300045051 | Ga0451576_0112992 | Ga0451576_0112992_520_1251 | 236 |
| 90 | 3300049129 | Ga0501309_014454 | Ga0501309_014454_219_953 | 236 |
| 91 | 3300049523 | Ga0501300_009381 | Ga0501300_009381_291_1025 | 236 |
| 92 | 3300049662 | Ga0501222_001756 | Ga0501222_001756_1547_2281 | 236 |
| 93 | 3300049663 | Ga0501223_019701 | Ga0501223_019701_575_1309 | 236 |
| 94 | 3300049683 | Ga0501253_015674 | Ga0501253_015674_182_916 | 236 |
| 95 | 3300049704 | Ga0501221_005867 | Ga0501221_005867_859_1593 | 236 |
| 96 | 3300049762 | Ga0501265_001954 | Ga0501265_001954_1035_1769 | 236 |
| 97 | 3300049764 | Ga0501267_002105 | Ga0501267_002105_559_1293 | 236 |
| 98 | iso_pu_bacteria | 2721755523 | 2722882646 | 236 |
| 99 | iso_pu_bacteria | 2839138175 | 2839143267 | 236 |
| 100 | iso_pu_bacteria | 2585428058 | 2587734802 | 237 |
| 101 | iso_pu_bacteria | 2585428062 | 2587760232 | 237 |
| 102 | iso_pu_bacteria | 2588253510 | 2588295380 | 237 |
| 103 | 3300005614 | Ga0068856_100068699 | Ga0068856_1000686994 | 238 |
| 104 | 3300006195 | Ga0075366_10001141 | Ga0075366_1000114110 | 238 |
| 105 | 3300026078 | Ga0207702_10048355 | Ga0207702_100483552 | 238 |
| 106 | 3300031649 | Ga0307514_10006986 | Ga0307514_100069864 | 238 |
| 107 | 3300042004 | Ga0439445_0034439 | Ga0439445_0034439_133_876 | 238 |
| 108 | 3300050493 | nmdc:mga0k408_1107_c1 | nmdc:mga0k408_1107_c1_10463_11203 | 238 |
| 109 | iso_pu_bacteria | 2881101125 | 2881101729 | 238 |
| 110 | 3300003761 | Ga0055535_1000177 | Ga0055535_100017754 | 239 |
| 111 | 3300003763 | Ga0055529_1000346 | Ga0055529_100034627 | 239 |
| 112 | 3300005337 | Ga0070682_100172320 | Ga0070682_1001723202 | 239 |
| 113 | 3300005455 | Ga0070663_100000172 | Ga0070663_1000001727 | 239 |
| 114 | 3300009147 | Ga0114129_10118444 | Ga0114129_101184445 | 239 |
| 115 | 3300021361 | Ga0213872_10000129 | Ga0213872_1000012965 | 239 |
| 116 | 3300021361 | Ga0213872_10017841 | Ga0213872_100178414 | 239 |
| 117 | 3300021361 | Ga0213872_10037201 | Ga0213872_100372013 | 239 |
| 118 | 3300021361 | Ga0213872_10112089 | Ga0213872_101120892 | 239 |
| 119 | 3300025242 | Ga0209258_100146 | Ga0209258_100146145 | 239 |
| 120 | 3300025256 | Ga0209759_1001457 | Ga0209759_10014579 | 239 |
| 121 | 3300025272 | Ga0209455_1000059 | Ga0209455_1000059145 | 239 |
| 122 | 3300026067 | Ga0207678_10000478 | Ga0207678_100004788 | 239 |
| 123 | 3300031235 | Ga0265330_10000117 | Ga0265330_1000011758 | 239 |
| 124 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002383 | 239 |
| 125 | 3300031456 | Ga0307513_10000010 | Ga0307513_10000010272 | 239 |
| 126 | 3300031711 | Ga0265314_10000012 | Ga0265314_100000122 | 239 |
| 127 | 3300039447 | Ga0436361_0029649 | Ga0436361_0029649_2200_2946 | 239 |
| 128 | 3300039447 | Ga0436361_0257745 | Ga0436361_0257745_3031_3774 | 239 |
| 129 | 3300039447 | Ga0436361_0362737 | Ga0436361_0362737_1340_2083 | 239 |
| 130 | 3300039447 | Ga0436361_0650099 | Ga0436361_0650099_13709_14455 | 239 |
| 131 | 3300046660 | Ga0495625_0163982 | Ga0495625_0163982_524_1261 | 239 |
| 132 | 3300050507 | nmdc:mga05p37_129068_c1 | nmdc:mga05p37_129068_c1_62_793 | 239 |
| 133 | iso_pu_bacteria | 2585428057 | 2587730065 | 239 |
| 134 | iso_pu_bacteria | 2643221660 | 2644340065 | 239 |
| 135 | iso_pu_bacteria | 2738543012 | 2739244706 | 239 |
| 136 | iso_pu_bacteria | 2816332133 | 2816475087 | 239 |
| 137 | iso_pu_bacteria | 2842718218 | 2842719796 | 239 |
| 138 | 3300003792 | Ga0055540_1011016 | Ga0055540_10110162 | 240 |
| 139 | 3300003794 | Ga0055531_10000358 | Ga0055531_1000035822 | 240 |
| 140 | 3300005355 | Ga0070671_100011544 | Ga0070671_1000115445 | 240 |
| 141 | 3300005356 | Ga0070674_100023714 | Ga0070674_1000237143 | 240 |
| 142 | 3300005539 | Ga0068853_100913355 | Ga0068853_1009133551 | 240 |
| 143 | 3300005719 | Ga0068861_100159011 | Ga0068861_1001590112 | 240 |
| 144 | 3300005841 | Ga0068863_100261287 | Ga0068863_1002612872 | 240 |
| 145 | 3300005844 | Ga0068862_100071372 | Ga0068862_1000713722 | 240 |
| 146 | 3300005844 | Ga0068862_100294454 | Ga0068862_1002944542 | 240 |
| 147 | 3300006353 | Ga0075370_10019470 | Ga0075370_100194703 | 240 |
| 148 | 3300006846 | Ga0075430_100074859 | Ga0075430_1000748592 | 240 |
| 149 | 3300006880 | Ga0075429_100013802 | Ga0075429_1000138023 | 240 |
| 150 | 3300006946 | Ga0079104_1000025 | Ga0079104_100002596 | 240 |
| 151 | 3300009148 | Ga0105243_10000881 | Ga0105243_1000088115 | 240 |
| 152 | 3300009148 | Ga0105243_10017699 | Ga0105243_100176994 | 240 |
| 153 | 3300009148 | Ga0105243_10046506 | Ga0105243_100465062 | 240 |
| 154 | 3300009176 | Ga0105242_10155515 | Ga0105242_101555152 | 240 |
| 155 | 3300009177 | Ga0105248_10001394 | Ga0105248_1000139419 | 240 |
| 156 | 3300009553 | Ga0105249_10062903 | Ga0105249_100629032 | 240 |
| 157 | 3300025303 | Ga0209051_1000140 | Ga0209051_100014071 | 240 |
| 158 | 3300025303 | Ga0209051_1012820 | Ga0209051_10128204 | 240 |
| 159 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012769 | 240 |
| 160 | 3300025304 | Ga0209257_1000045 | Ga0209257_1000045175 | 240 |
| 161 | 3300025711 | Ga0207696_1046952 | Ga0207696_10469522 | 240 |
| 162 | 3300025910 | Ga0207684_10047582 | Ga0207684_100475821 | 240 |
| 163 | 3300025934 | Ga0207686_10214102 | Ga0207686_102141022 | 240 |
| 164 | 3300025935 | Ga0207709_10000159 | Ga0207709_1000015961 | 240 |
| 165 | 3300025935 | Ga0207709_10020701 | Ga0207709_100207014 | 240 |
| 166 | 3300025935 | Ga0207709_10312762 | Ga0207709_103127622 | 240 |
| 167 | 3300025940 | Ga0207691_10296112 | Ga0207691_102961121 | 240 |
| 168 | 3300025941 | Ga0207711_10010519 | Ga0207711_100105192 | 240 |
| 169 | 3300025961 | Ga0207712_10028278 | Ga0207712_100282784 | 240 |
| 170 | 3300025961 | Ga0207712_10449266 | Ga0207712_104492661 | 240 |
| 171 | 3300026088 | Ga0207641_10197851 | Ga0207641_101978512 | 240 |
| 172 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007125 | 240 |
| 173 | 3300027876 | Ga0209974_10006645 | Ga0209974_100066455 | 240 |
| 174 | 3300028380 | Ga0268265_10059385 | Ga0268265_100593853 | 240 |
| 175 | 3300031507 | Ga0307509_10391707 | Ga0307509_103917072 | 240 |
| 176 | 3300031730 | Ga0307516_10004865 | Ga0307516_1000486513 | 240 |
| 177 | 3300031730 | Ga0307516_10311992 | Ga0307516_103119922 | 240 |
| 178 | 3300034818 | Ga0373950_0001730 | Ga0373950_0001730_260_1009 | 240 |
| 179 | 3300035088 | Ga0373940_0029217 | Ga0373940_0029217_343_1092 | 240 |
| 180 | 3300035114 | Ga0373939_0000134 | Ga0373939_0000134_17588_18337 | 240 |
| 181 | 3300035121 | Ga0373960_0000060 | Ga0373960_0000060_11207_11956 | 240 |
| 182 | 3300035241 | Ga0373961_0060848 | Ga0373961_0060848_328_1077 | 240 |
| 183 | 3300035691 | Ga0373931_0001710 | Ga0373931_0001710_6502_7245 | 240 |
| 184 | 3300035691 | Ga0373931_0009130 | Ga0373931_0009130_3483_4232 | 240 |
| 185 | 3300037471 | Ga0395905_0006990 | Ga0395905_0006990_3325_4062 | 240 |
| 186 | 3300037471 | Ga0395905_0028506 | Ga0395905_0028506_295_1032 | 240 |
| 187 | 3300037471 | Ga0395905_0104308 | Ga0395905_0104308_1458_2213 | 240 |
| 188 | 3300042126 | Ga0450888_000157 | Ga0450888_000157_313_1062 | 240 |
| 189 | 3300042127 | Ga0450890_000648 | Ga0450890_000648_938_1687 | 240 |
| 190 | 3300042144 | Ga0450889_002440 | Ga0450889_002440_182_931 | 240 |
| 191 | 3300042530 | Ga0450916_008020 | Ga0450916_008020_456_1205 | 240 |
| 192 | 3300042532 | Ga0450893_0006610 | Ga0450893_0006610_272_1021 | 240 |
| 193 | 3300044719 | Ga0466971_0166188 | Ga0466971_0166188_180_914 | 240 |
| 194 | 3300046507 | Ga0495606_0110943 | Ga0495606_0110943_827_1570 | 240 |
| 195 | 3300048907 | Ga0496104_0365663 | Ga0496104_0365663_445_1182 | 240 |
| 196 | 3300048911 | Ga0496108_0147760 | Ga0496108_0147760_922_1659 | 240 |
| 197 | 3300048912 | Ga0496109_0098397 | Ga0496109_0098397_1570_2307 | 240 |
| 198 | 3300048915 | Ga0496112_0013286 | Ga0496112_0013286_2330_3067 | 240 |
| 199 | 3300048916 | Ga0496113_0019299 | Ga0496113_0019299_3423_4160 | 240 |
| 200 | 3300049568 | Ga0501031_0044698 | Ga0501031_0044698_1431_2171 | 240 |
| 201 | 3300049579 | Ga0501043_0000149 | Ga0501043_0000149_28835_29572 | 240 |
| 202 | 3300049580 | Ga0501046_0000092 | Ga0501046_0000092_35687_36424 | 240 |
| 203 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_190882_191619 | 240 |
| 204 | 3300049582 | Ga0501048_0000097 | Ga0501048_0000097_28229_28966 | 240 |
| 205 | 3300049649 | Ga0501198_000039 | Ga0501198_000039_45602_46342 | 240 |
| 206 | 3300049662 | Ga0501222_000043 | Ga0501222_000043_45602_46342 | 240 |
| 207 | 3300049763 | Ga0501266_000210 | Ga0501266_000210_5363_6109 | 240 |
| 208 | 3300049824 | Ga0501045_0002894 | Ga0501045_0002894_10636_11373 | 240 |
| 209 | 3300050493 | nmdc:mga0k408_387263_c1 | nmdc:mga0k408_387263_c1_22_759 | 240 |
| 210 | 3300050496 | nmdc:mga07m45_4099_c1 | nmdc:mga07m45_4099_c1_2548_3297 | 240 |
| 211 | 3300050508 | nmdc:mga09592_965_c1 | nmdc:mga09592_965_c1_1391_2131 | 240 |
| 212 | 3300050509 | nmdc:mga0qj67_175370_c1 | nmdc:mga0qj67_175370_c1_340_1080 | 240 |
| 213 | 3300053148 | Ga0500590_044082 | Ga0500590_044082_259_996 | 240 |
| 214 | iso_pu_bacteria | 2511231002 | 2511245226 | 240 |
| 215 | iso_pu_bacteria | 2643221592 | 2643971682 | 240 |
| 216 | iso_pu_bacteria | 2643221625 | 2644139767 | 240 |
| 217 | iso_pu_bacteria | 2643221648 | 2644272595 | 240 |
| 218 | iso_pu_bacteria | 2842733646 | 2842735188 | 240 |
| 219 | iso_pu_bacteria | 2842747753 | 2842751068 | 240 |
| 220 | iso_pu_bacteria | 2974320154 | 2974323873 | 240 |
| 221 | 3300003215 | JGI25153J46596_10001674 | JGI25153J46596_100016743 | 241 |
| 222 | 3300003771 | Ga0055526_1001196 | Ga0055526_10011967 | 241 |
| 223 | 3300003775 | Ga0055524_1000182 | Ga0055524_100018256 | 241 |
| 224 | 3300003791 | Ga0055530_10003939 | Ga0055530_100039394 | 241 |
| 225 | 3300003792 | Ga0055540_1000233 | Ga0055540_10002335 | 241 |
| 226 | 3300005262 | Ga0065165_1001066 | Ga0065165_100106612 | 241 |
| 227 | 3300005328 | Ga0070676_10109041 | Ga0070676_101090411 | 241 |
| 228 | 3300005339 | Ga0070660_100062158 | Ga0070660_1000621583 | 241 |
| 229 | 3300005344 | Ga0070661_100002048 | Ga0070661_1000020487 | 241 |
| 230 | 3300005347 | Ga0070668_100121311 | Ga0070668_1001213111 | 241 |
| 231 | 3300005366 | Ga0070659_100000684 | Ga0070659_10000068418 | 241 |
| 232 | 3300005366 | Ga0070659_100036638 | Ga0070659_1000366383 | 241 |
| 233 | 3300005456 | Ga0070678_100378795 | Ga0070678_1003787952 | 241 |
| 234 | 3300005467 | Ga0070706_100780930 | Ga0070706_1007809301 | 241 |
| 235 | 3300005539 | Ga0068853_100547719 | Ga0068853_1005477191 | 241 |
| 236 | 3300005543 | Ga0070672_100155866 | Ga0070672_1001558661 | 241 |
| 237 | 3300005564 | Ga0070664_100011468 | Ga0070664_1000114683 | 241 |
| 238 | 3300005616 | Ga0068852_100278126 | Ga0068852_1002781262 | 241 |
| 239 | 3300006038 | Ga0075365_10174636 | Ga0075365_101746362 | 241 |
| 240 | 3300006048 | Ga0075363_100134428 | Ga0075363_1001344282 | 241 |
| 241 | 3300006178 | Ga0075367_10014386 | Ga0075367_100143864 | 241 |
| 242 | 3300006195 | Ga0075366_10083048 | Ga0075366_100830482 | 241 |
| 243 | 3300006195 | Ga0075366_10145137 | Ga0075366_101451372 | 241 |
| 244 | 3300006353 | Ga0075370_10067947 | Ga0075370_100679472 | 241 |
| 245 | 3300009093 | Ga0105240_10050723 | Ga0105240_100507233 | 241 |
| 246 | 3300009098 | Ga0105245_10371897 | Ga0105245_103718972 | 241 |
| 247 | 3300009545 | Ga0105237_10002681 | Ga0105237_1000268111 | 241 |
| 248 | 3300009551 | Ga0105238_10010268 | Ga0105238_100102683 | 241 |
| 249 | 3300010375 | Ga0105239_10001896 | Ga0105239_1000189614 | 241 |
| 250 | 3300025245 | Ga0207425_1000332 | Ga0207425_100033227 | 241 |
| 251 | 3300025256 | Ga0209759_1001102 | Ga0209759_10011028 | 241 |
| 252 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012499 | 241 |
| 253 | 3300025273 | Ga0209673_1003959 | Ga0209673_10039598 | 241 |
| 254 | 3300025295 | Ga0209564_1000022 | Ga0209564_100002215 | 241 |
| 255 | 3300025297 | Ga0209758_1000356 | Ga0209758_100035663 | 241 |
| 256 | 3300025297 | Ga0209758_1000708 | Ga0209758_100070815 | 241 |
| 257 | 3300025298 | Ga0209050_1002670 | Ga0209050_10026708 | 241 |
| 258 | 3300025303 | Ga0209051_1000155 | Ga0209051_10001556 | 241 |
| 259 | 3300025304 | Ga0209257_1000236 | Ga0209257_10002366 | 241 |
| 260 | 3300025304 | Ga0209257_1040128 | Ga0209257_10401282 | 241 |
| 261 | 3300025909 | Ga0207705_10034666 | Ga0207705_100346664 | 241 |
| 262 | 3300025909 | Ga0207705_10270512 | Ga0207705_102705122 | 241 |
| 263 | 3300025913 | Ga0207695_10037040 | Ga0207695_100370405 | 241 |
| 264 | 3300025914 | Ga0207671_10002325 | Ga0207671_1000232518 | 241 |
| 265 | 3300025919 | Ga0207657_10010303 | Ga0207657_100103034 | 241 |
| 266 | 3300025919 | Ga0207657_10229529 | Ga0207657_102295292 | 241 |
| 267 | 3300025920 | Ga0207649_10005919 | Ga0207649_100059195 | 241 |
| 268 | 3300025924 | Ga0207694_10013570 | Ga0207694_100135702 | 241 |
| 269 | 3300025932 | Ga0207690_10005848 | Ga0207690_100058484 | 241 |
| 270 | 3300025933 | Ga0207706_10071708 | Ga0207706_100717084 | 241 |
| 271 | 3300025945 | Ga0207679_10003912 | Ga0207679_100039126 | 241 |
| 272 | 3300025961 | Ga0207712_10479238 | Ga0207712_104792382 | 241 |
| 273 | 3300026041 | Ga0207639_10083956 | Ga0207639_100839563 | 241 |
| 274 | 3300026067 | Ga0207678_10235881 | Ga0207678_102358812 | 241 |
| 275 | 3300027252 | Ga0209973_1006169 | Ga0209973_10061692 | 241 |
| 276 | 3300027876 | Ga0209974_10002379 | Ga0209974_100023793 | 241 |
| 277 | 3300027876 | Ga0209974_10005889 | Ga0209974_100058892 | 241 |
| 278 | 3300028786 | Ga0307517_10091779 | Ga0307517_100917792 | 241 |
| 279 | 3300028794 | Ga0307515_10000026 | Ga0307515_10000026110 | 241 |
| 280 | 3300028794 | Ga0307515_10000051 | Ga0307515_10000051200 | 241 |
| 281 | 3300028794 | Ga0307515_10000132 | Ga0307515_1000013252 | 241 |
| 282 | 3300028794 | Ga0307515_10000305 | Ga0307515_1000030518 | 241 |
| 283 | 3300028794 | Ga0307515_10038818 | Ga0307515_100388187 | 241 |
| 284 | 3300031456 | Ga0307513_10015459 | Ga0307513_100154594 | 241 |
| 285 | 3300031507 | Ga0307509_10010432 | Ga0307509_1001043211 | 241 |
| 286 | 3300031616 | Ga0307508_10000098 | Ga0307508_1000009811 | 241 |
| 287 | 3300031649 | Ga0307514_10008269 | Ga0307514_100082693 | 241 |
| 288 | 3300031730 | Ga0307516_10004343 | Ga0307516_1000434318 | 241 |
| 289 | 3300031911 | Ga0307412_10112312 | Ga0307412_101123122 | 241 |
| 290 | 3300034820 | Ga0373959_0021287 | Ga0373959_0021287_268_1020 | 241 |
| 291 | 3300035691 | Ga0373931_0068429 | Ga0373931_0068429_499_1251 | 241 |
| 292 | 3300037471 | Ga0395905_0683946 | Ga0395905_0683946_82_831 | 241 |
| 293 | 3300039450 | Ga0436363_0690192 | Ga0436363_0690192_49_792 | 241 |
| 294 | 3300041458 | Ga0451798_0843930 | Ga0451798_0843930_296_1036 | 241 |
| 295 | 3300041463 | Ga0451804_0897864 | Ga0451804_0897864_433_1173 | 241 |
| 296 | 3300041486 | Ga0451807_1692089 | Ga0451807_1692089_215_955 | 241 |
| 297 | 3300042004 | Ga0439445_0008876 | Ga0439445_0008876_385_1131 | 241 |
| 298 | 3300042012 | Ga0439455_0057914 | Ga0439455_0057914_201_950 | 241 |
| 299 | 3300042115 | Ga0450911_001002 | Ga0450911_001002_3637_4383 | 241 |
| 300 | 3300042121 | Ga0450919_000793 | Ga0450919_000793_1269_2015 | 241 |
| 301 | 3300042435 | Ga0439434_0029442 | Ga0439434_0029442_759_1520 | 241 |
| 302 | 3300042531 | Ga0450918_000287 | Ga0450918_000287_5934_6680 | 241 |
| 303 | 3300044656 | Ga0466969_0000017 | Ga0466969_0000017_44656_45405 | 241 |
| 304 | 3300044684 | Ga0466966_0002454 | Ga0466966_0002454_8444_9193 | 241 |
| 305 | 3300044712 | Ga0453684_0441023 | Ga0453684_0441023_268_1008 | 241 |
| 306 | 3300044765 | Ga0466970_0091123 | Ga0466970_0091123_359_1108 | 241 |
| 307 | 3300045049 | Ga0466959_0101685 | Ga0466959_0101685_686_1435 | 241 |
| 308 | 3300045976 | Ga0466967_0353253 | Ga0466967_0353253_151_924 | 241 |
| 309 | 3300046460 | Ga0495638_0083200 | Ga0495638_0083200_746_1486 | 241 |
| 310 | 3300046471 | Ga0495650_0010155 | Ga0495650_0010155_646_1386 | 241 |
| 311 | 3300046519 | Ga0495632_0009453 | Ga0495632_0009453_174_914 | 241 |
| 312 | 3300046525 | Ga0495663_0015892 | Ga0495663_0015892_845_1594 | 241 |
| 313 | 3300046528 | Ga0495642_0099720 | Ga0495642_0099720_158_907 | 241 |
| 314 | 3300046674 | Ga0495588_0223682 | Ga0495588_0223682_159_908 | 241 |
| 315 | 3300046683 | Ga0495658_0319442 | Ga0495658_0319442_89_826 | 241 |
| 316 | 3300048905 | Ga0496102_0008536 | Ga0496102_0008536_739_1476 | 241 |
| 317 | 3300048907 | Ga0496104_0549326 | Ga0496104_0549326_134_886 | 241 |
| 318 | 3300048924 | Ga0496121_0017655 | Ga0496121_0017655_2887_3633 | 241 |
| 319 | 3300048928 | Ga0496125_0016741 | Ga0496125_0016741_4220_4966 | 241 |
| 320 | 3300048929 | Ga0496126_0280036 | Ga0496126_0280036_235_981 | 241 |
| 321 | 3300049521 | Ga0501298_038442 | Ga0501298_038442_87_866 | 241 |
| 322 | 3300050490 | nmdc:mga03n38_50977_c1 | nmdc:mga03n38_50977_c1_333_1073 | 241 |
| 323 | 3300050492 | nmdc:mga0yw44_69875_c1 | nmdc:mga0yw44_69875_c1_1211_1948 | 241 |
| 324 | 3300050493 | nmdc:mga0k408_133236_c1 | nmdc:mga0k408_133236_c1_438_1178 | 241 |
| 325 | 3300050493 | nmdc:mga0k408_53199_c1 | nmdc:mga0k408_53199_c1_1197_1949 | 241 |
| 326 | 3300050496 | nmdc:mga07m45_85631_c1 | nmdc:mga07m45_85631_c1_972_1712 | 241 |
| 327 | 3300053092 | Ga0500583_0088168 | Ga0500583_0088168_634_1404 | 241 |
| 328 | 3300053093 | Ga0500651_0003537 | Ga0500651_0003537_2141_2881 | 241 |
| 329 | 3300053117 | Ga0500593_001079 | Ga0500593_001079_3662_4399 | 241 |
| 330 | 3300053131 | Ga0500652_000757 | Ga0500652_000757_7179_7919 | 241 |
| 331 | 3300053134 | Ga0500658_0180596 | Ga0500658_0180596_109_873 | 241 |
| 332 | 3300053139 | Ga0500568_0015423 | Ga0500568_0015423_2507_3247 | 241 |
| 333 | 3300053154 | Ga0500619_000137 | Ga0500619_000137_11284_12021 | 241 |
| 334 | 3300053156 | Ga0500622_0001329 | Ga0500622_0001329_12334_13074 | 241 |
| 335 | iso_pu_bacteria | 2547132374 | 2548498588 | 241 |
| 336 | iso_pu_bacteria | 2643221570 | 2643865409 | 241 |
| 337 | iso_pu_bacteria | 2643221596 | 2643990613 | 241 |
| 338 | iso_pu_bacteria | 2643221652 | 2644296116 | 241 |
| 339 | iso_pu_bacteria | 2643221717 | 2644649323 | 241 |
| 340 | iso_pu_bacteria | 2894023352 | 2894025684 | 241 |
| 341 | iso_pu_bacteria | 2939631187 | 2939636096 | 241 |
| 342 | iso_pu_bacteria | 2990710928 | 2990711996 | 241 |
| 343 | 3300002705 | JGI25156J39149_1000076 | JGI25156J39149_10000768 | 242 |
| 344 | 3300002705 | JGI25156J39149_1020167 | JGI25156J39149_10201672 | 242 |
| 345 | 3300002738 | JGI25154J39366_1003428 | JGI25154J39366_10034283 | 242 |
| 346 | 3300002741 | JGI25157J39369_1000037 | JGI25157J39369_100003795 | 242 |
| 347 | 3300003316 | rootH1_10027198 | rootH1_100271984 | 242 |
| 348 | 3300003752 | Ga0055539_1000180 | Ga0055539_100018035 | 242 |
| 349 | 3300003752 | Ga0055539_1003887 | Ga0055539_10038872 | 242 |
| 350 | 3300003756 | Ga0055533_1000169 | Ga0055533_10001699 | 242 |
| 351 | 3300003759 | Ga0055525_1000526 | Ga0055525_100052611 | 242 |
| 352 | 3300005327 | Ga0070658_10228945 | Ga0070658_102289452 | 242 |
| 353 | 3300005328 | Ga0070676_10014095 | Ga0070676_100140952 | 242 |
| 354 | 3300005330 | Ga0070690_100096685 | Ga0070690_1000966852 | 242 |
| 355 | 3300005331 | Ga0070670_100137157 | Ga0070670_1001371573 | 242 |
| 356 | 3300005334 | Ga0068869_100009616 | Ga0068869_1000096167 | 242 |
| 357 | 3300005338 | Ga0068868_100003572 | Ga0068868_10000357211 | 242 |
| 358 | 3300005338 | Ga0068868_100127576 | Ga0068868_1001275762 | 242 |
| 359 | 3300005354 | Ga0070675_100028517 | Ga0070675_1000285174 | 242 |
| 360 | 3300005364 | Ga0070673_100001255 | Ga0070673_1000012558 | 242 |
| 361 | 3300005364 | Ga0070673_100035122 | Ga0070673_1000351225 | 242 |
| 362 | 3300005364 | Ga0070673_100483671 | Ga0070673_1004836712 | 242 |
| 363 | 3300005367 | Ga0070667_100141133 | Ga0070667_1001411332 | 242 |
| 364 | 3300005367 | Ga0070667_100272803 | Ga0070667_1002728032 | 242 |
| 365 | 3300005459 | Ga0068867_100035855 | Ga0068867_1000358552 | 242 |
| 366 | 3300005535 | Ga0070684_100070877 | Ga0070684_1000708772 | 242 |
| 367 | 3300005539 | Ga0068853_100071386 | Ga0068853_1000713862 | 242 |
| 368 | 3300005543 | Ga0070672_100009784 | Ga0070672_1000097846 | 242 |
| 369 | 3300005548 | Ga0070665_100011217 | Ga0070665_10001121711 | 242 |
| 370 | 3300005563 | Ga0068855_100002721 | Ga0068855_1000027219 | 242 |
| 371 | 3300005563 | Ga0068855_100584798 | Ga0068855_1005847982 | 242 |
| 372 | 3300005577 | Ga0068857_100001142 | Ga0068857_1000011428 | 242 |
| 373 | 3300005577 | Ga0068857_100056777 | Ga0068857_1000567775 | 242 |
| 374 | 3300005578 | Ga0068854_100002016 | Ga0068854_1000020162 | 242 |
| 375 | 3300005614 | Ga0068856_100005635 | Ga0068856_1000056353 | 242 |
| 376 | 3300005618 | Ga0068864_100006013 | Ga0068864_1000060138 | 242 |
| 377 | 3300005719 | Ga0068861_100038355 | Ga0068861_1000383553 | 242 |
| 378 | 3300005841 | Ga0068863_100010184 | Ga0068863_1000101845 | 242 |
| 379 | 3300005842 | Ga0068858_100441145 | Ga0068858_1004411452 | 242 |
| 380 | 3300006177 | Ga0075362_10066929 | Ga0075362_100669292 | 242 |
| 381 | 3300006358 | Ga0068871_100180653 | Ga0068871_1001806532 | 242 |
| 382 | 3300009093 | Ga0105240_10040427 | Ga0105240_100404274 | 242 |
| 383 | 3300009093 | Ga0105240_10063922 | Ga0105240_100639223 | 242 |
| 384 | 3300009174 | Ga0105241_10966884 | Ga0105241_109668841 | 242 |
| 385 | 3300010375 | Ga0105239_10010428 | Ga0105239_100104284 | 242 |
| 386 | 3300013105 | Ga0157369_10108715 | Ga0157369_101087153 | 242 |
| 387 | 3300013296 | Ga0157374_10219015 | Ga0157374_102190153 | 242 |
| 388 | 3300013297 | Ga0157378_10066654 | Ga0157378_100666543 | 242 |
| 389 | 3300014968 | Ga0157379_10258325 | Ga0157379_102583252 | 242 |
| 390 | 3300014969 | Ga0157376_10077188 | Ga0157376_100771882 | 242 |
| 391 | 3300025226 | Ga0209674_100165 | Ga0209674_10016526 | 242 |
| 392 | 3300025230 | Ga0209563_100137 | Ga0209563_10013726 | 242 |
| 393 | 3300025231 | Ga0207427_101146 | Ga0207427_1011465 | 242 |
| 394 | 3300025242 | Ga0209258_100973 | Ga0209258_1009734 | 242 |
| 395 | 3300025246 | Ga0209646_1000062 | Ga0209646_1000062192 | 242 |
| 396 | 3300025250 | Ga0209026_1000026 | Ga0209026_100002620 | 242 |
| 397 | 3300025253 | Ga0209677_100124 | Ga0209677_10012460 | 242 |
| 398 | 3300025253 | Ga0209677_100191 | Ga0209677_10019139 | 242 |
| 399 | 3300025253 | Ga0209677_101539 | Ga0209677_1015393 | 242 |
| 400 | 3300025256 | Ga0209759_1000050 | Ga0209759_1000050161 | 242 |
| 401 | 3300025256 | Ga0209759_1007632 | Ga0209759_10076322 | 242 |
| 402 | 3300025256 | Ga0209759_1008489 | Ga0209759_10084892 | 242 |
| 403 | 3300025893 | Ga0207682_10076193 | Ga0207682_100761932 | 242 |
| 404 | 3300025907 | Ga0207645_10002689 | Ga0207645_1000268911 | 242 |
| 405 | 3300025911 | Ga0207654_10022895 | Ga0207654_100228953 | 242 |
| 406 | 3300025913 | Ga0207695_10018539 | Ga0207695_100185394 | 242 |
| 407 | 3300025913 | Ga0207695_10046644 | Ga0207695_100466442 | 242 |
| 408 | 3300025925 | Ga0207650_10098288 | Ga0207650_100982884 | 242 |
| 409 | 3300025926 | Ga0207659_10015029 | Ga0207659_100150294 | 242 |
| 410 | 3300025927 | Ga0207687_10072680 | Ga0207687_100726802 | 242 |
| 411 | 3300025935 | Ga0207709_10174758 | Ga0207709_101747582 | 242 |
| 412 | 3300025940 | Ga0207691_10100719 | Ga0207691_101007194 | 242 |
| 413 | 3300025942 | Ga0207689_10031852 | Ga0207689_100318522 | 242 |
| 414 | 3300025942 | Ga0207689_10128307 | Ga0207689_101283072 | 242 |
| 415 | 3300025949 | Ga0207667_10001993 | Ga0207667_100019937 | 242 |
| 416 | 3300025960 | Ga0207651_10000893 | Ga0207651_100008934 | 242 |
| 417 | 3300025960 | Ga0207651_10201182 | Ga0207651_102011822 | 242 |
| 418 | 3300026023 | Ga0207677_10004499 | Ga0207677_100044994 | 242 |
| 419 | 3300026023 | Ga0207677_10050885 | Ga0207677_100508852 | 242 |
| 420 | 3300026035 | Ga0207703_10118572 | Ga0207703_101185721 | 242 |
| 421 | 3300026078 | Ga0207702_10000573 | Ga0207702_1000057320 | 242 |
| 422 | 3300026089 | Ga0207648_10017331 | Ga0207648_100173317 | 242 |
| 423 | 3300026116 | Ga0207674_10001842 | Ga0207674_1000184211 | 242 |
| 424 | 3300026116 | Ga0207674_10152841 | Ga0207674_101528412 | 242 |
| 425 | 3300026116 | Ga0207674_10261740 | Ga0207674_102617402 | 242 |
| 426 | 3300026118 | Ga0207675_100122801 | Ga0207675_1001228012 | 242 |
| 427 | 3300027665 | Ga0209983_1044212 | Ga0209983_10442122 | 242 |
| 428 | 3300028666 | Ga0265336_10000119 | Ga0265336_1000011941 | 242 |
| 429 | 3300028794 | Ga0307515_10004253 | Ga0307515_100042532 | 242 |
| 430 | 3300028794 | Ga0307515_10006880 | Ga0307515_100068808 | 242 |
| 431 | 3300028794 | Ga0307515_10013694 | Ga0307515_100136946 | 242 |
| 432 | 3300029957 | Ga0265324_10009959 | Ga0265324_100099593 | 242 |
| 433 | 3300030522 | Ga0307512_10024522 | Ga0307512_100245222 | 242 |
| 434 | 3300030522 | Ga0307512_10139156 | Ga0307512_101391562 | 242 |
| 435 | 3300031456 | Ga0307513_10177002 | Ga0307513_101770022 | 242 |
| 436 | 3300031507 | Ga0307509_10001286 | Ga0307509_100012867 | 242 |
| 437 | 3300031507 | Ga0307509_10013769 | Ga0307509_100137696 | 242 |
| 438 | 3300031507 | Ga0307509_10067207 | Ga0307509_100672072 | 242 |
| 439 | 3300031507 | Ga0307509_10076047 | Ga0307509_100760474 | 242 |
| 440 | 3300031548 | Ga0307408_100321109 | Ga0307408_1003211092 | 242 |
| 441 | 3300031616 | Ga0307508_10000159 | Ga0307508_1000015947 | 242 |
| 442 | 3300031649 | Ga0307514_10020555 | Ga0307514_100205552 | 242 |
| 443 | 3300031730 | Ga0307516_10003066 | Ga0307516_100030662 | 242 |
| 444 | 3300031730 | Ga0307516_10003335 | Ga0307516_1000333520 | 242 |
| 445 | 3300031730 | Ga0307516_10030498 | Ga0307516_100304983 | 242 |
| 446 | 3300031730 | Ga0307516_10212700 | Ga0307516_102127002 | 242 |
| 447 | 3300032005 | Ga0307411_10165412 | Ga0307411_101654122 | 242 |
| 448 | 3300033179 | Ga0307507_10064389 | Ga0307507_100643892 | 242 |
| 449 | 3300033180 | Ga0307510_10002924 | Ga0307510_100029247 | 242 |
| 450 | 3300033180 | Ga0307510_10109577 | Ga0307510_101095772 | 242 |
| 451 | 3300034818 | Ga0373950_0018591 | Ga0373950_0018591_260_1024 | 242 |
| 452 | 3300035691 | Ga0373931_0055604 | Ga0373931_0055604_1277_2041 | 242 |
| 453 | 3300037466 | Ga0395898_0134229 | Ga0395898_0134229_1499_2254 | 242 |
| 454 | 3300038443 | Ga0395901_0001599 | Ga0395901_0001599_21198_21953 | 242 |
| 455 | 3300041453 | Ga0451797_0933919 | Ga0451797_0933919_285_1058 | 242 |
| 456 | 3300041460 | Ga0451802_0937156 | Ga0451802_0937156_113_853 | 242 |
| 457 | 3300041491 | Ga0451833_1270813 | Ga0451833_1270813_88_828 | 242 |
| 458 | 3300044656 | Ga0466969_0025097 | Ga0466969_0025097_1071_1826 | 242 |
| 459 | 3300044658 | Ga0466972_0090890 | Ga0466972_0090890_66_878 | 242 |
| 460 | 3300044683 | Ga0466965_0018420 | Ga0466965_0018420_2302_3057 | 242 |
| 461 | 3300044683 | Ga0466965_0024197 | Ga0466965_0024197_977_1723 | 242 |
| 462 | 3300044683 | Ga0466965_0045731 | Ga0466965_0045731_1060_1803 | 242 |
| 463 | 3300044693 | Ga0466961_0000655 | Ga0466961_0000655_16048_16803 | 242 |
| 464 | 3300044706 | Ga0466964_0055191 | Ga0466964_0055191_143_898 | 242 |
| 465 | 3300044719 | Ga0466971_0011261 | Ga0466971_0011261_1672_2427 | 242 |
| 466 | 3300044735 | Ga0466968_0010399 | Ga0466968_0010399_928_1686 | 242 |
| 467 | 3300044735 | Ga0466968_0013533 | Ga0466968_0013533_1283_2056 | 242 |
| 468 | 3300044842 | Ga0466957_0147629 | Ga0466957_0147629_84_839 | 242 |
| 469 | 3300044901 | Ga0466960_0049038 | Ga0466960_0049038_906_1652 | 242 |
| 470 | 3300044901 | Ga0466960_0063358 | Ga0466960_0063358_960_1715 | 242 |
| 471 | 3300045049 | Ga0466959_0044517 | Ga0466959_0044517_1364_2119 | 242 |
| 472 | 3300046454 | Ga0495592_0000205 | Ga0495592_0000205_43953_44735 | 242 |
| 473 | 3300046506 | Ga0495583_0000585 | Ga0495583_0000585_19854_20609 | 242 |
| 474 | 3300046507 | Ga0495606_0005296 | Ga0495606_0005296_9984_10739 | 242 |
| 475 | 3300046512 | Ga0495610_0019044 | Ga0495610_0019044_92_868 | 242 |
| 476 | 3300046512 | Ga0495610_0020856 | Ga0495610_0020856_1685_2425 | 242 |
| 477 | 3300046515 | Ga0495620_0024574 | Ga0495620_0024574_1672_2448 | 242 |
| 478 | 3300046515 | Ga0495620_0062267 | Ga0495620_0062267_359_1099 | 242 |
| 479 | 3300046519 | Ga0495632_0106960 | Ga0495632_0106960_295_1035 | 242 |
| 480 | 3300046616 | Ga0495668_0020891 | Ga0495668_0020891_2214_2969 | 242 |
| 481 | 3300046660 | Ga0495625_0002218 | Ga0495625_0002218_16090_16830 | 242 |
| 482 | 3300046660 | Ga0495625_0051677 | Ga0495625_0051677_1367_2122 | 242 |
| 483 | 3300046690 | Ga0495624_0137503 | Ga0495624_0137503_415_1179 | 242 |
| 484 | 3300046692 | Ga0495671_0073676 | Ga0495671_0073676_231_980 | 242 |
| 485 | 3300046694 | Ga0495649_0008123 | Ga0495649_0008123_2807_3562 | 242 |
| 486 | 3300046794 | Ga0495589_0068403 | Ga0495589_0068403_899_1654 | 242 |
| 487 | 3300047321 | Ga0495676_0171497 | Ga0495676_0171497_513_1277 | 242 |
| 488 | 3300047472 | Ga0495686_0003630 | Ga0495686_0003630_130_906 | 242 |
| 489 | 3300047472 | Ga0495686_0007475 | Ga0495686_0007475_4920_5675 | 242 |
| 490 | 3300047472 | Ga0495686_0066710 | Ga0495686_0066710_631_1371 | 242 |
| 491 | 3300047673 | Ga0495593_0083841 | Ga0495593_0083841_369_1133 | 242 |
| 492 | 3300049760 | Ga0501263_002339 | Ga0501263_002339_301_1041 | 242 |
| 493 | 3300050493 | nmdc:mga0k408_171182_c1 | nmdc:mga0k408_171182_c1_124_879 | 242 |
| 494 | 3300050493 | nmdc:mga0k408_81161_c1 | nmdc:mga0k408_81161_c1_645_1385 | 242 |
| 495 | 3300053080 | Ga0500635_0000129 | Ga0500635_0000129_42645_43400 | 242 |
| 496 | 3300053086 | Ga0500578_0197124 | Ga0500578_0197124_322_1077 | 242 |
| 497 | 3300053093 | Ga0500651_0018573 | Ga0500651_0018573_2463_3239 | 242 |
| 498 | 3300053118 | Ga0500594_0001531 | Ga0500594_0001531_1485_2261 | 242 |
| 499 | 3300053134 | Ga0500658_0002796 | Ga0500658_0002796_3104_3844 | 242 |
| 500 | 3300053136 | Ga0500559_0000134 | Ga0500559_0000134_20901_21677 | 242 |
| 501 | 3300053156 | Ga0500622_0011384 | Ga0500622_0011384_636_1412 | 242 |
| 502 | 3300053177 | Ga0500636_0015073 | Ga0500636_0015073_339_1094 | 242 |
| 503 | 3300055283 | Ga0500661_006420 | Ga0500661_006420_1337_2092 | 242 |
| 504 | 3300059421 | Ga0590071_001197 | Ga0590071_001197_3342_4112 | 242 |
| 505 | iso_pu_bacteria | 2643221609 | 2644062605 | 242 |
| 506 | iso_pu_bacteria | 2643221611 | 2644076369 | 242 |
| 507 | iso_pu_bacteria | 2643221654 | 2644302003 | 242 |
| 508 | iso_pu_bacteria | 2643221683 | 2644468070 | 242 |
| 509 | iso_pu_bacteria | 2738543013 | 2739250732 | 242 |
| 510 | iso_pu_bacteria | 2842677519 | 2842678935 | 242 |
| 511 | iso_pu_bacteria | 2885192300 | 2885192387 | 242 |
| 512 | iso_pu_bacteria | 2919462493 | 2919467523 | 242 |
| 513 | iso_pu_bacteria | 2945945610 | 2945947628 | 242 |
| 514 | iso_pu_bacteria | 2954767861 | 2954772528 | 242 |
| 515 | 3300005327 | Ga0070658_10037209 | Ga0070658_100372092 | 243 |
| 516 | 3300005329 | Ga0070683_100007080 | Ga0070683_10000708012 | 243 |
| 517 | 3300005331 | Ga0070670_100042246 | Ga0070670_1000422464 | 243 |
| 518 | 3300005331 | Ga0070670_100146701 | Ga0070670_1001467011 | 243 |
| 519 | 3300005333 | Ga0070677_10011451 | Ga0070677_100114514 | 243 |
| 520 | 3300005334 | Ga0068869_100020870 | Ga0068869_1000208705 | 243 |
| 521 | 3300005335 | Ga0070666_10114086 | Ga0070666_101140861 | 243 |
| 522 | 3300005335 | Ga0070666_10335833 | Ga0070666_103358331 | 243 |
| 523 | 3300005336 | Ga0070680_100002051 | Ga0070680_1000020517 | 243 |
| 524 | 3300005338 | Ga0068868_100003096 | Ga0068868_1000030962 | 243 |
| 525 | 3300005339 | Ga0070660_100008509 | Ga0070660_1000085099 | 243 |
| 526 | 3300005339 | Ga0070660_100027599 | Ga0070660_1000275992 | 243 |
| 527 | 3300005340 | Ga0070689_100116230 | Ga0070689_1001162304 | 243 |
| 528 | 3300005343 | Ga0070687_100020311 | Ga0070687_1000203115 | 243 |
| 529 | 3300005344 | Ga0070661_100031099 | Ga0070661_1000310992 | 243 |
| 530 | 3300005344 | Ga0070661_100214500 | Ga0070661_1002145002 | 243 |
| 531 | 3300005347 | Ga0070668_100023518 | Ga0070668_1000235186 | 243 |
| 532 | 3300005353 | Ga0070669_100055294 | Ga0070669_1000552944 | 243 |
| 533 | 3300005354 | Ga0070675_100000941 | Ga0070675_10000094113 | 243 |
| 534 | 3300005354 | Ga0070675_100059896 | Ga0070675_1000598963 | 243 |
| 535 | 3300005355 | Ga0070671_100070434 | Ga0070671_1000704344 | 243 |
| 536 | 3300005356 | Ga0070674_100053542 | Ga0070674_1000535423 | 243 |
| 537 | 3300005364 | Ga0070673_100072816 | Ga0070673_1000728164 | 243 |
| 538 | 3300005366 | Ga0070659_100021253 | Ga0070659_1000212533 | 243 |
| 539 | 3300005367 | Ga0070667_100004949 | Ga0070667_10000494912 | 243 |
| 540 | 3300005367 | Ga0070667_100238931 | Ga0070667_1002389312 | 243 |
| 541 | 3300005441 | Ga0070700_100210155 | Ga0070700_1002101552 | 243 |
| 542 | 3300005455 | Ga0070663_100023744 | Ga0070663_1000237446 | 243 |
| 543 | 3300005456 | Ga0070678_100156816 | Ga0070678_1001568163 | 243 |
| 544 | 3300005457 | Ga0070662_100000858 | Ga0070662_10000085811 | 243 |
| 545 | 3300005457 | Ga0070662_100013398 | Ga0070662_1000133984 | 243 |
| 546 | 3300005457 | Ga0070662_100089516 | Ga0070662_1000895162 | 243 |
| 547 | 3300005459 | Ga0068867_100000070 | Ga0068867_1000000705 | 243 |
| 548 | 3300005459 | Ga0068867_100075085 | Ga0068867_1000750852 | 243 |
| 549 | 3300005459 | Ga0068867_100079661 | Ga0068867_1000796612 | 243 |
| 550 | 3300005530 | Ga0070679_100006631 | Ga0070679_10000663114 | 243 |
| 551 | 3300005535 | Ga0070684_100031525 | Ga0070684_1000315253 | 243 |
| 552 | 3300005539 | Ga0068853_100014437 | Ga0068853_1000144379 | 243 |
| 553 | 3300005539 | Ga0068853_100127746 | Ga0068853_1001277462 | 243 |
| 554 | 3300005539 | Ga0068853_100641456 | Ga0068853_1006414562 | 243 |
| 555 | 3300005543 | Ga0070672_100004411 | Ga0070672_10000441111 | 243 |
| 556 | 3300005543 | Ga0070672_100006413 | Ga0070672_1000064137 | 243 |
| 557 | 3300005543 | Ga0070672_100232637 | Ga0070672_1002326372 | 243 |
| 558 | 3300005544 | Ga0070686_100338066 | Ga0070686_1003380661 | 243 |
| 559 | 3300005548 | Ga0070665_100350953 | Ga0070665_1003509532 | 243 |
| 560 | 3300005564 | Ga0070664_100005782 | Ga0070664_1000057825 | 243 |
| 561 | 3300005577 | Ga0068857_100049769 | Ga0068857_1000497695 | 243 |
| 562 | 3300005577 | Ga0068857_100076126 | Ga0068857_1000761262 | 243 |
| 563 | 3300005577 | Ga0068857_100084990 | Ga0068857_1000849902 | 243 |
| 564 | 3300005578 | Ga0068854_100311665 | Ga0068854_1003116652 | 243 |
| 565 | 3300005614 | Ga0068856_100071680 | Ga0068856_1000716805 | 243 |
| 566 | 3300005616 | Ga0068852_100002789 | Ga0068852_10000278913 | 243 |
| 567 | 3300005616 | Ga0068852_100171428 | Ga0068852_1001714282 | 243 |
| 568 | 3300005616 | Ga0068852_100555415 | Ga0068852_1005554152 | 243 |
| 569 | 3300005617 | Ga0068859_100041965 | Ga0068859_1000419655 | 243 |
| 570 | 3300005617 | Ga0068859_100055554 | Ga0068859_1000555542 | 243 |
| 571 | 3300005618 | Ga0068864_100122122 | Ga0068864_1001221223 | 243 |
| 572 | 3300005618 | Ga0068864_100160401 | Ga0068864_1001604012 | 243 |
| 573 | 3300005718 | Ga0068866_10018175 | Ga0068866_100181753 | 243 |
| 574 | 3300005719 | Ga0068861_100003493 | Ga0068861_1000034933 | 243 |
| 575 | 3300005719 | Ga0068861_100197171 | Ga0068861_1001971713 | 243 |
| 576 | 3300005841 | Ga0068863_100052311 | Ga0068863_1000523114 | 243 |
| 577 | 3300005841 | Ga0068863_100202960 | Ga0068863_1002029602 | 243 |
| 578 | 3300005842 | Ga0068858_100003457 | Ga0068858_10000345711 | 243 |
| 579 | 3300005842 | Ga0068858_100007880 | Ga0068858_1000078804 | 243 |
| 580 | 3300005843 | Ga0068860_100010521 | Ga0068860_10001052111 | 243 |
| 581 | 3300005843 | Ga0068860_100027642 | Ga0068860_1000276423 | 243 |
| 582 | 3300005843 | Ga0068860_100147158 | Ga0068860_1001471582 | 243 |
| 583 | 3300005844 | Ga0068862_100046531 | Ga0068862_1000465314 | 243 |
| 584 | 3300006038 | Ga0075365_10344941 | Ga0075365_103449412 | 243 |
| 585 | 3300006195 | Ga0075366_10105250 | Ga0075366_101052502 | 243 |
| 586 | 3300006237 | Ga0097621_100018737 | Ga0097621_1000187376 | 243 |
| 587 | 3300006358 | Ga0068871_100107790 | Ga0068871_1001077902 | 243 |
| 588 | 3300006358 | Ga0068871_100297967 | Ga0068871_1002979672 | 243 |
| 589 | 3300006881 | Ga0068865_100021548 | Ga0068865_1000215484 | 243 |
| 590 | 3300006931 | Ga0097620_100041965 | Ga0097620_1000419655 | 243 |
| 591 | 3300006931 | Ga0097620_100055553 | Ga0097620_1000555532 | 243 |
| 592 | 3300009098 | Ga0105245_10095403 | Ga0105245_100954033 | 243 |
| 593 | 3300009148 | Ga0105243_10001208 | Ga0105243_100012083 | 243 |
| 594 | 3300009148 | Ga0105243_10094187 | Ga0105243_100941874 | 243 |
| 595 | 3300009148 | Ga0105243_10129738 | Ga0105243_101297382 | 243 |
| 596 | 3300009177 | Ga0105248_10003839 | Ga0105248_1000383918 | 243 |
| 597 | 3300009545 | Ga0105237_10162787 | Ga0105237_101627874 | 243 |
| 598 | 3300009553 | Ga0105249_10071057 | Ga0105249_100710573 | 243 |
| 599 | 3300010375 | Ga0105239_10075364 | Ga0105239_100753646 | 243 |
| 600 | 3300013100 | Ga0157373_10016739 | Ga0157373_100167394 | 243 |
| 601 | 3300013104 | Ga0157370_10383422 | Ga0157370_103834222 | 243 |
| 602 | 3300013105 | Ga0157369_10008315 | Ga0157369_100083159 | 243 |
| 603 | 3300013296 | Ga0157374_10236678 | Ga0157374_102366782 | 243 |
| 604 | 3300013297 | Ga0157378_10196196 | Ga0157378_101961963 | 243 |
| 605 | 3300013306 | Ga0163162_10081416 | Ga0163162_100814164 | 243 |
| 606 | 3300013308 | Ga0157375_10005240 | Ga0157375_1000524016 | 243 |
| 607 | 3300013308 | Ga0157375_10040743 | Ga0157375_100407434 | 243 |
| 608 | 3300013308 | Ga0157375_10178174 | Ga0157375_101781742 | 243 |
| 609 | 3300013308 | Ga0157375_10453307 | Ga0157375_104533072 | 243 |
| 610 | 3300014325 | Ga0163163_10135864 | Ga0163163_101358644 | 243 |
| 611 | 3300014326 | Ga0157380_10039716 | Ga0157380_100397163 | 243 |
| 612 | 3300014326 | Ga0157380_10126388 | Ga0157380_101263882 | 243 |
| 613 | 3300014326 | Ga0157380_10144000 | Ga0157380_101440003 | 243 |
| 614 | 3300014326 | Ga0157380_10547814 | Ga0157380_105478141 | 243 |
| 615 | 3300014745 | Ga0157377_10000016 | Ga0157377_1000001678 | 243 |
| 616 | 3300014745 | Ga0157377_10000848 | Ga0157377_1000084813 | 243 |
| 617 | 3300014968 | Ga0157379_10004851 | Ga0157379_100048515 | 243 |
| 618 | 3300014968 | Ga0157379_10020286 | Ga0157379_100202867 | 243 |
| 619 | 3300014968 | Ga0157379_10072230 | Ga0157379_100722302 | 243 |
| 620 | 3300014968 | Ga0157379_10172089 | Ga0157379_101720893 | 243 |
| 621 | 3300014969 | Ga0157376_10007038 | Ga0157376_100070384 | 243 |
| 622 | 3300017792 | Ga0163161_10099189 | Ga0163161_100991893 | 243 |
| 623 | 3300025893 | Ga0207682_10003745 | Ga0207682_100037456 | 243 |
| 624 | 3300025899 | Ga0207642_10017237 | Ga0207642_100172374 | 243 |
| 625 | 3300025901 | Ga0207688_10027810 | Ga0207688_100278104 | 243 |
| 626 | 3300025907 | Ga0207645_10037411 | Ga0207645_100374113 | 243 |
| 627 | 3300025912 | Ga0207707_10218777 | Ga0207707_102187772 | 243 |
| 628 | 3300025917 | Ga0207660_10006938 | Ga0207660_100069385 | 243 |
| 629 | 3300025919 | Ga0207657_10011313 | Ga0207657_100113135 | 243 |
| 630 | 3300025920 | Ga0207649_10210734 | Ga0207649_102107342 | 243 |
| 631 | 3300025921 | Ga0207652_10009264 | Ga0207652_100092649 | 243 |
| 632 | 3300025923 | Ga0207681_10015010 | Ga0207681_100150102 | 243 |
| 633 | 3300025923 | Ga0207681_10020476 | Ga0207681_100204763 | 243 |
| 634 | 3300025923 | Ga0207681_10090407 | Ga0207681_100904072 | 243 |
| 635 | 3300025925 | Ga0207650_10006156 | Ga0207650_100061569 | 243 |
| 636 | 3300025926 | Ga0207659_10127859 | Ga0207659_101278593 | 243 |
| 637 | 3300025927 | Ga0207687_10064217 | Ga0207687_100642173 | 243 |
| 638 | 3300025931 | Ga0207644_10000924 | Ga0207644_1000092411 | 243 |
| 639 | 3300025933 | Ga0207706_10000272 | Ga0207706_1000027222 | 243 |
| 640 | 3300025933 | Ga0207706_10005864 | Ga0207706_1000586412 | 243 |
| 641 | 3300025934 | Ga0207686_10037737 | Ga0207686_100377374 | 243 |
| 642 | 3300025934 | Ga0207686_10048347 | Ga0207686_100483472 | 243 |
| 643 | 3300025935 | Ga0207709_10002246 | Ga0207709_100022463 | 243 |
| 644 | 3300025935 | Ga0207709_10019731 | Ga0207709_100197316 | 243 |
| 645 | 3300025935 | Ga0207709_10162297 | Ga0207709_101622972 | 243 |
| 646 | 3300025938 | Ga0207704_10066684 | Ga0207704_100666843 | 243 |
| 647 | 3300025938 | Ga0207704_10111664 | Ga0207704_101116642 | 243 |
| 648 | 3300025938 | Ga0207704_10149741 | Ga0207704_101497412 | 243 |
| 649 | 3300025939 | Ga0207665_10153165 | Ga0207665_101531652 | 243 |
| 650 | 3300025940 | Ga0207691_10000715 | Ga0207691_1000071536 | 243 |
| 651 | 3300025940 | Ga0207691_10052011 | Ga0207691_100520113 | 243 |
| 652 | 3300025941 | Ga0207711_10004324 | Ga0207711_100043244 | 243 |
| 653 | 3300025941 | Ga0207711_10006498 | Ga0207711_1000649814 | 243 |
| 654 | 3300025942 | Ga0207689_10000832 | Ga0207689_1000083222 | 243 |
| 655 | 3300025942 | Ga0207689_10003940 | Ga0207689_100039404 | 243 |
| 656 | 3300025944 | Ga0207661_10007953 | Ga0207661_1000795310 | 243 |
| 657 | 3300025945 | Ga0207679_10009078 | Ga0207679_1000907810 | 243 |
| 658 | 3300025945 | Ga0207679_10152036 | Ga0207679_101520362 | 243 |
| 659 | 3300025961 | Ga0207712_10108195 | Ga0207712_101081952 | 243 |
| 660 | 3300025972 | Ga0207668_10158126 | Ga0207668_101581263 | 243 |
| 661 | 3300025981 | Ga0207640_10285210 | Ga0207640_102852102 | 243 |
| 662 | 3300025986 | Ga0207658_10024952 | Ga0207658_100249523 | 243 |
| 663 | 3300025986 | Ga0207658_10031648 | Ga0207658_100316483 | 243 |
| 664 | 3300025986 | Ga0207658_10417520 | Ga0207658_104175202 | 243 |
| 665 | 3300026035 | Ga0207703_10009878 | Ga0207703_100098786 | 243 |
| 666 | 3300026035 | Ga0207703_10066736 | Ga0207703_100667364 | 243 |
| 667 | 3300026041 | Ga0207639_10206766 | Ga0207639_102067662 | 243 |
| 668 | 3300026041 | Ga0207639_10420623 | Ga0207639_104206232 | 243 |
| 669 | 3300026088 | Ga0207641_10064210 | Ga0207641_100642102 | 243 |
| 670 | 3300026088 | Ga0207641_10081066 | Ga0207641_100810662 | 243 |
| 671 | 3300026089 | Ga0207648_10000412 | Ga0207648_100004125 | 243 |
| 672 | 3300026095 | Ga0207676_10071218 | Ga0207676_100712182 | 243 |
| 673 | 3300026095 | Ga0207676_10177819 | Ga0207676_101778192 | 243 |
| 674 | 3300026116 | Ga0207674_10063585 | Ga0207674_100635856 | 243 |
| 675 | 3300026118 | Ga0207675_100000729 | Ga0207675_10000072918 | 243 |
| 676 | 3300026118 | Ga0207675_100036720 | Ga0207675_1000367203 | 243 |
| 677 | 3300026121 | Ga0207683_10299912 | Ga0207683_102999121 | 243 |
| 678 | 3300026142 | Ga0207698_10059115 | Ga0207698_100591152 | 243 |
| 679 | 3300026142 | Ga0207698_10256678 | Ga0207698_102566783 | 243 |
| 680 | 3300028379 | Ga0268266_10181438 | Ga0268266_101814383 | 243 |
| 681 | 3300028380 | Ga0268265_10024728 | Ga0268265_100247284 | 243 |
| 682 | 3300028380 | Ga0268265_10152579 | Ga0268265_101525793 | 243 |
| 683 | 3300028381 | Ga0268264_10006835 | Ga0268264_100068354 | 243 |
| 684 | 3300028381 | Ga0268264_10114353 | Ga0268264_101143532 | 243 |
| 685 | 3300028381 | Ga0268264_10218763 | Ga0268264_102187631 | 243 |
| 686 | 3300028794 | Ga0307515_10000484 | Ga0307515_1000048448 | 243 |
| 687 | 3300028794 | Ga0307515_10103254 | Ga0307515_101032544 | 243 |
| 688 | 3300031456 | Ga0307513_10055587 | Ga0307513_100555874 | 243 |
| 689 | 3300031507 | Ga0307509_10047789 | Ga0307509_100477896 | 243 |
| 690 | 3300031616 | Ga0307508_10030208 | Ga0307508_100302085 | 243 |
| 691 | 3300031649 | Ga0307514_10002245 | Ga0307514_100022454 | 243 |
| 692 | 3300031711 | Ga0265314_10148724 | Ga0265314_101487242 | 243 |
| 693 | 3300031731 | Ga0307405_10098181 | Ga0307405_100981813 | 243 |
| 694 | 3300031995 | Ga0307409_100001393 | Ga0307409_1000013935 | 243 |
| 695 | 3300032002 | Ga0307416_100388184 | Ga0307416_1003881842 | 243 |
| 696 | 3300032005 | Ga0307411_10002164 | Ga0307411_1000216410 | 243 |
| 697 | 3300034957 | Ga0373938_0041786 | Ga0373938_0041786_73_819 | 243 |
| 698 | 3300035114 | Ga0373939_0044851 | Ga0373939_0044851_81_827 | 243 |
| 699 | 3300035170 | Ga0373943_0071869 | Ga0373943_0071869_683_1429 | 243 |
| 700 | 3300035170 | Ga0373943_0204047 | Ga0373943_0204047_62_808 | 243 |
| 701 | 3300035242 | Ga0373962_0010649 | Ga0373962_0010649_110_856 | 243 |
| 702 | 3300035691 | Ga0373931_0001894 | Ga0373931_0001894_5846_6592 | 243 |
| 703 | 3300035724 | Ga0373933_0110964 | Ga0373933_0110964_881_1627 | 243 |
| 704 | 3300039437 | Ga0436365_1256270 | Ga0436365_1256270_2490_3236 | 243 |
| 705 | 3300041997 | Ga0439431_0023603 | Ga0439431_0023603_490_1242 | 243 |
| 706 | 3300042156 | Ga0439446_0072822 | Ga0439446_0072822_109_861 | 243 |
| 707 | 3300044658 | Ga0466972_0000564 | Ga0466972_0000564_14258_15010 | 243 |
| 708 | 3300045051 | Ga0451576_0019880 | Ga0451576_0019880_5603_6349 | 243 |
| 709 | 3300045051 | Ga0451576_0078482 | Ga0451576_0078482_612_1355 | 243 |
| 710 | 3300046455 | Ga0495603_0143090 | Ga0495603_0143090_531_1277 | 243 |
| 711 | 3300046459 | Ga0495629_0425583 | Ga0495629_0425583_64_810 | 243 |
| 712 | 3300046681 | Ga0495647_0094437 | Ga0495647_0094437_50_796 | 243 |
| 713 | 3300047471 | Ga0495684_0073961 | Ga0495684_0073961_584_1330 | 243 |
| 714 | 3300048090 | Ga0495615_0041037 | Ga0495615_0041037_98_847 | 243 |
| 715 | 3300048905 | Ga0496102_0420090 | Ga0496102_0420090_166_912 | 243 |
| 716 | 3300048906 | Ga0496103_0236788 | Ga0496103_0236788_322_1068 | 243 |
| 717 | 3300048908 | Ga0496105_0397226 | Ga0496105_0397226_165_911 | 243 |
| 718 | 3300048909 | Ga0496106_0022491 | Ga0496106_0022491_931_1677 | 243 |
| 719 | 3300048910 | Ga0496107_0307227 | Ga0496107_0307227_47_793 | 243 |
| 720 | 3300048911 | Ga0496108_0252414 | Ga0496108_0252414_141_887 | 243 |
| 721 | 3300048912 | Ga0496109_0369296 | Ga0496109_0369296_270_1016 | 243 |
| 722 | 3300048913 | Ga0496110_0023240 | Ga0496110_0023240_4138_4884 | 243 |
| 723 | 3300048914 | Ga0496111_0053968 | Ga0496111_0053968_771_1517 | 243 |
| 724 | 3300048917 | Ga0496114_0254296 | Ga0496114_0254296_98_844 | 243 |
| 725 | 3300048918 | Ga0496115_0005962 | Ga0496115_0005962_7926_8672 | 243 |
| 726 | 3300049823 | Ga0501044_0071742 | Ga0501044_0071742_2660_3403 | 243 |
| 727 | 3300050493 | nmdc:mga0k408_37931_c1 | nmdc:mga0k408_37931_c1_643_1440 | 243 |
| 728 | 3300050493 | nmdc:mga0k408_50451_c1 | nmdc:mga0k408_50451_c1_1144_1893 | 243 |
| 729 | 3300050511 | nmdc:mga08y16_552283_c1 | nmdc:mga08y16_552283_c1_115_861 | 243 |
| 730 | 3300053086 | Ga0500578_0001034 | Ga0500578_0001034_8922_9668 | 243 |
| 731 | 3300053117 | Ga0500593_000570 | Ga0500593_000570_10689_11474 | 243 |
| 732 | 3300002705 | JGI25156J39149_1000023 | JGI25156J39149_100002350 | 244 |
| 733 | 3300002738 | JGI25154J39366_1000036 | JGI25154J39366_1000036108 | 244 |
| 734 | 3300002741 | JGI25157J39369_1000023 | JGI25157J39369_100002350 | 244 |
| 735 | 3300002774 | JGI25150J39212_1000786 | JGI25150J39212_10007869 | 244 |
| 736 | 3300002774 | JGI25150J39212_1004277 | JGI25150J39212_10042773 | 244 |
| 737 | 3300002987 | JGI25159J45721_1001003 | JGI25159J45721_10010039 | 244 |
| 738 | 3300002987 | JGI25159J45721_1001012 | JGI25159J45721_10010129 | 244 |
| 739 | 3300003187 | JGI25151J46595_10007826 | JGI25151J46595_100078263 | 244 |
| 740 | 3300003187 | JGI25151J46595_10011776 | JGI25151J46595_100117763 | 244 |
| 741 | 3300003354 | JGI25160J50197_1000213 | JGI25160J50197_100021335 | 244 |
| 742 | 3300003374 | JGI25161J50226_1000015 | JGI25161J50226_1000015108 | 244 |
| 743 | 3300003771 | Ga0055526_1003300 | Ga0055526_10033008 | 244 |
| 744 | 3300003771 | Ga0055526_1007561 | Ga0055526_10075612 | 244 |
| 745 | 3300003773 | Ga0055537_1000034 | Ga0055537_10000347 | 244 |
| 746 | 3300003773 | Ga0055537_1000706 | Ga0055537_100070611 | 244 |
| 747 | 3300003775 | Ga0055524_1000016 | Ga0055524_1000016137 | 244 |
| 748 | 3300003784 | Ga0055534_1002208 | Ga0055534_10022081 | 244 |
| 749 | 3300003790 | Ga0055528_1002347 | Ga0055528_10023474 | 244 |
| 750 | 3300003791 | Ga0055530_10000243 | Ga0055530_1000024327 | 244 |
| 751 | 3300003792 | Ga0055540_1000031 | Ga0055540_1000031146 | 244 |
| 752 | 3300004625 | Ga0055543_1000608 | Ga0055543_100060814 | 244 |
| 753 | 3300005262 | Ga0065165_1021019 | Ga0065165_10210192 | 244 |
| 754 | 3300005295 | Ga0065707_10085220 | Ga0065707_100852202 | 244 |
| 755 | 3300005330 | Ga0070690_100000674 | Ga0070690_1000006747 | 244 |
| 756 | 3300005331 | Ga0070670_100001588 | Ga0070670_10000158811 | 244 |
| 757 | 3300005331 | Ga0070670_100007193 | Ga0070670_1000071935 | 244 |
| 758 | 3300005333 | Ga0070677_10000616 | Ga0070677_100006162 | 244 |
| 759 | 3300005334 | Ga0068869_100079183 | Ga0068869_1000791832 | 244 |
| 760 | 3300005335 | Ga0070666_10006295 | Ga0070666_100062955 | 244 |
| 761 | 3300005338 | Ga0068868_100001668 | Ga0068868_10000166815 | 244 |
| 762 | 3300005345 | Ga0070692_10208835 | Ga0070692_102088352 | 244 |
| 763 | 3300005347 | Ga0070668_100065066 | Ga0070668_1000650663 | 244 |
| 764 | 3300005353 | Ga0070669_100099413 | Ga0070669_1000994132 | 244 |
| 765 | 3300005353 | Ga0070669_100103198 | Ga0070669_1001031982 | 244 |
| 766 | 3300005354 | Ga0070675_100002761 | Ga0070675_1000027616 | 244 |
| 767 | 3300005354 | Ga0070675_100012995 | Ga0070675_1000129956 | 244 |
| 768 | 3300005354 | Ga0070675_100025238 | Ga0070675_1000252386 | 244 |
| 769 | 3300005355 | Ga0070671_100005745 | Ga0070671_1000057456 | 244 |
| 770 | 3300005355 | Ga0070671_100054749 | Ga0070671_1000547492 | 244 |
| 771 | 3300005364 | Ga0070673_100003101 | Ga0070673_1000031012 | 244 |
| 772 | 3300005364 | Ga0070673_100004666 | Ga0070673_1000046666 | 244 |
| 773 | 3300005365 | Ga0070688_100011717 | Ga0070688_1000117176 | 244 |
| 774 | 3300005365 | Ga0070688_100238868 | Ga0070688_1002388682 | 244 |
| 775 | 3300005367 | Ga0070667_100083474 | Ga0070667_1000834742 | 244 |
| 776 | 3300005367 | Ga0070667_100171475 | Ga0070667_1001714753 | 244 |
| 777 | 3300005367 | Ga0070667_100192436 | Ga0070667_1001924362 | 244 |
| 778 | 3300005441 | Ga0070700_100015415 | Ga0070700_1000154154 | 244 |
| 779 | 3300005455 | Ga0070663_100371403 | Ga0070663_1003714032 | 244 |
| 780 | 3300005456 | Ga0070678_100049891 | Ga0070678_1000498915 | 244 |
| 781 | 3300005456 | Ga0070678_100083026 | Ga0070678_1000830262 | 244 |
| 782 | 3300005456 | Ga0070678_100110138 | Ga0070678_1001101382 | 244 |
| 783 | 3300005459 | Ga0068867_100000587 | Ga0068867_10000058724 | 244 |
| 784 | 3300005466 | Ga0070685_10088868 | Ga0070685_100888683 | 244 |
| 785 | 3300005467 | Ga0070706_100012812 | Ga0070706_1000128128 | 244 |
| 786 | 3300005468 | Ga0070707_100034845 | Ga0070707_1000348454 | 244 |
| 787 | 3300005539 | Ga0068853_100484281 | Ga0068853_1004842811 | 244 |
| 788 | 3300005539 | Ga0068853_100523590 | Ga0068853_1005235901 | 244 |
| 789 | 3300005543 | Ga0070672_100000249 | Ga0070672_10000024915 | 244 |
| 790 | 3300005543 | Ga0070672_100031950 | Ga0070672_1000319503 | 244 |
| 791 | 3300005543 | Ga0070672_100073981 | Ga0070672_1000739813 | 244 |
| 792 | 3300005543 | Ga0070672_100081573 | Ga0070672_1000815733 | 244 |
| 793 | 3300005543 | Ga0070672_100089747 | Ga0070672_1000897472 | 244 |
| 794 | 3300005548 | Ga0070665_100128052 | Ga0070665_1001280522 | 244 |
| 795 | 3300005564 | Ga0070664_100227897 | Ga0070664_1002278972 | 244 |
| 796 | 3300005614 | Ga0068856_100715511 | Ga0068856_1007155111 | 244 |
| 797 | 3300005615 | Ga0070702_100080844 | Ga0070702_1000808443 | 244 |
| 798 | 3300005617 | Ga0068859_100002993 | Ga0068859_10000299316 | 244 |
| 799 | 3300005617 | Ga0068859_100329974 | Ga0068859_1003299742 | 244 |
| 800 | 3300005618 | Ga0068864_100006058 | Ga0068864_10000605810 | 244 |
| 801 | 3300005618 | Ga0068864_100013588 | Ga0068864_1000135887 | 244 |
| 802 | 3300005719 | Ga0068861_100021625 | Ga0068861_1000216253 | 244 |
| 803 | 3300005834 | Ga0068851_10101715 | Ga0068851_101017151 | 244 |
| 804 | 3300005841 | Ga0068863_100001479 | Ga0068863_1000014798 | 244 |
| 805 | 3300005842 | Ga0068858_100001164 | Ga0068858_10000116410 | 244 |
| 806 | 3300005842 | Ga0068858_100239145 | Ga0068858_1002391452 | 244 |
| 807 | 3300005842 | Ga0068858_100347806 | Ga0068858_1003478062 | 244 |
| 808 | 3300005843 | Ga0068860_100001400 | Ga0068860_10000140010 | 244 |
| 809 | 3300005843 | Ga0068860_100310715 | Ga0068860_1003107152 | 244 |
| 810 | 3300005843 | Ga0068860_100494552 | Ga0068860_1004945522 | 244 |
| 811 | 3300005844 | Ga0068862_100005708 | Ga0068862_1000057083 | 244 |
| 812 | 3300006038 | Ga0075365_10004092 | Ga0075365_100040924 | 244 |
| 813 | 3300006038 | Ga0075365_10096068 | Ga0075365_100960682 | 244 |
| 814 | 3300006038 | Ga0075365_10247416 | Ga0075365_102474161 | 244 |
| 815 | 3300006042 | Ga0075368_10015034 | Ga0075368_100150342 | 244 |
| 816 | 3300006051 | Ga0075364_10012737 | Ga0075364_100127375 | 244 |
| 817 | 3300006177 | Ga0075362_10008418 | Ga0075362_100084183 | 244 |
| 818 | 3300006177 | Ga0075362_10208418 | Ga0075362_102084181 | 244 |
| 819 | 3300006178 | Ga0075367_10040153 | Ga0075367_100401533 | 244 |
| 820 | 3300006178 | Ga0075367_10056457 | Ga0075367_100564572 | 244 |
| 821 | 3300006195 | Ga0075366_10003640 | Ga0075366_100036407 | 244 |
| 822 | 3300006195 | Ga0075366_10170668 | Ga0075366_101706681 | 244 |
| 823 | 3300006195 | Ga0075366_10185898 | Ga0075366_101858981 | 244 |
| 824 | 3300006237 | Ga0097621_100014909 | Ga0097621_1000149096 | 244 |
| 825 | 3300006353 | Ga0075370_10009819 | Ga0075370_100098192 | 244 |
| 826 | 3300006353 | Ga0075370_10016620 | Ga0075370_100166204 | 244 |
| 827 | 3300006358 | Ga0068871_100011778 | Ga0068871_1000117787 | 244 |
| 828 | 3300006358 | Ga0068871_100256765 | Ga0068871_1002567652 | 244 |
| 829 | 3300006880 | Ga0075429_100100877 | Ga0075429_1001008772 | 244 |
| 830 | 3300006881 | Ga0068865_100182037 | Ga0068865_1001820371 | 244 |
| 831 | 3300006931 | Ga0097620_100002993 | Ga0097620_10000299316 | 244 |
| 832 | 3300006931 | Ga0097620_100329983 | Ga0097620_1003299832 | 244 |
| 833 | 3300006948 | Ga0099826_10166968 | Ga0099826_101669682 | 244 |
| 834 | 3300009177 | Ga0105248_10074973 | Ga0105248_100749733 | 244 |
| 835 | 3300009177 | Ga0105248_10436192 | Ga0105248_104361922 | 244 |
| 836 | 3300009553 | Ga0105249_10093002 | Ga0105249_100930022 | 244 |
| 837 | 3300013297 | Ga0157378_10025519 | Ga0157378_100255192 | 244 |
| 838 | 3300013306 | Ga0163162_10039558 | Ga0163162_100395584 | 244 |
| 839 | 3300013306 | Ga0163162_10202262 | Ga0163162_102022623 | 244 |
| 840 | 3300013308 | Ga0157375_10128748 | Ga0157375_101287483 | 244 |
| 841 | 3300014325 | Ga0163163_10004818 | Ga0163163_100048187 | 244 |
| 842 | 3300014326 | Ga0157380_10188839 | Ga0157380_101888392 | 244 |
| 843 | 3300014497 | Ga0182008_10000893 | Ga0182008_1000089315 | 244 |
| 844 | 3300014968 | Ga0157379_10021534 | Ga0157379_100215343 | 244 |
| 845 | 3300014968 | Ga0157379_10023314 | Ga0157379_100233142 | 244 |
| 846 | 3300014968 | Ga0157379_10043364 | Ga0157379_100433641 | 244 |
| 847 | 3300014969 | Ga0157376_10011702 | Ga0157376_100117025 | 244 |
| 848 | 3300014969 | Ga0157376_10085569 | Ga0157376_100855691 | 244 |
| 849 | 3300017792 | Ga0163161_10034770 | Ga0163161_100347702 | 244 |
| 850 | 3300017792 | Ga0163161_10113300 | Ga0163161_101133002 | 244 |
| 851 | 3300025206 | Ga0209435_100001 | Ga0209435_100001354 | 244 |
| 852 | 3300025245 | Ga0207425_1001492 | Ga0207425_10014923 | 244 |
| 853 | 3300025245 | Ga0207425_1004000 | Ga0207425_10040005 | 244 |
| 854 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001723 | 244 |
| 855 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003354 | 244 |
| 856 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001354 | 244 |
| 857 | 3300025256 | Ga0209759_1011545 | Ga0209759_10115452 | 244 |
| 858 | 3300025258 | Ga0209129_1004667 | Ga0209129_10046672 | 244 |
| 859 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004256 | 244 |
| 860 | 3300025263 | Ga0209565_1000639 | Ga0209565_10006399 | 244 |
| 861 | 3300025273 | Ga0209673_1000045 | Ga0209673_1000045115 | 244 |
| 862 | 3300025284 | Ga0209130_1000056 | Ga0209130_100005684 | 244 |
| 863 | 3300025284 | Ga0209130_1001246 | Ga0209130_100124612 | 244 |
| 864 | 3300025291 | Ga0209675_1000273 | Ga0209675_100027322 | 244 |
| 865 | 3300025291 | Ga0209675_1001834 | Ga0209675_10018344 | 244 |
| 866 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007796 | 244 |
| 867 | 3300025292 | Ga0209676_1010898 | Ga0209676_10108982 | 244 |
| 868 | 3300025294 | Ga0209025_1002684 | Ga0209025_100268417 | 244 |
| 869 | 3300025294 | Ga0209025_1003907 | Ga0209025_10039074 | 244 |
| 870 | 3300025294 | Ga0209025_1005182 | Ga0209025_10051827 | 244 |
| 871 | 3300025294 | Ga0209025_1011455 | Ga0209025_10114557 | 244 |
| 872 | 3300025295 | Ga0209564_1000358 | Ga0209564_100035869 | 244 |
| 873 | 3300025295 | Ga0209564_1001264 | Ga0209564_100126423 | 244 |
| 874 | 3300025295 | Ga0209564_1004286 | Ga0209564_10042865 | 244 |
| 875 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003711 | 244 |
| 876 | 3300025298 | Ga0209050_1000257 | Ga0209050_10002576 | 244 |
| 877 | 3300025298 | Ga0209050_1011970 | Ga0209050_10119703 | 244 |
| 878 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001711 | 244 |
| 879 | 3300025302 | Ga0207426_1000025 | Ga0207426_1000025238 | 244 |
| 880 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003711 | 244 |
| 881 | 3300025303 | Ga0209051_1009349 | Ga0209051_10093494 | 244 |
| 882 | 3300025303 | Ga0209051_1066731 | Ga0209051_10667311 | 244 |
| 883 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018711 | 244 |
| 884 | 3300025304 | Ga0209257_1021608 | Ga0209257_10216083 | 244 |
| 885 | 3300025893 | Ga0207682_10001856 | Ga0207682_100018563 | 244 |
| 886 | 3300025893 | Ga0207682_10013067 | Ga0207682_100130673 | 244 |
| 887 | 3300025901 | Ga0207688_10061796 | Ga0207688_100617962 | 244 |
| 888 | 3300025903 | Ga0207680_10008447 | Ga0207680_100084474 | 244 |
| 889 | 3300025908 | Ga0207643_10073167 | Ga0207643_100731673 | 244 |
| 890 | 3300025909 | Ga0207705_10099860 | Ga0207705_100998602 | 244 |
| 891 | 3300025910 | Ga0207684_10103438 | Ga0207684_101034382 | 244 |
| 892 | 3300025918 | Ga0207662_10097161 | Ga0207662_100971613 | 244 |
| 893 | 3300025922 | Ga0207646_10172280 | Ga0207646_101722802 | 244 |
| 894 | 3300025923 | Ga0207681_10065945 | Ga0207681_100659452 | 244 |
| 895 | 3300025923 | Ga0207681_10089243 | Ga0207681_100892432 | 244 |
| 896 | 3300025923 | Ga0207681_10112910 | Ga0207681_101129103 | 244 |
| 897 | 3300025925 | Ga0207650_10000274 | Ga0207650_100002749 | 244 |
| 898 | 3300025925 | Ga0207650_10005108 | Ga0207650_100051085 | 244 |
| 899 | 3300025925 | Ga0207650_10172668 | Ga0207650_101726682 | 244 |
| 900 | 3300025926 | Ga0207659_10001360 | Ga0207659_1000136011 | 244 |
| 901 | 3300025926 | Ga0207659_10020561 | Ga0207659_100205612 | 244 |
| 902 | 3300025931 | Ga0207644_10014175 | Ga0207644_100141756 | 244 |
| 903 | 3300025937 | Ga0207669_10002096 | Ga0207669_100020969 | 244 |
| 904 | 3300025940 | Ga0207691_10025211 | Ga0207691_100252117 | 244 |
| 905 | 3300025940 | Ga0207691_10025283 | Ga0207691_100252834 | 244 |
| 906 | 3300025940 | Ga0207691_10039297 | Ga0207691_100392973 | 244 |
| 907 | 3300025940 | Ga0207691_10092182 | Ga0207691_100921822 | 244 |
| 908 | 3300025941 | Ga0207711_10022264 | Ga0207711_100222646 | 244 |
| 909 | 3300025941 | Ga0207711_10231669 | Ga0207711_102316692 | 244 |
| 910 | 3300025942 | Ga0207689_10100576 | Ga0207689_101005762 | 244 |
| 911 | 3300025945 | Ga0207679_10055221 | Ga0207679_100552212 | 244 |
| 912 | 3300025960 | Ga0207651_10003094 | Ga0207651_100030947 | 244 |
| 913 | 3300025960 | Ga0207651_10005362 | Ga0207651_100053625 | 244 |
| 914 | 3300025960 | Ga0207651_10127085 | Ga0207651_101270853 | 244 |
| 915 | 3300025986 | Ga0207658_10053233 | Ga0207658_100532333 | 244 |
| 916 | 3300025986 | Ga0207658_10078991 | Ga0207658_100789912 | 244 |
| 917 | 3300025986 | Ga0207658_10689502 | Ga0207658_106895022 | 244 |
| 918 | 3300026023 | Ga0207677_10004773 | Ga0207677_100047735 | 244 |
| 919 | 3300026035 | Ga0207703_10005879 | Ga0207703_1000587910 | 244 |
| 920 | 3300026067 | Ga0207678_10184766 | Ga0207678_101847663 | 244 |
| 921 | 3300026075 | Ga0207708_10074781 | Ga0207708_100747813 | 244 |
| 922 | 3300026088 | Ga0207641_10001486 | Ga0207641_1000148617 | 244 |
| 923 | 3300026089 | Ga0207648_10001396 | Ga0207648_100013964 | 244 |
| 924 | 3300026089 | Ga0207648_10076047 | Ga0207648_100760473 | 244 |
| 925 | 3300026095 | Ga0207676_10002421 | Ga0207676_100024213 | 244 |
| 926 | 3300026095 | Ga0207676_10047349 | Ga0207676_100473494 | 244 |
| 927 | 3300026118 | Ga0207675_100023188 | Ga0207675_1000231883 | 244 |
| 928 | 3300026121 | Ga0207683_10019109 | Ga0207683_100191096 | 244 |
| 929 | 3300026121 | Ga0207683_10048487 | Ga0207683_100484874 | 244 |
| 930 | 3300026121 | Ga0207683_10236164 | Ga0207683_102361642 | 244 |
| 931 | 3300026142 | Ga0207698_10146313 | Ga0207698_101463133 | 244 |
| 932 | 3300026142 | Ga0207698_10600036 | Ga0207698_106000361 | 244 |
| 933 | 3300028379 | Ga0268266_10380996 | Ga0268266_103809962 | 244 |
| 934 | 3300028380 | Ga0268265_10004180 | Ga0268265_1000418012 | 244 |
| 935 | 3300028381 | Ga0268264_10032321 | Ga0268264_100323212 | 244 |
| 936 | 3300028794 | Ga0307515_10025690 | Ga0307515_100256907 | 244 |
| 937 | 3300028794 | Ga0307515_10245956 | Ga0307515_102459562 | 244 |
| 938 | 3300031456 | Ga0307513_10039983 | Ga0307513_100399833 | 244 |
| 939 | 3300031548 | Ga0307408_100001875 | Ga0307408_10000187510 | 244 |
| 940 | 3300031711 | Ga0265314_10009417 | Ga0265314_100094175 | 244 |
| 941 | 3300031731 | Ga0307405_10004366 | Ga0307405_100043664 | 244 |
| 942 | 3300031824 | Ga0307413_10008901 | Ga0307413_100089013 | 244 |
| 943 | 3300031901 | Ga0307406_10001340 | Ga0307406_100013406 | 244 |
| 944 | 3300031911 | Ga0307412_10181879 | Ga0307412_101818792 | 244 |
| 945 | 3300032002 | Ga0307416_100271559 | Ga0307416_1002715592 | 244 |
| 946 | 3300032005 | Ga0307411_10010018 | Ga0307411_100100184 | 244 |
| 947 | 3300032126 | Ga0307415_100166848 | Ga0307415_1001668482 | 244 |
| 948 | 3300035089 | Ga0373944_0036019 | Ga0373944_0036019_482_1297 | 244 |
| 949 | 3300035695 | Ga0373927_0102238 | Ga0373927_0102238_441_1256 | 244 |
| 950 | 3300035725 | Ga0373947_0067563 | Ga0373947_0067563_57_806 | 244 |
| 951 | 3300036401 | Ga0373937_0191548 | Ga0373937_0191548_611_1360 | 244 |
| 952 | 3300037068 | Ga0373925_0011126 | Ga0373925_0011126_4752_5567 | 244 |
| 953 | 3300037471 | Ga0395905_0013384 | Ga0395905_0013384_1613_2365 | 244 |
| 954 | 3300042001 | Ga0439441_036863 | Ga0439441_036863_172_918 | 244 |
| 955 | 3300042015 | Ga0439462_0028647 | Ga0439462_0028647_421_1167 | 244 |
| 956 | 3300042123 | Ga0450921_003883 | Ga0450921_003883_275_1021 | 244 |
| 957 | 3300042129 | Ga0450891_003105 | Ga0450891_003105_660_1406 | 244 |
| 958 | 3300042184 | Ga0450908_013037 | Ga0450908_013037_167_913 | 244 |
| 959 | 3300042438 | Ga0439459_0006496 | Ga0439459_0006496_448_1194 | 244 |
| 960 | 3300042439 | Ga0439464_0033716 | Ga0439464_0033716_205_966 | 244 |
| 961 | 3300042530 | Ga0450916_022175 | Ga0450916_022175_38_787 | 244 |
| 962 | 3300044673 | Ga0453683_0002295 | Ga0453683_0002295_11494_12240 | 244 |
| 963 | 3300044684 | Ga0466966_0003862 | Ga0466966_0003862_1744_2538 | 244 |
| 964 | 3300044684 | Ga0466966_0005496 | Ga0466966_0005496_5928_6695 | 244 |
| 965 | 3300044693 | Ga0466961_0012612 | Ga0466961_0012612_3976_4743 | 244 |
| 966 | 3300044694 | Ga0466963_0085744 | Ga0466963_0085744_308_1075 | 244 |
| 967 | 3300044706 | Ga0466964_0004693 | Ga0466964_0004693_2290_3057 | 244 |
| 968 | 3300044712 | Ga0453684_0071583 | Ga0453684_0071583_1112_1867 | 244 |
| 969 | 3300044719 | Ga0466971_0084266 | Ga0466971_0084266_647_1441 | 244 |
| 970 | 3300044765 | Ga0466970_0004901 | Ga0466970_0004901_678_1517 | 244 |
| 971 | 3300044842 | Ga0466957_0156894 | Ga0466957_0156894_249_1016 | 244 |
| 972 | 3300045049 | Ga0466959_0000285 | Ga0466959_0000285_1020_1787 | 244 |
| 973 | 3300045976 | Ga0466967_0011318 | Ga0466967_0011318_2699_3466 | 244 |
| 974 | 3300046459 | Ga0495629_0018591 | Ga0495629_0018591_25_774 | 244 |
| 975 | 3300046515 | Ga0495620_0094695 | Ga0495620_0094695_379_1143 | 244 |
| 976 | 3300046516 | Ga0495628_0141802 | Ga0495628_0141802_793_1542 | 244 |
| 977 | 3300046543 | Ga0495645_0013074 | Ga0495645_0013074_412_1161 | 244 |
| 978 | 3300046681 | Ga0495647_0005157 | Ga0495647_0005157_3158_3907 | 244 |
| 979 | 3300047319 | Ga0495674_0229460 | Ga0495674_0229460_554_1303 | 244 |
| 980 | 3300047471 | Ga0495684_0017249 | Ga0495684_0017249_1157_1906 | 244 |
| 981 | 3300048907 | Ga0496104_0008971 | Ga0496104_0008971_5212_5979 | 244 |
| 982 | 3300048908 | Ga0496105_0085811 | Ga0496105_0085811_658_1425 | 244 |
| 983 | 3300048911 | Ga0496108_0131728 | Ga0496108_0131728_556_1305 | 244 |
| 984 | 3300048912 | Ga0496109_0209722 | Ga0496109_0209722_998_1747 | 244 |
| 985 | 3300048912 | Ga0496109_0355405 | Ga0496109_0355405_172_939 | 244 |
| 986 | 3300048925 | Ga0496122_0000034 | Ga0496122_0000034_299126_299872 | 244 |
| 987 | 3300048926 | Ga0496123_0000141 | Ga0496123_0000141_49782_50528 | 244 |
| 988 | 3300048927 | Ga0496124_0023318 | Ga0496124_0023318_368_1114 | 244 |
| 989 | 3300049581 | Ga0501047_0159212 | Ga0501047_0159212_328_1074 | 244 |
| 990 | 3300049775 | Ga0501279_004739 | Ga0501279_004739_674_1429 | 244 |
| 991 | 3300049822 | Ga0501035_0036476 | Ga0501035_0036476_1587_2354 | 244 |
| 992 | 3300050489 | nmdc:mga03683_10428_c1 | nmdc:mga03683_10428_c1_2111_2896 | 244 |
| 993 | 3300050492 | nmdc:mga0yw44_164081_c1 | nmdc:mga0yw44_164081_c1_573_1322 | 244 |
| 994 | 3300050493 | nmdc:mga0k408_33077_c1 | nmdc:mga0k408_33077_c1_1112_1870 | 244 |
| 995 | 3300050493 | nmdc:mga0k408_74008_c1 | nmdc:mga0k408_74008_c1_253_1038 | 244 |
| 996 | 3300050493 | nmdc:mga0k408_80770_c1 | nmdc:mga0k408_80770_c1_1079_1882 | 244 |
| 997 | 3300050493 | nmdc:mga0k408_91859_c1 | nmdc:mga0k408_91859_c1_366_1136 | 244 |
| 998 | 3300050496 | nmdc:mga07m45_98223_c1 | nmdc:mga07m45_98223_c1_815_1570 | 244 |
| 999 | 3300053085 | Ga0495619_0042460 | Ga0495619_0042460_2206_2955 | 244 |
| 1000 | 3300053136 | Ga0500559_0002741 | Ga0500559_0002741_4091_4837 | 244 |
| 1001 | 3300053140 | Ga0500573_0050389 | Ga0500573_0050389_590_1336 | 244 |
| 1002 | 3300053730 | Ga0500645_019674 | Ga0500645_019674_998_1786 | 244 |
| 1003 | 3300061719 | Ga0466962_0003867 | Ga0466962_0003867_4850_5653 | 244 |
| 1004 | 3300061719 | Ga0466962_0022710 | Ga0466962_0022710_463_1230 | 244 |
| 1005 | iso_pu_bacteria | 2945909444 | 2945911451 | 244 |
| 1006 | iso_pu_bacteria | 2945984333 | 2945986241 | 244 |
| 1007 | 3300003792 | Ga0055540_1031528 | Ga0055540_10315281 | 245 |
| 1008 | 3300005289 | Ga0065704_10118735 | Ga0065704_101187352 | 245 |
| 1009 | 3300005334 | Ga0068869_100160705 | Ga0068869_1001607052 | 245 |
| 1010 | 3300005341 | Ga0070691_10211197 | Ga0070691_102111972 | 245 |
| 1011 | 3300005367 | Ga0070667_100002698 | Ga0070667_10000269811 | 245 |
| 1012 | 3300005367 | Ga0070667_100203620 | Ga0070667_1002036202 | 245 |
| 1013 | 3300005435 | Ga0070714_100247327 | Ga0070714_1002473271 | 245 |
| 1014 | 3300005459 | Ga0068867_100708956 | Ga0068867_1007089561 | 245 |
| 1015 | 3300005466 | Ga0070685_10301435 | Ga0070685_103014351 | 245 |
| 1016 | 3300005539 | Ga0068853_100484200 | Ga0068853_1004842002 | 245 |
| 1017 | 3300005563 | Ga0068855_100012472 | Ga0068855_1000124729 | 245 |
| 1018 | 3300005563 | Ga0068855_100097782 | Ga0068855_1000977823 | 245 |
| 1019 | 3300005578 | Ga0068854_100149663 | Ga0068854_1001496632 | 245 |
| 1020 | 3300005614 | Ga0068856_100443349 | Ga0068856_1004433491 | 245 |
| 1021 | 3300005616 | Ga0068852_100007651 | Ga0068852_1000076519 | 245 |
| 1022 | 3300006048 | Ga0075363_100078873 | Ga0075363_1000788733 | 245 |
| 1023 | 3300006177 | Ga0075362_10015684 | Ga0075362_100156843 | 245 |
| 1024 | 3300006178 | Ga0075367_10005261 | Ga0075367_100052618 | 245 |
| 1025 | 3300006178 | Ga0075367_10051646 | Ga0075367_100516463 | 245 |
| 1026 | 3300006195 | Ga0075366_10018595 | Ga0075366_100185952 | 245 |
| 1027 | 3300006353 | Ga0075370_10007548 | Ga0075370_100075485 | 245 |
| 1028 | 3300006353 | Ga0075370_10038128 | Ga0075370_100381283 | 245 |
| 1029 | 3300009093 | Ga0105240_10002099 | Ga0105240_100020998 | 245 |
| 1030 | 3300009093 | Ga0105240_10052231 | Ga0105240_100522314 | 245 |
| 1031 | 3300009098 | Ga0105245_10140169 | Ga0105245_101401691 | 245 |
| 1032 | 3300010375 | Ga0105239_10129672 | Ga0105239_101296724 | 245 |
| 1033 | 3300010375 | Ga0105239_10646603 | Ga0105239_106466032 | 245 |
| 1034 | 3300013297 | Ga0157378_10285517 | Ga0157378_102855172 | 245 |
| 1035 | 3300013308 | Ga0157375_10134869 | Ga0157375_101348693 | 245 |
| 1036 | 3300025303 | Ga0209051_1007719 | Ga0209051_10077197 | 245 |
| 1037 | 3300025913 | Ga0207695_10096678 | Ga0207695_100966782 | 245 |
| 1038 | 3300025913 | Ga0207695_10266144 | Ga0207695_102661442 | 245 |
| 1039 | 3300025914 | Ga0207671_10304099 | Ga0207671_103040992 | 245 |
| 1040 | 3300025921 | Ga0207652_10087394 | Ga0207652_100873942 | 245 |
| 1041 | 3300025929 | Ga0207664_10217370 | Ga0207664_102173701 | 245 |
| 1042 | 3300025941 | Ga0207711_10640278 | Ga0207711_106402781 | 245 |
| 1043 | 3300025960 | Ga0207651_10284486 | Ga0207651_102844862 | 245 |
| 1044 | 3300025986 | Ga0207658_10000596 | Ga0207658_1000059627 | 245 |
| 1045 | 3300025986 | Ga0207658_10134700 | Ga0207658_101347002 | 245 |
| 1046 | 3300026067 | Ga0207678_10216388 | Ga0207678_102163882 | 245 |
| 1047 | 3300026078 | Ga0207702_10386985 | Ga0207702_103869851 | 245 |
| 1048 | 3300026089 | Ga0207648_10166809 | Ga0207648_101668092 | 245 |
| 1049 | 3300026116 | Ga0207674_10014163 | Ga0207674_100141637 | 245 |
| 1050 | 3300026116 | Ga0207674_10096985 | Ga0207674_100969852 | 245 |
| 1051 | 3300028786 | Ga0307517_10010987 | Ga0307517_100109878 | 245 |
| 1052 | 3300031456 | Ga0307513_10064266 | Ga0307513_100642663 | 245 |
| 1053 | 3300031548 | Ga0307408_100158321 | Ga0307408_1001583212 | 245 |
| 1054 | 3300031616 | Ga0307508_10259421 | Ga0307508_102594212 | 245 |
| 1055 | 3300031730 | Ga0307516_10002826 | Ga0307516_100028267 | 245 |
| 1056 | 3300032126 | Ga0307415_100515827 | Ga0307415_1005158271 | 245 |
| 1057 | 3300033180 | Ga0307510_10115880 | Ga0307510_101158802 | 245 |
| 1058 | 3300035695 | Ga0373927_0093092 | Ga0373927_0093092_935_1708 | 245 |
| 1059 | 3300037068 | Ga0373925_0056736 | Ga0373925_0056736_1757_2530 | 245 |
| 1060 | 3300037312 | Ga0395899_0019128 | Ga0395899_0019128_3180_3929 | 245 |
| 1061 | 3300037418 | Ga0395900_0002425 | Ga0395900_0002425_13009_13758 | 245 |
| 1062 | 3300037418 | Ga0395900_0020959 | Ga0395900_0020959_892_1644 | 245 |
| 1063 | 3300037418 | Ga0395900_0149133 | Ga0395900_0149133_675_1424 | 245 |
| 1064 | 3300037418 | Ga0395900_0160620 | Ga0395900_0160620_1455_2267 | 245 |
| 1065 | 3300037418 | Ga0395900_0403195 | Ga0395900_0403195_547_1296 | 245 |
| 1066 | 3300037466 | Ga0395898_0002961 | Ga0395898_0002961_4433_5182 | 245 |
| 1067 | 3300037466 | Ga0395898_0008634 | Ga0395898_0008634_9916_10668 | 245 |
| 1068 | 3300037471 | Ga0395905_0000180 | Ga0395905_0000180_7683_8432 | 245 |
| 1069 | 3300037471 | Ga0395905_0002881 | Ga0395905_0002881_10140_10892 | 245 |
| 1070 | 3300037471 | Ga0395905_0010125 | Ga0395905_0010125_2492_3241 | 245 |
| 1071 | 3300037471 | Ga0395905_0013704 | Ga0395905_0013704_584_1366 | 245 |
| 1072 | 3300037471 | Ga0395905_0028419 | Ga0395905_0028419_3737_4486 | 245 |
| 1073 | 3300037471 | Ga0395905_0037378 | Ga0395905_0037378_3673_4422 | 245 |
| 1074 | 3300037471 | Ga0395905_0080020 | Ga0395905_0080020_259_1008 | 245 |
| 1075 | 3300037471 | Ga0395905_0192568 | Ga0395905_0192568_1035_1814 | 245 |
| 1076 | 3300037471 | Ga0395905_0360945 | Ga0395905_0360945_168_917 | 245 |
| 1077 | 3300037471 | Ga0395905_0435910 | Ga0395905_0435910_334_1095 | 245 |
| 1078 | 3300038443 | Ga0395901_0047353 | Ga0395901_0047353_1121_1870 | 245 |
| 1079 | 3300038443 | Ga0395901_0085362 | Ga0395901_0085362_88_837 | 245 |
| 1080 | 3300038443 | Ga0395901_0122449 | Ga0395901_0122449_591_1343 | 245 |
| 1081 | 3300042007 | Ga0439449_0005738 | Ga0439449_0005738_3795_4544 | 245 |
| 1082 | 3300042532 | Ga0450893_0032490 | Ga0450893_0032490_27_788 | 245 |
| 1083 | 3300042876 | Ga0451577_0003543 | Ga0451577_0003543_2054_2809 | 245 |
| 1084 | 3300044656 | Ga0466969_0002322 | Ga0466969_0002322_7493_8242 | 245 |
| 1085 | 3300044656 | Ga0466969_0062655 | Ga0466969_0062655_268_1017 | 245 |
| 1086 | 3300044656 | Ga0466969_0192857 | Ga0466969_0192857_31_840 | 245 |
| 1087 | 3300044683 | Ga0466965_0002967 | Ga0466965_0002967_1681_2484 | 245 |
| 1088 | 3300044684 | Ga0466966_0004685 | Ga0466966_0004685_4882_5631 | 245 |
| 1089 | 3300044693 | Ga0466961_0005740 | Ga0466961_0005740_2839_3588 | 245 |
| 1090 | 3300044693 | Ga0466961_0016936 | Ga0466961_0016936_1300_2118 | 245 |
| 1091 | 3300044693 | Ga0466961_0046507 | Ga0466961_0046507_498_1247 | 245 |
| 1092 | 3300044765 | Ga0466970_0026951 | Ga0466970_0026951_2092_2841 | 245 |
| 1093 | 3300044842 | Ga0466957_0005869 | Ga0466957_0005869_4024_4842 | 245 |
| 1094 | 3300045049 | Ga0466959_0046888 | Ga0466959_0046888_2256_3074 | 245 |
| 1095 | 3300045836 | Ga0466958_0399212 | Ga0466958_0399212_76_825 | 245 |
| 1096 | 3300046462 | Ga0495651_0115987 | Ga0495651_0115987_118_882 | 245 |
| 1097 | 3300046519 | Ga0495632_0003624 | Ga0495632_0003624_4824_5603 | 245 |
| 1098 | 3300046519 | Ga0495632_0034350 | Ga0495632_0034350_715_1488 | 245 |
| 1099 | 3300046535 | Ga0495586_0007585 | Ga0495586_0007585_4197_5015 | 245 |
| 1100 | 3300046542 | Ga0495597_0002614 | Ga0495597_0002614_3237_4016 | 245 |
| 1101 | 3300046542 | Ga0495597_0004594 | Ga0495597_0004594_4616_5386 | 245 |
| 1102 | 3300046648 | Ga0495611_0086522 | Ga0495611_0086522_512_1291 | 245 |
| 1103 | 3300046660 | Ga0495625_0094976 | Ga0495625_0094976_841_1620 | 245 |
| 1104 | 3300046694 | Ga0495649_0007041 | Ga0495649_0007041_6101_6880 | 245 |
| 1105 | 3300046810 | Ga0495660_0016584 | Ga0495660_0016584_970_1749 | 245 |
| 1106 | 3300047443 | Ga0495687_000473 | Ga0495687_000473_24583_25362 | 245 |
| 1107 | 3300047443 | Ga0495687_010018 | Ga0495687_010018_2779_3558 | 245 |
| 1108 | 3300048925 | Ga0496122_0069305 | Ga0496122_0069305_1469_2236 | 245 |
| 1109 | 3300048927 | Ga0496124_0117899 | Ga0496124_0117899_301_1068 | 245 |
| 1110 | 3300048928 | Ga0496125_0002204 | Ga0496125_0002204_8985_9752 | 245 |
| 1111 | 3300048929 | Ga0496126_0030523 | Ga0496126_0030523_1943_2710 | 245 |
| 1112 | 3300049581 | Ga0501047_0037145 | Ga0501047_0037145_2577_3326 | 245 |
| 1113 | 3300049742 | Ga0501080_0037120 | Ga0501080_0037120_805_1554 | 245 |
| 1114 | 3300050489 | nmdc:mga03683_104008_c1 | nmdc:mga03683_104008_c1_216_965 | 245 |
| 1115 | 3300050489 | nmdc:mga03683_11744_c1 | nmdc:mga03683_11744_c1_787_1566 | 245 |
| 1116 | 3300050489 | nmdc:mga03683_4370_c1 | nmdc:mga03683_4370_c1_2580_3362 | 245 |
| 1117 | 3300050491 | nmdc:mga00v17_40775_c1 | nmdc:mga00v17_40775_c1_939_1721 | 245 |
| 1118 | 3300050493 | nmdc:mga0k408_11730_c1 | nmdc:mga0k408_11730_c1_755_1534 | 245 |
| 1119 | 3300050493 | nmdc:mga0k408_17184_c1 | nmdc:mga0k408_17184_c1_1839_2621 | 245 |
| 1120 | 3300050494 | nmdc:mga06z11_155402_c1 | nmdc:mga06z11_155402_c1_115_894 | 245 |
| 1121 | 3300050495 | nmdc:mga04h51_45950_c1 | nmdc:mga04h51_45950_c1_636_1418 | 245 |
| 1122 | 3300050496 | nmdc:mga07m45_11799_c1 | nmdc:mga07m45_11799_c1_1233_2015 | 245 |
| 1123 | 3300050496 | nmdc:mga07m45_18324_c1 | nmdc:mga07m45_18324_c1_1387_2169 | 245 |
| 1124 | 3300050496 | nmdc:mga07m45_220_c1 | nmdc:mga07m45_220_c1_13599_14381 | 245 |
| 1125 | 3300050496 | nmdc:mga07m45_23119_c1 | nmdc:mga07m45_23119_c1_2237_3016 | 245 |
| 1126 | 3300050496 | nmdc:mga07m45_66194_c1 | nmdc:mga07m45_66194_c1_125_931 | 245 |
| 1127 | 3300050496 | nmdc:mga07m45_8131_c1 | nmdc:mga07m45_8131_c1_3243_4022 | 245 |
| 1128 | 3300050516 | nmdc:mga0sz30_13382_c1 | nmdc:mga0sz30_13382_c1_1376_2158 | 245 |
| 1129 | 3300053129 | Ga0500628_001693 | Ga0500628_001693_265_1059 | 245 |
| 1130 | 3300053131 | Ga0500652_138434 | Ga0500652_138434_189_953 | 245 |
| 1131 | 3300053134 | Ga0500658_0002272 | Ga0500658_0002272_3761_4540 | 245 |
| 1132 | 3300055283 | Ga0500661_022231 | Ga0500661_022231_252_1046 | 245 |
| 1133 | 3300061719 | Ga0466962_0067867 | Ga0466962_0067867_443_1192 | 245 |
| 1134 | iso_pu_bacteria | 2513020051 | 2513229568 | 245 |
| 1135 | iso_pu_bacteria | 2599185214 | 2599623543 | 245 |
| 1136 | iso_pu_bacteria | 2599185226 | 2599671839 | 245 |
| 1137 | iso_pu_bacteria | 2599185227 | 2599681148 | 245 |
| 1138 | iso_pu_bacteria | 2599185229 | 2599693448 | 245 |
| 1139 | iso_pu_bacteria | 2643221628 | 2644160715 | 245 |
| 1140 | iso_pu_bacteria | 2643221658 | 2644327515 | 245 |
| 1141 | iso_pu_bacteria | 2643221672 | 2644401569 | 245 |
| 1142 | iso_pu_bacteria | 2738541277 | 2738717621 | 245 |
| 1143 | iso_pu_bacteria | 2738541307 | 2738879236 | 245 |
| 1144 | iso_pu_bacteria | 2738543019 | 2739278307 | 245 |
| 1145 | iso_pu_bacteria | 2818991446 | 2819597110 | 245 |
| 1146 | iso_pu_bacteria | 2831265667 | 2831266229 | 245 |
| 1147 | iso_pu_bacteria | 2838054893 | 2838057661 | 245 |
| 1148 | iso_pu_bacteria | 2885198086 | 2885204345 | 245 |
| 1149 | iso_pu_bacteria | 2885211737 | 2885217998 | 245 |
| 1150 | iso_pu_bacteria | 2899924645 | 2899930149 | 245 |
| 1151 | iso_pu_bacteria | 2904449895 | 2904456179 | 245 |
| 1152 | iso_pu_bacteria | 2904456579 | 2904457729 | 245 |
| 1153 | iso_pu_bacteria | 2904541872 | 2904543483 | 245 |
| 1154 | iso_pu_bacteria | 2928037797 | 2928039262 | 245 |
| 1155 | iso_pu_bacteria | 2928044640 | 2928045133 | 245 |
| 1156 | iso_pu_bacteria | 2928051484 | 2928052939 | 245 |
| 1157 | iso_pu_bacteria | 2928064002 | 2928064390 | 245 |
| 1158 | iso_pu_bacteria | 2928070936 | 2928071844 | 245 |
| 1159 | iso_pu_bacteria | 2928084124 | 2928084220 | 245 |
| 1160 | iso_pu_bacteria | 2929160207 | 2929162982 | 245 |
| 1161 | iso_pu_bacteria | 2929520902 | 2929527228 | 245 |
| 1162 | iso_pu_bacteria | 2945972063 | 2945977509 | 245 |
| 1163 | 3300003322 | rootL2_10044024 | rootL2_100440242 | 246 |
| 1164 | 3300003773 | Ga0055537_1000484 | Ga0055537_10004844 | 246 |
| 1165 | 3300003781 | Ga0055536_1001639 | Ga0055536_10016393 | 246 |
| 1166 | 3300003784 | Ga0055534_1000406 | Ga0055534_100040623 | 246 |
| 1167 | 3300003784 | Ga0055534_1001233 | Ga0055534_10012339 | 246 |
| 1168 | 3300003790 | Ga0055528_1000813 | Ga0055528_100081318 | 246 |
| 1169 | 3300003792 | Ga0055540_1001252 | Ga0055540_10012529 | 246 |
| 1170 | 3300005334 | Ga0068869_100490802 | Ga0068869_1004908022 | 246 |
| 1171 | 3300005354 | Ga0070675_100217028 | Ga0070675_1002170282 | 246 |
| 1172 | 3300005354 | Ga0070675_100297307 | Ga0070675_1002973072 | 246 |
| 1173 | 3300005356 | Ga0070674_100114654 | Ga0070674_1001146542 | 246 |
| 1174 | 3300005367 | Ga0070667_100021567 | Ga0070667_1000215672 | 246 |
| 1175 | 3300005456 | Ga0070678_100197838 | Ga0070678_1001978382 | 246 |
| 1176 | 3300005457 | Ga0070662_100055488 | Ga0070662_1000554881 | 246 |
| 1177 | 3300005543 | Ga0070672_100089667 | Ga0070672_1000896673 | 246 |
| 1178 | 3300005548 | Ga0070665_100015059 | Ga0070665_1000150593 | 246 |
| 1179 | 3300005548 | Ga0070665_100063615 | Ga0070665_1000636153 | 246 |
| 1180 | 3300005564 | Ga0070664_100032384 | Ga0070664_1000323845 | 246 |
| 1181 | 3300005577 | Ga0068857_100136013 | Ga0068857_1001360132 | 246 |
| 1182 | 3300006051 | Ga0075364_10022939 | Ga0075364_100229391 | 246 |
| 1183 | 3300006058 | Ga0075432_10007755 | Ga0075432_100077554 | 246 |
| 1184 | 3300006058 | Ga0075432_10050686 | Ga0075432_100506862 | 246 |
| 1185 | 3300006177 | Ga0075362_10088778 | Ga0075362_100887782 | 246 |
| 1186 | 3300006177 | Ga0075362_10091944 | Ga0075362_100919442 | 246 |
| 1187 | 3300006195 | Ga0075366_10050467 | Ga0075366_100504673 | 246 |
| 1188 | 3300006195 | Ga0075366_10071587 | Ga0075366_100715871 | 246 |
| 1189 | 3300006353 | Ga0075370_10003569 | Ga0075370_100035697 | 246 |
| 1190 | 3300006353 | Ga0075370_10005043 | Ga0075370_100050432 | 246 |
| 1191 | 3300006353 | Ga0075370_10006717 | Ga0075370_100067173 | 246 |
| 1192 | 3300006353 | Ga0075370_10416746 | Ga0075370_104167461 | 246 |
| 1193 | 3300006948 | Ga0099826_10009182 | Ga0099826_100091826 | 246 |
| 1194 | 3300006948 | Ga0099826_10177925 | Ga0099826_101779252 | 246 |
| 1195 | 3300009148 | Ga0105243_10006952 | Ga0105243_100069523 | 246 |
| 1196 | 3300009553 | Ga0105249_10652667 | Ga0105249_106526671 | 246 |
| 1197 | 3300013306 | Ga0163162_10291647 | Ga0163162_102916472 | 246 |
| 1198 | 3300014497 | Ga0182008_10002052 | Ga0182008_100020524 | 246 |
| 1199 | 3300015261 | Ga0182006_1068687 | Ga0182006_10686872 | 246 |
| 1200 | 3300015262 | Ga0182007_10002796 | Ga0182007_100027964 | 246 |
| 1201 | 3300015683 | Ga0183362_10001 | Ga0183362_100011067 | 246 |
| 1202 | 3300017792 | Ga0163161_10005014 | Ga0163161_100050148 | 246 |
| 1203 | 3300025263 | Ga0209565_1000085 | Ga0209565_1000085125 | 246 |
| 1204 | 3300025273 | Ga0209673_1001052 | Ga0209673_100105210 | 246 |
| 1205 | 3300025273 | Ga0209673_1003345 | Ga0209673_10033456 | 246 |
| 1206 | 3300025284 | Ga0209130_1004082 | Ga0209130_10040826 | 246 |
| 1207 | 3300025291 | Ga0209675_1000083 | Ga0209675_1000083125 | 246 |
| 1208 | 3300025291 | Ga0209675_1001347 | Ga0209675_10013479 | 246 |
| 1209 | 3300025292 | Ga0209676_1000268 | Ga0209676_100026856 | 246 |
| 1210 | 3300025303 | Ga0209051_1000343 | Ga0209051_100034356 | 246 |
| 1211 | 3300025303 | Ga0209051_1003803 | Ga0209051_10038036 | 246 |
| 1212 | 3300025304 | Ga0209257_1005357 | Ga0209257_10053573 | 246 |
| 1213 | 3300025304 | Ga0209257_1009186 | Ga0209257_10091862 | 246 |
| 1214 | 3300025935 | Ga0207709_10000425 | Ga0207709_1000042531 | 246 |
| 1215 | 3300025937 | Ga0207669_10162792 | Ga0207669_101627922 | 246 |
| 1216 | 3300025940 | Ga0207691_10234410 | Ga0207691_102344102 | 246 |
| 1217 | 3300025945 | Ga0207679_10059750 | Ga0207679_100597502 | 246 |
| 1218 | 3300025986 | Ga0207658_10053722 | Ga0207658_100537223 | 246 |
| 1219 | 3300026121 | Ga0207683_10044835 | Ga0207683_100448354 | 246 |
| 1220 | 3300026121 | Ga0207683_10146026 | Ga0207683_101460262 | 246 |
| 1221 | 3300026121 | Ga0207683_10215806 | Ga0207683_102158062 | 246 |
| 1222 | 3300027666 | Ga0209282_1000974 | Ga0209282_10009746 | 246 |
| 1223 | 3300028379 | Ga0268266_10141325 | Ga0268266_101413252 | 246 |
| 1224 | 3300028379 | Ga0268266_10305844 | Ga0268266_103058442 | 246 |
| 1225 | 3300028794 | Ga0307515_10002898 | Ga0307515_100028987 | 246 |
| 1226 | 3300030731 | Ga0316177_1080934 | Ga0316177_10809345 | 246 |
| 1227 | 3300030732 | Ga0316176_1095897 | Ga0316176_10958973 | 246 |
| 1228 | 3300030733 | Ga0314311_1024127 | Ga0314311_10241273 | 246 |
| 1229 | 3300030735 | Ga0316178_1082049 | Ga0316178_10820494 | 246 |
| 1230 | 3300030736 | Ga0316180_1101534 | Ga0316180_11015343 | 246 |
| 1231 | 3300030744 | Ga0316181_1045650 | Ga0316181_10456502 | 246 |
| 1232 | 3300030745 | Ga0316182_1369050 | Ga0316182_13690503 | 246 |
| 1233 | 3300031238 | Ga0265332_10000003 | Ga0265332_10000003228 | 246 |
| 1234 | 3300031251 | Ga0265327_10034893 | Ga0265327_100348932 | 246 |
| 1235 | 3300031456 | Ga0307513_10000121 | Ga0307513_1000012159 | 246 |
| 1236 | 3300031731 | Ga0307405_10011565 | Ga0307405_100115654 | 246 |
| 1237 | 3300031731 | Ga0307405_10060774 | Ga0307405_100607742 | 246 |
| 1238 | 3300031731 | Ga0307405_10106064 | Ga0307405_101060642 | 246 |
| 1239 | 3300031852 | Ga0307410_10233286 | Ga0307410_102332861 | 246 |
| 1240 | 3300031903 | Ga0307407_10426587 | Ga0307407_104265872 | 246 |
| 1241 | 3300031911 | Ga0307412_10051102 | Ga0307412_100511022 | 246 |
| 1242 | 3300031911 | Ga0307412_10134142 | Ga0307412_101341422 | 246 |
| 1243 | 3300031911 | Ga0307412_10142282 | Ga0307412_101422822 | 246 |
| 1244 | 3300032002 | Ga0307416_100069123 | Ga0307416_1000691232 | 246 |
| 1245 | 3300032004 | Ga0307414_10222178 | Ga0307414_102221781 | 246 |
| 1246 | 3300032005 | Ga0307411_10084274 | Ga0307411_100842742 | 246 |
| 1247 | 3300032005 | Ga0307411_10332514 | Ga0307411_103325142 | 246 |
| 1248 | 3300041404 | Ga0439436_0003791 | Ga0439436_0003791_1546_2295 | 246 |
| 1249 | 3300041404 | Ga0439436_0013490 | Ga0439436_0013490_817_1566 | 246 |
| 1250 | 3300041405 | Ga0439438_033972 | Ga0439438_033972_428_1177 | 246 |
| 1251 | 3300041406 | Ga0439439_0031011 | Ga0439439_0031011_209_958 | 246 |
| 1252 | 3300041407 | Ga0439447_009182 | Ga0439447_009182_309_1058 | 246 |
| 1253 | 3300041407 | Ga0439447_012418 | Ga0439447_012418_62_811 | 246 |
| 1254 | 3300041410 | Ga0439461_0005365 | Ga0439461_0005365_1174_1923 | 246 |
| 1255 | 3300041411 | Ga0439466_0003451 | Ga0439466_0003451_2578_3327 | 246 |
| 1256 | 3300041411 | Ga0439466_0016582 | Ga0439466_0016582_410_1159 | 246 |
| 1257 | 3300041413 | Ga0439465_0000072 | Ga0439465_0000072_11873_12622 | 246 |
| 1258 | 3300041997 | Ga0439431_0000235 | Ga0439431_0000235_9768_10517 | 246 |
| 1259 | 3300041997 | Ga0439431_0005013 | Ga0439431_0005013_2005_2754 | 246 |
| 1260 | 3300041999 | Ga0439433_0000055 | Ga0439433_0000055_4893_5642 | 246 |
| 1261 | 3300041999 | Ga0439433_0013981 | Ga0439433_0013981_607_1356 | 246 |
| 1262 | 3300042002 | Ga0439442_001375 | Ga0439442_001375_1242_1991 | 246 |
| 1263 | 3300042004 | Ga0439445_0000190 | Ga0439445_0000190_7486_8235 | 246 |
| 1264 | 3300042006 | Ga0439432_016345 | Ga0439432_016345_496_1245 | 246 |
| 1265 | 3300042006 | Ga0439432_023674 | Ga0439432_023674_1007_1756 | 246 |
| 1266 | 3300042007 | Ga0439449_0000135 | Ga0439449_0000135_9906_10655 | 246 |
| 1267 | 3300042007 | Ga0439449_0000254 | Ga0439449_0000254_14878_15627 | 246 |
| 1268 | 3300042007 | Ga0439449_0001356 | Ga0439449_0001356_4793_5542 | 246 |
| 1269 | 3300042010 | Ga0439452_008527 | Ga0439452_008527_393_1142 | 246 |
| 1270 | 3300042010 | Ga0439452_009437 | Ga0439452_009437_1943_2692 | 246 |
| 1271 | 3300042014 | Ga0439457_005620 | Ga0439457_005620_1892_2641 | 246 |
| 1272 | 3300042014 | Ga0439457_008935 | Ga0439457_008935_1436_2185 | 246 |
| 1273 | 3300042015 | Ga0439462_0002085 | Ga0439462_0002085_3723_4472 | 246 |
| 1274 | 3300042121 | Ga0450919_004251 | Ga0450919_004251_432_1181 | 246 |
| 1275 | 3300042125 | Ga0450923_004122 | Ga0450923_004122_1197_1946 | 246 |
| 1276 | 3300042133 | Ga0450896_021139 | Ga0450896_021139_16_765 | 246 |
| 1277 | 3300042145 | Ga0450906_000642 | Ga0450906_000642_95_844 | 246 |
| 1278 | 3300042145 | Ga0450906_001202 | Ga0450906_001202_628_1377 | 246 |
| 1279 | 3300042146 | Ga0450907_019534 | Ga0450907_019534_147_896 | 246 |
| 1280 | 3300042156 | Ga0439446_0003368 | Ga0439446_0003368_366_1115 | 246 |
| 1281 | 3300042157 | Ga0439458_0032050 | Ga0439458_0032050_145_921 | 246 |
| 1282 | 3300042184 | Ga0450908_007998 | Ga0450908_007998_536_1285 | 246 |
| 1283 | 3300042185 | Ga0450909_000922 | Ga0450909_000922_1430_2179 | 246 |
| 1284 | 3300042435 | Ga0439434_0004125 | Ga0439434_0004125_1346_2095 | 246 |
| 1285 | 3300042531 | Ga0450918_000282 | Ga0450918_000282_6946_7695 | 246 |
| 1286 | 3300042532 | Ga0450893_0001086 | Ga0450893_0001086_1013_1762 | 246 |
| 1287 | 3300044712 | Ga0453684_0115887 | Ga0453684_0115887_1399_2169 | 246 |
| 1288 | 3300044901 | Ga0466960_0115367 | Ga0466960_0115367_307_1056 | 246 |
| 1289 | 3300046475 | Ga0495639_0007016 | Ga0495639_0007016_1343_2092 | 246 |
| 1290 | 3300046522 | Ga0495643_0149582 | Ga0495643_0149582_126_908 | 246 |
| 1291 | 3300046535 | Ga0495586_0259785 | Ga0495586_0259785_150_899 | 246 |
| 1292 | 3300046539 | Ga0495621_0007544 | Ga0495621_0007544_1389_2138 | 246 |
| 1293 | 3300046615 | Ga0495656_0000184 | Ga0495656_0000184_14409_15158 | 246 |
| 1294 | 3300046615 | Ga0495656_0027396 | Ga0495656_0027396_562_1311 | 246 |
| 1295 | 3300046674 | Ga0495588_0035371 | Ga0495588_0035371_256_1005 | 246 |
| 1296 | 3300046678 | Ga0495599_0174270 | Ga0495599_0174270_491_1240 | 246 |
| 1297 | 3300046680 | Ga0495646_0108946 | Ga0495646_0108946_365_1147 | 246 |
| 1298 | 3300046809 | Ga0495600_0127367 | Ga0495600_0127367_264_1013 | 246 |
| 1299 | 3300048903 | Ga0496100_0004910 | Ga0496100_0004910_1757_2506 | 246 |
| 1300 | 3300048905 | Ga0496102_0012505 | Ga0496102_0012505_6105_6854 | 246 |
| 1301 | 3300048906 | Ga0496103_0029430 | Ga0496103_0029430_2142_2891 | 246 |
| 1302 | 3300048907 | Ga0496104_0008803 | Ga0496104_0008803_7743_8492 | 246 |
| 1303 | 3300048908 | Ga0496105_0007444 | Ga0496105_0007444_5473_6222 | 246 |
| 1304 | 3300048911 | Ga0496108_0489376 | Ga0496108_0489376_122_871 | 246 |
| 1305 | 3300048914 | Ga0496111_0030189 | Ga0496111_0030189_2152_2901 | 246 |
| 1306 | 3300048915 | Ga0496112_0264853 | Ga0496112_0264853_86_835 | 246 |
| 1307 | 3300049571 | Ga0501034_0187644 | Ga0501034_0187644_856_1662 | 246 |
| 1308 | 3300049679 | Ga0501249_001402 | Ga0501249_001402_977_1726 | 246 |
| 1309 | 3300049705 | Ga0501225_0005658 | Ga0501225_0005658_1225_1974 | 246 |
| 1310 | 3300049759 | Ga0501262_000305 | Ga0501262_000305_967_1716 | 246 |
| 1311 | 3300050489 | nmdc:mga03683_51468_c1 | nmdc:mga03683_51468_c1_44_850 | 246 |
| 1312 | 3300050491 | nmdc:mga00v17_40979_c1 | nmdc:mga00v17_40979_c1_1147_1896 | 246 |
| 1313 | 3300050493 | nmdc:mga0k408_56887_c1 | nmdc:mga0k408_56887_c1_999_1748 | 246 |
| 1314 | 3300050493 | nmdc:mga0k408_7826_c1 | nmdc:mga0k408_7826_c1_1950_2699 | 246 |
| 1315 | 3300050496 | nmdc:mga07m45_1644_c1 | nmdc:mga07m45_1644_c1_2023_2772 | 246 |
| 1316 | 3300050496 | nmdc:mga07m45_24416_c1 | nmdc:mga07m45_24416_c1_1427_2176 | 246 |
| 1317 | 3300050496 | nmdc:mga07m45_246000_c1 | nmdc:mga07m45_246000_c1_117_866 | 246 |
| 1318 | 3300050496 | nmdc:mga07m45_36783_c1 | nmdc:mga07m45_36783_c1_1122_1877 | 246 |
| 1319 | 3300017792 | Ga0163161_10000193 | Ga0163161_1000019355 | 248 |
| 1320 | 3300046520 | Ga0495637_0003270 | Ga0495637_0003270_5488_6237 | 248 |
| 1321 | 3300046660 | Ga0495625_0068099 | Ga0495625_0068099_580_1329 | 248 |
| 1322 | 3300046664 | Ga0495659_0028103 | Ga0495659_0028103_868_1617 | 248 |
| 1323 | 3300046691 | Ga0495670_0024793 | Ga0495670_0024793_1992_2741 | 248 |
| 1324 | 3300046692 | Ga0495671_0008121 | Ga0495671_0008121_2145_2894 | 248 |
| 1325 | 3300046810 | Ga0495660_0064686 | Ga0495660_0064686_1056_1805 | 248 |
| 1326 | 3300047470 | Ga0495681_0195136 | Ga0495681_0195136_17_766 | 248 |
| 1327 | 3300053079 | Ga0500610_0000863 | Ga0500610_0000863_8944_9693 | 248 |
| 1328 | 3300053079 | Ga0500610_0027623 | Ga0500610_0027623_18_767 | 248 |
| 1329 | 3300053079 | Ga0500610_0114083 | Ga0500610_0114083_199_948 | 248 |
| 1330 | 3300053121 | Ga0500607_002610 | Ga0500607_002610_6535_7284 | 248 |
| 1331 | 3300053158 | Ga0500627_0001008 | Ga0500627_0001008_2966_3715 | 248 |
| 1332 | 3300053160 | Ga0500633_0081403 | Ga0500633_0081403_50_799 | 248 |
| 1333 | 3300053161 | Ga0500634_0031872 | Ga0500634_0031872_1409_2158 | 248 |
| 1334 | 3300001979 | JGI24740J21852_10006036 | JGI24740J21852_100060363 | 249 |
| 1335 | 3300002773 | JGI25152J39213_1003031 | JGI25152J39213_10030313 | 249 |
| 1336 | 3300002774 | JGI25150J39212_1000926 | JGI25150J39212_10009264 | 249 |
| 1337 | 3300002774 | JGI25150J39212_1018853 | JGI25150J39212_10188532 | 249 |
| 1338 | 3300002987 | JGI25159J45721_1003283 | JGI25159J45721_10032833 | 249 |
| 1339 | 3300002987 | JGI25159J45721_1005159 | JGI25159J45721_10051592 | 249 |
| 1340 | 3300003187 | JGI25151J46595_10006139 | JGI25151J46595_100061393 | 249 |
| 1341 | 3300003187 | JGI25151J46595_10006404 | JGI25151J46595_100064043 | 249 |
| 1342 | 3300003215 | JGI25153J46596_10004013 | JGI25153J46596_100040133 | 249 |
| 1343 | 3300003215 | JGI25153J46596_10006457 | JGI25153J46596_100064573 | 249 |
| 1344 | 3300003354 | JGI25160J50197_1004586 | JGI25160J50197_10045863 | 249 |
| 1345 | 3300003354 | JGI25160J50197_1004770 | JGI25160J50197_10047703 | 249 |
| 1346 | 3300003374 | JGI25161J50226_1001902 | JGI25161J50226_10019023 | 249 |
| 1347 | 3300003374 | JGI25161J50226_1007034 | JGI25161J50226_10070341 | 249 |
| 1348 | 3300003578 | Ga0006562J51391_1011384 | Ga0006562J51391_10113843 | 249 |
| 1349 | 3300003761 | Ga0055535_1000364 | Ga0055535_100036411 | 249 |
| 1350 | 3300003762 | Ga0055542_1000114 | Ga0055542_100011434 | 249 |
| 1351 | 3300003771 | Ga0055526_1007041 | Ga0055526_10070413 | 249 |
| 1352 | 3300003771 | Ga0055526_1007087 | Ga0055526_10070873 | 249 |
| 1353 | 3300003773 | Ga0055537_1002598 | Ga0055537_10025983 | 249 |
| 1354 | 3300003773 | Ga0055537_1004288 | Ga0055537_10042883 | 249 |
| 1355 | 3300003775 | Ga0055524_1005088 | Ga0055524_10050883 | 249 |
| 1356 | 3300003775 | Ga0055524_1005130 | Ga0055524_10051303 | 249 |
| 1357 | 3300003781 | Ga0055536_1002703 | Ga0055536_10027037 | 249 |
| 1358 | 3300003781 | Ga0055536_1003538 | Ga0055536_10035386 | 249 |
| 1359 | 3300003781 | Ga0055536_1036564 | Ga0055536_10365641 | 249 |
| 1360 | 3300003784 | Ga0055534_1001253 | Ga0055534_10012539 | 249 |
| 1361 | 3300003784 | Ga0055534_1002991 | Ga0055534_10029913 | 249 |
| 1362 | 3300003790 | Ga0055528_1005459 | Ga0055528_10054593 | 249 |
| 1363 | 3300003790 | Ga0055528_1009318 | Ga0055528_10093183 | 249 |
| 1364 | 3300003791 | Ga0055530_10000777 | Ga0055530_100007776 | 249 |
| 1365 | 3300003791 | Ga0055530_10005794 | Ga0055530_100057942 | 249 |
| 1366 | 3300003792 | Ga0055540_1001662 | Ga0055540_10016626 | 249 |
| 1367 | 3300003792 | Ga0055540_1002289 | Ga0055540_10022893 | 249 |
| 1368 | 3300003794 | Ga0055531_10002682 | Ga0055531_100026825 | 249 |
| 1369 | 3300003794 | Ga0055531_10005309 | Ga0055531_100053094 | 249 |
| 1370 | 3300003794 | Ga0055531_10005963 | Ga0055531_100059634 | 249 |
| 1371 | 3300004625 | Ga0055543_1000748 | Ga0055543_100074813 | 249 |
| 1372 | 3300004625 | Ga0055543_1005165 | Ga0055543_10051653 | 249 |
| 1373 | 3300005262 | Ga0065165_1003702 | Ga0065165_10037029 | 249 |
| 1374 | 3300005262 | Ga0065165_1019433 | Ga0065165_10194333 | 249 |
| 1375 | 3300005366 | Ga0070659_100116188 | Ga0070659_1001161882 | 249 |
| 1376 | 3300005539 | Ga0068853_100055955 | Ga0068853_1000559553 | 249 |
| 1377 | 3300005539 | Ga0068853_100218231 | Ga0068853_1002182312 | 249 |
| 1378 | 3300005563 | Ga0068855_100556656 | Ga0068855_1005566562 | 249 |
| 1379 | 3300005564 | Ga0070664_100083753 | Ga0070664_1000837533 | 249 |
| 1380 | 3300005577 | Ga0068857_100343629 | Ga0068857_1003436292 | 249 |
| 1381 | 3300005616 | Ga0068852_100162604 | Ga0068852_1001626041 | 249 |
| 1382 | 3300005834 | Ga0068851_10059788 | Ga0068851_100597882 | 249 |
| 1383 | 3300006038 | Ga0075365_10286431 | Ga0075365_102864312 | 249 |
| 1384 | 3300006048 | Ga0075363_100004278 | Ga0075363_1000042782 | 249 |
| 1385 | 3300006051 | Ga0075364_10346540 | Ga0075364_103465401 | 249 |
| 1386 | 3300006058 | Ga0075432_10008480 | Ga0075432_100084803 | 249 |
| 1387 | 3300006177 | Ga0075362_10036898 | Ga0075362_100368983 | 249 |
| 1388 | 3300006177 | Ga0075362_10196340 | Ga0075362_101963402 | 249 |
| 1389 | 3300006186 | Ga0075369_10056543 | Ga0075369_100565432 | 249 |
| 1390 | 3300006186 | Ga0075369_10075732 | Ga0075369_100757322 | 249 |
| 1391 | 3300006195 | Ga0075366_10011288 | Ga0075366_100112882 | 249 |
| 1392 | 3300006195 | Ga0075366_10072270 | Ga0075366_100722702 | 249 |
| 1393 | 3300006353 | Ga0075370_10000200 | Ga0075370_100002005 | 249 |
| 1394 | 3300006353 | Ga0075370_10004970 | Ga0075370_100049706 | 249 |
| 1395 | 3300006353 | Ga0075370_10260017 | Ga0075370_102600171 | 249 |
| 1396 | 3300009036 | Ga0105244_10014231 | Ga0105244_100142313 | 249 |
| 1397 | 3300009148 | Ga0105243_10003393 | Ga0105243_100033933 | 249 |
| 1398 | 3300009545 | Ga0105237_10241354 | Ga0105237_102413542 | 249 |
| 1399 | 3300010375 | Ga0105239_10047344 | Ga0105239_100473442 | 249 |
| 1400 | 3300011119 | Ga0105246_10283900 | Ga0105246_102839002 | 249 |
| 1401 | 3300013100 | Ga0157373_10032893 | Ga0157373_100328932 | 249 |
| 1402 | 3300013102 | Ga0157371_10052068 | Ga0157371_100520683 | 249 |
| 1403 | 3300013104 | Ga0157370_10031947 | Ga0157370_100319474 | 249 |
| 1404 | 3300013104 | Ga0157370_10079823 | Ga0157370_100798232 | 249 |
| 1405 | 3300013105 | Ga0157369_10037330 | Ga0157369_100373304 | 249 |
| 1406 | 3300013307 | Ga0157372_10730119 | Ga0157372_107301191 | 249 |
| 1407 | 3300014497 | Ga0182008_10018330 | Ga0182008_100183301 | 249 |
| 1408 | 3300015261 | Ga0182006_1001088 | Ga0182006_10010885 | 249 |
| 1409 | 3300017792 | Ga0163161_10004445 | Ga0163161_100044455 | 249 |
| 1410 | 3300025208 | Ga0209436_111100 | Ga0209436_1111002 | 249 |
| 1411 | 3300025228 | Ga0209672_100157 | Ga0209672_10015752 | 249 |
| 1412 | 3300025229 | Ga0209147_100575 | Ga0209147_10057515 | 249 |
| 1413 | 3300025242 | Ga0209258_100225 | Ga0209258_10022535 | 249 |
| 1414 | 3300025245 | Ga0207425_1000295 | Ga0207425_100029517 | 249 |
| 1415 | 3300025245 | Ga0207425_1002296 | Ga0207425_10022963 | 249 |
| 1416 | 3300025254 | Ga0209148_1000040 | Ga0209148_1000040443 | 249 |
| 1417 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007350 | 249 |
| 1418 | 3300025258 | Ga0209129_1002839 | Ga0209129_10028393 | 249 |
| 1419 | 3300025258 | Ga0209129_1013599 | Ga0209129_10135992 | 249 |
| 1420 | 3300025263 | Ga0209565_1000937 | Ga0209565_10009375 | 249 |
| 1421 | 3300025263 | Ga0209565_1005491 | Ga0209565_10054913 | 249 |
| 1422 | 3300025263 | Ga0209565_1009634 | Ga0209565_10096342 | 249 |
| 1423 | 3300025273 | Ga0209673_1000133 | Ga0209673_1000133105 | 249 |
| 1424 | 3300025273 | Ga0209673_1000304 | Ga0209673_100030492 | 249 |
| 1425 | 3300025284 | Ga0209130_1000070 | Ga0209130_1000070187 | 249 |
| 1426 | 3300025284 | Ga0209130_1000326 | Ga0209130_100032611 | 249 |
| 1427 | 3300025291 | Ga0209675_1000516 | Ga0209675_100051610 | 249 |
| 1428 | 3300025291 | Ga0209675_1002863 | Ga0209675_10028634 | 249 |
| 1429 | 3300025291 | Ga0209675_1004787 | Ga0209675_10047875 | 249 |
| 1430 | 3300025292 | Ga0209676_1000122 | Ga0209676_1000122172 | 249 |
| 1431 | 3300025292 | Ga0209676_1001242 | Ga0209676_10012429 | 249 |
| 1432 | 3300025292 | Ga0209676_1011875 | Ga0209676_10118753 | 249 |
| 1433 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073292 | 249 |
| 1434 | 3300025294 | Ga0209025_1000111 | Ga0209025_1000111186 | 249 |
| 1435 | 3300025294 | Ga0209025_1000432 | Ga0209025_100043277 | 249 |
| 1436 | 3300025294 | Ga0209025_1010358 | Ga0209025_10103583 | 249 |
| 1437 | 3300025294 | Ga0209025_1010592 | Ga0209025_10105923 | 249 |
| 1438 | 3300025295 | Ga0209564_1000524 | Ga0209564_100052410 | 249 |
| 1439 | 3300025295 | Ga0209564_1000594 | Ga0209564_100059410 | 249 |
| 1440 | 3300025297 | Ga0209758_1000025 | Ga0209758_1000025176 | 249 |
| 1441 | 3300025297 | Ga0209758_1002137 | Ga0209758_10021373 | 249 |
| 1442 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021597 | 249 |
| 1443 | 3300025298 | Ga0209050_1001024 | Ga0209050_10010247 | 249 |
| 1444 | 3300025298 | Ga0209050_1005556 | Ga0209050_10055563 | 249 |
| 1445 | 3300025299 | Ga0209256_1000050 | Ga0209256_1000050242 | 249 |
| 1446 | 3300025299 | Ga0209256_1000063 | Ga0209256_100006361 | 249 |
| 1447 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001461 | 249 |
| 1448 | 3300025302 | Ga0207426_1000028 | Ga0207426_1000028279 | 249 |
| 1449 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021367 | 249 |
| 1450 | 3300025303 | Ga0209051_1000618 | Ga0209051_100061810 | 249 |
| 1451 | 3300025303 | Ga0209051_1000665 | Ga0209051_100066534 | 249 |
| 1452 | 3300025303 | Ga0209051_1027048 | Ga0209051_10270483 | 249 |
| 1453 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021508 | 249 |
| 1454 | 3300025304 | Ga0209257_1000333 | Ga0209257_100033333 | 249 |
| 1455 | 3300025304 | Ga0209257_1001964 | Ga0209257_100196414 | 249 |
| 1456 | 3300025728 | Ga0207655_1031742 | Ga0207655_10317422 | 249 |
| 1457 | 3300025914 | Ga0207671_10096860 | Ga0207671_100968602 | 249 |
| 1458 | 3300025919 | Ga0207657_10109360 | Ga0207657_101093603 | 249 |
| 1459 | 3300025933 | Ga0207706_10042765 | Ga0207706_100427652 | 249 |
| 1460 | 3300025935 | Ga0207709_10001100 | Ga0207709_100011009 | 249 |
| 1461 | 3300025945 | Ga0207679_10029674 | Ga0207679_100296744 | 249 |
| 1462 | 3300025949 | Ga0207667_10543182 | Ga0207667_105431822 | 249 |
| 1463 | 3300025981 | Ga0207640_10063936 | Ga0207640_100639363 | 249 |
| 1464 | 3300026041 | Ga0207639_10017601 | Ga0207639_100176013 | 249 |
| 1465 | 3300026041 | Ga0207639_10236597 | Ga0207639_102365972 | 249 |
| 1466 | 3300026116 | Ga0207674_10211435 | Ga0207674_102114352 | 249 |
| 1467 | 3300026142 | Ga0207698_10261724 | Ga0207698_102617242 | 249 |
| 1468 | 3300027866 | Ga0209813_10037038 | Ga0209813_100370382 | 249 |
| 1469 | 3300031548 | Ga0307408_100330796 | Ga0307408_1003307962 | 249 |
| 1470 | 3300031649 | Ga0307514_10181998 | Ga0307514_101819981 | 249 |
| 1471 | 3300031901 | Ga0307406_10000864 | Ga0307406_1000086411 | 249 |
| 1472 | 3300032002 | Ga0307416_100651167 | Ga0307416_1006511671 | 249 |
| 1473 | 3300046512 | Ga0495610_0022310 | Ga0495610_0022310_1756_2505 | 249 |
| 1474 | 3300046518 | Ga0495631_0000228 | Ga0495631_0000228_8883_9632 | 249 |
| 1475 | 3300046530 | Ga0495654_0065348 | Ga0495654_0065348_506_1255 | 249 |
| 1476 | 3300046660 | Ga0495625_0000044 | Ga0495625_0000044_197068_197901 | 249 |
| 1477 | 3300046660 | Ga0495625_0107409 | Ga0495625_0107409_497_1246 | 249 |
| 1478 | 3300046674 | Ga0495588_0054081 | Ga0495588_0054081_352_1101 | 249 |
| 1479 | 3300046683 | Ga0495658_0015865 | Ga0495658_0015865_643_1392 | 249 |
| 1480 | 3300047321 | Ga0495676_0226337 | Ga0495676_0226337_162_911 | 249 |
| 1481 | 3300048904 | Ga0496101_0039108 | Ga0496101_0039108_542_1336 | 249 |
| 1482 | 3300048919 | Ga0496116_0011622 | Ga0496116_0011622_1739_2557 | 249 |
| 1483 | 3300048919 | Ga0496116_0053310 | Ga0496116_0053310_1570_2403 | 249 |
| 1484 | 3300048920 | Ga0496117_0035938 | Ga0496117_0035938_163_912 | 249 |
| 1485 | 3300048921 | Ga0496118_0023095 | Ga0496118_0023095_2624_3373 | 249 |
| 1486 | 3300048921 | Ga0496118_0031236 | Ga0496118_0031236_2235_3068 | 249 |
| 1487 | 3300048921 | Ga0496118_0034548 | Ga0496118_0034548_1372_2121 | 249 |
| 1488 | 3300048924 | Ga0496121_0061301 | Ga0496121_0061301_1920_2669 | 249 |
| 1489 | 3300048924 | Ga0496121_0186898 | Ga0496121_0186898_355_1173 | 249 |
| 1490 | 3300048925 | Ga0496122_0128058 | Ga0496122_0128058_544_1293 | 249 |
| 1491 | 3300048926 | Ga0496123_0081613 | Ga0496123_0081613_419_1237 | 249 |
| 1492 | 3300048926 | Ga0496123_0140925 | Ga0496123_0140925_259_1008 | 249 |
| 1493 | 3300048927 | Ga0496124_0072208 | Ga0496124_0072208_580_1329 | 249 |
| 1494 | 3300048927 | Ga0496124_0106277 | Ga0496124_0106277_1389_2138 | 249 |
| 1495 | 3300048928 | Ga0496125_0027383 | Ga0496125_0027383_1482_2231 | 249 |
| 1496 | 3300048928 | Ga0496125_0198958 | Ga0496125_0198958_265_1014 | 249 |
| 1497 | 3300048929 | Ga0496126_0072855 | Ga0496126_0072855_1980_2729 | 249 |
| 1498 | 3300050489 | nmdc:mga03683_27041_c1 | nmdc:mga03683_27041_c1_169_918 | 249 |
| 1499 | 3300050489 | nmdc:mga03683_9155_c1 | nmdc:mga03683_9155_c1_1803_2636 | 249 |
| 1500 | 3300050490 | nmdc:mga03n38_11598_c1 | nmdc:mga03n38_11598_c1_2126_2959 | 249 |
| 1501 | 3300050491 | nmdc:mga00v17_13234_c1 | nmdc:mga00v17_13234_c1_2914_3747 | 249 |
| 1502 | 3300050494 | nmdc:mga06z11_259120_c1 | nmdc:mga06z11_259120_c1_173_949 | 249 |
| 1503 | 3300050494 | nmdc:mga06z11_62720_c1 | nmdc:mga06z11_62720_c1_214_1047 | 249 |
| 1504 | 3300050495 | nmdc:mga04h51_44314_c1 | nmdc:mga04h51_44314_c1_279_1055 | 249 |
| 1505 | 3300050496 | nmdc:mga07m45_1441_c1 | nmdc:mga07m45_1441_c1_3392_4168 | 249 |
| 1506 | 3300050496 | nmdc:mga07m45_17064_c2 | nmdc:mga07m45_17064_c2_1449_2282 | 249 |
| 1507 | 3300050496 | nmdc:mga07m45_208560_c1 | nmdc:mga07m45_208560_c1_93_842 | 249 |
| 1508 | 3300050516 | nmdc:mga0sz30_127678_c1 | nmdc:mga0sz30_127678_c1_63_896 | 249 |
| 1509 | 3300050516 | nmdc:mga0sz30_18248_c1 | nmdc:mga0sz30_18248_c1_1392_2141 | 249 |
| 1510 | 3300053093 | Ga0500651_0000097 | Ga0500651_0000097_20477_21226 | 249 |
| 1511 | 3300053110 | Ga0500571_000190 | Ga0500571_000190_12634_13383 | 249 |
| 1512 | 3300053118 | Ga0500594_0000766 | Ga0500594_0000766_4360_5109 | 249 |
| 1513 | 3300053120 | Ga0500597_087377 | Ga0500597_087377_459_1208 | 249 |
| 1514 | 3300053125 | Ga0500618_032668 | Ga0500618_032668_373_1122 | 249 |
| 1515 | 3300053133 | Ga0500655_008878 | Ga0500655_008878_289_1038 | 249 |
| 1516 | 3300053134 | Ga0500658_0000521 | Ga0500658_0000521_6213_6962 | 249 |
| 1517 | 3300053134 | Ga0500658_0000753 | Ga0500658_0000753_3358_4107 | 249 |
| 1518 | 3300053139 | Ga0500568_0003370 | Ga0500568_0003370_1170_1919 | 249 |
| 1519 | 3300053153 | Ga0500616_0077624 | Ga0500616_0077624_62_811 | 249 |
| 1520 | 3300053161 | Ga0500634_0015124 | Ga0500634_0015124_293_1042 | 249 |
| 1521 | 3300053729 | Ga0500625_019956 | Ga0500625_019956_2147_2980 | 249 |
| 1522 | 3300053735 | Ga0500596_016460 | Ga0500596_016460_87_920 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iuf-assembly1.cif.gz_B | crystal structure of anti-crispr protein acrva5 | 0.8171 | 165 | 209 |
| 7wg4-assembly1.cif.gz_A | dvaa-klate1 | 0.8031 | 28 | 246 |
| 7wg1-assembly2.cif.gz_B | dvaa-klate1 | 0.7709 | 28 | 246 |
| 7wfx-assembly2.cif.gz_B | evaa-klate1 | 0.7701 | 28 | 246 |
| 8j6v-assembly9.cif.gz_C | structure of yeast arginyl-trna-protein transferase 1 | 0.7665 | 27 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14133_140_264_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7082 | 112 | 232 | 3.40.50.1820 |
| af_Q9C776_322_467_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6959 | 111 | 237 | 3.40.630.30 |
| af_O06136_158_460_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6953 | 71 | 218 | 3.40.630.30 |
| af_P90914_254_388_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.6905 | 111 | 232 | 3.40.630.30 |
| af_O14133_140_264_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.6833 | 112 | 232 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C8TK06-F1-model_v4 | deleted | 0.905 | 7 | 243 |
|
| AF-A0A0B0EJN1-F1-model_v4 | Putative arginyl-tRNA--protein transferase (EC 2.3.2.8) | 0.9004 | 12 | 243 |
GO:0004057
GO:0005737 |
| AF-A0A370ASX8-F1-model_v4 | Arginyltransferase (EC 2.3.2.8) | 0.9001 | 12 | 243 |
GO:0004057
GO:0005737 GO:0008914 GO:0071596 |
| AF-A0A3M1DUD1-F1-model_v4 | Aspartate/glutamate leucyltransferase (EC 2.3.2.29) | 0.8992 | 12 | 243 |
GO:0004057
GO:0005737 GO:0008914 GO:0071596 |
| AF-A0A7Y3J0Z5-F1-model_v4 | Arginyltransferase (EC 2.3.2.8) | 0.8985 | 13 | 243 |
GO:0004057
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar