F494325

General Info

Members Datasets Scaffolds Average Seq Length
1489 470 1485 105

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0666508|Ga0395901_0666508_603_938
Length 111
Sequence MVMAKAKMRIRKGDDVVVLTGKDRGKRGTVLRIVDAGHVVVEGANKVKKHQRPNPMKGVAGGIIEREMPLHVSNVALFNPASSKGDRVGIKNLEDGRRVRFFKSNGEVVDA

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
120 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
226 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
262 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
263 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
264 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
267 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
268 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
269 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
276 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
277 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
290 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
292 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
298 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
302 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
303 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
304 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
305 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
306 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
307 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
308 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
309 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
310 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
311 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
312 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
313 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
314 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
315 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
316 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
317 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
320 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
321 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
322 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
323 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
324 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
325 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
326 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
327 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
328 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
329 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
330 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
331 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
332 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
333 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
334 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
335 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
336 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
337 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
338 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
348 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
351 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
352 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
358 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
359 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
366 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
370 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
371 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
372 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
373 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
408 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
409 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
410 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
425 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
432 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
433 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
434 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
435 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
440 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
441 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
442 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
443 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
463 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
464 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
465 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
466 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
469 639633007 Azoarcus olearius BH72 Isolate Unclassified
470 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 3.76
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 1.14
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1047948 3300002073 Bacteria 538
2 JGI24749J21850_1007294 3300002076 Bacteria 1540
3 JGI24034J26672_10030684 3300002239 Bacteria 875
4 JGI24751J29686_10112362 3300002459 Bacteria 571
5 Ga0058859_11810920 3300004798 Bacteria 1193
6 Ga0058863_11627892 3300004799 Bacteria 657
7 Ga0058860_10092512 3300004801 Bacteria 1276
8 Ga0058860_11632615 3300004801 Bacteria 639
9 Ga0058862_12003567 3300004803 Bacteria 500
10 Ga0058862_12369315 3300004803 Bacteria 676
11 Ga0058862_12759491 3300004803 Bacteria 978
12 Ga0065704_10036098 3300005289 Bacteria 885
13 Ga0065712_10014871 3300005290 Bacteria 1546
14 Ga0065715_10147379 3300005293 Bacteria 1771
15 Ga0065707_10189559 3300005295 Bacteria 1369
16 Ga0065707_10211389 3300005295 Bacteria 1253
17 Ga0065707_10215781 3300005295 Bacteria 1245
18 Ga0065707_10231340 3300005295 Bacteria 1173
19 Ga0065707_10350006 3300005295 Bacteria 920
20 Ga0065707_10410461 3300005295 Bacteria 842
21 Ga0065707_10456341 3300005295 Bacteria 795
22 Ga0065707_10611602 3300005295 Bacteria 684
23 Ga0070676_10037090 3300005328 Bacteria 2810
24 Ga0070676_10591011 3300005328 Bacteria 799
25 Ga0070676_10702666 3300005328 Bacteria 738
26 Ga0070683_102235097 3300005329 Bacteria 525
27 Ga0070690_100001051 3300005330 Bacteria 14153
28 Ga0070690_100013814 3300005330 Bacteria 4783
29 Ga0070690_100033805 3300005330 Bacteria 3202
30 Ga0070690_100091881 3300005330 Bacteria 2000
31 Ga0070690_100232037 3300005330 Bacteria 1298
32 Ga0070690_100407618 3300005330 Bacteria 1000
33 Ga0070690_100726687 3300005330 Bacteria 765
34 Ga0070677_10004529 3300005333 Bacteria 4536
35 Ga0070677_10299844 3300005333 Bacteria 816
36 Ga0068869_100000239 3300005334 Bacteria 28911
37 Ga0068869_100002849 3300005334 Bacteria 10479
38 Ga0068869_100009454 3300005334 Bacteria 6326
39 Ga0068869_100053176 3300005334 Bacteria 2943
40 Ga0068869_100227797 3300005334 Bacteria 1480
41 Ga0068869_100242099 3300005334 Bacteria 1437
42 Ga0070666_10020483 3300005335 Bacteria 4275
43 Ga0070666_10917492 3300005335 Bacteria 648
44 Ga0070666_10976170 3300005335 Bacteria 628
45 Ga0070680_100007954 3300005336 Bacteria 8092
46 Ga0070680_100191421 3300005336 Bacteria 1724
47 Ga0070680_100603844 3300005336 Bacteria 942
48 Ga0070680_101065211 3300005336 Bacteria 699
49 Ga0070680_101097666 3300005336 Bacteria 688
50 Ga0070680_101178063 3300005336 Bacteria 663
51 Ga0070680_101340089 3300005336 Bacteria 619
52 Ga0070682_100043573 3300005337 Bacteria 2776
53 Ga0070682_100068422 3300005337 Bacteria 2265
54 Ga0070682_100187720 3300005337 Bacteria 1449
55 Ga0070682_100405805 3300005337 Bacteria 1032
56 Ga0068868_100001937 3300005338 Bacteria 14202
57 Ga0068868_100100364 3300005338 Bacteria 2342
58 Ga0068868_100202081 3300005338 Bacteria 1657
59 Ga0068868_100277744 3300005338 Bacteria 1417
60 Ga0068868_100684721 3300005338 Bacteria 916
61 Ga0068868_101408459 3300005338 Bacteria 650
62 Ga0068868_101806907 3300005338 Bacteria 578
63 Ga0068868_101865165 3300005338 Bacteria 569
64 Ga0070689_100001590 3300005340 Bacteria 14486
65 Ga0070689_100010970 3300005340 Bacteria 6476
66 Ga0070689_100070703 3300005340 Bacteria 2725
67 Ga0070689_100232887 3300005340 Bacteria 1515
68 Ga0070689_100269821 3300005340 Bacteria 1408
69 Ga0070689_100327552 3300005340 Bacteria 1281
70 Ga0070689_101253941 3300005340 Bacteria 667
71 Ga0070691_10001529 3300005341 Bacteria 9951
72 Ga0070691_10104737 3300005341 Bacteria 1409
73 Ga0070691_10187248 3300005341 Bacteria 1080
74 Ga0070691_10662258 3300005341 Bacteria 623
75 Ga0070687_100009024 3300005343 Bacteria 4252
76 Ga0070687_100156344 3300005343 Bacteria 1343
77 Ga0070687_100361470 3300005343 Bacteria 940
78 Ga0070687_100460808 3300005343 Bacteria 848
79 Ga0070687_100954148 3300005343 Bacteria 618
80 Ga0070661_100150323 3300005344 Bacteria 1760
81 Ga0070661_100271767 3300005344 Bacteria 1313
82 Ga0070661_101029760 3300005344 Bacteria 684
83 Ga0070692_10023267 3300005345 Bacteria 3034
84 Ga0070692_10023401 3300005345 Bacteria 3027
85 Ga0070692_10147347 3300005345 Bacteria 1338
86 Ga0070668_100304035 3300005347 Bacteria 1338
87 Ga0070668_100714326 3300005347 Bacteria 885
88 Ga0070669_100102281 3300005353 Bacteria 2163
89 Ga0070669_100267656 3300005353 Bacteria 1365
90 Ga0070669_100426289 3300005353 Bacteria 1089
91 Ga0070669_101719786 3300005353 Bacteria 547
92 Ga0070675_100057111 3300005354 Bacteria 3217
93 Ga0070675_100352665 3300005354 Bacteria 1305
94 Ga0070675_100471326 3300005354 Bacteria 1128
95 Ga0070675_101157279 3300005354 Bacteria 712
96 Ga0070675_101765755 3300005354 Bacteria 571
97 Ga0070671_100340695 3300005355 Bacteria 1279
98 Ga0070671_100375053 3300005355 Bacteria 1215
99 Ga0070671_100826219 3300005355 Bacteria 807
100 Ga0070671_101569923 3300005355 Bacteria 583
101 Ga0070674_100014259 3300005356 Bacteria 4938
102 Ga0070674_100106716 3300005356 Bacteria 2050
103 Ga0070673_100177686 3300005364 Bacteria 1821
104 Ga0070673_100252247 3300005364 Bacteria 1538
105 Ga0070688_100062951 3300005365 Bacteria 2350
106 Ga0070688_100092946 3300005365 Bacteria 1974
107 Ga0070659_100975614 3300005366 Bacteria 743
108 Ga0070667_100097551 3300005367 Bacteria 2535
109 Ga0070667_100703035 3300005367 Bacteria 935
110 Ga0070709_10259538 3300005434 Bacteria 1255
111 Ga0070714_100064265 3300005435 Bacteria 3158
112 Ga0070714_100973792 3300005435 Bacteria 825
113 Ga0070713_100461083 3300005436 Bacteria 1195
114 Ga0070701_10003420 3300005438 Bacteria 6276
115 Ga0070701_10004910 3300005438 Bacteria 5473
116 Ga0070701_10256191 3300005438 Bacteria 1059
117 Ga0070701_10597077 3300005438 Bacteria 730
118 Ga0070701_10848949 3300005438 Bacteria 627
119 Ga0070701_11167394 3300005438 Bacteria 545
120 Ga0070711_100582225 3300005439 Bacteria 932
121 Ga0070711_101501762 3300005439 Bacteria 588
122 Ga0070705_100004151 3300005440 Bacteria 7079
123 Ga0070705_100025279 3300005440 Bacteria 3218
124 Ga0070705_100087011 3300005440 Bacteria 1936
125 Ga0070705_100118750 3300005440 Bacteria 1704
126 Ga0070705_100497651 3300005440 Bacteria 925
127 Ga0070705_100645443 3300005440 Bacteria 825
128 Ga0070705_100730473 3300005440 Bacteria 781
129 Ga0070705_101164724 3300005440 Bacteria 634
130 Ga0070705_101570558 3300005440 Bacteria 553
131 Ga0070705_101732436 3300005440 Bacteria 529
132 Ga0070700_100004810 3300005441 Bacteria 7084
133 Ga0070700_100008581 3300005441 Bacteria 5568
134 Ga0070700_100016206 3300005441 Bacteria 4243
135 Ga0070700_100022163 3300005441 Bacteria 3701
136 Ga0070700_100276590 3300005441 Bacteria 1215
137 Ga0070700_100951659 3300005441 Bacteria 703
138 Ga0070694_100001615 3300005444 Bacteria 13236
139 Ga0070694_100011413 3300005444 Bacteria 5502
140 Ga0070694_100171493 3300005444 Bacteria 1599
141 Ga0070694_100201519 3300005444 Bacteria 1484
142 Ga0070694_100253752 3300005444 Bacteria 1331
143 Ga0070694_100282423 3300005444 Bacteria 1266
144 Ga0070694_100455390 3300005444 Bacteria 1011
145 Ga0070694_100563771 3300005444 Bacteria 913
146 Ga0070694_100607104 3300005444 Bacteria 882
147 Ga0070694_100823067 3300005444 Bacteria 762
148 Ga0070694_100925809 3300005444 Bacteria 721
149 Ga0070694_100938272 3300005444 Bacteria 716
150 Ga0070694_101958670 3300005444 Bacteria 501
151 Ga0070708_100077421 3300005445 Bacteria 3005
152 Ga0070708_100270554 3300005445 Bacteria 1598
153 Ga0070663_100766300 3300005455 Bacteria 825
154 Ga0070663_101312334 3300005455 Bacteria 639
155 Ga0070678_100021374 3300005456 Bacteria 4266
156 Ga0070678_100205032 3300005456 Bacteria 1630
157 Ga0070678_100975082 3300005456 Bacteria 778
158 Ga0070662_100031910 3300005457 Bacteria 3700
159 Ga0070662_100225275 3300005457 Bacteria 1498
160 Ga0070662_101209235 3300005457 Bacteria 650
161 Ga0070681_10001245 3300005458 Bacteria 22156
162 Ga0070681_10010917 3300005458 Bacteria 8982
163 Ga0070681_10013972 3300005458 Bacteria 7989
164 Ga0070681_10084187 3300005458 Bacteria 3133
165 Ga0070681_11017592 3300005458 Bacteria 748
166 Ga0070681_11670671 3300005458 Bacteria 563
167 Ga0068867_100002002 3300005459 Bacteria 14223
168 Ga0068867_100020156 3300005459 Bacteria 4751
169 Ga0068867_100084552 3300005459 Bacteria 2397
170 Ga0068867_100192943 3300005459 Bacteria 1626
171 Ga0068867_100384697 3300005459 Bacteria 1179
172 Ga0068867_100510719 3300005459 Bacteria 1034
173 Ga0068867_100704112 3300005459 Bacteria 892
174 Ga0068867_101682857 3300005459 Bacteria 594
175 Ga0070685_10119525 3300005466 Bacteria 1634
176 Ga0070685_10146965 3300005466 Bacteria 1490
177 Ga0070706_100211323 3300005467 Bacteria 1812
178 Ga0070707_100064367 3300005468 Bacteria 3521
179 Ga0070707_100360224 3300005468 Bacteria 1413
180 Ga0070707_100878854 3300005468 Bacteria 861
181 Ga0070698_100068456 3300005471 Bacteria 3567
182 Ga0070698_100548218 3300005471 Bacteria 1096
183 Ga0070698_101074132 3300005471 Bacteria 753
184 Ga0070699_100114998 3300005518 Bacteria 2364
185 Ga0070699_101169279 3300005518 Bacteria 706
186 Ga0070679_100047981 3300005530 Bacteria 4255
187 Ga0070679_100085474 3300005530 Bacteria 3142
188 Ga0070679_100710531 3300005530 Bacteria 948
189 Ga0070684_100381722 3300005535 Bacteria 1298
190 Ga0068853_100113226 3300005539 Bacteria 2412
191 Ga0068853_100969412 3300005539 Bacteria 818
192 Ga0068853_101426199 3300005539 Bacteria 670
193 Ga0068853_102432824 3300005539 Bacteria 507
194 Ga0070672_100872148 3300005543 Bacteria 794
195 Ga0070672_101034153 3300005543 Bacteria 729
196 Ga0070672_101237293 3300005543 Bacteria 666
197 Ga0070686_100005386 3300005544 Bacteria 7079
198 Ga0070686_100008053 3300005544 Bacteria 5887
199 Ga0070686_100067971 3300005544 Bacteria 2323
200 Ga0070686_100104063 3300005544 Bacteria 1922
201 Ga0070686_100113557 3300005544 Bacteria 1849
202 Ga0070686_100209308 3300005544 Bacteria 1403
203 Ga0070686_100878460 3300005544 Bacteria 728
204 Ga0070686_100891871 3300005544 Bacteria 723
205 Ga0070695_100002452 3300005545 Bacteria 10674
206 Ga0070695_100053783 3300005545 Bacteria 2590
207 Ga0070695_100059957 3300005545 Bacteria 2465
208 Ga0070695_100067573 3300005545 Bacteria 2331
209 Ga0070695_100107065 3300005545 Bacteria 1891
210 Ga0070695_100405521 3300005545 Bacteria 1034
211 Ga0070695_100424260 3300005545 Bacteria 1013
212 Ga0070695_100688032 3300005545 Bacteria 811
213 Ga0070695_100768743 3300005545 Bacteria 770
214 Ga0070695_101384830 3300005545 Bacteria 583
215 Ga0070695_101521815 3300005545 Bacteria 557
216 Ga0070696_100008855 3300005546 Bacteria 6731
217 Ga0070696_100186775 3300005546 Bacteria 1540
218 Ga0070696_100210004 3300005546 Bacteria 1457
219 Ga0070696_100238297 3300005546 Bacteria 1371
220 Ga0070696_100288006 3300005546 Bacteria 1254
221 Ga0070696_100759477 3300005546 Bacteria 795
222 Ga0070696_100809684 3300005546 Bacteria 771
223 Ga0070696_100897544 3300005546 Bacteria 735
224 Ga0070693_100003958 3300005547 Bacteria 6952
225 Ga0070693_100104780 3300005547 Bacteria 1729
226 Ga0070693_100258602 3300005547 Bacteria 1157
227 Ga0070693_100599816 3300005547 Bacteria 795
228 Ga0070693_101049737 3300005547 Bacteria 619
229 Ga0070693_101068979 3300005547 Bacteria 614
230 Ga0070665_100243577 3300005548 Bacteria 1798
231 Ga0070665_101587846 3300005548 Bacteria 662
232 Ga0070704_100006092 3300005549 Bacteria 7079
233 Ga0070704_100008494 3300005549 Bacteria 6160
234 Ga0070704_100011692 3300005549 Bacteria 5393
235 Ga0070704_100011835 3300005549 Bacteria 5368
236 Ga0070704_100029374 3300005549 Bacteria 3670
237 Ga0070704_100035296 3300005549 Bacteria 3398
238 Ga0070704_100204957 3300005549 Bacteria 1594
239 Ga0070704_100612905 3300005549 Bacteria 958
240 Ga0070704_100696589 3300005549 Bacteria 900
241 Ga0070704_100947940 3300005549 Bacteria 776
242 Ga0070704_101192943 3300005549 Bacteria 694
243 Ga0068855_100025144 3300005563 Bacteria 7129
244 Ga0068855_100063116 3300005563 Bacteria 4324
245 Ga0070664_100129787 3300005564 Bacteria 2213
246 Ga0070664_100743942 3300005564 Bacteria 915
247 Ga0068857_100354237 3300005577 Bacteria 1360
248 Ga0068854_100008879 3300005578 Bacteria 6470
249 Ga0068856_100054039 3300005614 Bacteria 3960
250 Ga0068856_100066492 3300005614 Bacteria 3562
251 Ga0068856_100577812 3300005614 Bacteria 1145
252 Ga0070702_100003937 3300005615 Bacteria 6734
253 Ga0070702_100012107 3300005615 Bacteria 4310
254 Ga0070702_100014621 3300005615 Bacteria 3986
255 Ga0070702_100044682 3300005615 Bacteria 2502
256 Ga0070702_100297534 3300005615 Bacteria 1115
257 Ga0070702_100885338 3300005615 Bacteria 698
258 Ga0068852_100511042 3300005616 Bacteria 1198
259 Ga0068852_100701941 3300005616 Bacteria 1022
260 Ga0068852_101012256 3300005616 Bacteria 850
261 Ga0068852_102383740 3300005616 Bacteria 550
262 Ga0068859_100046188 3300005617 Bacteria 4374
263 Ga0068859_100077704 3300005617 Bacteria 3360
264 Ga0068859_100113425 3300005617 Bacteria 2774
265 Ga0068859_100323620 3300005617 Bacteria 1636
266 Ga0068859_100783542 3300005617 Bacteria 1042
267 Ga0068859_101566566 3300005617 Bacteria 727
268 Ga0068864_100114654 3300005618 Bacteria 2403
269 Ga0068864_100265233 3300005618 Bacteria 1599
270 Ga0068864_102210012 3300005618 Bacteria 557
271 Ga0068866_10000800 3300005718 Bacteria 14106
272 Ga0068866_10003079 3300005718 Bacteria 6876
273 Ga0068866_10003278 3300005718 Bacteria 6654
274 Ga0068866_10153563 3300005718 Bacteria 1336
275 Ga0068861_100001378 3300005719 Bacteria 15253
276 Ga0068861_100007917 3300005719 Bacteria 7311
277 Ga0068861_100008199 3300005719 Bacteria 7186
278 Ga0068861_100131548 3300005719 Bacteria 2031
279 Ga0068861_100208882 3300005719 Bacteria 1643
280 Ga0068861_100896050 3300005719 Bacteria 840
281 Ga0068861_101690539 3300005719 Bacteria 626
282 Ga0068851_10358403 3300005834 Bacteria 850
283 Ga0068870_10009891 3300005840 Bacteria 4355
284 Ga0068870_10034810 3300005840 Bacteria 2579
285 Ga0068870_10094428 3300005840 Bacteria 1679
286 Ga0068870_10395950 3300005840 Bacteria 897
287 Ga0068870_10555447 3300005840 Bacteria 774
288 Ga0068858_100015520 3300005842 Bacteria 7163
289 Ga0068858_100017672 3300005842 Bacteria 6684
290 Ga0068858_100572886 3300005842 Bacteria 1094
291 Ga0068858_100635651 3300005842 Bacteria 1037
292 Ga0068860_100019846 3300005843 Bacteria 6518
293 Ga0068860_100021123 3300005843 Bacteria 6304
294 Ga0068860_100170761 3300005843 Bacteria 2100
295 Ga0068860_100420719 3300005843 Bacteria 1324
296 Ga0068860_100799051 3300005843 Bacteria 957
297 Ga0068860_101433126 3300005843 Bacteria 712
298 Ga0068862_100006216 3300005844 Bacteria 9947
299 Ga0068862_100015629 3300005844 Bacteria 6304
300 Ga0068862_100142453 3300005844 Bacteria 2129
301 Ga0068862_100260635 3300005844 Bacteria 1582
302 Ga0068862_100328547 3300005844 Bacteria 1413
303 Ga0068862_101053408 3300005844 Bacteria 806
304 Ga0075364_10114391 3300006051 Bacteria 1803
305 Ga0070715_10068894 3300006163 Bacteria 1575
306 Ga0070715_10872492 3300006163 Bacteria 552
307 Ga0070715_10892148 3300006163 Bacteria 547
308 Ga0070716_100020284 3300006173 Bacteria 3488
309 Ga0075367_10701309 3300006178 Bacteria 644
310 Ga0075366_10019624 3300006195 Bacteria 3916
311 Ga0075366_10630568 3300006195 Bacteria 665
312 Ga0097621_100001348 3300006237 Bacteria 16895
313 Ga0097621_100041396 3300006237 Bacteria 3709
314 Ga0097621_100062852 3300006237 Bacteria 3050
315 Ga0097621_100180965 3300006237 Bacteria 1821
316 Ga0097621_100397084 3300006237 Bacteria 1234
317 Ga0097621_100554017 3300006237 Bacteria 1047
318 Ga0097621_100782777 3300006237 Bacteria 883
319 Ga0068871_100000763 3300006358 Bacteria 21687
320 Ga0068871_100001793 3300006358 Bacteria 14486
321 Ga0068871_100038968 3300006358 Bacteria 3800
322 Ga0068871_100066382 3300006358 Bacteria 2957
323 Ga0068871_100652894 3300006358 Bacteria 960
324 Ga0068871_101835926 3300006358 Bacteria 576
325 Ga0075428_100000047 3300006844 Bacteria 96882
326 Ga0075428_100000808 3300006844 Bacteria 32725
327 Ga0075428_100015919 3300006844 Bacteria 8320
328 Ga0075428_100022001 3300006844 Bacteria 7058
329 Ga0075428_100201562 3300006844 Bacteria 2151
330 Ga0075428_100382680 3300006844 Bacteria 1508
331 Ga0075428_101755829 3300006844 Bacteria 646
332 Ga0075430_100000579 3300006846 Bacteria 27829
333 Ga0075430_100012417 3300006846 Bacteria 7246
334 Ga0075430_100199474 3300006846 Bacteria 1662
335 Ga0075430_100257074 3300006846 Bacteria 1447
336 Ga0075430_100358361 3300006846 Bacteria 1204
337 Ga0075430_100461911 3300006846 Bacteria 1048
338 Ga0075430_100735127 3300006846 Bacteria 813
339 Ga0075430_101078377 3300006846 Bacteria 662
340 Ga0075430_101165459 3300006846 Bacteria 634
341 Ga0075430_101392324 3300006846 Bacteria 576
342 Ga0075431_100001591 3300006847 Bacteria 21135
343 Ga0075431_100025866 3300006847 Bacteria 6015
344 Ga0075431_100030007 3300006847 Bacteria 5600
345 Ga0075431_100140879 3300006847 Bacteria 2486
346 Ga0075431_100148177 3300006847 Bacteria 2417
347 Ga0075431_100418244 3300006847 Bacteria 1340
348 Ga0075431_100538566 3300006847 Bacteria 1156
349 Ga0075431_100577637 3300006847 Bacteria 1110
350 Ga0075431_100816275 3300006847 Bacteria 905
351 Ga0075431_100986936 3300006847 Bacteria 809
352 Ga0075431_102071627 3300006847 Bacteria 524
353 Ga0075433_10020651 3300006852 Bacteria 5511
354 Ga0075433_10083297 3300006852 Bacteria 2823
355 Ga0075433_10387311 3300006852 Bacteria 1234
356 Ga0075433_10702413 3300006852 Bacteria 886
357 Ga0075433_11268392 3300006852 Bacteria 639
358 Ga0075434_100000895 3300006871 Bacteria 23884
359 Ga0075434_100012054 3300006871 Bacteria 8182
360 Ga0075434_100032897 3300006871 Bacteria 5114
361 Ga0075434_100197979 3300006871 Bacteria 2029
362 Ga0075434_100345604 3300006871 Bacteria 1509
363 Ga0075434_100789255 3300006871 Bacteria 966
364 Ga0075434_101098347 3300006871 Bacteria 809
365 Ga0075434_101792878 3300006871 Bacteria 621
366 Ga0075429_100000047 3300006880 Bacteria 56773
367 Ga0075429_100000220 3300006880 Bacteria 38587
368 Ga0075429_100040647 3300006880 Bacteria 4049
369 Ga0075429_100095463 3300006880 Bacteria 2593
370 Ga0075429_100159107 3300006880 Bacteria 1978
371 Ga0075429_100206491 3300006880 Bacteria 1721
372 Ga0075429_100926024 3300006880 Bacteria 762
373 Ga0075429_101021785 3300006880 Bacteria 723
374 Ga0075429_101608711 3300006880 Bacteria 565
375 Ga0075429_101829282 3300006880 Bacteria 527
376 Ga0068865_100001223 3300006881 Bacteria 14933
377 Ga0068865_100005809 3300006881 Bacteria 7502
378 Ga0068865_100087295 3300006881 Bacteria 2254
379 Ga0068865_100633857 3300006881 Bacteria 907
380 Ga0068865_100744039 3300006881 Bacteria 841
381 Ga0068865_101234548 3300006881 Bacteria 662
382 Ga0075436_100000458 3300006914 Bacteria 26344
383 Ga0075436_100013476 3300006914 Bacteria 5597
384 Ga0075436_100107512 3300006914 Bacteria 1946
385 Ga0075436_100156624 3300006914 Bacteria 1605
386 Ga0075436_100394880 3300006914 Bacteria 1002
387 Ga0097620_100046188 3300006931 Bacteria 4374
388 Ga0097620_100077698 3300006931 Bacteria 3360
389 Ga0097620_100113427 3300006931 Bacteria 2774
390 Ga0097620_100323614 3300006931 Bacteria 1636
391 Ga0097620_100783525 3300006931 Bacteria 1042
392 Ga0097620_101566621 3300006931 Bacteria 727
393 Ga0075435_100005357 3300007076 Bacteria 8945
394 Ga0075435_100060011 3300007076 Bacteria 3083
395 Ga0075435_100136570 3300007076 Bacteria 2055
396 Ga0075435_100776647 3300007076 Bacteria 834
397 Ga0075435_101329386 3300007076 Bacteria 630
398 Ga0075435_101594073 3300007076 Bacteria 573
399 Ga0099794_10004598 3300007265 Bacteria 5446
400 Ga0099794_10038713 3300007265 Bacteria 2260
401 Ga0099794_10645373 3300007265 Bacteria 562
402 Ga0099795_10000373 3300007788 Bacteria 8087
403 Ga0099795_10100642 3300007788 Bacteria 1133
404 Ga0099795_10646093 3300007788 Bacteria 506
405 Ga0105251_10334631 3300009011 Bacteria 689
406 Ga0105250_10224149 3300009092 Bacteria 798
407 Ga0105240_12316737 3300009093 Bacteria 556
408 Ga0111539_10002099 3300009094 Bacteria 26631
409 Ga0111539_10030319 3300009094 Bacteria 6575
410 Ga0111539_10069995 3300009094 Bacteria 4142
411 Ga0111539_10148535 3300009094 Bacteria 2744
412 Ga0111539_10223146 3300009094 Bacteria 2195
413 Ga0111539_10309381 3300009094 Bacteria 1839
414 Ga0111539_10342356 3300009094 Bacteria 1741
415 Ga0111539_10454500 3300009094 Bacteria 1491
416 Ga0111539_10556014 3300009094 Bacteria 1336
417 Ga0111539_10710160 3300009094 Bacteria 1170
418 Ga0111539_11031804 3300009094 Bacteria 956
419 Ga0111539_11490837 3300009094 Bacteria 784
420 Ga0111539_12425279 3300009094 Bacteria 608
421 Ga0111539_12701363 3300009094 Bacteria 575
422 Ga0105245_10002556 3300009098 Bacteria 16384
423 Ga0105245_10010103 3300009098 Bacteria 8220
424 Ga0105245_10040665 3300009098 Bacteria 4143
425 Ga0105245_10082869 3300009098 Bacteria 2935
426 Ga0105245_10388920 3300009098 Bacteria 1391
427 Ga0105247_10426482 3300009101 Bacteria 951
428 Ga0105247_11360580 3300009101 Bacteria 573
429 Ga0114129_10008888 3300009147 Bacteria 14322
430 Ga0114129_10011902 3300009147 Bacteria 12373
431 Ga0114129_10414616 3300009147 Bacteria 1773
432 Ga0114129_11053150 3300009147 Bacteria 1021
433 Ga0114129_11386408 3300009147 Bacteria 868
434 Ga0114129_12918255 3300009147 Bacteria 565
435 Ga0114129_13315415 3300009147 Bacteria 520
436 Ga0105243_10003107 3300009148 Bacteria 13657
437 Ga0105243_10008999 3300009148 Bacteria 7631
438 Ga0105243_10010767 3300009148 Bacteria 6922
439 Ga0105243_10035000 3300009148 Bacteria 3892
440 Ga0105243_11714261 3300009148 Bacteria 657
441 Ga0105243_12321112 3300009148 Bacteria 574
442 Ga0105241_10015944 3300009174 Bacteria 5506
443 Ga0105241_10411605 3300009174 Bacteria 1188
444 Ga0105241_11346348 3300009174 Bacteria 682
445 Ga0105242_10002800 3300009176 Bacteria 13659
446 Ga0105242_10009166 3300009176 Bacteria 7598
447 Ga0105242_10009973 3300009176 Bacteria 7273
448 Ga0105242_10026750 3300009176 Bacteria 4575
449 Ga0105242_10178692 3300009176 Bacteria 1871
450 Ga0105242_10622754 3300009176 Bacteria 1046
451 Ga0105242_11909735 3300009176 Unclassified 634
452 Ga0105248_10010314 3300009177 Bacteria 10284
453 Ga0105248_10118417 3300009177 Bacteria 2987
454 Ga0105248_10167563 3300009177 Bacteria 2476
455 Ga0105248_11013096 3300009177 Bacteria 938
456 Ga0105248_11197859 3300009177 Bacteria 859
457 Ga0105248_12936476 3300009177 Bacteria 543
458 Ga0105237_10022429 3300009545 Bacteria 6478
459 Ga0105237_11198094 3300009545 Bacteria 766
460 Ga0105237_11379321 3300009545 Bacteria 711
461 Ga0105238_10382103 3300009551 Bacteria 1400
462 Ga0105238_10631642 3300009551 Bacteria 1080
463 Ga0105238_12176484 3300009551 Bacteria 589
464 Ga0105249_10010299 3300009553 Bacteria 8213
465 Ga0105249_10078757 3300009553 Bacteria 3058
466 Ga0105249_10363778 3300009553 Bacteria 1469
467 Ga0105249_10781348 3300009553 Bacteria 1018
468 Ga0105249_11039131 3300009553 Bacteria 889
469 Ga0099796_10001027 3300010159 Bacteria 5287
470 Ga0099796_10442540 3300010159 Bacteria 577
471 Ga0105239_10185378 3300010375 Bacteria 2329
472 Ga0105239_10220259 3300010375 Bacteria 2128
473 Ga0105239_11344751 3300010375 Bacteria 824
474 Ga0105246_10094546 3300011119 Bacteria 2162
475 Ga0105246_10153679 3300011119 Bacteria 1745
476 Ga0157345_1012699 3300012498 Bacteria 765
477 Ga0157313_1010149 3300012503 Bacteria 793
478 Ga0157371_11199658 3300013102 Bacteria 585
479 Ga0157369_12469926 3300013105 Bacteria 526
480 Ga0157369_12586799 3300013105 Bacteria 513
481 Ga0157374_10129323 3300013296 Bacteria 2443
482 Ga0157374_10138530 3300013296 Bacteria 2361
483 Ga0157374_10500063 3300013296 Bacteria 1220
484 Ga0157374_10894281 3300013296 Bacteria 905
485 Ga0157374_11020618 3300013296 Bacteria 847
486 Ga0157378_10007830 3300013297 Bacteria 9326
487 Ga0157378_10021639 3300013297 Bacteria 5655
488 Ga0157378_10043237 3300013297 Bacteria 4000
489 Ga0157378_10058507 3300013297 Bacteria 3437
490 Ga0157378_10174132 3300013297 Bacteria 2020
491 Ga0157378_12266128 3300013297 Bacteria 595
492 Ga0163162_10060008 3300013306 Bacteria 3837
493 Ga0163162_11071065 3300013306 Bacteria 913
494 Ga0157372_11333582 3300013307 Bacteria 828
495 Ga0157372_13314326 3300013307 Bacteria 513
496 Ga0157375_10042447 3300013308 Bacteria 4402
497 Ga0157375_11557245 3300013308 Bacteria 781
498 Ga0157375_12645822 3300013308 Bacteria 600
499 Ga0157375_13364554 3300013308 Bacteria 533
500 Ga0163163_10278391 3300014325 Bacteria 1724
501 Ga0163163_11656453 3300014325 Bacteria 700
502 Ga0157380_10024376 3300014326 Bacteria 4579
503 Ga0157380_10026469 3300014326 Bacteria 4403
504 Ga0157380_10033551 3300014326 Bacteria 3953
505 Ga0157380_10301196 3300014326 Bacteria 1477
506 Ga0157380_10855544 3300014326 Bacteria 932
507 Ga0157380_11003438 3300014326 Bacteria 868
508 Ga0157380_12491876 3300014326 Bacteria 583
509 Ga0157377_10172095 3300014745 Bacteria 1355
510 Ga0157377_10527454 3300014745 Bacteria 830
511 Ga0157379_10030185 3300014968 Bacteria 4823
512 Ga0157379_10079870 3300014968 Bacteria 2930
513 Ga0157379_10149967 3300014968 Bacteria 2103
514 Ga0157379_10982775 3300014968 Bacteria 804
515 Ga0157379_11765093 3300014968 Bacteria 607
516 Ga0157376_10110927 3300014969 Bacteria 2414
517 Ga0157376_10160305 3300014969 Bacteria 2038
518 Ga0157376_10340930 3300014969 Bacteria 1431
519 Ga0157376_10864239 3300014969 Bacteria 921
520 Ga0157376_10928353 3300014969 Bacteria 890
521 Ga0163161_10045011 3300017792 Bacteria 3181
522 Ga0163161_10070887 3300017792 Bacteria 2549
523 Ga0163161_10214617 3300017792 Bacteria 1488
524 Ga0213871_10066730 3300021441 Bacteria 1010
525 Ga0207697_10001157 3300025315 Bacteria 14504
526 Ga0207696_1039049 3300025711 Bacteria 1398
527 Ga0207653_10032461 3300025885 Bacteria 1689
528 Ga0207682_10006357 3300025893 Bacteria 4766
529 Ga0207642_10000436 3300025899 Bacteria 12598
530 Ga0207642_10004830 3300025899 Bacteria 4362
531 Ga0207642_10256973 3300025899 Bacteria 994
532 Ga0207688_10002803 3300025901 Bacteria 9458
533 Ga0207688_10417319 3300025901 Bacteria 834
534 Ga0207680_10058987 3300025903 Bacteria 2329
535 Ga0207680_11343909 3300025903 Bacteria 508
536 Ga0207647_10367431 3300025904 Bacteria 813
537 Ga0207647_10551852 3300025904 Bacteria 639
538 Ga0207699_10189684 3300025906 Bacteria 1386
539 Ga0207645_10004332 3300025907 Bacteria 10510
540 Ga0207645_10178952 3300025907 Bacteria 1391
541 Ga0207645_10307354 3300025907 Bacteria 1056
542 Ga0207645_10433313 3300025907 Bacteria 886
543 Ga0207643_10001343 3300025908 Bacteria 14235
544 Ga0207643_10005493 3300025908 Bacteria 6776
545 Ga0207643_10011769 3300025908 Bacteria 4722
546 Ga0207643_10022628 3300025908 Bacteria 3462
547 Ga0207643_10041264 3300025908 Bacteria 2600
548 Ga0207684_10150016 3300025910 Bacteria 2006
549 Ga0207684_10529555 3300025910 Bacteria 1009
550 Ga0207684_11530737 3300025910 Bacteria 542
551 Ga0207654_10324813 3300025911 Bacteria 1053
552 Ga0207654_10435628 3300025911 Bacteria 917
553 Ga0207654_10442822 3300025911 Bacteria 910
554 Ga0207707_10007445 3300025912 Bacteria 9539
555 Ga0207707_10015921 3300025912 Bacteria 6559
556 Ga0207707_10036525 3300025912 Bacteria 4294
557 Ga0207707_10168268 3300025912 Bacteria 1915
558 Ga0207707_11434459 3300025912 Bacteria 549
559 Ga0207695_11684538 3300025913 Bacteria 515
560 Ga0207671_10095133 3300025914 Bacteria 2249
561 Ga0207671_10645383 3300025914 Bacteria 843
562 Ga0207663_10321063 3300025916 Bacteria 1164
563 Ga0207660_10001979 3300025917 Bacteria 13656
564 Ga0207660_10329659 3300025917 Bacteria 1220
565 Ga0207660_10377482 3300025917 Bacteria 1139
566 Ga0207660_10397067 3300025917 Bacteria 1110
567 Ga0207660_10412360 3300025917 Bacteria 1089
568 Ga0207660_10933070 3300025917 Bacteria 708
569 Ga0207660_11236643 3300025917 Bacteria 607
570 Ga0207662_10000006 3300025918 Bacteria 105457
571 Ga0207662_10009139 3300025918 Bacteria 5448
572 Ga0207662_10073771 3300025918 Bacteria 2070
573 Ga0207662_10117611 3300025918 Bacteria 1664
574 Ga0207662_10299255 3300025918 Bacteria 1069
575 Ga0207662_10299630 3300025918 Bacteria 1068
576 Ga0207662_10365384 3300025918 Bacteria 972
577 Ga0207649_10478856 3300025920 Bacteria 944
578 Ga0207652_10016184 3300025921 Bacteria 6084
579 Ga0207652_10224142 3300025921 Bacteria 1694
580 Ga0207652_10287808 3300025921 Bacteria 1483
581 Ga0207652_10641966 3300025921 Bacteria 950
582 Ga0207652_10770365 3300025921 Bacteria 856
583 Ga0207652_10935800 3300025921 Bacteria 764
584 Ga0207646_10027133 3300025922 Bacteria 5222
585 Ga0207646_10087238 3300025922 Bacteria 2792
586 Ga0207646_10527520 3300025922 Bacteria 1063
587 Ga0207646_10916132 3300025922 Bacteria 777
588 Ga0207646_11101336 3300025922 Bacteria 699
589 Ga0207681_10003287 3300025923 Bacteria 10121
590 Ga0207681_10213883 3300025923 Bacteria 1487
591 Ga0207694_10318822 3300025924 Bacteria 1282
592 Ga0207650_10145986 3300025925 Bacteria 1863
593 Ga0207650_10183495 3300025925 Bacteria 1669
594 Ga0207659_10979955 3300025926 Bacteria 727
595 Ga0207687_10001080 3300025927 Bacteria 18512
596 Ga0207687_10104647 3300025927 Bacteria 2090
597 Ga0207687_10309937 3300025927 Bacteria 1274
598 Ga0207687_10976394 3300025927 Bacteria 726
599 Ga0207687_11080102 3300025927 Bacteria 689
600 Ga0207687_11452979 3300025927 Bacteria 589
601 Ga0207700_11071530 3300025928 Bacteria 721
602 Ga0207664_10094691 3300025929 Bacteria 2455
603 Ga0207664_10629554 3300025929 Bacteria 964
604 Ga0207644_10021011 3300025931 Bacteria 4445
605 Ga0207644_10136885 3300025931 Bacteria 1881
606 Ga0207644_11328367 3300025931 Bacteria 604
607 Ga0207690_11707372 3300025932 Bacteria 526
608 Ga0207706_10006693 3300025933 Bacteria 10657
609 Ga0207706_10158436 3300025933 Bacteria 1990
610 Ga0207706_10217951 3300025933 Bacteria 1672
611 Ga0207706_10535139 3300025933 Bacteria 1009
612 Ga0207686_10001285 3300025934 Bacteria 14428
613 Ga0207686_10007495 3300025934 Bacteria 5874
614 Ga0207686_10015693 3300025934 Bacteria 4240
615 Ga0207686_10018577 3300025934 Bacteria 3939
616 Ga0207686_10134223 3300025934 Bacteria 1702
617 Ga0207686_10313576 3300025934 Bacteria 1169
618 Ga0207709_10005880 3300025935 Bacteria 6927
619 Ga0207709_10006627 3300025935 Bacteria 6498
620 Ga0207709_10007251 3300025935 Bacteria 6185
621 Ga0207709_10580959 3300025935 Bacteria 885
622 Ga0207670_10005366 3300025936 Bacteria 7029
623 Ga0207670_10032595 3300025936 Bacteria 3352
624 Ga0207670_10131537 3300025936 Bacteria 1834
625 Ga0207670_10196223 3300025936 Bacteria 1531
626 Ga0207670_10255423 3300025936 Bacteria 1356
627 Ga0207670_10644838 3300025936 Bacteria 873
628 Ga0207669_10023463 3300025937 Bacteria 3296
629 Ga0207669_10341596 3300025937 Bacteria 1153
630 Ga0207669_10441409 3300025937 Bacteria 1029
631 Ga0207704_10000913 3300025938 Bacteria 13073
632 Ga0207704_10007008 3300025938 Bacteria 5296
633 Ga0207704_10378324 3300025938 Bacteria 1111
634 Ga0207704_10397644 3300025938 Bacteria 1086
635 Ga0207704_10404401 3300025938 Bacteria 1078
636 Ga0207704_10556179 3300025938 Bacteria 933
637 Ga0207665_10128034 3300025939 Bacteria 1799
638 Ga0207665_10739134 3300025939 Bacteria 775
639 Ga0207691_10010153 3300025940 Bacteria 9035
640 Ga0207691_10054461 3300025940 Bacteria 3648
641 Ga0207691_10119744 3300025940 Bacteria 2334
642 Ga0207691_10457538 3300025940 Bacteria 1086
643 Ga0207691_10817306 3300025940 Bacteria 783
644 Ga0207711_10028146 3300025941 Bacteria 4727
645 Ga0207711_10091045 3300025941 Bacteria 2682
646 Ga0207711_10112488 3300025941 Bacteria 2423
647 Ga0207689_10000292 3300025942 Bacteria 45545
648 Ga0207689_10000370 3300025942 Bacteria 42422
649 Ga0207689_10008334 3300025942 Bacteria 9029
650 Ga0207689_10014115 3300025942 Bacteria 6799
651 Ga0207689_10055992 3300025942 Bacteria 3245
652 Ga0207689_10988038 3300025942 Bacteria 710
653 Ga0207661_10269908 3300025944 Bacteria 1518
654 Ga0207661_10339098 3300025944 Bacteria 1354
655 Ga0207679_11090378 3300025945 Bacteria 733
656 Ga0207667_10002489 3300025949 Bacteria 22959
657 Ga0207667_10051427 3300025949 Bacteria 4344
658 Ga0207667_10395785 3300025949 Bacteria 1407
659 Ga0207651_10184977 3300025960 Bacteria 1656
660 Ga0207651_10223361 3300025960 Bacteria 1524
661 Ga0207651_10428996 3300025960 Bacteria 1130
662 Ga0207651_10465783 3300025960 Bacteria 1087
663 Ga0207651_10504095 3300025960 Bacteria 1047
664 Ga0207712_10002872 3300025961 Bacteria 11017
665 Ga0207712_10007287 3300025961 Bacteria 6976
666 Ga0207712_10015338 3300025961 Bacteria 4940
667 Ga0207712_10104420 3300025961 Bacteria 2113
668 Ga0207712_11041495 3300025961 Bacteria 727
669 Ga0207640_10005329 3300025981 Bacteria 7007
670 Ga0207640_10937507 3300025981 Bacteria 758
671 Ga0207658_11457772 3300025986 Bacteria 626
672 Ga0207677_10002702 3300026023 Bacteria 9350
673 Ga0207677_10024488 3300026023 Bacteria 3752
674 Ga0207677_10189354 3300026023 Bacteria 1626
675 Ga0207677_10258705 3300026023 Bacteria 1418
676 Ga0207677_10258859 3300026023 Bacteria 1417
677 Ga0207677_10599005 3300026023 Bacteria 967
678 Ga0207677_10903902 3300026023 Bacteria 796
679 Ga0207703_10004381 3300026035 Bacteria 11604
680 Ga0207703_10043986 3300026035 Bacteria 3587
681 Ga0207703_10283662 3300026035 Bacteria 1505
682 Ga0207703_10405619 3300026035 Bacteria 1265
683 Ga0207703_10503103 3300026035 Bacteria 1138
684 Ga0207703_10585668 3300026035 Bacteria 1054
685 Ga0207703_12192858 3300026035 Bacteria 528
686 Ga0207639_10045614 3300026041 Bacteria 3302
687 Ga0207639_11161545 3300026041 Bacteria 724
688 Ga0207639_11646932 3300026041 Bacteria 602
689 Ga0207678_10133179 3300026067 Bacteria 2121
690 Ga0207708_10004151 3300026075 Bacteria 10655
691 Ga0207708_10005800 3300026075 Bacteria 9127
692 Ga0207708_10057714 3300026075 Bacteria 2962
693 Ga0207708_10200386 3300026075 Bacteria 1592
694 Ga0207708_10416415 3300026075 Bacteria 1113
695 Ga0207708_10420592 3300026075 Bacteria 1108
696 Ga0207702_10040250 3300026078 Bacteria 3919
697 Ga0207702_10220360 3300026078 Bacteria 1768
698 Ga0207702_10993020 3300026078 Bacteria 833
699 Ga0207702_11627321 3300026078 Bacteria 639
700 Ga0207702_11778236 3300026078 Bacteria 609
701 Ga0207641_10078861 3300026088 Bacteria 2853
702 Ga0207641_10233491 3300026088 Bacteria 1710
703 Ga0207648_10004560 3300026089 Bacteria 14202
704 Ga0207648_10008885 3300026089 Bacteria 9673
705 Ga0207648_10008905 3300026089 Bacteria 9661
706 Ga0207648_10063803 3300026089 Bacteria 3210
707 Ga0207648_10190278 3300026089 Bacteria 1818
708 Ga0207648_10399210 3300026089 Bacteria 1246
709 Ga0207648_11540271 3300026089 Bacteria 625
710 Ga0207676_10018878 3300026095 Bacteria 5020
711 Ga0207676_10291139 3300026095 Bacteria 1487
712 Ga0207676_10437772 3300026095 Bacteria 1230
713 Ga0207676_11629124 3300026095 Bacteria 643
714 Ga0207676_11822496 3300026095 Bacteria 607
715 Ga0207674_10007832 3300026116 Bacteria 12420
716 Ga0207674_10057822 3300026116 Bacteria 3931
717 Ga0207674_10058297 3300026116 Bacteria 3912
718 Ga0207675_100004342 3300026118 Bacteria 13698
719 Ga0207675_100006269 3300026118 Bacteria 11287
720 Ga0207675_100010565 3300026118 Bacteria 8650
721 Ga0207675_100013573 3300026118 Bacteria 7605
722 Ga0207675_100059255 3300026118 Bacteria 3573
723 Ga0207675_101635540 3300026118 Bacteria 664
724 Ga0207683_10007403 3300026121 Bacteria 9411
725 Ga0207683_10041485 3300026121 Bacteria 4018
726 Ga0207683_10130176 3300026121 Bacteria 2263
727 Ga0207683_10154381 3300026121 Bacteria 2073
728 Ga0207683_11198099 3300026121 Bacteria 704
729 Ga0207698_10050988 3300026142 Bacteria 3162
730 Ga0207698_10466331 3300026142 Bacteria 1222
731 Ga0207698_11157997 3300026142 Bacteria 787
732 Ga0209973_1087373 3300027252 Bacteria 500
733 Ga0209969_1000547 3300027360 Bacteria 5071
734 Ga0209969_1002984 3300027360 Bacteria 2343
735 Ga0209969_1073969 3300027360 Bacteria 543
736 Ga0209967_1000358 3300027364 Bacteria 6044
737 Ga0209967_1002852 3300027364 Bacteria 2258
738 Ga0209967_1007341 3300027364 Bacteria 1507
739 Ga0209981_1000434 3300027378 Bacteria 5302
740 Ga0209981_1002861 3300027378 Bacteria 2215
741 Ga0209981_1026935 3300027378 Bacteria 836
742 Ga0209996_1007434 3300027395 Bacteria 1425
743 Ga0209996_1012987 3300027395 Bacteria 1122
744 Ga0209996_1017859 3300027395 Bacteria 982
745 Ga0209996_1045320 3300027395 Bacteria 660
746 Ga0209996_1047639 3300027395 Bacteria 645
747 Ga0209984_1060594 3300027424 Bacteria 560
748 Ga0210000_1001641 3300027462 Bacteria 3159
749 Ga0210000_1006381 3300027462 Bacteria 1716
750 Ga0210000_1022258 3300027462 Bacteria 972
751 Ga0210000_1041021 3300027462 Bacteria 734
752 Ga0210000_1078846 3300027462 Bacteria 540
753 Ga0209995_1010585 3300027471 Bacteria 1497
754 Ga0209995_1020156 3300027471 Bacteria 1102
755 Ga0209995_1083857 3300027471 Bacteria 547
756 Ga0209179_1001842 3300027512 Bacteria 2719
757 Ga0209968_1064292 3300027526 Bacteria 649
758 Ga0209999_1010791 3300027543 Bacteria 1651
759 Ga0209999_1030844 3300027543 Bacteria 995
760 Ga0209999_1031291 3300027543 Bacteria 988
761 Ga0209999_1034116 3300027543 Bacteria 947
762 Ga0209982_1008959 3300027552 Bacteria 1474
763 Ga0209970_1039948 3300027614 Bacteria 833
764 Ga0209970_1092818 3300027614 Bacteria 573
765 Ga0209983_1003146 3300027665 Bacteria 3549
766 Ga0209983_1080830 3300027665 Bacteria 728
767 Ga0209588_1005292 3300027671 Bacteria 3690
768 Ga0209588_1061196 3300027671 Bacteria 1217
769 Ga0209971_1000807 3300027682 Bacteria 8071
770 Ga0209971_1006804 3300027682 Bacteria 2709
771 Ga0209971_1006907 3300027682 Bacteria 2692
772 Ga0209966_1002355 3300027695 Bacteria 3147
773 Ga0209966_1005071 3300027695 Bacteria 2249
774 Ga0209966_1035847 3300027695 Bacteria 1019
775 Ga0209966_1048597 3300027695 Bacteria 898
776 Ga0209998_10019418 3300027717 Bacteria 1448
777 Ga0209974_10000163 3300027876 Bacteria 20307
778 Ga0209974_10060324 3300027876 Bacteria 1284
779 Ga0207428_10002412 3300027907 Bacteria 18661
780 Ga0207428_10009607 3300027907 Bacteria 8666
781 Ga0207428_10047143 3300027907 Bacteria 3461
782 Ga0207428_10357483 3300027907 Bacteria 1074
783 Ga0207428_10438154 3300027907 Bacteria 954
784 Ga0207428_10573199 3300027907 Bacteria 815
785 Ga0268266_10380414 3300028379 Bacteria 1331
786 Ga0268265_10000858 3300028380 Bacteria 28507
787 Ga0268265_10004065 3300028380 Bacteria 10284
788 Ga0268265_10188685 3300028380 Bacteria 1778
789 Ga0268265_10247238 3300028380 Bacteria 1577
790 Ga0268265_10262411 3300028380 Bacteria 1536
791 Ga0268264_10003087 3300028381 Bacteria 14417
792 Ga0268264_10044828 3300028381 Bacteria 3670
793 Ga0268264_10138389 3300028381 Bacteria 2168
794 Ga0268264_10145830 3300028381 Bacteria 2116
795 Ga0268264_10651704 3300028381 Bacteria 1042
796 Ga0268264_11125347 3300028381 Bacteria 794
797 Ga0265318_10002940 3300028577 Bacteria 8845
798 Ga0265338_10389059 3300028800 Bacteria 996
799 Ga0265324_10251776 3300029957 Bacteria 600
800 Ga0265330_10032242 3300031235 Bacteria 2347
801 Ga0265332_10002675 3300031238 Bacteria 8936
802 Ga0265328_10021129 3300031239 Bacteria 2487
803 Ga0265328_10184284 3300031239 Bacteria 790
804 Ga0265320_10033040 3300031240 Bacteria 2644
805 Ga0265329_10005644 3300031242 Bacteria 5034
806 Ga0265329_10192013 3300031242 Bacteria 670
807 Ga0265339_10444206 3300031249 Bacteria 602
808 Ga0265331_10004043 3300031250 Bacteria 9240
809 Ga0265327_10290252 3300031251 Bacteria 722
810 Ga0265316_10026805 3300031344 Bacteria 4786
811 Ga0265316_10029265 3300031344 Bacteria 4531
812 Ga0265316_10473472 3300031344 Bacteria 897
813 Ga0307509_10000050 3300031507 Bacteria 165692
814 Ga0307509_10629011 3300031507 Bacteria 744
815 Ga0307408_100094279 3300031548 Bacteria 2266
816 Ga0307408_100481016 3300031548 Bacteria 1083
817 Ga0307408_100496673 3300031548 Bacteria 1067
818 Ga0307408_100775553 3300031548 Bacteria 868
819 Ga0307408_100875472 3300031548 Bacteria 820
820 Ga0307408_101201984 3300031548 Bacteria 707
821 Ga0307408_101563293 3300031548 Bacteria 625
822 Ga0265313_10158854 3300031595 Bacteria 961
823 Ga0316575_10004197 3300031665 Bacteria 5056
824 Ga0316575_10017794 3300031665 Bacteria 2703
825 Ga0316575_10081963 3300031665 Bacteria 1302
826 Ga0316579_10000104 3300031691 Bacteria 22526
827 Ga0316579_10003374 3300031691 Bacteria 6211
828 Ga0316579_10003879 3300031691 Bacteria 5891
829 Ga0316579_10007430 3300031691 Bacteria 4525
830 Ga0265314_10000765 3300031711 Bacteria 38412
831 Ga0265342_10065682 3300031712 Bacteria 2125
832 Ga0316576_10000067 3300031727 Bacteria 34602
833 Ga0316576_10000365 3300031727 Bacteria 20446
834 Ga0316576_10000685 3300031727 Bacteria 16585
835 Ga0316578_10000046 3300031728 Bacteria 25015
836 Ga0316578_10014712 3300031728 Bacteria 4188
837 Ga0316578_10331986 3300031728 Bacteria 906
838 Ga0307405_10541915 3300031731 Bacteria 940
839 Ga0307405_10648164 3300031731 Bacteria 868
840 Ga0307405_11075493 3300031731 Bacteria 690
841 Ga0307405_11174540 3300031731 Bacteria 663
842 Ga0307405_11235792 3300031731 Bacteria 647
843 Ga0316577_10000967 3300031733 Bacteria 12817
844 Ga0316577_10001498 3300031733 Bacteria 11066
845 Ga0316577_10231157 3300031733 Bacteria 1045
846 Ga0316577_10334178 3300031733 Bacteria 859
847 Ga0307413_10646002 3300031824 Bacteria 872
848 Ga0307410_10129185 3300031852 Bacteria 1854
849 Ga0307410_10499049 3300031852 Bacteria 1001
850 Ga0307410_10539868 3300031852 Bacteria 965
851 Ga0307406_10160574 3300031901 Bacteria 1615
852 Ga0307406_10320343 3300031901 Bacteria 1199
853 Ga0307406_10809428 3300031901 Bacteria 791
854 Ga0307406_10885182 3300031901 Bacteria 759
855 Ga0307406_11700694 3300031901 Bacteria 559
856 Ga0307407_10071899 3300031903 Bacteria 2061
857 Ga0307407_10335767 3300031903 Bacteria 1065
858 Ga0307407_10356734 3300031903 Bacteria 1037
859 Ga0307407_10437732 3300031903 Bacteria 946
860 Ga0307407_11191000 3300031903 Bacteria 595
861 Ga0307407_11620201 3300031903 Bacteria 514
862 Ga0307412_10302433 3300031911 Bacteria 1265
863 Ga0307412_10311817 3300031911 Bacteria 1248
864 Ga0307412_10696821 3300031911 Bacteria 871
865 Ga0307412_11211459 3300031911 Bacteria 676
866 Ga0307409_100176131 3300031995 Bacteria 1888
867 Ga0307409_102532670 3300031995 Bacteria 542
868 Ga0307416_100030489 3300032002 Bacteria 4047
869 Ga0307416_100035079 3300032002 Bacteria 3826
870 Ga0307416_100100966 3300032002 Bacteria 2511
871 Ga0307416_100189830 3300032002 Bacteria 1936
872 Ga0307416_100349609 3300032002 Bacteria 1495
873 Ga0307416_100521706 3300032002 Bacteria 1256
874 Ga0307416_100585693 3300032002 Bacteria 1193
875 Ga0307416_101314390 3300032002 Bacteria 829
876 Ga0307416_101329746 3300032002 Bacteria 824
877 Ga0307416_102621660 3300032002 Bacteria 601
878 Ga0307416_103092088 3300032002 Bacteria 557
879 Ga0307414_10128163 3300032004 Bacteria 1965
880 Ga0307411_10035780 3300032005 Bacteria 3105
881 Ga0307411_10041460 3300032005 Bacteria 2929
882 Ga0307411_10102375 3300032005 Bacteria 2029
883 Ga0307411_10167736 3300032005 Bacteria 1652
884 Ga0307411_10251546 3300032005 Bacteria 1390
885 Ga0307411_10326768 3300032005 Bacteria 1241
886 Ga0307411_10489053 3300032005 Bacteria 1038
887 Ga0307415_100499359 3300032126 Bacteria 1063
888 Ga0307415_101487925 3300032126 Bacteria 647
889 Ga0307415_102263446 3300032126 Bacteria 533
890 Ga0316583_10009674 3300032133 Bacteria 3473
891 Ga0316583_10019777 3300032133 Bacteria 2414
892 Ga0316583_10135774 3300032133 Bacteria 857
893 Ga0316585_10000029 3300032137 Bacteria 21513
894 Ga0316585_10010856 3300032137 Bacteria 2677
895 Ga0316585_10028503 3300032137 Bacteria 1746
896 Ga0316585_10036638 3300032137 Bacteria 1555
897 Ga0316580_10000016 3300032139 Bacteria 26098
898 Ga0316580_10096148 3300032139 Bacteria 906
899 Ga0316593_10000167 3300032168 Bacteria 9674
900 Ga0316593_10000170 3300032168 Bacteria 9614
901 Ga0316593_10000387 3300032168 Bacteria 7860
902 Ga0316593_10000468 3300032168 Bacteria 7436
903 Ga0316593_10001038 3300032168 Bacteria 5773
904 Ga0316593_10001508 3300032168 Bacteria 5159
905 Ga0316593_10001676 3300032168 Bacteria 4993
906 Ga0316593_10002414 3300032168 Bacteria 4421
907 Ga0316593_10010927 3300032168 Bacteria 2622
908 Ga0316593_10012566 3300032168 Bacteria 2488
909 Ga0316593_10013401 3300032168 Bacteria 2427
910 Ga0316593_10021147 3300032168 Bacteria 2031
911 Ga0316593_10069942 3300032168 Bacteria 1213
912 Ga0316593_10104508 3300032168 Bacteria 1007
913 Ga0316593_10156905 3300032168 Bacteria 830
914 Ga0316593_10183019 3300032168 Bacteria 771
915 Ga0316593_10190842 3300032168 Bacteria 755
916 Ga0316593_10400864 3300032168 Bacteria 530
917 Ga0316592_1000052 3300033524 Bacteria 9955
918 Ga0316592_1006806 3300033524 Bacteria 2213
919 Ga0316592_1017527 3300033524 Bacteria 1503
920 Ga0316586_1001114 3300033527 Bacteria 2935
921 Ga0316586_1006413 3300033527 Bacteria 1688
922 Ga0316586_1006567 3300033527 Bacteria 1671
923 Ga0316586_1012294 3300033527 Bacteria 1325
924 Ga0316588_1000195 3300033528 Bacteria 6976
925 Ga0316588_1000372 3300033528 Bacteria 5863
926 Ga0316588_1001652 3300033528 Bacteria 3720
927 Ga0316588_1014519 3300033528 Bacteria 1725
928 Ga0316587_1000541 3300033529 Bacteria 3919
929 Ga0316587_1003352 3300033529 Bacteria 2236
930 Ga0316587_1034579 3300033529 Bacteria 901
931 Ga0316587_1055264 3300033529 Bacteria 731
932 Ga0316587_1126985 3300033529 Bacteria 502
933 Ga0316596_1000013 3300033541 Bacteria 16477
934 Ga0316596_1000038 3300033541 Bacteria 13809
935 Ga0316596_1000123 3300033541 Bacteria 10193
936 Ga0316596_1000864 3300033541 Bacteria 5686
937 Ga0316596_1002088 3300033541 Bacteria 4213
938 Ga0316596_1002127 3300033541 Bacteria 4184
939 Ga0316596_1009066 3300033541 Bacteria 2384
940 Ga0316596_1021654 3300033541 Bacteria 1640
941 Ga0316596_1034592 3300033541 Bacteria 1320
942 Ga0316596_1047503 3300033541 Bacteria 1134
943 Ga0316596_1052339 3300033541 Bacteria 1082
944 Ga0373930_0117272 3300034816 Bacteria 646
945 Ga0373948_0033767 3300034817 Bacteria 1043
946 Ga0373959_0045221 3300034820 Bacteria 936
947 Ga0373938_0019304 3300034957 Bacteria 1362
948 Ga0373926_0048224 3300035083 Bacteria 1531
949 Ga0373928_0005915 3300035084 Bacteria 2342
950 Ga0373928_0037015 3300035084 Bacteria 1105
951 Ga0373928_0202844 3300035084 Bacteria 573
952 Ga0373928_0258641 3300035084 Bacteria 521
953 Ga0373934_0000158 3300035086 Bacteria 24585
954 Ga0373934_0001086 3300035086 Bacteria 9852
955 Ga0373934_0294132 3300035086 Bacteria 673
956 Ga0373940_0049822 3300035088 Bacteria 1173
957 Ga0373949_0027669 3300035090 Bacteria 1334
958 Ga0373949_0125292 3300035090 Bacteria 725
959 Ga0373951_0008711 3300035091 Bacteria 2287
960 Ga0373952_0026432 3300035092 Bacteria 1261
961 Ga0373923_0004770 3300035111 Bacteria 4535
962 Ga0373932_0031857 3300035112 Bacteria 1471
963 Ga0373932_0055953 3300035112 Bacteria 1185
964 Ga0373932_0136627 3300035112 Bacteria 830
965 Ga0373932_0173006 3300035112 Bacteria 753
966 Ga0373936_0000624 3300035113 Bacteria 12231
967 Ga0373936_0535392 3300035113 Bacteria 547
968 Ga0373939_0103931 3300035114 Bacteria 979
969 Ga0373939_0206682 3300035114 Bacteria 745
970 Ga0373939_0309763 3300035114 Bacteria 632
971 Ga0373941_0005817 3300035115 Bacteria 2929
972 Ga0373945_0265633 3300035116 Bacteria 728
973 Ga0373953_0001117 3300035117 Bacteria 7601
974 Ga0373953_0028593 3300035117 Bacteria 2151
975 Ga0373953_0046589 3300035117 Bacteria 1741
976 Ga0373954_0002008 3300035118 Bacteria 8452
977 Ga0373954_0002513 3300035118 Bacteria 7698
978 Ga0373954_0009083 3300035118 Bacteria 4370
979 Ga0373954_0124082 3300035118 Bacteria 1255
980 Ga0373956_0000755 3300035119 Bacteria 13380
981 Ga0373956_0004261 3300035119 Bacteria 5747
982 Ga0373956_0004335 3300035119 Bacteria 5693
983 Ga0373956_0380685 3300035119 Bacteria 673
984 Ga0373956_0533507 3300035119 Bacteria 560
985 Ga0373957_0002643 3300035120 Bacteria 5143
986 Ga0373957_0011093 3300035120 Bacteria 2997
987 Ga0373957_0012050 3300035120 Bacteria 2901
988 Ga0373957_0221456 3300035120 Bacteria 792
989 Ga0373960_0082802 3300035121 Bacteria 1013
990 Ga0373943_0084837 3300035170 Bacteria 1630
991 Ga0373946_0006373 3300035171 Bacteria 4275
992 Ga0373946_0270601 3300035171 Bacteria 833
993 Ga0373955_0002904 3300035172 Bacteria 7521
994 Ga0373955_0004190 3300035172 Bacteria 6366
995 Ga0373955_0349481 3300035172 Bacteria 895
996 Ga0373955_0873643 3300035172 Bacteria 553
997 Ga0373942_0279758 3300035207 Bacteria 574
998 Ga0373942_0305615 3300035207 Bacteria 553
999 Ga0373961_0075730 3300035241 Bacteria 1049
1000 Ga0373961_0095914 3300035241 Bacteria 954
1001 Ga0373961_0199465 3300035241 Bacteria 705
1002 Ga0373962_0083204 3300035242 Bacteria 975
1003 Ga0373962_0103037 3300035242 Bacteria 892
1004 Ga0373962_0322812 3300035242 Bacteria 552
1005 Ga0316574_0000016 3300035398 Bacteria 41302
1006 Ga0316574_0028540 3300035398 Bacteria 3366
1007 Ga0316574_0046734 3300035398 Bacteria 2685
1008 Ga0316574_0228311 3300035398 Bacteria 1192
1009 Ga0316574_0404367 3300035398 Unclassified 859
1010 Ga0316574_0548341 3300035398 Bacteria 718
1011 Ga0373924_0001492 3300035410 Bacteria 7616
1012 Ga0373924_0097856 3300035410 Bacteria 1260
1013 Ga0373924_0101212 3300035410 Bacteria 1240
1014 Ga0373924_0131457 3300035410 Bacteria 1089
1015 Ga0373931_0032033 3300035691 Bacteria 2717
1016 Ga0373931_0064527 3300035691 Bacteria 1982
1017 Ga0373931_0070412 3300035691 Bacteria 1908
1018 Ga0373931_0078947 3300035691 Bacteria 1812
1019 Ga0373931_0169828 3300035691 Bacteria 1284
1020 Ga0373931_0703191 3300035691 Bacteria 668
1021 Ga0373931_0833253 3300035691 Bacteria 617
1022 Ga0373935_0061266 3300035692 Bacteria 2408
1023 Ga0373935_0709057 3300035692 Bacteria 740
1024 Ga0373927_0074508 3300035695 Bacteria 2198
1025 Ga0373927_0375335 3300035695 Bacteria 938
1026 Ga0373933_0000780 3300035724 Bacteria 19427
1027 Ga0373933_0103282 3300035724 Bacteria 1770
1028 Ga0373933_0421520 3300035724 Bacteria 872
1029 Ga0373947_0069005 3300035725 Bacteria 2163
1030 Ga0373937_0002498 3300036401 Bacteria 15273
1031 Ga0373937_0002976 3300036401 Bacteria 14187
1032 Ga0373937_0003228 3300036401 Bacteria 13663
1033 Ga0373937_0178377 3300036401 Bacteria 1994
1034 Ga0373937_0217226 3300036401 Bacteria 1799
1035 Ga0373937_0290351 3300036401 Bacteria 1545
1036 Ga0373937_0364870 3300036401 Bacteria 1369
1037 Ga0373937_0933854 3300036401 Bacteria 816
1038 Ga0316582_0000015 3300036647 Bacteria 41441
1039 Ga0316582_0007625 3300036647 Bacteria 5769
1040 Ga0316582_0395463 3300036647 Bacteria 952
1041 Ga0316582_0973855 3300036647 Unclassified 579
1042 Ga0316582_1077289 3300036647 Bacteria 548
1043 Ga0316584_0000487 3300036712 Bacteria 20931
1044 Ga0316584_0000609 3300036712 Bacteria 19432
1045 Ga0316584_0046768 3300036712 Bacteria 3232
1046 Ga0316584_0074355 3300036712 Bacteria 2547
1047 Ga0316584_0214139 3300036712 Bacteria 1417
1048 Ga0373925_0003017 3300037068 Bacteria 13241
1049 Ga0373925_1381282 3300037068 Bacteria 577
1050 Ga0395905_0894216 3300037471 Unclassified 791
1051 Ga0316581_0007287 3300037588 Bacteria 2961
1052 Ga0316581_0065940 3300037588 Bacteria 1112
1053 Ga0436364_1269112 3300037853 Bacteria 1955
1054 Ga0395901_0666508 3300038443 Bacteria 1042
1055 Ga0242420_044494 3300038996 Bacteria 855
1056 Ga0436360_0521510 3300039438 Bacteria 2768
1057 Ga0439436_0046067 3300041404 Bacteria 1240
1058 Ga0439439_0004795 3300041406 Bacteria 3064
1059 Ga0439439_0090587 3300041406 Bacteria 835
1060 Ga0439447_044922 3300041407 Bacteria 1067
1061 Ga0439461_0006133 3300041410 Bacteria 2084
1062 Ga0439466_0265458 3300041411 Bacteria 520
1063 Ga0451794_25102 3300041446 Bacteria 695
1064 Ga0451799_14863 3300041454 Bacteria 652
1065 Ga0451800_0317342 3300041459 Bacteria 1017
1066 Ga0451805_029132 3300041461 Bacteria 743
1067 Ga0451807_0787656 3300041486 Bacteria 578
1068 Ga0451807_0872513 3300041486 Bacteria 1741
1069 Ga0451839_0614858 3300041496 Bacteria 580
1070 Ga0451843_0768512 3300041509 Bacteria 602
1071 Ga0451853_1511620 3300041512 Bacteria 741
1072 Ga0439431_0052390 3300041997 Bacteria 1060
1073 Ga0439441_000058 3300042001 Bacteria 8355
1074 Ga0439441_002636 3300042001 Bacteria 2548
1075 Ga0439441_004832 3300042001 Bacteria 2062
1076 Ga0439441_010405 3300042001 Bacteria 1559
1077 Ga0439441_048987 3300042001 Bacteria 866
1078 Ga0439443_011856 3300042003 Bacteria 1283
1079 Ga0439449_0158879 3300042007 Bacteria 844
1080 Ga0439451_087743 3300042009 Bacteria 626
1081 Ga0439456_019918 3300042013 Bacteria 1413
1082 Ga0450923_025496 3300042125 Bacteria 1179
1083 Ga0450923_054868 3300042125 Bacteria 861
1084 Ga0450888_017492 3300042126 Bacteria 891
1085 Ga0450891_029854 3300042129 Bacteria 562
1086 Ga0450894_052659 3300042131 Bacteria 602
1087 Ga0439446_0005512 3300042156 Bacteria 3257
1088 Ga0439446_0129234 3300042156 Bacteria 818
1089 Ga0439446_0199598 3300042156 Bacteria 675
1090 Ga0439434_0002508 3300042435 Bacteria 5343
1091 Ga0439435_0000603 3300042436 Bacteria 5845
1092 Ga0439435_0000723 3300042436 Bacteria 5528
1093 Ga0439444_0004900 3300042437 Bacteria 1964
1094 Ga0439459_0078390 3300042438 Bacteria 776
1095 Ga0450916_088899 3300042530 Bacteria 536
1096 Ga0450918_036334 3300042531 Bacteria 878
1097 Ga0451577_0029277 3300042876 Bacteria 4977
1098 Ga0451577_0143351 3300042876 Bacteria 2147
1099 Ga0451577_0262897 3300042876 Bacteria 1562
1100 Ga0451577_0464427 3300042876 Bacteria 1149
1101 Ga0451577_0488116 3300042876 Bacteria 1118
1102 Ga0451577_0749485 3300042876 Bacteria 883
1103 Ga0451577_0914359 3300042876 Bacteria 790
1104 Ga0451577_0970095 3300042876 Bacteria 764
1105 Ga0453683_0327501 3300044673 Bacteria 982
1106 Ga0453683_0767018 3300044673 Bacteria 634
1107 Ga0453683_0872655 3300044673 Bacteria 594
1108 Ga0453683_0910084 3300044673 Bacteria 582
1109 Ga0453684_0004092 3300044712 Bacteria 31636
1110 Ga0453684_0049425 3300044712 Bacteria 5546
1111 Ga0453684_0177715 3300044712 Bacteria 2502
1112 Ga0453684_0421641 3300044712 Bacteria 1490
1113 Ga0453684_0596240 3300044712 Bacteria 1211
1114 Ga0453684_0694905 3300044712 Bacteria 1106
1115 Ga0453684_0797103 3300044712 Bacteria 1019
1116 Ga0453684_0988243 3300044712 Bacteria 896
1117 Ga0453684_1270384 3300044712 Bacteria 769
1118 Ga0466960_0135610 3300044901 Bacteria 1303
1119 Ga0451576_0044124 3300045051 Bacteria 4701
1120 Ga0451576_0055564 3300045051 Bacteria 4141
1121 Ga0451576_0057306 3300045051 Bacteria 4073
1122 Ga0451576_0070730 3300045051 Bacteria 3632
1123 Ga0451576_0121787 3300045051 Bacteria 2716
1124 Ga0451576_0253201 3300045051 Bacteria 1840
1125 Ga0451576_0566765 3300045051 Bacteria 1193
1126 Ga0451576_0615895 3300045051 Bacteria 1141
1127 Ga0451576_0869437 3300045051 Bacteria 946
1128 Ga0451576_1180872 3300045051 Bacteria 799
1129 Ga0451576_1544956 3300045051 Bacteria 689
1130 Ga0466967_1623748 3300045976 Bacteria 644
1131 Ga0495592_0001797 3300046454 Bacteria 15080
1132 Ga0495592_0002485 3300046454 Bacteria 13026
1133 Ga0495592_0008724 3300046454 Bacteria 7610
1134 Ga0495592_0046906 3300046454 Bacteria 3219
1135 Ga0495592_0263209 3300046454 Bacteria 1135
1136 Ga0495592_0265960 3300046454 Bacteria 1127
1137 Ga0495629_0021177 3300046459 Bacteria 4641
1138 Ga0495641_0004364 3300046461 Bacteria 10030
1139 Ga0495651_0000262 3300046462 Bacteria 41024
1140 Ga0495651_0001867 3300046462 Bacteria 16313
1141 Ga0495651_0450849 3300046462 Bacteria 831
1142 Ga0495653_0024888 3300046463 Bacteria 4817
1143 Ga0495580_0002612 3300046472 Bacteria 15641
1144 Ga0495582_0019936 3300046473 Bacteria 3668
1145 Ga0495582_0108559 3300046473 Bacteria 1558
1146 Ga0495582_0161598 3300046473 Bacteria 1274
1147 Ga0495639_0003426 3300046475 Bacteria 6868
1148 Ga0495662_0000671 3300046476 Bacteria 16169
1149 Ga0495662_0003778 3300046476 Bacteria 7636
1150 Ga0495664_0004876 3300046477 Bacteria 7340
1151 Ga0495584_0157568 3300046491 Bacteria 1154
1152 Ga0495594_0047828 3300046499 Bacteria 2349
1153 Ga0495608_0001279 3300046511 Bacteria 17865
1154 Ga0495608_0078337 3300046511 Bacteria 2150
1155 Ga0495608_0742181 3300046511 Bacteria 582
1156 Ga0495618_0003479 3300046514 Bacteria 9774
1157 Ga0495618_0232214 3300046514 Bacteria 1161
1158 Ga0495628_0004691 3300046516 Bacteria 12056
1159 Ga0495628_0007665 3300046516 Bacteria 9333
1160 Ga0495628_0020177 3300046516 Bacteria 5500
1161 Ga0495628_0266828 3300046516 Bacteria 1274
1162 Ga0495628_0315733 3300046516 Bacteria 1154
1163 Ga0495630_0007891 3300046517 Bacteria 7632
1164 Ga0495630_0008596 3300046517 Bacteria 7327
1165 Ga0495666_0008919 3300046526 Bacteria 5020
1166 Ga0495642_0029006 3300046528 Bacteria 2207
1167 Ga0495642_0043098 3300046528 Bacteria 1840
1168 Ga0495642_0087417 3300046528 Bacteria 1317
1169 Ga0495652_0014898 3300046529 Bacteria 6969
1170 Ga0495652_0020887 3300046529 Bacteria 5819
1171 Ga0495652_0167283 3300046529 Bacteria 1700
1172 Ga0495665_0007072 3300046531 Bacteria 6055
1173 Ga0495640_0002705 3300046533 Bacteria 14256
1174 Ga0495640_0072895 3300046533 Bacteria 2299
1175 Ga0495586_0002201 3300046535 Bacteria 10581
1176 Ga0495586_0005265 3300046535 Bacteria 6919
1177 Ga0495587_0055615 3300046536 Bacteria 2330
1178 Ga0495587_0069856 3300046536 Bacteria 2044
1179 Ga0495587_0663870 3300046536 Bacteria 572
1180 Ga0495598_0065944 3300046537 Bacteria 1128
1181 Ga0495598_0151136 3300046537 Bacteria 810
1182 Ga0495621_0127082 3300046539 Bacteria 989
1183 Ga0495621_0202565 3300046539 Bacteria 799
1184 Ga0495621_0504454 3300046539 Bacteria 522
1185 Ga0495645_0006580 3300046543 Bacteria 8071
1186 Ga0495645_0716975 3300046543 Bacteria 606
1187 Ga0495622_0088378 3300046557 Bacteria 1424
1188 Ga0495667_0004974 3300046559 Bacteria 8988
1189 Ga0495667_0007843 3300046559 Bacteria 7235
1190 Ga0495667_0010037 3300046559 Bacteria 6414
1191 Ga0495667_0063165 3300046559 Bacteria 2424
1192 Ga0495667_0209715 3300046559 Bacteria 1245
1193 Ga0495667_0655344 3300046559 Bacteria 652
1194 Ga0495656_0039480 3300046615 Bacteria 1961
1195 Ga0495634_0003763 3300046642 Bacteria 12066
1196 Ga0495634_0072349 3300046642 Bacteria 2267
1197 Ga0495634_0329191 3300046642 Bacteria 918
1198 Ga0495635_0017562 3300046663 Bacteria 4997
1199 Ga0495635_0188265 3300046663 Bacteria 1401
1200 Ga0495659_0027075 3300046664 Bacteria 1975
1201 Ga0495659_0075806 3300046664 Bacteria 1268
1202 Ga0495659_0142375 3300046664 Bacteria 958
1203 Ga0495588_0504883 3300046674 Bacteria 634
1204 Ga0495657_0017230 3300046675 Bacteria 5248
1205 Ga0495599_0000999 3300046678 Bacteria 15882
1206 Ga0495599_0031317 3300046678 Bacteria 3338
1207 Ga0495599_0048286 3300046678 Bacteria 2668
1208 Ga0495599_0048593 3300046678 Bacteria 2659
1209 Ga0495599_0103237 3300046678 Bacteria 1777
1210 Ga0495623_0037153 3300046679 Bacteria 3119
1211 Ga0495647_0002171 3300046681 Bacteria 6131
1212 Ga0495658_0004608 3300046683 Bacteria 6784
1213 Ga0495658_0092835 3300046683 Bacteria 1790
1214 Ga0495658_0206319 3300046683 Bacteria 1226
1215 Ga0495658_0324375 3300046683 Bacteria 976
1216 Ga0495658_0395259 3300046683 Bacteria 881
1217 Ga0495669_0003086 3300046684 Bacteria 6848
1218 Ga0495613_0064087 3300046689 Bacteria 2688
1219 Ga0495624_0042044 3300046690 Bacteria 2921
1220 Ga0495624_0413718 3300046690 Bacteria 809
1221 Ga0495624_0426540 3300046690 Bacteria 795
1222 Ga0495670_0092936 3300046691 Bacteria 1546
1223 Ga0495600_0001967 3300046809 Bacteria 11550
1224 Ga0495600_0002534 3300046809 Bacteria 10512
1225 Ga0495600_0072631 3300046809 Bacteria 2247
1226 Ga0495581_0247471 3300047315 Bacteria 1042
1227 Ga0495604_0011964 3300047317 Bacteria 6898
1228 Ga0495604_0092590 3300047317 Bacteria 2239
1229 Ga0495604_0259363 3300047317 Bacteria 1182
1230 Ga0495604_0270813 3300047317 Bacteria 1150
1231 Ga0495604_0713145 3300047317 Bacteria 636
1232 Ga0495636_0001724 3300047318 Bacteria 8345
1233 Ga0495636_0113720 3300047318 Bacteria 1193
1234 Ga0495674_0003216 3300047319 Bacteria 15868
1235 Ga0495674_0281599 3300047319 Bacteria 1362
1236 Ga0495674_0550852 3300047319 Bacteria 918
1237 Ga0495680_0001155 3300047322 Bacteria 29117
1238 Ga0495680_0005362 3300047322 Bacteria 12093
1239 Ga0495680_0014044 3300047322 Bacteria 6958
1240 Ga0495680_0482109 3300047322 Bacteria 844
1241 Ga0495680_0972355 3300047322 Bacteria 544
1242 Ga0495675_0000381 3300047444 Bacteria 30587
1243 Ga0495675_0630924 3300047444 Bacteria 605
1244 Ga0495675_0731233 3300047444 Bacteria 552
1245 Ga0495685_089205 3300047447 Bacteria 1023
1246 Ga0495684_0006022 3300047471 Bacteria 9426
1247 Ga0495593_0270410 3300047673 Bacteria 850
1248 Ga0495602_0577526 3300048088 Bacteria 776
1249 Ga0495602_0850953 3300048088 Bacteria 610
1250 Ga0495614_0030199 3300048089 Bacteria 2332
1251 Ga0496106_0274076 3300048909 Bacteria 1351
1252 Ga0496106_0415580 3300048909 Bacteria 1081
1253 Ga0496108_0432798 3300048911 Bacteria 1149
1254 Ga0496109_0917385 3300048912 Bacteria 814
1255 Ga0496110_0326046 3300048913 Bacteria 1399
1256 Ga0496110_1004145 3300048913 Bacteria 742
1257 Ga0496111_0231257 3300048914 Bacteria 1373
1258 Ga0496112_0357365 3300048915 Bacteria 1403
1259 Ga0496113_1309431 3300048916 Bacteria 563
1260 Ga0496114_0138568 3300048917 Bacteria 2105
1261 Ga0496115_0242099 3300048918 Bacteria 1487
1262 Ga0496121_0356501 3300048924 Bacteria 972
1263 Ga0496124_0000007 3300048927 Bacteria 883534
1264 Ga0501296_013708 3300049519 Bacteria 989
1265 Ga0501296_027026 3300049519 Bacteria 758
1266 Ga0501296_060130 3300049519 Bacteria 573
1267 Ga0501298_004799 3300049521 Bacteria 2147
1268 Ga0501298_014271 3300049521 Bacteria 1418
1269 Ga0501298_072859 3300049521 Bacteria 744
1270 Ga0501298_104618 3300049521 Bacteria 650
1271 Ga0501298_142749 3300049521 Bacteria 580
1272 Ga0501299_043278 3300049522 Bacteria 910
1273 Ga0501031_0898903 3300049568 Bacteria 567
1274 Ga0501032_0307768 3300049569 Bacteria 1024
1275 Ga0501033_0194223 3300049570 Bacteria 1452
1276 Ga0501033_0350928 3300049570 Bacteria 1033
1277 Ga0501033_1077124 3300049570 Bacteria 535
1278 Ga0501034_0002599 3300049571 Bacteria 21472
1279 Ga0501034_0162410 3300049571 Bacteria 2204
1280 Ga0501036_0044466 3300049572 Bacteria 3762
1281 Ga0501036_0057314 3300049572 Bacteria 3300
1282 Ga0501036_0207451 3300049572 Bacteria 1647
1283 Ga0501036_0823735 3300049572 Bacteria 764
1284 Ga0501037_0225499 3300049573 Bacteria 1317
1285 Ga0501037_0363440 3300049573 Bacteria 997
1286 Ga0501038_0082883 3300049574 Bacteria 2700
1287 Ga0501038_1108877 3300049574 Bacteria 577
1288 Ga0501039_0066388 3300049575 Bacteria 2800
1289 Ga0501039_0736240 3300049575 Bacteria 770
1290 Ga0501039_1125267 3300049575 Bacteria 608
1291 Ga0501039_1303300 3300049575 Bacteria 560
1292 Ga0501039_1329448 3300049575 Bacteria 554
1293 Ga0501040_0256524 3300049576 Bacteria 1248
1294 Ga0501040_0273887 3300049576 Bacteria 1205
1295 Ga0501040_0481802 3300049576 Bacteria 894
1296 Ga0501040_0697892 3300049576 Bacteria 734
1297 Ga0501040_0843750 3300049576 Bacteria 663
1298 Ga0501041_0000437 3300049577 Bacteria 21135
1299 Ga0501041_0079297 3300049577 Bacteria 2021
1300 Ga0501041_0154946 3300049577 Bacteria 1431
1301 Ga0501042_0157401 3300049578 Bacteria 1639
1302 Ga0501042_0354585 3300049578 Bacteria 1061
1303 Ga0501042_0469562 3300049578 Bacteria 913
1304 Ga0501042_0540891 3300049578 Bacteria 846
1305 Ga0501046_0181001 3300049580 Bacteria 1576
1306 Ga0501046_0371107 3300049580 Bacteria 1037
1307 Ga0501046_0391615 3300049580 Bacteria 1004
1308 Ga0501048_0050022 3300049582 Bacteria 2977
1309 Ga0501048_0578125 3300049582 Bacteria 806
1310 Ga0501048_1364085 3300049582 Bacteria 510
1311 Ga0501067_0211966 3300049583 Bacteria 1079
1312 Ga0501068_0777734 3300049584 Bacteria 627
1313 Ga0501069_0505698 3300049585 Bacteria 721
1314 Ga0501071_0148530 3300049587 Bacteria 1747
1315 Ga0501071_0219677 3300049587 Bacteria 1430
1316 Ga0501071_0537966 3300049587 Bacteria 897
1317 Ga0501072_0007047 3300049588 Bacteria 8532
1318 Ga0501072_0030599 3300049588 Bacteria 4211
1319 Ga0501072_0032220 3300049588 Bacteria 4105
1320 Ga0501072_0047187 3300049588 Bacteria 3392
1321 Ga0501072_0061311 3300049588 Bacteria 2966
1322 Ga0501072_0158094 3300049588 Bacteria 1808
1323 Ga0501072_0708480 3300049588 Bacteria 791
1324 Ga0501072_0912556 3300049588 Bacteria 686
1325 Ga0501072_1048418 3300049588 Bacteria 635
1326 Ga0501072_1535002 3300049588 Bacteria 514
1327 Ga0501074_0055306 3300049590 Bacteria 2861
1328 Ga0501074_0234284 3300049590 Bacteria 1307
1329 Ga0501075_0001690 3300049591 Bacteria 14492
1330 Ga0501075_0031943 3300049591 Bacteria 3911
1331 Ga0501075_0096383 3300049591 Bacteria 2245
1332 Ga0501075_0308945 3300049591 Bacteria 1205
1333 Ga0501075_0309541 3300049591 Bacteria 1204
1334 Ga0501076_0020757 3300049592 Bacteria 5030
1335 Ga0501076_0160766 3300049592 Bacteria 1830
1336 Ga0501076_0183238 3300049592 Bacteria 1707
1337 Ga0501076_0425627 3300049592 Bacteria 1092
1338 Ga0501076_0881283 3300049592 Bacteria 738
1339 Ga0501077_0052597 3300049593 Bacteria 2586
1340 Ga0501077_0127887 3300049593 Bacteria 1610
1341 Ga0501077_0232491 3300049593 Bacteria 1172
1342 Ga0501077_0275974 3300049593 Bacteria 1070
1343 Ga0501207_149814 3300049654 Bacteria 502
1344 Ga0501227_166023 3300049665 Unclassified 616
1345 Ga0501233_049447 3300049668 Bacteria 1014
1346 Ga0501235_135526 3300049669 Bacteria 627
1347 Ga0501079_0081724 3300049741 Bacteria 2499
1348 Ga0501079_0375905 3300049741 Bacteria 1114
1349 Ga0501079_0456661 3300049741 Bacteria 1003
1350 Ga0501079_0628222 3300049741 Bacteria 845
1351 Ga0501079_1040873 3300049741 Bacteria 645
1352 Ga0501080_0582653 3300049742 Bacteria 994
1353 Ga0501080_1066522 3300049742 Bacteria 699
1354 Ga0501080_1250389 3300049742 Bacteria 637
1355 Ga0501080_1343434 3300049742 Bacteria 611
1356 Ga0501080_1627997 3300049742 Bacteria 546
1357 Ga0501081_0002862 3300049743 Bacteria 10959
1358 Ga0501081_0025313 3300049743 Bacteria 3991
1359 Ga0501081_0445673 3300049743 Bacteria 961
1360 Ga0501081_0641149 3300049743 Bacteria 796
1361 Ga0501083_0354410 3300049744 Bacteria 954
1362 Ga0501083_0597214 3300049744 Bacteria 718
1363 Ga0501083_0727965 3300049744 Bacteria 645
1364 Ga0501263_039150 3300049760 Bacteria 692
1365 Ga0501280_000425 3300049776 Bacteria 10117
1366 Ga0501282_012234 3300049778 Bacteria 926
1367 Ga0501283_090944 3300049779 Bacteria 584
1368 Ga0501283_103671 3300049779 Bacteria 556
1369 Ga0501035_0439509 3300049822 Bacteria 1081
1370 Ga0501035_0813309 3300049822 Bacteria 746
1371 Ga0501035_0937820 3300049822 Bacteria 684
1372 Ga0501035_1091670 3300049822 Bacteria 624
1373 Ga0501044_0444678 3300049823 Bacteria 1204
1374 Ga0501044_0612898 3300049823 Bacteria 981
1375 Ga0501045_0050583 3300049824 Bacteria 3032
1376 Ga0501045_0074048 3300049824 Bacteria 2508
1377 Ga0501045_0719078 3300049824 Bacteria 736
1378 Ga0501204_095319 3300049850 Bacteria 524
1379 nmdc:mga00v17_239522_c1 3300050491 Bacteria 1176
1380 nmdc:mga00v17_72725_c1 3300050491 Bacteria 2133
1381 nmdc:mga0k408_133485_c1 3300050493 Bacteria 1474
1382 nmdc:mga0k408_796741_c1 3300050493 Bacteria 551
1383 nmdc:mga05p37_1027452_c1 3300050507 Bacteria 872
1384 nmdc:mga05p37_1193695_c1 3300050507 Bacteria 787
1385 nmdc:mga05p37_121097_c1 3300050507 Bacteria 3214
1386 nmdc:mga05p37_181698_c1 3300050507 Bacteria 2558
1387 nmdc:mga05p37_2197272_c1 3300050507 Bacteria 513
1388 nmdc:mga05p37_2800_c1 3300050507 Bacteria 20274
1389 nmdc:mga05p37_431_c1 3300050507 Bacteria 45404
1390 nmdc:mga05p37_546585_c1 3300050507 Bacteria 1319
1391 nmdc:mga05p37_75636_c1 3300050507 Bacteria 4145
1392 nmdc:mga05p37_771975_c1 3300050507 Bacteria 1056
1393 nmdc:mga05p37_96645_c1 3300050507 Bacteria 3639
1394 nmdc:mga09592_133603_c1 3300050508 Bacteria 2136
1395 nmdc:mga09592_1477_c1 3300050508 Bacteria 18889
1396 nmdc:mga09592_16325_c1 3300050508 Bacteria 6073
1397 nmdc:mga09592_190628_c1 3300050508 Bacteria 1774
1398 nmdc:mga09592_229_c1 3300050508 Bacteria 40458
1399 nmdc:mga09592_256466_c1 3300050508 Bacteria 1516
1400 nmdc:mga09592_37298_c1 3300050508 Bacteria 4077
1401 nmdc:mga09592_592887_c1 3300050508 Bacteria 950
1402 nmdc:mga0qj67_1196818_c1 3300050509 Bacteria 591
1403 nmdc:mga0qj67_1448373_c1 3300050509 Bacteria 529
1404 nmdc:mga0qj67_1458_c1 3300050509 Bacteria 16584
1405 nmdc:mga0qj67_148226_c1 3300050509 Bacteria 1903
1406 nmdc:mga0qj67_21577_c1 3300050509 Bacteria 4941
1407 nmdc:mga0qj67_237097_c1 3300050509 Bacteria 1480
1408 nmdc:mga0qj67_41193_c1 3300050509 Bacteria 3632
1409 nmdc:mga0qj67_56501_c1 3300050509 Bacteria 3111
1410 nmdc:mga0qj67_9221_c1 3300050509 Bacteria 7331
1411 nmdc:mga06r32_14300_c1 3300050510 Bacteria 7199
1412 nmdc:mga06r32_18350_c1 3300050510 Bacteria 6405
1413 nmdc:mga06r32_220612_c2 3300050510 Bacteria 958
1414 nmdc:mga06r32_24235_c1 3300050510 Bacteria 5628
1415 nmdc:mga06r32_352410_c1 3300050510 Bacteria 1456
1416 nmdc:mga06r32_59716_c1 3300050510 Bacteria 3669
1417 nmdc:mga06r32_610336_c1 3300050510 Bacteria 1061
1418 nmdc:mga06r32_842809_c1 3300050510 Bacteria 876
1419 nmdc:mga08y16_1752187_c1 3300050511 Bacteria 575
1420 nmdc:mga08y16_1885287_c1 3300050511 Bacteria 549
1421 nmdc:mga08y16_20591_c1 3300050511 Bacteria 6962
1422 nmdc:mga08y16_239934_c1 3300050511 Bacteria 1874
1423 nmdc:mga08y16_2559_c1 3300050511 Bacteria 18707
1424 nmdc:mga08y16_26203_c1 3300050511 Bacteria 6148
1425 nmdc:mga08y16_4095_c1 3300050511 Bacteria 15220
1426 nmdc:mga08y16_55149_c1 3300050511 Bacteria 4154
1427 nmdc:mga08y16_649085_c1 3300050511 Bacteria 1060
1428 nmdc:mga08y16_69771_c1 3300050511 Bacteria 3664
1429 nmdc:mga08y16_804414_c1 3300050511 Bacteria 933
1430 nmdc:mga08y16_81215_c1 3300050511 Bacteria 3380
1431 nmdc:mga0n895_12383_c1 3300050512 Bacteria 7652
1432 nmdc:mga0n895_1761888_c1 3300050512 Bacteria 581
1433 nmdc:mga0n895_206995_c1 3300050512 Bacteria 1992
1434 nmdc:mga0n895_2822_c1 3300050512 Bacteria 13752
1435 nmdc:mga0n895_512190_c1 3300050512 Bacteria 1208
1436 nmdc:mga0n895_570_c1 3300050512 Bacteria 25297
1437 nmdc:mga0n895_67348_c1 3300050512 Bacteria 3546
1438 nmdc:mga0rr50_134057_c1 3300050513 Bacteria 1986
1439 nmdc:mga0rr50_25139_c1 3300050513 Bacteria 4137
1440 nmdc:mga0rr50_402689_c1 3300050513 Bacteria 1156
1441 nmdc:mga0rr50_590347_c1 3300050513 Bacteria 947
1442 nmdc:mga0rr50_7779_c1 3300050513 Bacteria 6642
1443 nmdc:mga0rr50_807895_c1 3300050513 Bacteria 800
1444 nmdc:mga08x19_2636_c1 3300050514 Bacteria 10849
1445 nmdc:mga08x19_285719_c1 3300050514 Bacteria 1144
1446 nmdc:mga08x19_370697_c1 3300050514 Bacteria 1002
1447 nmdc:mga08x19_6329_c1 3300050514 Bacteria 7010
1448 nmdc:mga08x19_6648_c1 3300050514 Bacteria 6858
1449 nmdc:mga08x19_945_c1 3300050514 Bacteria 18277
1450 nmdc:mga0a205_1075782_c1 3300050515 Bacteria 651
1451 nmdc:mga0a205_1142975_c1 3300050515 Bacteria 626
1452 nmdc:mga0a205_157568_c1 3300050515 Bacteria 2168
1453 nmdc:mga0a205_217_c1 3300050515 Bacteria 40547
1454 nmdc:mga0a205_298168_c1 3300050515 Bacteria 1485
1455 nmdc:mga0a205_392853_c1 3300050515 Bacteria 1251
1456 nmdc:mga0a205_67555_c1 3300050515 Bacteria 3453
1457 nmdc:mga0a205_714297_c1 3300050515 Bacteria 852
1458 nmdc:mga0a205_837210_c1 3300050515 Bacteria 767
1459 Ga0495601_0002356 3300053077 Bacteria 10700
1460 Ga0495601_0024247 3300053077 Bacteria 3736
1461 Ga0495601_0066863 3300053077 Bacteria 2288
1462 Ga0495601_0095238 3300053077 Bacteria 1919
1463 Ga0495601_0355633 3300053077 Bacteria 952
1464 Ga0495595_0005561 3300053084 Bacteria 5101
1465 Ga0495595_0137752 3300053084 Bacteria 1196
1466 Ga0495619_0003862 3300053085 Bacteria 9640
1467 Ga0495619_1146364 3300053085 Bacteria 516
1468 Ga0500566_0103447 3300053094 Bacteria 1558
1469 Ga0501084_0219012 3300054114 Bacteria 1606
1470 Ga0501084_0348423 3300054114 Bacteria 1251
1471 Ga0501084_0859640 3300054114 Bacteria 763
1472 Ga0501084_1479133 3300054114 Bacteria 568
1473 Ga0590071_029698 3300059421 Bacteria 1300
1474 Ga0590071_077420 3300059421 Bacteria 824
1475 Ga0590077_005746 3300059426 Bacteria 2540
1476 Ga0590077_044788 3300059426 Bacteria 988
1477 Ga0587077_181878 3300059493 Bacteria 570
1478 Ga0501082_0023114 3300060353 Bacteria 5361
1479 Ga0501082_0024226 3300060353 Bacteria 5233
1480 Ga0501082_0559110 3300060353 Bacteria 1001
1481 Ga0501082_0893334 3300060353 Bacteria 777
1482 Ga0501082_1084413 3300060353 Bacteria 700
1483 Ga0530510_0001565 3300061734 Bacteria 15447
1484 Ga0530510_0227808 3300061734 Bacteria 1386
1485 Ga0530510_1485314 3300061734 Bacteria 520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100382680 Ga0075428_1003826803 90
2 3300006847 Ga0075431_102071627 Ga0075431_1020716271 90
3 3300044673 Ga0453683_0910084 Ga0453683_0910084_217_534 90
4 3300037588 Ga0316581_0065940 Ga0316581_0065940_20_304 94
5 3300005438 Ga0070701_10848949 Ga0070701_108489492 95
6 3300031665 Ga0316575_10004197 Ga0316575_100041973 95
7 3300031691 Ga0316579_10003374 Ga0316579_1000337411 95
8 3300031727 Ga0316576_10000365 Ga0316576_1000036518 95
9 3300031728 Ga0316578_10331986 Ga0316578_103319862 95
10 3300031733 Ga0316577_10231157 Ga0316577_102311573 95
11 3300032133 Ga0316583_10009674 Ga0316583_100096745 95
12 3300032137 Ga0316585_10010856 Ga0316585_100108566 95
13 3300032139 Ga0316580_10096148 Ga0316580_100961482 95
14 3300032168 Ga0316593_10013401 Ga0316593_100134015 95
15 3300033527 Ga0316586_1001114 Ga0316586_10011146 95
16 3300033528 Ga0316588_1000372 Ga0316588_10003725 95
17 3300033541 Ga0316596_1009066 Ga0316596_10090665 95
18 3300060353 Ga0501082_1084413 Ga0501082_1084413_390_680 96
19 iso_pu_bacteria 8055225921 8055226499 100
20 3300037471 Ga0395905_0894216 Ga0395905_0894216_125_445 101
21 iso_pu_bacteria 2526164512 2526214042 101
22 iso_pu_bacteria 2574179768 2574429660 101
23 iso_pu_bacteria 639633007 639788568 101
24 3300005539 Ga0068853_100969412 Ga0068853_1009694122 103
25 3300005544 Ga0070686_100878460 Ga0070686_1008784602 103
26 3300005435 Ga0070714_100064265 Ga0070714_1000642654 104
27 3300005440 Ga0070705_100497651 Ga0070705_1004976512 104
28 3300006051 Ga0075364_10114391 Ga0075364_101143913 104
29 3300009147 Ga0114129_13315415 Ga0114129_133154152 104
30 3300012498 Ga0157345_1012699 Ga0157345_10126991 104
31 3300012503 Ga0157313_1010149 Ga0157313_10101492 104
32 3300017792 Ga0163161_10070887 Ga0163161_100708876 104
33 3300025922 Ga0207646_10087238 Ga0207646_100872384 104
34 3300025927 Ga0207687_11452979 Ga0207687_114529791 104
35 3300025929 Ga0207664_10094691 Ga0207664_100946916 104
36 3300031251 Ga0265327_10290252 Ga0265327_102902522 104
37 3300032137 Ga0316585_10036638 Ga0316585_100366383 104
38 3300032168 Ga0316593_10000170 Ga0316593_1000017015 104
39 3300032168 Ga0316593_10001508 Ga0316593_1000150810 104
40 3300032168 Ga0316593_10002414 Ga0316593_100024143 104
41 3300032168 Ga0316593_10012566 Ga0316593_100125662 104
42 3300033524 Ga0316592_1006806 Ga0316592_10068065 104
43 3300033524 Ga0316592_1017527 Ga0316592_10175273 104
44 3300033527 Ga0316586_1012294 Ga0316586_10122942 104
45 3300033528 Ga0316588_1001652 Ga0316588_10016522 104
46 3300033528 Ga0316588_1014519 Ga0316588_10145194 104
47 3300033529 Ga0316587_1000541 Ga0316587_10005418 104
48 3300033529 Ga0316587_1003352 Ga0316587_10033524 104
49 3300033529 Ga0316587_1034579 Ga0316587_10345792 104
50 3300033541 Ga0316596_1000013 Ga0316596_100001314 104
51 3300033541 Ga0316596_1002088 Ga0316596_10020887 104
52 3300033541 Ga0316596_1052339 Ga0316596_10523392 104
53 3300035398 Ga0316574_0046734 Ga0316574_0046734_1354_1668 104
54 3300035398 Ga0316574_0404367 Ga0316574_0404367_345_659 104
55 3300036647 Ga0316582_0973855 Ga0316582_0973855_46_360 104
56 3300036712 Ga0316584_0074355 Ga0316584_0074355_762_1076 104
57 3300036712 Ga0316584_0214139 Ga0316584_0214139_549_863 104
58 3300042876 Ga0451577_0143351 Ga0451577_0143351_891_1211 104
59 3300042876 Ga0451577_0749485 Ga0451577_0749485_260_580 104
60 3300044712 Ga0453684_0049425 Ga0453684_0049425_594_914 104
61 3300044712 Ga0453684_0596240 Ga0453684_0596240_567_887 104
62 3300046528 Ga0495642_0029006 Ga0495642_0029006_642_956 104
63 3300046664 Ga0495659_0075806 Ga0495659_0075806_822_1136 104
64 3300048924 Ga0496121_0356501 Ga0496121_0356501_580_900 104
65 3300048927 Ga0496124_0000007 Ga0496124_0000007_11527_11847 104
66 3300050491 nmdc:mga00v17_239522_c1 nmdc:mga00v17_239522_c1_769_1089 104
67 3300050507 nmdc:mga05p37_2197272_c1 nmdc:mga05p37_2197272_c1_98_412 104
68 3300002073 JGI24745J21846_1047948 JGI24745J21846_10479482 105
69 3300002076 JGI24749J21850_1007294 JGI24749J21850_10072942 105
70 3300002239 JGI24034J26672_10030684 JGI24034J26672_100306841 105
71 3300002459 JGI24751J29686_10112362 JGI24751J29686_101123622 105
72 3300004798 Ga0058859_11810920 Ga0058859_118109201 105
73 3300004799 Ga0058863_11627892 Ga0058863_116278921 105
74 3300004801 Ga0058860_10092512 Ga0058860_100925121 105
75 3300004801 Ga0058860_11632615 Ga0058860_116326152 105
76 3300004803 Ga0058862_12003567 Ga0058862_120035671 105
77 3300004803 Ga0058862_12369315 Ga0058862_123693152 105
78 3300004803 Ga0058862_12759491 Ga0058862_127594912 105
79 3300005289 Ga0065704_10036098 Ga0065704_100360982 105
80 3300005290 Ga0065712_10014871 Ga0065712_100148712 105
81 3300005293 Ga0065715_10147379 Ga0065715_101473794 105
82 3300005295 Ga0065707_10189559 Ga0065707_101895592 105
83 3300005295 Ga0065707_10211389 Ga0065707_102113892 105
84 3300005295 Ga0065707_10215781 Ga0065707_102157811 105
85 3300005295 Ga0065707_10231340 Ga0065707_102313403 105
86 3300005295 Ga0065707_10350006 Ga0065707_103500062 105
87 3300005295 Ga0065707_10410461 Ga0065707_104104612 105
88 3300005295 Ga0065707_10456341 Ga0065707_104563411 105
89 3300005295 Ga0065707_10611602 Ga0065707_106116022 105
90 3300005328 Ga0070676_10037090 Ga0070676_100370904 105
91 3300005328 Ga0070676_10591011 Ga0070676_105910111 105
92 3300005328 Ga0070676_10702666 Ga0070676_107026661 105
93 3300005329 Ga0070683_102235097 Ga0070683_1022350971 105
94 3300005330 Ga0070690_100001051 Ga0070690_10000105113 105
95 3300005330 Ga0070690_100013814 Ga0070690_1000138142 105
96 3300005330 Ga0070690_100033805 Ga0070690_1000338053 105
97 3300005330 Ga0070690_100091881 Ga0070690_1000918815 105
98 3300005330 Ga0070690_100232037 Ga0070690_1002320372 105
99 3300005330 Ga0070690_100407618 Ga0070690_1004076182 105
100 3300005330 Ga0070690_100726687 Ga0070690_1007266872 105
101 3300005333 Ga0070677_10004529 Ga0070677_100045297 105
102 3300005333 Ga0070677_10299844 Ga0070677_102998442 105
103 3300005334 Ga0068869_100000239 Ga0068869_10000023929 105
104 3300005334 Ga0068869_100002849 Ga0068869_10000284913 105
105 3300005334 Ga0068869_100009454 Ga0068869_1000094542 105
106 3300005334 Ga0068869_100053176 Ga0068869_1000531766 105
107 3300005334 Ga0068869_100227797 Ga0068869_1002277973 105
108 3300005334 Ga0068869_100242099 Ga0068869_1002420992 105
109 3300005335 Ga0070666_10020483 Ga0070666_100204832 105
110 3300005335 Ga0070666_10917492 Ga0070666_109174922 105
111 3300005335 Ga0070666_10976170 Ga0070666_109761702 105
112 3300005336 Ga0070680_100007954 Ga0070680_10000795412 105
113 3300005336 Ga0070680_100191421 Ga0070680_1001914214 105
114 3300005336 Ga0070680_100603844 Ga0070680_1006038442 105
115 3300005336 Ga0070680_101065211 Ga0070680_1010652111 105
116 3300005336 Ga0070680_101097666 Ga0070680_1010976662 105
117 3300005336 Ga0070680_101178063 Ga0070680_1011780631 105
118 3300005336 Ga0070680_101340089 Ga0070680_1013400892 105
119 3300005337 Ga0070682_100043573 Ga0070682_1000435733 105
120 3300005337 Ga0070682_100068422 Ga0070682_1000684222 105
121 3300005337 Ga0070682_100187720 Ga0070682_1001877203 105
122 3300005337 Ga0070682_100405805 Ga0070682_1004058052 105
123 3300005338 Ga0068868_100001937 Ga0068868_10000193713 105
124 3300005338 Ga0068868_100100364 Ga0068868_1001003642 105
125 3300005338 Ga0068868_100202081 Ga0068868_1002020814 105
126 3300005338 Ga0068868_100277744 Ga0068868_1002777443 105
127 3300005338 Ga0068868_100684721 Ga0068868_1006847212 105
128 3300005338 Ga0068868_101408459 Ga0068868_1014084592 105
129 3300005338 Ga0068868_101806907 Ga0068868_1018069072 105
130 3300005338 Ga0068868_101865165 Ga0068868_1018651651 105
131 3300005340 Ga0070689_100001590 Ga0070689_10000159016 105
132 3300005340 Ga0070689_100010970 Ga0070689_1000109706 105
133 3300005340 Ga0070689_100070703 Ga0070689_1000707036 105
134 3300005340 Ga0070689_100232887 Ga0070689_1002328873 105
135 3300005340 Ga0070689_100269821 Ga0070689_1002698212 105
136 3300005340 Ga0070689_100327552 Ga0070689_1003275522 105
137 3300005340 Ga0070689_101253941 Ga0070689_1012539412 105
138 3300005341 Ga0070691_10001529 Ga0070691_1000152915 105
139 3300005341 Ga0070691_10104737 Ga0070691_101047373 105
140 3300005341 Ga0070691_10187248 Ga0070691_101872482 105
141 3300005341 Ga0070691_10662258 Ga0070691_106622581 105
142 3300005343 Ga0070687_100009024 Ga0070687_1000090245 105
143 3300005343 Ga0070687_100156344 Ga0070687_1001563444 105
144 3300005343 Ga0070687_100361470 Ga0070687_1003614701 105
145 3300005343 Ga0070687_100460808 Ga0070687_1004608082 105
146 3300005343 Ga0070687_100954148 Ga0070687_1009541481 105
147 3300005344 Ga0070661_100150323 Ga0070661_1001503232 105
148 3300005344 Ga0070661_100271767 Ga0070661_1002717673 105
149 3300005344 Ga0070661_101029760 Ga0070661_1010297602 105
150 3300005345 Ga0070692_10023267 Ga0070692_100232677 105
151 3300005345 Ga0070692_10023401 Ga0070692_100234012 105
152 3300005345 Ga0070692_10147347 Ga0070692_101473473 105
153 3300005347 Ga0070668_100304035 Ga0070668_1003040352 105
154 3300005347 Ga0070668_100714326 Ga0070668_1007143262 105
155 3300005353 Ga0070669_100102281 Ga0070669_1001022814 105
156 3300005353 Ga0070669_100267656 Ga0070669_1002676562 105
157 3300005353 Ga0070669_100426289 Ga0070669_1004262892 105
158 3300005353 Ga0070669_101719786 Ga0070669_1017197862 105
159 3300005354 Ga0070675_100057111 Ga0070675_1000571115 105
160 3300005354 Ga0070675_100352665 Ga0070675_1003526652 105
161 3300005354 Ga0070675_100471326 Ga0070675_1004713261 105
162 3300005354 Ga0070675_101157279 Ga0070675_1011572791 105
163 3300005354 Ga0070675_101765755 Ga0070675_1017657552 105
164 3300005355 Ga0070671_100340695 Ga0070671_1003406952 105
165 3300005355 Ga0070671_100375053 Ga0070671_1003750532 105
166 3300005355 Ga0070671_100826219 Ga0070671_1008262191 105
167 3300005355 Ga0070671_101569923 Ga0070671_1015699232 105
168 3300005356 Ga0070674_100014259 Ga0070674_1000142598 105
169 3300005356 Ga0070674_100106716 Ga0070674_1001067165 105
170 3300005364 Ga0070673_100177686 Ga0070673_1001776863 105
171 3300005364 Ga0070673_100252247 Ga0070673_1002522473 105
172 3300005365 Ga0070688_100062951 Ga0070688_1000629513 105
173 3300005365 Ga0070688_100092946 Ga0070688_1000929464 105
174 3300005366 Ga0070659_100975614 Ga0070659_1009756141 105
175 3300005367 Ga0070667_100097551 Ga0070667_1000975514 105
176 3300005367 Ga0070667_100703035 Ga0070667_1007030352 105
177 3300005434 Ga0070709_10259538 Ga0070709_102595384 105
178 3300005435 Ga0070714_100973792 Ga0070714_1009737921 105
179 3300005436 Ga0070713_100461083 Ga0070713_1004610832 105
180 3300005438 Ga0070701_10003420 Ga0070701_100034204 105
181 3300005438 Ga0070701_10004910 Ga0070701_100049106 105
182 3300005438 Ga0070701_10256191 Ga0070701_102561912 105
183 3300005438 Ga0070701_10597077 Ga0070701_105970772 105
184 3300005438 Ga0070701_11167394 Ga0070701_111673941 105
185 3300005439 Ga0070711_100582225 Ga0070711_1005822252 105
186 3300005439 Ga0070711_101501762 Ga0070711_1015017621 105
187 3300005440 Ga0070705_100004151 Ga0070705_1000041512 105
188 3300005440 Ga0070705_100025279 Ga0070705_1000252797 105
189 3300005440 Ga0070705_100087011 Ga0070705_1000870112 105
190 3300005440 Ga0070705_100118750 Ga0070705_1001187501 105
191 3300005440 Ga0070705_100645443 Ga0070705_1006454432 105
192 3300005440 Ga0070705_100730473 Ga0070705_1007304732 105
193 3300005440 Ga0070705_101164724 Ga0070705_1011647241 105
194 3300005440 Ga0070705_101570558 Ga0070705_1015705581 105
195 3300005440 Ga0070705_101732436 Ga0070705_1017324361 105
196 3300005441 Ga0070700_100004810 Ga0070700_10000481012 105
197 3300005441 Ga0070700_100008581 Ga0070700_10000858110 105
198 3300005441 Ga0070700_100016206 Ga0070700_1000162067 105
199 3300005441 Ga0070700_100022163 Ga0070700_1000221633 105
200 3300005441 Ga0070700_100276590 Ga0070700_1002765902 105
201 3300005441 Ga0070700_100951659 Ga0070700_1009516591 105
202 3300005444 Ga0070694_100001615 Ga0070694_10000161513 105
203 3300005444 Ga0070694_100011413 Ga0070694_10001141310 105
204 3300005444 Ga0070694_100171493 Ga0070694_1001714934 105
205 3300005444 Ga0070694_100201519 Ga0070694_1002015192 105
206 3300005444 Ga0070694_100253752 Ga0070694_1002537523 105
207 3300005444 Ga0070694_100282423 Ga0070694_1002824233 105
208 3300005444 Ga0070694_100455390 Ga0070694_1004553902 105
209 3300005444 Ga0070694_100563771 Ga0070694_1005637711 105
210 3300005444 Ga0070694_100607104 Ga0070694_1006071042 105
211 3300005444 Ga0070694_100823067 Ga0070694_1008230671 105
212 3300005444 Ga0070694_100925809 Ga0070694_1009258092 105
213 3300005444 Ga0070694_100938272 Ga0070694_1009382721 105
214 3300005444 Ga0070694_101958670 Ga0070694_1019586701 105
215 3300005445 Ga0070708_100077421 Ga0070708_1000774212 105
216 3300005445 Ga0070708_100270554 Ga0070708_1002705543 105
217 3300005455 Ga0070663_100766300 Ga0070663_1007663002 105
218 3300005455 Ga0070663_101312334 Ga0070663_1013123341 105
219 3300005456 Ga0070678_100021374 Ga0070678_1000213746 105
220 3300005456 Ga0070678_100205032 Ga0070678_1002050322 105
221 3300005456 Ga0070678_100975082 Ga0070678_1009750822 105
222 3300005457 Ga0070662_100031910 Ga0070662_1000319107 105
223 3300005457 Ga0070662_100225275 Ga0070662_1002252752 105
224 3300005457 Ga0070662_101209235 Ga0070662_1012092352 105
225 3300005458 Ga0070681_10001245 Ga0070681_1000124514 105
226 3300005458 Ga0070681_10010917 Ga0070681_100109178 105
227 3300005458 Ga0070681_10013972 Ga0070681_100139729 105
228 3300005458 Ga0070681_10084187 Ga0070681_100841875 105
229 3300005458 Ga0070681_11017592 Ga0070681_110175922 105
230 3300005458 Ga0070681_11670671 Ga0070681_116706712 105
231 3300005459 Ga0068867_100002002 Ga0068867_10000200213 105
232 3300005459 Ga0068867_100020156 Ga0068867_1000201569 105
233 3300005459 Ga0068867_100084552 Ga0068867_1000845525 105
234 3300005459 Ga0068867_100192943 Ga0068867_1001929433 105
235 3300005459 Ga0068867_100384697 Ga0068867_1003846972 105
236 3300005459 Ga0068867_100510719 Ga0068867_1005107193 105
237 3300005459 Ga0068867_100704112 Ga0068867_1007041121 105
238 3300005459 Ga0068867_101682857 Ga0068867_1016828571 105
239 3300005466 Ga0070685_10119525 Ga0070685_101195254 105
240 3300005466 Ga0070685_10146965 Ga0070685_101469652 105
241 3300005467 Ga0070706_100211323 Ga0070706_1002113236 105
242 3300005468 Ga0070707_100064367 Ga0070707_1000643678 105
243 3300005468 Ga0070707_100360224 Ga0070707_1003602243 105
244 3300005468 Ga0070707_100878854 Ga0070707_1008788542 105
245 3300005471 Ga0070698_100068456 Ga0070698_1000684564 105
246 3300005471 Ga0070698_100548218 Ga0070698_1005482182 105
247 3300005471 Ga0070698_101074132 Ga0070698_1010741321 105
248 3300005518 Ga0070699_100114998 Ga0070699_1001149985 105
249 3300005518 Ga0070699_101169279 Ga0070699_1011692792 105
250 3300005530 Ga0070679_100047981 Ga0070679_1000479812 105
251 3300005530 Ga0070679_100085474 Ga0070679_1000854747 105
252 3300005530 Ga0070679_100710531 Ga0070679_1007105311 105
253 3300005535 Ga0070684_100381722 Ga0070684_1003817221 105
254 3300005539 Ga0068853_100113226 Ga0068853_1001132262 105
255 3300005539 Ga0068853_101426199 Ga0068853_1014261991 105
256 3300005539 Ga0068853_102432824 Ga0068853_1024328241 105
257 3300005543 Ga0070672_100872148 Ga0070672_1008721482 105
258 3300005543 Ga0070672_101034153 Ga0070672_1010341532 105
259 3300005543 Ga0070672_101237293 Ga0070672_1012372932 105
260 3300005544 Ga0070686_100005386 Ga0070686_1000053862 105
261 3300005544 Ga0070686_100008053 Ga0070686_1000080536 105
262 3300005544 Ga0070686_100067971 Ga0070686_1000679713 105
263 3300005544 Ga0070686_100104063 Ga0070686_1001040636 105
264 3300005544 Ga0070686_100113557 Ga0070686_1001135572 105
265 3300005544 Ga0070686_100209308 Ga0070686_1002093084 105
266 3300005544 Ga0070686_100891871 Ga0070686_1008918711 105
267 3300005545 Ga0070695_100002452 Ga0070695_10000245210 105
268 3300005545 Ga0070695_100053783 Ga0070695_1000537836 105
269 3300005545 Ga0070695_100059957 Ga0070695_1000599576 105
270 3300005545 Ga0070695_100067573 Ga0070695_1000675732 105
271 3300005545 Ga0070695_100107065 Ga0070695_1001070651 105
272 3300005545 Ga0070695_100405521 Ga0070695_1004055212 105
273 3300005545 Ga0070695_100424260 Ga0070695_1004242602 105
274 3300005545 Ga0070695_100688032 Ga0070695_1006880322 105
275 3300005545 Ga0070695_100768743 Ga0070695_1007687432 105
276 3300005545 Ga0070695_101384830 Ga0070695_1013848302 105
277 3300005545 Ga0070695_101521815 Ga0070695_1015218151 105
278 3300005546 Ga0070696_100008855 Ga0070696_10000885514 105
279 3300005546 Ga0070696_100186775 Ga0070696_1001867752 105
280 3300005546 Ga0070696_100210004 Ga0070696_1002100042 105
281 3300005546 Ga0070696_100238297 Ga0070696_1002382972 105
282 3300005546 Ga0070696_100288006 Ga0070696_1002880063 105
283 3300005546 Ga0070696_100759477 Ga0070696_1007594772 105
284 3300005546 Ga0070696_100809684 Ga0070696_1008096842 105
285 3300005546 Ga0070696_100897544 Ga0070696_1008975441 105
286 3300005547 Ga0070693_100003958 Ga0070693_10000395814 105
287 3300005547 Ga0070693_100104780 Ga0070693_1001047806 105
288 3300005547 Ga0070693_100258602 Ga0070693_1002586021 105
289 3300005547 Ga0070693_100599816 Ga0070693_1005998162 105
290 3300005547 Ga0070693_101049737 Ga0070693_1010497372 105
291 3300005547 Ga0070693_101068979 Ga0070693_1010689791 105
292 3300005548 Ga0070665_100243577 Ga0070665_1002435773 105
293 3300005548 Ga0070665_101587846 Ga0070665_1015878462 105
294 3300005549 Ga0070704_100006092 Ga0070704_1000060922 105
295 3300005549 Ga0070704_100008494 Ga0070704_10000849410 105
296 3300005549 Ga0070704_100011692 Ga0070704_10001169211 105
297 3300005549 Ga0070704_100011835 Ga0070704_1000118359 105
298 3300005549 Ga0070704_100029374 Ga0070704_1000293742 105
299 3300005549 Ga0070704_100035296 Ga0070704_1000352962 105
300 3300005549 Ga0070704_100204957 Ga0070704_1002049572 105
301 3300005549 Ga0070704_100612905 Ga0070704_1006129052 105
302 3300005549 Ga0070704_100696589 Ga0070704_1006965892 105
303 3300005549 Ga0070704_100947940 Ga0070704_1009479402 105
304 3300005549 Ga0070704_101192943 Ga0070704_1011929432 105
305 3300005563 Ga0068855_100025144 Ga0068855_1000251442 105
306 3300005563 Ga0068855_100063116 Ga0068855_1000631162 105
307 3300005564 Ga0070664_100129787 Ga0070664_1001297875 105
308 3300005564 Ga0070664_100743942 Ga0070664_1007439422 105
309 3300005577 Ga0068857_100354237 Ga0068857_1003542372 105
310 3300005578 Ga0068854_100008879 Ga0068854_10000887914 105
311 3300005614 Ga0068856_100054039 Ga0068856_1000540395 105
312 3300005614 Ga0068856_100066492 Ga0068856_1000664924 105
313 3300005614 Ga0068856_100577812 Ga0068856_1005778122 105
314 3300005615 Ga0070702_100003937 Ga0070702_1000039373 105
315 3300005615 Ga0070702_100012107 Ga0070702_1000121075 105
316 3300005615 Ga0070702_100014621 Ga0070702_1000146216 105
317 3300005615 Ga0070702_100044682 Ga0070702_1000446825 105
318 3300005615 Ga0070702_100297534 Ga0070702_1002975342 105
319 3300005615 Ga0070702_100885338 Ga0070702_1008853381 105
320 3300005616 Ga0068852_100511042 Ga0068852_1005110423 105
321 3300005616 Ga0068852_100701941 Ga0068852_1007019412 105
322 3300005616 Ga0068852_101012256 Ga0068852_1010122562 105
323 3300005616 Ga0068852_102383740 Ga0068852_1023837402 105
324 3300005617 Ga0068859_100046188 Ga0068859_1000461886 105
325 3300005617 Ga0068859_100077704 Ga0068859_1000777047 105
326 3300005617 Ga0068859_100113425 Ga0068859_1001134252 105
327 3300005617 Ga0068859_100323620 Ga0068859_1003236203 105
328 3300005617 Ga0068859_100783542 Ga0068859_1007835422 105
329 3300005617 Ga0068859_101566566 Ga0068859_1015665662 105
330 3300005618 Ga0068864_100114654 Ga0068864_1001146544 105
331 3300005618 Ga0068864_100265233 Ga0068864_1002652334 105
332 3300005618 Ga0068864_102210012 Ga0068864_1022100122 105
333 3300005718 Ga0068866_10000800 Ga0068866_1000080013 105
334 3300005718 Ga0068866_10003079 Ga0068866_100030799 105
335 3300005718 Ga0068866_10003278 Ga0068866_1000327814 105
336 3300005718 Ga0068866_10153563 Ga0068866_101535632 105
337 3300005719 Ga0068861_100001378 Ga0068861_10000137812 105
338 3300005719 Ga0068861_100007917 Ga0068861_10000791713 105
339 3300005719 Ga0068861_100008199 Ga0068861_1000081999 105
340 3300005719 Ga0068861_100131548 Ga0068861_1001315484 105
341 3300005719 Ga0068861_100208882 Ga0068861_1002088823 105
342 3300005719 Ga0068861_100896050 Ga0068861_1008960502 105
343 3300005719 Ga0068861_101690539 Ga0068861_1016905392 105
344 3300005834 Ga0068851_10358403 Ga0068851_103584032 105
345 3300005840 Ga0068870_10009891 Ga0068870_100098917 105
346 3300005840 Ga0068870_10034810 Ga0068870_100348106 105
347 3300005840 Ga0068870_10094428 Ga0068870_100944282 105
348 3300005840 Ga0068870_10395950 Ga0068870_103959502 105
349 3300005840 Ga0068870_10555447 Ga0068870_105554472 105
350 3300005842 Ga0068858_100015520 Ga0068858_1000155204 105
351 3300005842 Ga0068858_100017672 Ga0068858_10001767210 105
352 3300005842 Ga0068858_100572886 Ga0068858_1005728862 105
353 3300005842 Ga0068858_100635651 Ga0068858_1006356512 105
354 3300005843 Ga0068860_100019846 Ga0068860_10001984610 105
355 3300005843 Ga0068860_100021123 Ga0068860_1000211232 105
356 3300005843 Ga0068860_100170761 Ga0068860_1001707612 105
357 3300005843 Ga0068860_100420719 Ga0068860_1004207192 105
358 3300005843 Ga0068860_100799051 Ga0068860_1007990511 105
359 3300005843 Ga0068860_101433126 Ga0068860_1014331262 105
360 3300005844 Ga0068862_100006216 Ga0068862_1000062166 105
361 3300005844 Ga0068862_100015629 Ga0068862_1000156296 105
362 3300005844 Ga0068862_100142453 Ga0068862_1001424535 105
363 3300005844 Ga0068862_100260635 Ga0068862_1002606352 105
364 3300005844 Ga0068862_100328547 Ga0068862_1003285471 105
365 3300005844 Ga0068862_101053408 Ga0068862_1010534082 105
366 3300006163 Ga0070715_10068894 Ga0070715_100688944 105
367 3300006163 Ga0070715_10872492 Ga0070715_108724922 105
368 3300006163 Ga0070715_10892148 Ga0070715_108921482 105
369 3300006173 Ga0070716_100020284 Ga0070716_1000202847 105
370 3300006178 Ga0075367_10701309 Ga0075367_107013091 105
371 3300006195 Ga0075366_10019624 Ga0075366_100196246 105
372 3300006195 Ga0075366_10630568 Ga0075366_106305682 105
373 3300006237 Ga0097621_100001348 Ga0097621_10000134820 105
374 3300006237 Ga0097621_100041396 Ga0097621_1000413962 105
375 3300006237 Ga0097621_100062852 Ga0097621_1000628522 105
376 3300006237 Ga0097621_100180965 Ga0097621_1001809654 105
377 3300006237 Ga0097621_100397084 Ga0097621_1003970843 105
378 3300006237 Ga0097621_100554017 Ga0097621_1005540172 105
379 3300006237 Ga0097621_100782777 Ga0097621_1007827772 105
380 3300006358 Ga0068871_100000763 Ga0068871_10000076312 105
381 3300006358 Ga0068871_100001793 Ga0068871_10000179314 105
382 3300006358 Ga0068871_100038968 Ga0068871_1000389685 105
383 3300006358 Ga0068871_100066382 Ga0068871_1000663823 105
384 3300006358 Ga0068871_100652894 Ga0068871_1006528942 105
385 3300006358 Ga0068871_101835926 Ga0068871_1018359261 105
386 3300006844 Ga0075428_100000047 Ga0075428_100000047102 105
387 3300006844 Ga0075428_100000808 Ga0075428_10000080814 105
388 3300006844 Ga0075428_100015919 Ga0075428_10001591910 105
389 3300006844 Ga0075428_100022001 Ga0075428_10002200110 105
390 3300006844 Ga0075428_100201562 Ga0075428_1002015622 105
391 3300006844 Ga0075428_101755829 Ga0075428_1017558291 105
392 3300006846 Ga0075430_100000579 Ga0075430_10000057914 105
393 3300006846 Ga0075430_100012417 Ga0075430_1000124178 105
394 3300006846 Ga0075430_100199474 Ga0075430_1001994742 105
395 3300006846 Ga0075430_100257074 Ga0075430_1002570742 105
396 3300006846 Ga0075430_100358361 Ga0075430_1003583612 105
397 3300006846 Ga0075430_100461911 Ga0075430_1004619112 105
398 3300006846 Ga0075430_100735127 Ga0075430_1007351272 105
399 3300006846 Ga0075430_101078377 Ga0075430_1010783772 105
400 3300006846 Ga0075430_101165459 Ga0075430_1011654591 105
401 3300006846 Ga0075430_101392324 Ga0075430_1013923241 105
402 3300006847 Ga0075431_100001591 Ga0075431_10000159125 105
403 3300006847 Ga0075431_100025866 Ga0075431_1000258668 105
404 3300006847 Ga0075431_100030007 Ga0075431_1000300077 105
405 3300006847 Ga0075431_100140879 Ga0075431_1001408792 105
406 3300006847 Ga0075431_100148177 Ga0075431_1001481776 105
407 3300006847 Ga0075431_100418244 Ga0075431_1004182443 105
408 3300006847 Ga0075431_100538566 Ga0075431_1005385662 105
409 3300006847 Ga0075431_100577637 Ga0075431_1005776372 105
410 3300006847 Ga0075431_100816275 Ga0075431_1008162751 105
411 3300006847 Ga0075431_100986936 Ga0075431_1009869362 105
412 3300006852 Ga0075433_10020651 Ga0075433_1002065110 105
413 3300006852 Ga0075433_10083297 Ga0075433_100832971 105
414 3300006852 Ga0075433_10387311 Ga0075433_103873112 105
415 3300006852 Ga0075433_10702413 Ga0075433_107024132 105
416 3300006852 Ga0075433_11268392 Ga0075433_112683921 105
417 3300006871 Ga0075434_100000895 Ga0075434_10000089525 105
418 3300006871 Ga0075434_100012054 Ga0075434_1000120542 105
419 3300006871 Ga0075434_100032897 Ga0075434_1000328977 105
420 3300006871 Ga0075434_100197979 Ga0075434_1001979792 105
421 3300006871 Ga0075434_100345604 Ga0075434_1003456042 105
422 3300006871 Ga0075434_100789255 Ga0075434_1007892551 105
423 3300006871 Ga0075434_101098347 Ga0075434_1010983472 105
424 3300006871 Ga0075434_101792878 Ga0075434_1017928781 105
425 3300006880 Ga0075429_100000047 Ga0075429_10000004763 105
426 3300006880 Ga0075429_100000220 Ga0075429_10000022043 105
427 3300006880 Ga0075429_100040647 Ga0075429_1000406476 105
428 3300006880 Ga0075429_100095463 Ga0075429_1000954632 105
429 3300006880 Ga0075429_100159107 Ga0075429_1001591075 105
430 3300006880 Ga0075429_100206491 Ga0075429_1002064912 105
431 3300006880 Ga0075429_100926024 Ga0075429_1009260242 105
432 3300006880 Ga0075429_101021785 Ga0075429_1010217851 105
433 3300006880 Ga0075429_101608711 Ga0075429_1016087112 105
434 3300006880 Ga0075429_101829282 Ga0075429_1018292822 105
435 3300006881 Ga0068865_100001223 Ga0068865_10000122313 105
436 3300006881 Ga0068865_100005809 Ga0068865_10000580914 105
437 3300006881 Ga0068865_100087295 Ga0068865_1000872956 105
438 3300006881 Ga0068865_100633857 Ga0068865_1006338572 105
439 3300006881 Ga0068865_100744039 Ga0068865_1007440392 105
440 3300006881 Ga0068865_101234548 Ga0068865_1012345482 105
441 3300006914 Ga0075436_100000458 Ga0075436_10000045829 105
442 3300006914 Ga0075436_100013476 Ga0075436_1000134766 105
443 3300006914 Ga0075436_100107512 Ga0075436_1001075122 105
444 3300006914 Ga0075436_100156624 Ga0075436_1001566242 105
445 3300006914 Ga0075436_100394880 Ga0075436_1003948803 105
446 3300006931 Ga0097620_100046188 Ga0097620_1000461885 105
447 3300006931 Ga0097620_100077698 Ga0097620_1000776987 105
448 3300006931 Ga0097620_100113427 Ga0097620_1001134272 105
449 3300006931 Ga0097620_100323614 Ga0097620_1003236142 105
450 3300006931 Ga0097620_100783525 Ga0097620_1007835252 105
451 3300006931 Ga0097620_101566621 Ga0097620_1015666212 105
452 3300007076 Ga0075435_100005357 Ga0075435_10000535715 105
453 3300007076 Ga0075435_100060011 Ga0075435_1000600117 105
454 3300007076 Ga0075435_100136570 Ga0075435_1001365703 105
455 3300007076 Ga0075435_100776647 Ga0075435_1007766472 105
456 3300007076 Ga0075435_101329386 Ga0075435_1013293862 105
457 3300007076 Ga0075435_101594073 Ga0075435_1015940732 105
458 3300007265 Ga0099794_10004598 Ga0099794_100045987 105
459 3300007265 Ga0099794_10038713 Ga0099794_100387132 105
460 3300007265 Ga0099794_10645373 Ga0099794_106453731 105
461 3300007788 Ga0099795_10000373 Ga0099795_100003736 105
462 3300007788 Ga0099795_10100642 Ga0099795_101006423 105
463 3300007788 Ga0099795_10646093 Ga0099795_106460932 105
464 3300009011 Ga0105251_10334631 Ga0105251_103346312 105
465 3300009092 Ga0105250_10224149 Ga0105250_102241492 105
466 3300009093 Ga0105240_12316737 Ga0105240_123167372 105
467 3300009094 Ga0111539_10002099 Ga0111539_1000209914 105
468 3300009094 Ga0111539_10030319 Ga0111539_1003031910 105
469 3300009094 Ga0111539_10069995 Ga0111539_100699956 105
470 3300009094 Ga0111539_10148535 Ga0111539_101485352 105
471 3300009094 Ga0111539_10223146 Ga0111539_102231466 105
472 3300009094 Ga0111539_10309381 Ga0111539_103093815 105
473 3300009094 Ga0111539_10342356 Ga0111539_103423563 105
474 3300009094 Ga0111539_10454500 Ga0111539_104545002 105
475 3300009094 Ga0111539_10556014 Ga0111539_105560142 105
476 3300009094 Ga0111539_10710160 Ga0111539_107101602 105
477 3300009094 Ga0111539_11031804 Ga0111539_110318042 105
478 3300009094 Ga0111539_11490837 Ga0111539_114908372 105
479 3300009094 Ga0111539_12425279 Ga0111539_124252792 105
480 3300009094 Ga0111539_12701363 Ga0111539_127013631 105
481 3300009098 Ga0105245_10002556 Ga0105245_1000255620 105
482 3300009098 Ga0105245_10010103 Ga0105245_1001010314 105
483 3300009098 Ga0105245_10040665 Ga0105245_100406656 105
484 3300009098 Ga0105245_10082869 Ga0105245_100828696 105
485 3300009098 Ga0105245_10388920 Ga0105245_103889202 105
486 3300009101 Ga0105247_10426482 Ga0105247_104264822 105
487 3300009101 Ga0105247_11360580 Ga0105247_113605802 105
488 3300009147 Ga0114129_10008888 Ga0114129_1000888814 105
489 3300009147 Ga0114129_10011902 Ga0114129_1001190218 105
490 3300009147 Ga0114129_10414616 Ga0114129_104146162 105
491 3300009147 Ga0114129_11053150 Ga0114129_110531502 105
492 3300009147 Ga0114129_11386408 Ga0114129_113864082 105
493 3300009147 Ga0114129_12918255 Ga0114129_129182552 105
494 3300009148 Ga0105243_10003107 Ga0105243_1000310713 105
495 3300009148 Ga0105243_10008999 Ga0105243_100089999 105
496 3300009148 Ga0105243_10010767 Ga0105243_1001076713 105
497 3300009148 Ga0105243_10035000 Ga0105243_100350006 105
498 3300009148 Ga0105243_11714261 Ga0105243_117142611 105
499 3300009148 Ga0105243_12321112 Ga0105243_123211122 105
500 3300009174 Ga0105241_10015944 Ga0105241_100159449 105
501 3300009174 Ga0105241_10411605 Ga0105241_104116052 105
502 3300009174 Ga0105241_11346348 Ga0105241_113463482 105
503 3300009176 Ga0105242_10002800 Ga0105242_1000280016 105
504 3300009176 Ga0105242_10009166 Ga0105242_1000916614 105
505 3300009176 Ga0105242_10009973 Ga0105242_100099738 105
506 3300009176 Ga0105242_10026750 Ga0105242_1002675010 105
507 3300009176 Ga0105242_10178692 Ga0105242_101786923 105
508 3300009176 Ga0105242_10622754 Ga0105242_106227542 105
509 3300009176 Ga0105242_11909735 Ga0105242_119097351 105
510 3300009177 Ga0105248_10010314 Ga0105248_1001031417 105
511 3300009177 Ga0105248_10118417 Ga0105248_101184173 105
512 3300009177 Ga0105248_10167563 Ga0105248_101675636 105
513 3300009177 Ga0105248_11013096 Ga0105248_110130963 105
514 3300009177 Ga0105248_11197859 Ga0105248_111978592 105
515 3300009177 Ga0105248_12936476 Ga0105248_129364762 105
516 3300009545 Ga0105237_10022429 Ga0105237_100224291 105
517 3300009545 Ga0105237_11198094 Ga0105237_111980942 105
518 3300009545 Ga0105237_11379321 Ga0105237_113793212 105
519 3300009551 Ga0105238_10382103 Ga0105238_103821032 105
520 3300009551 Ga0105238_10631642 Ga0105238_106316423 105
521 3300009551 Ga0105238_12176484 Ga0105238_121764842 105
522 3300009553 Ga0105249_10010299 Ga0105249_1001029916 105
523 3300009553 Ga0105249_10078757 Ga0105249_100787572 105
524 3300009553 Ga0105249_10363778 Ga0105249_103637782 105
525 3300009553 Ga0105249_10781348 Ga0105249_107813482 105
526 3300009553 Ga0105249_11039131 Ga0105249_110391312 105
527 3300010159 Ga0099796_10001027 Ga0099796_1000102710 105
528 3300010159 Ga0099796_10442540 Ga0099796_104425402 105
529 3300010375 Ga0105239_10185378 Ga0105239_101853785 105
530 3300010375 Ga0105239_10220259 Ga0105239_102202592 105
531 3300010375 Ga0105239_11344751 Ga0105239_113447511 105
532 3300011119 Ga0105246_10094546 Ga0105246_100945462 105
533 3300011119 Ga0105246_10153679 Ga0105246_101536794 105
534 3300013102 Ga0157371_11199658 Ga0157371_111996582 105
535 3300013105 Ga0157369_12469926 Ga0157369_124699262 105
536 3300013105 Ga0157369_12586799 Ga0157369_125867992 105
537 3300013296 Ga0157374_10129323 Ga0157374_101293235 105
538 3300013296 Ga0157374_10138530 Ga0157374_101385302 105
539 3300013296 Ga0157374_10500063 Ga0157374_105000632 105
540 3300013296 Ga0157374_10894281 Ga0157374_108942812 105
541 3300013296 Ga0157374_11020618 Ga0157374_110206182 105
542 3300013297 Ga0157378_10007830 Ga0157378_1000783017 105
543 3300013297 Ga0157378_10021639 Ga0157378_100216395 105
544 3300013297 Ga0157378_10043237 Ga0157378_100432375 105
545 3300013297 Ga0157378_10058507 Ga0157378_100585075 105
546 3300013297 Ga0157378_10174132 Ga0157378_101741322 105
547 3300013297 Ga0157378_12266128 Ga0157378_122661282 105
548 3300013306 Ga0163162_10060008 Ga0163162_100600082 105
549 3300013306 Ga0163162_11071065 Ga0163162_110710653 105
550 3300013307 Ga0157372_11333582 Ga0157372_113335822 105
551 3300013307 Ga0157372_13314326 Ga0157372_133143261 105
552 3300013308 Ga0157375_10042447 Ga0157375_100424479 105
553 3300013308 Ga0157375_11557245 Ga0157375_115572452 105
554 3300013308 Ga0157375_12645822 Ga0157375_126458222 105
555 3300013308 Ga0157375_13364554 Ga0157375_133645541 105
556 3300014325 Ga0163163_10278391 Ga0163163_102783913 105
557 3300014325 Ga0163163_11656453 Ga0163163_116564532 105
558 3300014326 Ga0157380_10024376 Ga0157380_100243762 105
559 3300014326 Ga0157380_10026469 Ga0157380_100264695 105
560 3300014326 Ga0157380_10033551 Ga0157380_100335514 105
561 3300014326 Ga0157380_10301196 Ga0157380_103011964 105
562 3300014326 Ga0157380_10855544 Ga0157380_108555442 105
563 3300014326 Ga0157380_11003438 Ga0157380_110034382 105
564 3300014326 Ga0157380_12491876 Ga0157380_124918762 105
565 3300014745 Ga0157377_10172095 Ga0157377_101720952 105
566 3300014745 Ga0157377_10527454 Ga0157377_105274542 105
567 3300014968 Ga0157379_10030185 Ga0157379_100301859 105
568 3300014968 Ga0157379_10079870 Ga0157379_100798705 105
569 3300014968 Ga0157379_10149967 Ga0157379_101499672 105
570 3300014968 Ga0157379_10982775 Ga0157379_109827752 105
571 3300014968 Ga0157379_11765093 Ga0157379_117650931 105
572 3300014969 Ga0157376_10110927 Ga0157376_101109275 105
573 3300014969 Ga0157376_10160305 Ga0157376_101603055 105
574 3300014969 Ga0157376_10340930 Ga0157376_103409303 105
575 3300014969 Ga0157376_10864239 Ga0157376_108642392 105
576 3300014969 Ga0157376_10928353 Ga0157376_109283532 105
577 3300017792 Ga0163161_10045011 Ga0163161_100450114 105
578 3300017792 Ga0163161_10214617 Ga0163161_102146172 105
579 3300021441 Ga0213871_10066730 Ga0213871_100667302 105
580 3300025315 Ga0207697_10001157 Ga0207697_1000115712 105
581 3300025711 Ga0207696_1039049 Ga0207696_10390492 105
582 3300025885 Ga0207653_10032461 Ga0207653_100324614 105
583 3300025893 Ga0207682_10006357 Ga0207682_100063576 105
584 3300025899 Ga0207642_10000436 Ga0207642_1000043616 105
585 3300025899 Ga0207642_10004830 Ga0207642_100048309 105
586 3300025899 Ga0207642_10256973 Ga0207642_102569733 105
587 3300025901 Ga0207688_10002803 Ga0207688_100028034 105
588 3300025901 Ga0207688_10417319 Ga0207688_104173193 105
589 3300025903 Ga0207680_10058987 Ga0207680_100589872 105
590 3300025903 Ga0207680_11343909 Ga0207680_113439092 105
591 3300025904 Ga0207647_10367431 Ga0207647_103674312 105
592 3300025904 Ga0207647_10551852 Ga0207647_105518522 105
593 3300025906 Ga0207699_10189684 Ga0207699_101896844 105
594 3300025907 Ga0207645_10004332 Ga0207645_1000433210 105
595 3300025907 Ga0207645_10178952 Ga0207645_101789522 105
596 3300025907 Ga0207645_10307354 Ga0207645_103073542 105
597 3300025907 Ga0207645_10433313 Ga0207645_104333132 105
598 3300025908 Ga0207643_10001343 Ga0207643_1000134314 105
599 3300025908 Ga0207643_10005493 Ga0207643_100054935 105
600 3300025908 Ga0207643_10011769 Ga0207643_1001176911 105
601 3300025908 Ga0207643_10022628 Ga0207643_100226286 105
602 3300025908 Ga0207643_10041264 Ga0207643_100412642 105
603 3300025910 Ga0207684_10150016 Ga0207684_101500161 105
604 3300025910 Ga0207684_10529555 Ga0207684_105295553 105
605 3300025910 Ga0207684_11530737 Ga0207684_115307372 105
606 3300025911 Ga0207654_10324813 Ga0207654_103248132 105
607 3300025911 Ga0207654_10435628 Ga0207654_104356282 105
608 3300025911 Ga0207654_10442822 Ga0207654_104428221 105
609 3300025912 Ga0207707_10007445 Ga0207707_1000744515 105
610 3300025912 Ga0207707_10015921 Ga0207707_100159219 105
611 3300025912 Ga0207707_10036525 Ga0207707_100365259 105
612 3300025912 Ga0207707_10168268 Ga0207707_101682684 105
613 3300025912 Ga0207707_11434459 Ga0207707_114344591 105
614 3300025913 Ga0207695_11684538 Ga0207695_116845382 105
615 3300025914 Ga0207671_10095133 Ga0207671_100951331 105
616 3300025914 Ga0207671_10645383 Ga0207671_106453832 105
617 3300025916 Ga0207663_10321063 Ga0207663_103210632 105
618 3300025917 Ga0207660_10001979 Ga0207660_1000197913 105
619 3300025917 Ga0207660_10329659 Ga0207660_103296593 105
620 3300025917 Ga0207660_10377482 Ga0207660_103774823 105
621 3300025917 Ga0207660_10397067 Ga0207660_103970672 105
622 3300025917 Ga0207660_10412360 Ga0207660_104123602 105
623 3300025917 Ga0207660_10933070 Ga0207660_109330702 105
624 3300025917 Ga0207660_11236643 Ga0207660_112366432 105
625 3300025918 Ga0207662_10000006 Ga0207662_100000066 105
626 3300025918 Ga0207662_10009139 Ga0207662_100091392 105
627 3300025918 Ga0207662_10073771 Ga0207662_100737714 105
628 3300025918 Ga0207662_10117611 Ga0207662_101176113 105
629 3300025918 Ga0207662_10299255 Ga0207662_102992552 105
630 3300025918 Ga0207662_10299630 Ga0207662_102996303 105
631 3300025918 Ga0207662_10365384 Ga0207662_103653842 105
632 3300025920 Ga0207649_10478856 Ga0207649_104788562 105
633 3300025921 Ga0207652_10016184 Ga0207652_100161842 105
634 3300025921 Ga0207652_10224142 Ga0207652_102241424 105
635 3300025921 Ga0207652_10287808 Ga0207652_102878082 105
636 3300025921 Ga0207652_10641966 Ga0207652_106419661 105
637 3300025921 Ga0207652_10770365 Ga0207652_107703652 105
638 3300025921 Ga0207652_10935800 Ga0207652_109358002 105
639 3300025922 Ga0207646_10027133 Ga0207646_1002713310 105
640 3300025922 Ga0207646_10527520 Ga0207646_105275202 105
641 3300025922 Ga0207646_10916132 Ga0207646_109161322 105
642 3300025922 Ga0207646_11101336 Ga0207646_111013362 105
643 3300025923 Ga0207681_10003287 Ga0207681_1000328714 105
644 3300025923 Ga0207681_10213883 Ga0207681_102138832 105
645 3300025924 Ga0207694_10318822 Ga0207694_103188223 105
646 3300025925 Ga0207650_10145986 Ga0207650_101459865 105
647 3300025925 Ga0207650_10183495 Ga0207650_101834952 105
648 3300025926 Ga0207659_10979955 Ga0207659_109799552 105
649 3300025927 Ga0207687_10001080 Ga0207687_100010802 105
650 3300025927 Ga0207687_10104647 Ga0207687_101046476 105
651 3300025927 Ga0207687_10309937 Ga0207687_103099372 105
652 3300025927 Ga0207687_10976394 Ga0207687_109763941 105
653 3300025927 Ga0207687_11080102 Ga0207687_110801022 105
654 3300025928 Ga0207700_11071530 Ga0207700_110715302 105
655 3300025929 Ga0207664_10629554 Ga0207664_106295542 105
656 3300025931 Ga0207644_10021011 Ga0207644_100210112 105
657 3300025931 Ga0207644_10136885 Ga0207644_101368854 105
658 3300025931 Ga0207644_11328367 Ga0207644_113283672 105
659 3300025932 Ga0207690_11707372 Ga0207690_117073721 105
660 3300025933 Ga0207706_10006693 Ga0207706_1000669310 105
661 3300025933 Ga0207706_10158436 Ga0207706_101584362 105
662 3300025933 Ga0207706_10217951 Ga0207706_102179514 105
663 3300025933 Ga0207706_10535139 Ga0207706_105351392 105
664 3300025934 Ga0207686_10001285 Ga0207686_1000128513 105
665 3300025934 Ga0207686_10007495 Ga0207686_1000749511 105
666 3300025934 Ga0207686_10015693 Ga0207686_100156933 105
667 3300025934 Ga0207686_10018577 Ga0207686_100185777 105
668 3300025934 Ga0207686_10134223 Ga0207686_101342232 105
669 3300025934 Ga0207686_10313576 Ga0207686_103135761 105
670 3300025935 Ga0207709_10005880 Ga0207709_1000588010 105
671 3300025935 Ga0207709_10006627 Ga0207709_100066277 105
672 3300025935 Ga0207709_10007251 Ga0207709_100072515 105
673 3300025935 Ga0207709_10580959 Ga0207709_105809592 105
674 3300025936 Ga0207670_10005366 Ga0207670_1000536614 105
675 3300025936 Ga0207670_10032595 Ga0207670_100325952 105
676 3300025936 Ga0207670_10131537 Ga0207670_101315376 105
677 3300025936 Ga0207670_10196223 Ga0207670_101962232 105
678 3300025936 Ga0207670_10255423 Ga0207670_102554233 105
679 3300025936 Ga0207670_10644838 Ga0207670_106448382 105
680 3300025937 Ga0207669_10023463 Ga0207669_100234635 105
681 3300025937 Ga0207669_10341596 Ga0207669_103415962 105
682 3300025937 Ga0207669_10441409 Ga0207669_104414092 105
683 3300025938 Ga0207704_10000913 Ga0207704_1000091320 105
684 3300025938 Ga0207704_10007008 Ga0207704_1000700811 105
685 3300025938 Ga0207704_10378324 Ga0207704_103783242 105
686 3300025938 Ga0207704_10397644 Ga0207704_103976442 105
687 3300025938 Ga0207704_10404401 Ga0207704_104044013 105
688 3300025938 Ga0207704_10556179 Ga0207704_105561792 105
689 3300025939 Ga0207665_10128034 Ga0207665_101280342 105
690 3300025939 Ga0207665_10739134 Ga0207665_107391343 105
691 3300025940 Ga0207691_10010153 Ga0207691_100101537 105
692 3300025940 Ga0207691_10054461 Ga0207691_100544619 105
693 3300025940 Ga0207691_10119744 Ga0207691_101197446 105
694 3300025940 Ga0207691_10457538 Ga0207691_104575382 105
695 3300025940 Ga0207691_10817306 Ga0207691_108173062 105
696 3300025941 Ga0207711_10028146 Ga0207711_100281467 105
697 3300025941 Ga0207711_10091045 Ga0207711_100910452 105
698 3300025941 Ga0207711_10112488 Ga0207711_101124886 105
699 3300025942 Ga0207689_10000292 Ga0207689_1000029243 105
700 3300025942 Ga0207689_10000370 Ga0207689_1000037014 105
701 3300025942 Ga0207689_10008334 Ga0207689_100083347 105
702 3300025942 Ga0207689_10014115 Ga0207689_1001411513 105
703 3300025942 Ga0207689_10055992 Ga0207689_100559923 105
704 3300025942 Ga0207689_10988038 Ga0207689_109880381 105
705 3300025944 Ga0207661_10269908 Ga0207661_102699082 105
706 3300025944 Ga0207661_10339098 Ga0207661_103390981 105
707 3300025945 Ga0207679_11090378 Ga0207679_110903782 105
708 3300025949 Ga0207667_10002489 Ga0207667_1000248916 105
709 3300025949 Ga0207667_10051427 Ga0207667_100514272 105
710 3300025949 Ga0207667_10395785 Ga0207667_103957854 105
711 3300025960 Ga0207651_10184977 Ga0207651_101849772 105
712 3300025960 Ga0207651_10223361 Ga0207651_102233612 105
713 3300025960 Ga0207651_10428996 Ga0207651_104289963 105
714 3300025960 Ga0207651_10465783 Ga0207651_104657831 105
715 3300025960 Ga0207651_10504095 Ga0207651_105040952 105
716 3300025961 Ga0207712_10002872 Ga0207712_1000287211 105
717 3300025961 Ga0207712_10007287 Ga0207712_100072872 105
718 3300025961 Ga0207712_10015338 Ga0207712_100153389 105
719 3300025961 Ga0207712_10104420 Ga0207712_101044202 105
720 3300025961 Ga0207712_11041495 Ga0207712_110414952 105
721 3300025981 Ga0207640_10005329 Ga0207640_1000532914 105
722 3300025981 Ga0207640_10937507 Ga0207640_109375072 105
723 3300025986 Ga0207658_11457772 Ga0207658_114577722 105
724 3300026023 Ga0207677_10002702 Ga0207677_1000270210 105
725 3300026023 Ga0207677_10024488 Ga0207677_100244882 105
726 3300026023 Ga0207677_10189354 Ga0207677_101893543 105
727 3300026023 Ga0207677_10258705 Ga0207677_102587053 105
728 3300026023 Ga0207677_10258859 Ga0207677_102588592 105
729 3300026023 Ga0207677_10599005 Ga0207677_105990052 105
730 3300026023 Ga0207677_10903902 Ga0207677_109039023 105
731 3300026035 Ga0207703_10004381 Ga0207703_1000438119 105
732 3300026035 Ga0207703_10043986 Ga0207703_100439864 105
733 3300026035 Ga0207703_10283662 Ga0207703_102836622 105
734 3300026035 Ga0207703_10405619 Ga0207703_104056192 105
735 3300026035 Ga0207703_10503103 Ga0207703_105031032 105
736 3300026035 Ga0207703_10585668 Ga0207703_105856682 105
737 3300026035 Ga0207703_12192858 Ga0207703_121928582 105
738 3300026041 Ga0207639_10045614 Ga0207639_100456143 105
739 3300026041 Ga0207639_11161545 Ga0207639_111615452 105
740 3300026041 Ga0207639_11646932 Ga0207639_116469322 105
741 3300026067 Ga0207678_10133179 Ga0207678_101331791 105
742 3300026075 Ga0207708_10004151 Ga0207708_1000415118 105
743 3300026075 Ga0207708_10005800 Ga0207708_100058007 105
744 3300026075 Ga0207708_10057714 Ga0207708_100577142 105
745 3300026075 Ga0207708_10200386 Ga0207708_102003861 105
746 3300026075 Ga0207708_10416415 Ga0207708_104164152 105
747 3300026075 Ga0207708_10420592 Ga0207708_104205922 105
748 3300026078 Ga0207702_10040250 Ga0207702_100402505 105
749 3300026078 Ga0207702_10220360 Ga0207702_102203602 105
750 3300026078 Ga0207702_10993020 Ga0207702_109930202 105
751 3300026078 Ga0207702_11627321 Ga0207702_116273212 105
752 3300026078 Ga0207702_11778236 Ga0207702_117782361 105
753 3300026088 Ga0207641_10078861 Ga0207641_100788615 105
754 3300026088 Ga0207641_10233491 Ga0207641_102334915 105
755 3300026089 Ga0207648_10004560 Ga0207648_1000456017 105
756 3300026089 Ga0207648_10008885 Ga0207648_1000888513 105
757 3300026089 Ga0207648_10008905 Ga0207648_100089059 105
758 3300026089 Ga0207648_10063803 Ga0207648_100638034 105
759 3300026089 Ga0207648_10190278 Ga0207648_101902785 105
760 3300026089 Ga0207648_10399210 Ga0207648_103992103 105
761 3300026089 Ga0207648_11540271 Ga0207648_115402711 105
762 3300026095 Ga0207676_10018878 Ga0207676_100188782 105
763 3300026095 Ga0207676_10291139 Ga0207676_102911393 105
764 3300026095 Ga0207676_10437772 Ga0207676_104377722 105
765 3300026095 Ga0207676_11629124 Ga0207676_116291242 105
766 3300026095 Ga0207676_11822496 Ga0207676_118224962 105
767 3300026116 Ga0207674_10007832 Ga0207674_1000783217 105
768 3300026116 Ga0207674_10057822 Ga0207674_100578229 105
769 3300026116 Ga0207674_10058297 Ga0207674_100582977 105
770 3300026118 Ga0207675_100004342 Ga0207675_10000434222 105
771 3300026118 Ga0207675_100006269 Ga0207675_10000626914 105
772 3300026118 Ga0207675_100010565 Ga0207675_1000105657 105
773 3300026118 Ga0207675_100013573 Ga0207675_1000135735 105
774 3300026118 Ga0207675_100059255 Ga0207675_1000592559 105
775 3300026118 Ga0207675_101635540 Ga0207675_1016355402 105
776 3300026121 Ga0207683_10007403 Ga0207683_1000740314 105
777 3300026121 Ga0207683_10041485 Ga0207683_100414856 105
778 3300026121 Ga0207683_10130176 Ga0207683_101301762 105
779 3300026121 Ga0207683_10154381 Ga0207683_101543812 105
780 3300026121 Ga0207683_11198099 Ga0207683_111980992 105
781 3300026142 Ga0207698_10050988 Ga0207698_100509887 105
782 3300026142 Ga0207698_10466331 Ga0207698_104663312 105
783 3300026142 Ga0207698_11157997 Ga0207698_111579972 105
784 3300027252 Ga0209973_1087373 Ga0209973_10873731 105
785 3300027360 Ga0209969_1000547 Ga0209969_10005475 105
786 3300027360 Ga0209969_1002984 Ga0209969_10029845 105
787 3300027360 Ga0209969_1073969 Ga0209969_10739692 105
788 3300027364 Ga0209967_1000358 Ga0209967_10003585 105
789 3300027364 Ga0209967_1002852 Ga0209967_10028525 105
790 3300027364 Ga0209967_1007341 Ga0209967_10073414 105
791 3300027378 Ga0209981_1000434 Ga0209981_100043411 105
792 3300027378 Ga0209981_1002861 Ga0209981_10028615 105
793 3300027378 Ga0209981_1026935 Ga0209981_10269352 105
794 3300027395 Ga0209996_1007434 Ga0209996_10074342 105
795 3300027395 Ga0209996_1012987 Ga0209996_10129873 105
796 3300027395 Ga0209996_1017859 Ga0209996_10178592 105
797 3300027395 Ga0209996_1045320 Ga0209996_10453202 105
798 3300027395 Ga0209996_1047639 Ga0209996_10476392 105
799 3300027424 Ga0209984_1060594 Ga0209984_10605941 105
800 3300027462 Ga0210000_1001641 Ga0210000_10016415 105
801 3300027462 Ga0210000_1006381 Ga0210000_10063812 105
802 3300027462 Ga0210000_1022258 Ga0210000_10222582 105
803 3300027462 Ga0210000_1041021 Ga0210000_10410212 105
804 3300027462 Ga0210000_1078846 Ga0210000_10788462 105
805 3300027471 Ga0209995_1010585 Ga0209995_10105851 105
806 3300027471 Ga0209995_1020156 Ga0209995_10201562 105
807 3300027471 Ga0209995_1083857 Ga0209995_10838572 105
808 3300027512 Ga0209179_1001842 Ga0209179_10018423 105
809 3300027526 Ga0209968_1064292 Ga0209968_10642922 105
810 3300027543 Ga0209999_1010791 Ga0209999_10107912 105
811 3300027543 Ga0209999_1030844 Ga0209999_10308442 105
812 3300027543 Ga0209999_1031291 Ga0209999_10312911 105
813 3300027543 Ga0209999_1034116 Ga0209999_10341162 105
814 3300027552 Ga0209982_1008959 Ga0209982_10089591 105
815 3300027614 Ga0209970_1039948 Ga0209970_10399482 105
816 3300027614 Ga0209970_1092818 Ga0209970_10928181 105
817 3300027665 Ga0209983_1003146 Ga0209983_10031462 105
818 3300027665 Ga0209983_1080830 Ga0209983_10808302 105
819 3300027671 Ga0209588_1005292 Ga0209588_10052925 105
820 3300027671 Ga0209588_1061196 Ga0209588_10611962 105
821 3300027682 Ga0209971_1000807 Ga0209971_100080713 105
822 3300027682 Ga0209971_1006804 Ga0209971_10068043 105
823 3300027682 Ga0209971_1006907 Ga0209971_10069076 105
824 3300027695 Ga0209966_1002355 Ga0209966_10023558 105
825 3300027695 Ga0209966_1005071 Ga0209966_10050715 105
826 3300027695 Ga0209966_1035847 Ga0209966_10358472 105
827 3300027695 Ga0209966_1048597 Ga0209966_10485972 105
828 3300027717 Ga0209998_10019418 Ga0209998_100194184 105
829 3300027876 Ga0209974_10000163 Ga0209974_1000016328 105
830 3300027876 Ga0209974_10060324 Ga0209974_100603244 105
831 3300027907 Ga0207428_10002412 Ga0207428_1000241217 105
832 3300027907 Ga0207428_10009607 Ga0207428_100096079 105
833 3300027907 Ga0207428_10047143 Ga0207428_100471435 105
834 3300027907 Ga0207428_10357483 Ga0207428_103574833 105
835 3300027907 Ga0207428_10438154 Ga0207428_104381542 105
836 3300027907 Ga0207428_10573199 Ga0207428_105731992 105
837 3300028379 Ga0268266_10380414 Ga0268266_103804142 105
838 3300028380 Ga0268265_10000858 Ga0268265_100008582 105
839 3300028380 Ga0268265_10004065 Ga0268265_100040657 105
840 3300028380 Ga0268265_10188685 Ga0268265_101886852 105
841 3300028380 Ga0268265_10247238 Ga0268265_102472384 105
842 3300028380 Ga0268265_10262411 Ga0268265_102624115 105
843 3300028381 Ga0268264_10003087 Ga0268264_1000308717 105
844 3300028381 Ga0268264_10044828 Ga0268264_100448286 105
845 3300028381 Ga0268264_10138389 Ga0268264_101383891 105
846 3300028381 Ga0268264_10145830 Ga0268264_101458306 105
847 3300028381 Ga0268264_10651704 Ga0268264_106517041 105
848 3300028381 Ga0268264_11125347 Ga0268264_111253472 105
849 3300028577 Ga0265318_10002940 Ga0265318_100029409 105
850 3300028800 Ga0265338_10389059 Ga0265338_103890592 105
851 3300029957 Ga0265324_10251776 Ga0265324_102517761 105
852 3300031235 Ga0265330_10032242 Ga0265330_100322422 105
853 3300031238 Ga0265332_10002675 Ga0265332_100026757 105
854 3300031239 Ga0265328_10021129 Ga0265328_100211296 105
855 3300031239 Ga0265328_10184284 Ga0265328_101842842 105
856 3300031240 Ga0265320_10033040 Ga0265320_100330406 105
857 3300031242 Ga0265329_10005644 Ga0265329_100056444 105
858 3300031242 Ga0265329_10192013 Ga0265329_101920132 105
859 3300031249 Ga0265339_10444206 Ga0265339_104442061 105
860 3300031250 Ga0265331_10004043 Ga0265331_1000404314 105
861 3300031344 Ga0265316_10026805 Ga0265316_1002680510 105
862 3300031344 Ga0265316_10029265 Ga0265316_100292659 105
863 3300031344 Ga0265316_10473472 Ga0265316_104734721 105
864 3300031507 Ga0307509_10000050 Ga0307509_1000005057 105
865 3300031507 Ga0307509_10629011 Ga0307509_106290112 105
866 3300031548 Ga0307408_100094279 Ga0307408_1000942792 105
867 3300031548 Ga0307408_100481016 Ga0307408_1004810162 105
868 3300031548 Ga0307408_100496673 Ga0307408_1004966732 105
869 3300031548 Ga0307408_100775553 Ga0307408_1007755532 105
870 3300031548 Ga0307408_100875472 Ga0307408_1008754721 105
871 3300031548 Ga0307408_101201984 Ga0307408_1012019841 105
872 3300031548 Ga0307408_101563293 Ga0307408_1015632932 105
873 3300031595 Ga0265313_10158854 Ga0265313_101588542 105
874 3300031665 Ga0316575_10017794 Ga0316575_100177942 105
875 3300031665 Ga0316575_10081963 Ga0316575_100819631 105
876 3300031691 Ga0316579_10000104 Ga0316579_1000010424 105
877 3300031691 Ga0316579_10003879 Ga0316579_100038799 105
878 3300031691 Ga0316579_10007430 Ga0316579_100074307 105
879 3300031711 Ga0265314_10000765 Ga0265314_1000076527 105
880 3300031712 Ga0265342_10065682 Ga0265342_100656823 105
881 3300031727 Ga0316576_10000067 Ga0316576_1000006729 105
882 3300031727 Ga0316576_10000685 Ga0316576_1000068515 105
883 3300031728 Ga0316578_10000046 Ga0316578_1000004614 105
884 3300031728 Ga0316578_10014712 Ga0316578_100147127 105
885 3300031731 Ga0307405_10541915 Ga0307405_105419152 105
886 3300031731 Ga0307405_10648164 Ga0307405_106481642 105
887 3300031731 Ga0307405_11075493 Ga0307405_110754932 105
888 3300031731 Ga0307405_11174540 Ga0307405_111745402 105
889 3300031731 Ga0307405_11235792 Ga0307405_112357922 105
890 3300031733 Ga0316577_10000967 Ga0316577_1000096717 105
891 3300031733 Ga0316577_10001498 Ga0316577_1000149812 105
892 3300031733 Ga0316577_10334178 Ga0316577_103341782 105
893 3300031824 Ga0307413_10646002 Ga0307413_106460022 105
894 3300031852 Ga0307410_10129185 Ga0307410_101291853 105
895 3300031852 Ga0307410_10499049 Ga0307410_104990492 105
896 3300031852 Ga0307410_10539868 Ga0307410_105398682 105
897 3300031901 Ga0307406_10160574 Ga0307406_101605744 105
898 3300031901 Ga0307406_10320343 Ga0307406_103203432 105
899 3300031901 Ga0307406_10809428 Ga0307406_108094282 105
900 3300031901 Ga0307406_10885182 Ga0307406_108851822 105
901 3300031901 Ga0307406_11700694 Ga0307406_117006942 105
902 3300031903 Ga0307407_10071899 Ga0307407_100718994 105
903 3300031903 Ga0307407_10335767 Ga0307407_103357672 105
904 3300031903 Ga0307407_10356734 Ga0307407_103567342 105
905 3300031903 Ga0307407_10437732 Ga0307407_104377323 105
906 3300031903 Ga0307407_11191000 Ga0307407_111910001 105
907 3300031903 Ga0307407_11620201 Ga0307407_116202011 105
908 3300031911 Ga0307412_10302433 Ga0307412_103024332 105
909 3300031911 Ga0307412_10311817 Ga0307412_103118172 105
910 3300031911 Ga0307412_10696821 Ga0307412_106968212 105
911 3300031911 Ga0307412_11211459 Ga0307412_112114592 105
912 3300031995 Ga0307409_100176131 Ga0307409_1001761312 105
913 3300031995 Ga0307409_102532670 Ga0307409_1025326702 105
914 3300032002 Ga0307416_100030489 Ga0307416_1000304892 105
915 3300032002 Ga0307416_100035079 Ga0307416_1000350792 105
916 3300032002 Ga0307416_100100966 Ga0307416_1001009666 105
917 3300032002 Ga0307416_100189830 Ga0307416_1001898304 105
918 3300032002 Ga0307416_100349609 Ga0307416_1003496093 105
919 3300032002 Ga0307416_100521706 Ga0307416_1005217062 105
920 3300032002 Ga0307416_100585693 Ga0307416_1005856933 105
921 3300032002 Ga0307416_101314390 Ga0307416_1013143902 105
922 3300032002 Ga0307416_101329746 Ga0307416_1013297462 105
923 3300032002 Ga0307416_102621660 Ga0307416_1026216602 105
924 3300032002 Ga0307416_103092088 Ga0307416_1030920881 105
925 3300032004 Ga0307414_10128163 Ga0307414_101281631 105
926 3300032005 Ga0307411_10035780 Ga0307411_100357807 105
927 3300032005 Ga0307411_10041460 Ga0307411_100414602 105
928 3300032005 Ga0307411_10102375 Ga0307411_101023752 105
929 3300032005 Ga0307411_10167736 Ga0307411_101677365 105
930 3300032005 Ga0307411_10251546 Ga0307411_102515462 105
931 3300032005 Ga0307411_10326768 Ga0307411_103267683 105
932 3300032005 Ga0307411_10489053 Ga0307411_104890532 105
933 3300032126 Ga0307415_100499359 Ga0307415_1004993592 105
934 3300032126 Ga0307415_101487925 Ga0307415_1014879252 105
935 3300032126 Ga0307415_102263446 Ga0307415_1022634462 105
936 3300032133 Ga0316583_10019777 Ga0316583_100197771 105
937 3300032133 Ga0316583_10135774 Ga0316583_101357742 105
938 3300032137 Ga0316585_10000029 Ga0316585_1000002914 105
939 3300032137 Ga0316585_10028503 Ga0316585_100285034 105
940 3300032139 Ga0316580_10000016 Ga0316580_1000001626 105
941 3300032168 Ga0316593_10000167 Ga0316593_1000016711 105
942 3300032168 Ga0316593_10000387 Ga0316593_1000038714 105
943 3300032168 Ga0316593_10000468 Ga0316593_100004688 105
944 3300032168 Ga0316593_10001038 Ga0316593_1000103812 105
945 3300032168 Ga0316593_10001676 Ga0316593_100016762 105
946 3300032168 Ga0316593_10010927 Ga0316593_100109272 105
947 3300032168 Ga0316593_10021147 Ga0316593_100211475 105
948 3300032168 Ga0316593_10069942 Ga0316593_100699422 105
949 3300032168 Ga0316593_10104508 Ga0316593_101045081 105
950 3300032168 Ga0316593_10156905 Ga0316593_101569051 105
951 3300032168 Ga0316593_10183019 Ga0316593_101830192 105
952 3300032168 Ga0316593_10190842 Ga0316593_101908422 105
953 3300032168 Ga0316593_10400864 Ga0316593_104008642 105
954 3300033524 Ga0316592_1000052 Ga0316592_100005213 105
955 3300033527 Ga0316586_1006413 Ga0316586_10064135 105
956 3300033527 Ga0316586_1006567 Ga0316586_10065673 105
957 3300033528 Ga0316588_1000195 Ga0316588_10001953 105
958 3300033529 Ga0316587_1055264 Ga0316587_10552642 105
959 3300033529 Ga0316587_1126985 Ga0316587_11269852 105
960 3300033541 Ga0316596_1000038 Ga0316596_100003816 105
961 3300033541 Ga0316596_1000123 Ga0316596_100012314 105
962 3300033541 Ga0316596_1000864 Ga0316596_10008643 105
963 3300033541 Ga0316596_1002127 Ga0316596_10021279 105
964 3300033541 Ga0316596_1021654 Ga0316596_10216542 105
965 3300033541 Ga0316596_1034592 Ga0316596_10345922 105
966 3300033541 Ga0316596_1047503 Ga0316596_10475032 105
967 3300034816 Ga0373930_0117272 Ga0373930_0117272_266_583 105
968 3300034817 Ga0373948_0033767 Ga0373948_0033767_503_820 105
969 3300034820 Ga0373959_0045221 Ga0373959_0045221_262_579 105
970 3300034957 Ga0373938_0019304 Ga0373938_0019304_151_468 105
971 3300035083 Ga0373926_0048224 Ga0373926_0048224_45_362 105
972 3300035084 Ga0373928_0005915 Ga0373928_0005915_557_874 105
973 3300035084 Ga0373928_0037015 Ga0373928_0037015_759_1079 105
974 3300035084 Ga0373928_0202844 Ga0373928_0202844_110_427 105
975 3300035084 Ga0373928_0258641 Ga0373928_0258641_192_509 105
976 3300035086 Ga0373934_0000158 Ga0373934_0000158_17261_17578 105
977 3300035086 Ga0373934_0001086 Ga0373934_0001086_9086_9403 105
978 3300035086 Ga0373934_0294132 Ga0373934_0294132_248_565 105
979 3300035088 Ga0373940_0049822 Ga0373940_0049822_240_557 105
980 3300035090 Ga0373949_0027669 Ga0373949_0027669_330_647 105
981 3300035090 Ga0373949_0125292 Ga0373949_0125292_335_652 105
982 3300035091 Ga0373951_0008711 Ga0373951_0008711_1361_1678 105
983 3300035092 Ga0373952_0026432 Ga0373952_0026432_254_571 105
984 3300035111 Ga0373923_0004770 Ga0373923_0004770_413_730 105
985 3300035112 Ga0373932_0031857 Ga0373932_0031857_973_1290 105
986 3300035112 Ga0373932_0055953 Ga0373932_0055953_156_473 105
987 3300035112 Ga0373932_0136627 Ga0373932_0136627_462_779 105
988 3300035112 Ga0373932_0173006 Ga0373932_0173006_185_502 105
989 3300035113 Ga0373936_0000624 Ga0373936_0000624_1744_2061 105
990 3300035113 Ga0373936_0535392 Ga0373936_0535392_92_409 105
991 3300035114 Ga0373939_0103931 Ga0373939_0103931_286_603 105
992 3300035114 Ga0373939_0206682 Ga0373939_0206682_74_391 105
993 3300035114 Ga0373939_0309763 Ga0373939_0309763_118_435 105
994 3300035115 Ga0373941_0005817 Ga0373941_0005817_1599_1916 105
995 3300035116 Ga0373945_0265633 Ga0373945_0265633_216_533 105
996 3300035117 Ga0373953_0001117 Ga0373953_0001117_2438_2755 105
997 3300035117 Ga0373953_0028593 Ga0373953_0028593_17_334 105
998 3300035117 Ga0373953_0046589 Ga0373953_0046589_679_996 105
999 3300035118 Ga0373954_0002008 Ga0373954_0002008_5586_5903 105
1000 3300035118 Ga0373954_0002513 Ga0373954_0002513_141_458 105
1001 3300035118 Ga0373954_0009083 Ga0373954_0009083_86_403 105
1002 3300035118 Ga0373954_0124082 Ga0373954_0124082_77_394 105
1003 3300035119 Ga0373956_0000755 Ga0373956_0000755_8747_9064 105
1004 3300035119 Ga0373956_0004261 Ga0373956_0004261_2515_2832 105
1005 3300035119 Ga0373956_0004335 Ga0373956_0004335_5353_5670 105
1006 3300035119 Ga0373956_0380685 Ga0373956_0380685_176_493 105
1007 3300035119 Ga0373956_0533507 Ga0373956_0533507_144_461 105
1008 3300035120 Ga0373957_0002643 Ga0373957_0002643_4410_4727 105
1009 3300035120 Ga0373957_0011093 Ga0373957_0011093_1231_1548 105
1010 3300035120 Ga0373957_0012050 Ga0373957_0012050_1158_1475 105
1011 3300035120 Ga0373957_0221456 Ga0373957_0221456_183_500 105
1012 3300035121 Ga0373960_0082802 Ga0373960_0082802_398_715 105
1013 3300035170 Ga0373943_0084837 Ga0373943_0084837_1103_1420 105
1014 3300035171 Ga0373946_0006373 Ga0373946_0006373_1821_2138 105
1015 3300035171 Ga0373946_0270601 Ga0373946_0270601_454_771 105
1016 3300035172 Ga0373955_0002904 Ga0373955_0002904_6295_6612 105
1017 3300035172 Ga0373955_0004190 Ga0373955_0004190_488_805 105
1018 3300035172 Ga0373955_0349481 Ga0373955_0349481_521_838 105
1019 3300035172 Ga0373955_0873643 Ga0373955_0873643_225_542 105
1020 3300035207 Ga0373942_0279758 Ga0373942_0279758_133_450 105
1021 3300035207 Ga0373942_0305615 Ga0373942_0305615_168_485 105
1022 3300035241 Ga0373961_0075730 Ga0373961_0075730_693_1010 105
1023 3300035241 Ga0373961_0095914 Ga0373961_0095914_186_503 105
1024 3300035241 Ga0373961_0199465 Ga0373961_0199465_239_556 105
1025 3300035242 Ga0373962_0083204 Ga0373962_0083204_63_380 105
1026 3300035242 Ga0373962_0103037 Ga0373962_0103037_263_580 105
1027 3300035242 Ga0373962_0322812 Ga0373962_0322812_119_436 105
1028 3300035398 Ga0316574_0000016 Ga0316574_0000016_3441_3758 105
1029 3300035398 Ga0316574_0028540 Ga0316574_0028540_569_886 105
1030 3300035398 Ga0316574_0228311 Ga0316574_0228311_216_533 105
1031 3300035398 Ga0316574_0548341 Ga0316574_0548341_233_550 105
1032 3300035410 Ga0373924_0001492 Ga0373924_0001492_5037_5354 105
1033 3300035410 Ga0373924_0097856 Ga0373924_0097856_207_524 105
1034 3300035410 Ga0373924_0101212 Ga0373924_0101212_274_591 105
1035 3300035410 Ga0373924_0131457 Ga0373924_0131457_345_662 105
1036 3300035691 Ga0373931_0032033 Ga0373931_0032033_529_846 105
1037 3300035691 Ga0373931_0064527 Ga0373931_0064527_1266_1583 105
1038 3300035691 Ga0373931_0070412 Ga0373931_0070412_1533_1850 105
1039 3300035691 Ga0373931_0078947 Ga0373931_0078947_1347_1664 105
1040 3300035691 Ga0373931_0169828 Ga0373931_0169828_264_581 105
1041 3300035691 Ga0373931_0703191 Ga0373931_0703191_214_531 105
1042 3300035691 Ga0373931_0833253 Ga0373931_0833253_267_584 105
1043 3300035692 Ga0373935_0061266 Ga0373935_0061266_1746_2063 105
1044 3300035692 Ga0373935_0709057 Ga0373935_0709057_83_400 105
1045 3300035695 Ga0373927_0074508 Ga0373927_0074508_1435_1752 105
1046 3300035695 Ga0373927_0375335 Ga0373927_0375335_290_607 105
1047 3300035724 Ga0373933_0000780 Ga0373933_0000780_11793_12110 105
1048 3300035724 Ga0373933_0103282 Ga0373933_0103282_860_1177 105
1049 3300035724 Ga0373933_0421520 Ga0373933_0421520_475_792 105
1050 3300035725 Ga0373947_0069005 Ga0373947_0069005_935_1252 105
1051 3300036401 Ga0373937_0002498 Ga0373937_0002498_5670_5987 105
1052 3300036401 Ga0373937_0002976 Ga0373937_0002976_6553_6870 105
1053 3300036401 Ga0373937_0003228 Ga0373937_0003228_5947_6264 105
1054 3300036401 Ga0373937_0178377 Ga0373937_0178377_346_663 105
1055 3300036401 Ga0373937_0217226 Ga0373937_0217226_407_724 105
1056 3300036401 Ga0373937_0290351 Ga0373937_0290351_249_566 105
1057 3300036401 Ga0373937_0364870 Ga0373937_0364870_105_422 105
1058 3300036401 Ga0373937_0933854 Ga0373937_0933854_474_791 105
1059 3300036647 Ga0316582_0000015 Ga0316582_0000015_6628_6945 105
1060 3300036647 Ga0316582_0007625 Ga0316582_0007625_3310_3627 105
1061 3300036647 Ga0316582_0395463 Ga0316582_0395463_395_712 105
1062 3300036647 Ga0316582_1077289 Ga0316582_1077289_48_365 105
1063 3300036712 Ga0316584_0000487 Ga0316584_0000487_15045_15362 105
1064 3300036712 Ga0316584_0000609 Ga0316584_0000609_5557_5874 105
1065 3300036712 Ga0316584_0046768 Ga0316584_0046768_53_370 105
1066 3300037068 Ga0373925_0003017 Ga0373925_0003017_9992_10309 105
1067 3300037068 Ga0373925_1381282 Ga0373925_1381282_59_376 105
1068 3300037588 Ga0316581_0007287 Ga0316581_0007287_505_822 105
1069 3300037853 Ga0436364_1269112 Ga0436364_1269112_1336_1653 105
1070 3300038443 Ga0395901_0666508 Ga0395901_0666508_603_938 105
1071 3300038996 Ga0242420_044494 Ga0242420_044494_372_689 105
1072 3300039438 Ga0436360_0521510 Ga0436360_0521510_865_1182 105
1073 3300041404 Ga0439436_0046067 Ga0439436_0046067_499_816 105
1074 3300041406 Ga0439439_0004795 Ga0439439_0004795_125_442 105
1075 3300041406 Ga0439439_0090587 Ga0439439_0090587_442_759 105
1076 3300041407 Ga0439447_044922 Ga0439447_044922_642_959 105
1077 3300041410 Ga0439461_0006133 Ga0439461_0006133_1495_1812 105
1078 3300041411 Ga0439466_0265458 Ga0439466_0265458_159_476 105
1079 3300041446 Ga0451794_25102 Ga0451794_25102_210_533 105
1080 3300041454 Ga0451799_14863 Ga0451799_14863_135_458 105
1081 3300041459 Ga0451800_0317342 Ga0451800_0317342_439_756 105
1082 3300041461 Ga0451805_029132 Ga0451805_029132_266_583 105
1083 3300041486 Ga0451807_0787656 Ga0451807_0787656_126_443 105
1084 3300041486 Ga0451807_0872513 Ga0451807_0872513_363_680 105
1085 3300041496 Ga0451839_0614858 Ga0451839_0614858_248_565 105
1086 3300041509 Ga0451843_0768512 Ga0451843_0768512_142_459 105
1087 3300041512 Ga0451853_1511620 Ga0451853_1511620_312_629 105
1088 3300041997 Ga0439431_0052390 Ga0439431_0052390_299_616 105
1089 3300042001 Ga0439441_000058 Ga0439441_000058_7471_7788 105
1090 3300042001 Ga0439441_002636 Ga0439441_002636_1408_1725 105
1091 3300042001 Ga0439441_004832 Ga0439441_004832_171_488 105
1092 3300042001 Ga0439441_010405 Ga0439441_010405_1148_1465 105
1093 3300042001 Ga0439441_048987 Ga0439441_048987_19_336 105
1094 3300042003 Ga0439443_011856 Ga0439443_011856_216_533 105
1095 3300042007 Ga0439449_0158879 Ga0439449_0158879_379_696 105
1096 3300042009 Ga0439451_087743 Ga0439451_087743_52_369 105
1097 3300042013 Ga0439456_019918 Ga0439456_019918_765_1082 105
1098 3300042125 Ga0450923_025496 Ga0450923_025496_769_1086 105
1099 3300042125 Ga0450923_054868 Ga0450923_054868_529_846 105
1100 3300042126 Ga0450888_017492 Ga0450888_017492_397_714 105
1101 3300042129 Ga0450891_029854 Ga0450891_029854_172_489 105
1102 3300042131 Ga0450894_052659 Ga0450894_052659_10_327 105
1103 3300042156 Ga0439446_0005512 Ga0439446_0005512_2550_2867 105
1104 3300042156 Ga0439446_0129234 Ga0439446_0129234_120_437 105
1105 3300042156 Ga0439446_0199598 Ga0439446_0199598_234_551 105
1106 3300042435 Ga0439434_0002508 Ga0439434_0002508_3736_4053 105
1107 3300042436 Ga0439435_0000603 Ga0439435_0000603_1679_1996 105
1108 3300042436 Ga0439435_0000723 Ga0439435_0000723_2594_2911 105
1109 3300042437 Ga0439444_0004900 Ga0439444_0004900_1109_1426 105
1110 3300042438 Ga0439459_0078390 Ga0439459_0078390_312_629 105
1111 3300042530 Ga0450916_088899 Ga0450916_088899_132_449 105
1112 3300042531 Ga0450918_036334 Ga0450918_036334_206_523 105
1113 3300042876 Ga0451577_0029277 Ga0451577_0029277_4215_4532 105
1114 3300042876 Ga0451577_0262897 Ga0451577_0262897_340_657 105
1115 3300042876 Ga0451577_0464427 Ga0451577_0464427_494_811 105
1116 3300042876 Ga0451577_0488116 Ga0451577_0488116_307_624 105
1117 3300042876 Ga0451577_0914359 Ga0451577_0914359_398_715 105
1118 3300042876 Ga0451577_0970095 Ga0451577_0970095_399_716 105
1119 3300044673 Ga0453683_0327501 Ga0453683_0327501_539_856 105
1120 3300044673 Ga0453683_0767018 Ga0453683_0767018_109_426 105
1121 3300044673 Ga0453683_0872655 Ga0453683_0872655_102_419 105
1122 3300044712 Ga0453684_0004092 Ga0453684_0004092_29134_29451 105
1123 3300044712 Ga0453684_0177715 Ga0453684_0177715_887_1204 105
1124 3300044712 Ga0453684_0421641 Ga0453684_0421641_894_1211 105
1125 3300044712 Ga0453684_0694905 Ga0453684_0694905_10_327 105
1126 3300044712 Ga0453684_0797103 Ga0453684_0797103_494_811 105
1127 3300044712 Ga0453684_0988243 Ga0453684_0988243_434_751 105
1128 3300044712 Ga0453684_1270384 Ga0453684_1270384_397_714 105
1129 3300044901 Ga0466960_0135610 Ga0466960_0135610_507_824 105
1130 3300045051 Ga0451576_0044124 Ga0451576_0044124_2819_3136 105
1131 3300045051 Ga0451576_0055564 Ga0451576_0055564_682_999 105
1132 3300045051 Ga0451576_0057306 Ga0451576_0057306_1129_1446 105
1133 3300045051 Ga0451576_0070730 Ga0451576_0070730_598_915 105
1134 3300045051 Ga0451576_0121787 Ga0451576_0121787_436_753 105
1135 3300045051 Ga0451576_0253201 Ga0451576_0253201_511_828 105
1136 3300045051 Ga0451576_0566765 Ga0451576_0566765_764_1081 105
1137 3300045051 Ga0451576_0615895 Ga0451576_0615895_184_501 105
1138 3300045051 Ga0451576_0869437 Ga0451576_0869437_429_746 105
1139 3300045051 Ga0451576_1180872 Ga0451576_1180872_299_616 105
1140 3300045051 Ga0451576_1544956 Ga0451576_1544956_177_494 105
1141 3300045976 Ga0466967_1623748 Ga0466967_1623748_277_594 105
1142 3300046454 Ga0495592_0001797 Ga0495592_0001797_4359_4676 105
1143 3300046454 Ga0495592_0002485 Ga0495592_0002485_5514_5831 105
1144 3300046454 Ga0495592_0008724 Ga0495592_0008724_1307_1624 105
1145 3300046454 Ga0495592_0046906 Ga0495592_0046906_428_745 105
1146 3300046454 Ga0495592_0263209 Ga0495592_0263209_157_474 105
1147 3300046454 Ga0495592_0265960 Ga0495592_0265960_769_1086 105
1148 3300046459 Ga0495629_0021177 Ga0495629_0021177_3138_3455 105
1149 3300046461 Ga0495641_0004364 Ga0495641_0004364_4929_5246 105
1150 3300046462 Ga0495651_0000262 Ga0495651_0000262_15906_16223 105
1151 3300046462 Ga0495651_0001867 Ga0495651_0001867_12753_13070 105
1152 3300046462 Ga0495651_0450849 Ga0495651_0450849_328_645 105
1153 3300046463 Ga0495653_0024888 Ga0495653_0024888_4349_4666 105
1154 3300046472 Ga0495580_0002612 Ga0495580_0002612_4060_4377 105
1155 3300046473 Ga0495582_0019936 Ga0495582_0019936_1900_2217 105
1156 3300046473 Ga0495582_0108559 Ga0495582_0108559_292_609 105
1157 3300046473 Ga0495582_0161598 Ga0495582_0161598_744_1061 105
1158 3300046475 Ga0495639_0003426 Ga0495639_0003426_679_996 105
1159 3300046476 Ga0495662_0000671 Ga0495662_0000671_4556_4873 105
1160 3300046476 Ga0495662_0003778 Ga0495662_0003778_1821_2138 105
1161 3300046477 Ga0495664_0004876 Ga0495664_0004876_2462_2779 105
1162 3300046491 Ga0495584_0157568 Ga0495584_0157568_211_528 105
1163 3300046499 Ga0495594_0047828 Ga0495594_0047828_1546_1863 105
1164 3300046511 Ga0495608_0001279 Ga0495608_0001279_11552_11869 105
1165 3300046511 Ga0495608_0078337 Ga0495608_0078337_1756_2073 105
1166 3300046511 Ga0495608_0742181 Ga0495608_0742181_34_351 105
1167 3300046514 Ga0495618_0003479 Ga0495618_0003479_5434_5751 105
1168 3300046514 Ga0495618_0232214 Ga0495618_0232214_291_608 105
1169 3300046516 Ga0495628_0004691 Ga0495628_0004691_4127_4444 105
1170 3300046516 Ga0495628_0007665 Ga0495628_0007665_8493_8810 105
1171 3300046516 Ga0495628_0020177 Ga0495628_0020177_3470_3787 105
1172 3300046516 Ga0495628_0266828 Ga0495628_0266828_328_645 105
1173 3300046516 Ga0495628_0315733 Ga0495628_0315733_480_797 105
1174 3300046517 Ga0495630_0007891 Ga0495630_0007891_337_654 105
1175 3300046517 Ga0495630_0008596 Ga0495630_0008596_6987_7304 105
1176 3300046526 Ga0495666_0008919 Ga0495666_0008919_2503_2820 105
1177 3300046528 Ga0495642_0043098 Ga0495642_0043098_534_851 105
1178 3300046528 Ga0495642_0087417 Ga0495642_0087417_764_1081 105
1179 3300046529 Ga0495652_0014898 Ga0495652_0014898_305_622 105
1180 3300046529 Ga0495652_0020887 Ga0495652_0020887_3701_4018 105
1181 3300046529 Ga0495652_0167283 Ga0495652_0167283_1065_1382 105
1182 3300046531 Ga0495665_0007072 Ga0495665_0007072_4052_4369 105
1183 3300046533 Ga0495640_0002705 Ga0495640_0002705_7959_8276 105
1184 3300046533 Ga0495640_0072895 Ga0495640_0072895_71_388 105
1185 3300046535 Ga0495586_0002201 Ga0495586_0002201_5993_6310 105
1186 3300046535 Ga0495586_0005265 Ga0495586_0005265_4847_5164 105
1187 3300046536 Ga0495587_0055615 Ga0495587_0055615_1347_1664 105
1188 3300046536 Ga0495587_0069856 Ga0495587_0069856_433_750 105
1189 3300046536 Ga0495587_0663870 Ga0495587_0663870_232_549 105
1190 3300046537 Ga0495598_0065944 Ga0495598_0065944_606_923 105
1191 3300046537 Ga0495598_0151136 Ga0495598_0151136_54_371 105
1192 3300046539 Ga0495621_0127082 Ga0495621_0127082_79_396 105
1193 3300046539 Ga0495621_0202565 Ga0495621_0202565_388_705 105
1194 3300046539 Ga0495621_0504454 Ga0495621_0504454_89_406 105
1195 3300046543 Ga0495645_0006580 Ga0495645_0006580_6199_6516 105
1196 3300046543 Ga0495645_0716975 Ga0495645_0716975_270_587 105
1197 3300046557 Ga0495622_0088378 Ga0495622_0088378_217_534 105
1198 3300046559 Ga0495667_0004974 Ga0495667_0004974_2679_2996 105
1199 3300046559 Ga0495667_0007843 Ga0495667_0007843_4401_4718 105
1200 3300046559 Ga0495667_0010037 Ga0495667_0010037_2091_2408 105
1201 3300046559 Ga0495667_0063165 Ga0495667_0063165_346_663 105
1202 3300046559 Ga0495667_0209715 Ga0495667_0209715_765_1082 105
1203 3300046559 Ga0495667_0655344 Ga0495667_0655344_242_559 105
1204 3300046615 Ga0495656_0039480 Ga0495656_0039480_1344_1661 105
1205 3300046642 Ga0495634_0003763 Ga0495634_0003763_5150_5467 105
1206 3300046642 Ga0495634_0072349 Ga0495634_0072349_37_354 105
1207 3300046642 Ga0495634_0329191 Ga0495634_0329191_282_599 105
1208 3300046663 Ga0495635_0017562 Ga0495635_0017562_250_567 105
1209 3300046663 Ga0495635_0188265 Ga0495635_0188265_438_755 105
1210 3300046664 Ga0495659_0027075 Ga0495659_0027075_1195_1512 105
1211 3300046664 Ga0495659_0142375 Ga0495659_0142375_339_656 105
1212 3300046674 Ga0495588_0504883 Ga0495588_0504883_222_539 105
1213 3300046675 Ga0495657_0017230 Ga0495657_0017230_1316_1633 105
1214 3300046678 Ga0495599_0000999 Ga0495599_0000999_647_964 105
1215 3300046678 Ga0495599_0031317 Ga0495599_0031317_2712_3029 105
1216 3300046678 Ga0495599_0048286 Ga0495599_0048286_66_383 105
1217 3300046678 Ga0495599_0048593 Ga0495599_0048593_904_1221 105
1218 3300046678 Ga0495599_0103237 Ga0495599_0103237_568_885 105
1219 3300046679 Ga0495623_0037153 Ga0495623_0037153_608_925 105
1220 3300046681 Ga0495647_0002171 Ga0495647_0002171_1912_2229 105
1221 3300046683 Ga0495658_0004608 Ga0495658_0004608_1912_2229 105
1222 3300046683 Ga0495658_0092835 Ga0495658_0092835_1235_1552 105
1223 3300046683 Ga0495658_0206319 Ga0495658_0206319_150_467 105
1224 3300046683 Ga0495658_0324375 Ga0495658_0324375_255_572 105
1225 3300046683 Ga0495658_0395259 Ga0495658_0395259_465_782 105
1226 3300046684 Ga0495669_0003086 Ga0495669_0003086_478_795 105
1227 3300046689 Ga0495613_0064087 Ga0495613_0064087_719_1036 105
1228 3300046690 Ga0495624_0042044 Ga0495624_0042044_1296_1613 105
1229 3300046690 Ga0495624_0413718 Ga0495624_0413718_161_478 105
1230 3300046690 Ga0495624_0426540 Ga0495624_0426540_104_421 105
1231 3300046691 Ga0495670_0092936 Ga0495670_0092936_912_1229 105
1232 3300046809 Ga0495600_0001967 Ga0495600_0001967_11082_11399 105
1233 3300046809 Ga0495600_0002534 Ga0495600_0002534_7140_7457 105
1234 3300046809 Ga0495600_0072631 Ga0495600_0072631_1395_1712 105
1235 3300047315 Ga0495581_0247471 Ga0495581_0247471_136_453 105
1236 3300047317 Ga0495604_0011964 Ga0495604_0011964_3740_4057 105
1237 3300047317 Ga0495604_0092590 Ga0495604_0092590_1339_1656 105
1238 3300047317 Ga0495604_0259363 Ga0495604_0259363_581_898 105
1239 3300047317 Ga0495604_0270813 Ga0495604_0270813_488_805 105
1240 3300047317 Ga0495604_0713145 Ga0495604_0713145_43_360 105
1241 3300047318 Ga0495636_0001724 Ga0495636_0001724_2778_3095 105
1242 3300047318 Ga0495636_0113720 Ga0495636_0113720_177_494 105
1243 3300047319 Ga0495674_0003216 Ga0495674_0003216_4326_4643 105
1244 3300047319 Ga0495674_0281599 Ga0495674_0281599_881_1198 105
1245 3300047319 Ga0495674_0550852 Ga0495674_0550852_98_415 105
1246 3300047322 Ga0495680_0001155 Ga0495680_0001155_5988_6305 105
1247 3300047322 Ga0495680_0005362 Ga0495680_0005362_6215_6532 105
1248 3300047322 Ga0495680_0014044 Ga0495680_0014044_1017_1334 105
1249 3300047322 Ga0495680_0482109 Ga0495680_0482109_402_719 105
1250 3300047322 Ga0495680_0972355 Ga0495680_0972355_187_504 105
1251 3300047444 Ga0495675_0000381 Ga0495675_0000381_26512_26829 105
1252 3300047444 Ga0495675_0630924 Ga0495675_0630924_38_355 105
1253 3300047444 Ga0495675_0731233 Ga0495675_0731233_128_445 105
1254 3300047447 Ga0495685_089205 Ga0495685_089205_575_892 105
1255 3300047471 Ga0495684_0006022 Ga0495684_0006022_9086_9403 105
1256 3300047673 Ga0495593_0270410 Ga0495593_0270410_153_470 105
1257 3300048088 Ga0495602_0577526 Ga0495602_0577526_80_397 105
1258 3300048088 Ga0495602_0850953 Ga0495602_0850953_233_550 105
1259 3300048089 Ga0495614_0030199 Ga0495614_0030199_454_771 105
1260 3300048909 Ga0496106_0274076 Ga0496106_0274076_134_451 105
1261 3300048909 Ga0496106_0415580 Ga0496106_0415580_338_655 105
1262 3300048911 Ga0496108_0432798 Ga0496108_0432798_385_702 105
1263 3300048912 Ga0496109_0917385 Ga0496109_0917385_244_561 105
1264 3300048913 Ga0496110_0326046 Ga0496110_0326046_110_427 105
1265 3300048913 Ga0496110_1004145 Ga0496110_1004145_238_555 105
1266 3300048914 Ga0496111_0231257 Ga0496111_0231257_200_517 105
1267 3300048915 Ga0496112_0357365 Ga0496112_0357365_208_525 105
1268 3300048916 Ga0496113_1309431 Ga0496113_1309431_186_503 105
1269 3300048917 Ga0496114_0138568 Ga0496114_0138568_465_782 105
1270 3300048918 Ga0496115_0242099 Ga0496115_0242099_573_890 105
1271 3300049519 Ga0501296_013708 Ga0501296_013708_480_797 105
1272 3300049519 Ga0501296_027026 Ga0501296_027026_95_412 105
1273 3300049519 Ga0501296_060130 Ga0501296_060130_17_334 105
1274 3300049521 Ga0501298_004799 Ga0501298_004799_1361_1678 105
1275 3300049521 Ga0501298_014271 Ga0501298_014271_114_431 105
1276 3300049521 Ga0501298_072859 Ga0501298_072859_412_729 105
1277 3300049521 Ga0501298_104618 Ga0501298_104618_17_334 105
1278 3300049521 Ga0501298_142749 Ga0501298_142749_237_554 105
1279 3300049522 Ga0501299_043278 Ga0501299_043278_421_738 105
1280 3300049568 Ga0501031_0898903 Ga0501031_0898903_149_466 105
1281 3300049569 Ga0501032_0307768 Ga0501032_0307768_562_879 105
1282 3300049570 Ga0501033_0194223 Ga0501033_0194223_949_1266 105
1283 3300049570 Ga0501033_0350928 Ga0501033_0350928_147_464 105
1284 3300049570 Ga0501033_1077124 Ga0501033_1077124_137_454 105
1285 3300049571 Ga0501034_0002599 Ga0501034_0002599_18273_18590 105
1286 3300049571 Ga0501034_0162410 Ga0501034_0162410_695_1012 105
1287 3300049572 Ga0501036_0044466 Ga0501036_0044466_778_1095 105
1288 3300049572 Ga0501036_0057314 Ga0501036_0057314_2599_2916 105
1289 3300049572 Ga0501036_0207451 Ga0501036_0207451_117_434 105
1290 3300049572 Ga0501036_0823735 Ga0501036_0823735_316_633 105
1291 3300049573 Ga0501037_0225499 Ga0501037_0225499_601_918 105
1292 3300049573 Ga0501037_0363440 Ga0501037_0363440_597_914 105
1293 3300049574 Ga0501038_0082883 Ga0501038_0082883_382_699 105
1294 3300049574 Ga0501038_1108877 Ga0501038_1108877_214_531 105
1295 3300049575 Ga0501039_0066388 Ga0501039_0066388_643_960 105
1296 3300049575 Ga0501039_0736240 Ga0501039_0736240_251_568 105
1297 3300049575 Ga0501039_1125267 Ga0501039_1125267_277_594 105
1298 3300049575 Ga0501039_1303300 Ga0501039_1303300_207_524 105
1299 3300049575 Ga0501039_1329448 Ga0501039_1329448_81_398 105
1300 3300049576 Ga0501040_0256524 Ga0501040_0256524_341_658 105
1301 3300049576 Ga0501040_0273887 Ga0501040_0273887_444_761 105
1302 3300049576 Ga0501040_0481802 Ga0501040_0481802_392_709 105
1303 3300049576 Ga0501040_0697892 Ga0501040_0697892_300_617 105
1304 3300049576 Ga0501040_0843750 Ga0501040_0843750_206_523 105
1305 3300049577 Ga0501041_0000437 Ga0501041_0000437_6496_6813 105
1306 3300049577 Ga0501041_0079297 Ga0501041_0079297_1642_1959 105
1307 3300049577 Ga0501041_0154946 Ga0501041_0154946_425_742 105
1308 3300049578 Ga0501042_0157401 Ga0501042_0157401_56_373 105
1309 3300049578 Ga0501042_0354585 Ga0501042_0354585_730_1047 105
1310 3300049578 Ga0501042_0469562 Ga0501042_0469562_351_668 105
1311 3300049578 Ga0501042_0540891 Ga0501042_0540891_498_815 105
1312 3300049580 Ga0501046_0181001 Ga0501046_0181001_951_1268 105
1313 3300049580 Ga0501046_0371107 Ga0501046_0371107_456_773 105
1314 3300049580 Ga0501046_0391615 Ga0501046_0391615_358_675 105
1315 3300049582 Ga0501048_0050022 Ga0501048_0050022_705_1022 105
1316 3300049582 Ga0501048_0578125 Ga0501048_0578125_207_524 105
1317 3300049582 Ga0501048_1364085 Ga0501048_1364085_178_495 105
1318 3300049583 Ga0501067_0211966 Ga0501067_0211966_444_761 105
1319 3300049584 Ga0501068_0777734 Ga0501068_0777734_290_607 105
1320 3300049585 Ga0501069_0505698 Ga0501069_0505698_86_403 105
1321 3300049587 Ga0501071_0148530 Ga0501071_0148530_1006_1323 105
1322 3300049587 Ga0501071_0219677 Ga0501071_0219677_1021_1338 105
1323 3300049587 Ga0501071_0537966 Ga0501071_0537966_387_704 105
1324 3300049588 Ga0501072_0007047 Ga0501072_0007047_2451_2768 105
1325 3300049588 Ga0501072_0030599 Ga0501072_0030599_1765_2082 105
1326 3300049588 Ga0501072_0032220 Ga0501072_0032220_2983_3300 105
1327 3300049588 Ga0501072_0047187 Ga0501072_0047187_1712_2029 105
1328 3300049588 Ga0501072_0061311 Ga0501072_0061311_2639_2956 105
1329 3300049588 Ga0501072_0158094 Ga0501072_0158094_366_683 105
1330 3300049588 Ga0501072_0708480 Ga0501072_0708480_281_598 105
1331 3300049588 Ga0501072_0912556 Ga0501072_0912556_210_527 105
1332 3300049588 Ga0501072_1048418 Ga0501072_1048418_268_585 105
1333 3300049588 Ga0501072_1535002 Ga0501072_1535002_16_333 105
1334 3300049590 Ga0501074_0055306 Ga0501074_0055306_552_869 105
1335 3300049590 Ga0501074_0234284 Ga0501074_0234284_242_559 105
1336 3300049591 Ga0501075_0001690 Ga0501075_0001690_10295_10612 105
1337 3300049591 Ga0501075_0031943 Ga0501075_0031943_2794_3111 105
1338 3300049591 Ga0501075_0096383 Ga0501075_0096383_1874_2191 105
1339 3300049591 Ga0501075_0308945 Ga0501075_0308945_305_622 105
1340 3300049591 Ga0501075_0309541 Ga0501075_0309541_827_1144 105
1341 3300049592 Ga0501076_0020757 Ga0501076_0020757_2044_2361 105
1342 3300049592 Ga0501076_0160766 Ga0501076_0160766_980_1297 105
1343 3300049592 Ga0501076_0183238 Ga0501076_0183238_496_813 105
1344 3300049592 Ga0501076_0425627 Ga0501076_0425627_761_1078 105
1345 3300049592 Ga0501076_0881283 Ga0501076_0881283_341_658 105
1346 3300049593 Ga0501077_0052597 Ga0501077_0052597_771_1088 105
1347 3300049593 Ga0501077_0127887 Ga0501077_0127887_996_1313 105
1348 3300049593 Ga0501077_0232491 Ga0501077_0232491_627_944 105
1349 3300049593 Ga0501077_0275974 Ga0501077_0275974_428_745 105
1350 3300049654 Ga0501207_149814 Ga0501207_149814_12_329 105
1351 3300049665 Ga0501227_166023 Ga0501227_166023_266_583 105
1352 3300049668 Ga0501233_049447 Ga0501233_049447_646_963 105
1353 3300049669 Ga0501235_135526 Ga0501235_135526_195_512 105
1354 3300049741 Ga0501079_0081724 Ga0501079_0081724_1246_1563 105
1355 3300049741 Ga0501079_0375905 Ga0501079_0375905_275_592 105
1356 3300049741 Ga0501079_0456661 Ga0501079_0456661_109_426 105
1357 3300049741 Ga0501079_0628222 Ga0501079_0628222_61_378 105
1358 3300049741 Ga0501079_1040873 Ga0501079_1040873_132_449 105
1359 3300049742 Ga0501080_0582653 Ga0501080_0582653_120_437 105
1360 3300049742 Ga0501080_1066522 Ga0501080_1066522_346_663 105
1361 3300049742 Ga0501080_1250389 Ga0501080_1250389_13_330 105
1362 3300049742 Ga0501080_1343434 Ga0501080_1343434_217_534 105
1363 3300049742 Ga0501080_1627997 Ga0501080_1627997_163_480 105
1364 3300049743 Ga0501081_0002862 Ga0501081_0002862_6050_6367 105
1365 3300049743 Ga0501081_0025313 Ga0501081_0025313_375_692 105
1366 3300049743 Ga0501081_0445673 Ga0501081_0445673_609_926 105
1367 3300049743 Ga0501081_0641149 Ga0501081_0641149_93_410 105
1368 3300049744 Ga0501083_0354410 Ga0501083_0354410_461_778 105
1369 3300049744 Ga0501083_0597214 Ga0501083_0597214_382_699 105
1370 3300049744 Ga0501083_0727965 Ga0501083_0727965_213_530 105
1371 3300049760 Ga0501263_039150 Ga0501263_039150_76_393 105
1372 3300049776 Ga0501280_000425 Ga0501280_000425_8004_8321 105
1373 3300049778 Ga0501282_012234 Ga0501282_012234_325_642 105
1374 3300049779 Ga0501283_090944 Ga0501283_090944_191_508 105
1375 3300049779 Ga0501283_103671 Ga0501283_103671_167_484 105
1376 3300049822 Ga0501035_0439509 Ga0501035_0439509_29_346 105
1377 3300049822 Ga0501035_0813309 Ga0501035_0813309_44_361 105
1378 3300049822 Ga0501035_0937820 Ga0501035_0937820_49_366 105
1379 3300049822 Ga0501035_1091670 Ga0501035_1091670_189_506 105
1380 3300049823 Ga0501044_0444678 Ga0501044_0444678_547_864 105
1381 3300049823 Ga0501044_0612898 Ga0501044_0612898_24_341 105
1382 3300049824 Ga0501045_0050583 Ga0501045_0050583_214_531 105
1383 3300049824 Ga0501045_0074048 Ga0501045_0074048_404_721 105
1384 3300049824 Ga0501045_0719078 Ga0501045_0719078_21_338 105
1385 3300049850 Ga0501204_095319 Ga0501204_095319_178_495 105
1386 3300050491 nmdc:mga00v17_72725_c1 nmdc:mga00v17_72725_c1_1183_1500 105
1387 3300050493 nmdc:mga0k408_133485_c1 nmdc:mga0k408_133485_c1_898_1215 105
1388 3300050493 nmdc:mga0k408_796741_c1 nmdc:mga0k408_796741_c1_34_351 105
1389 3300050507 nmdc:mga05p37_1027452_c1 nmdc:mga05p37_1027452_c1_430_747 105
1390 3300050507 nmdc:mga05p37_1193695_c1 nmdc:mga05p37_1193695_c1_411_728 105
1391 3300050507 nmdc:mga05p37_121097_c1 nmdc:mga05p37_121097_c1_2626_2943 105
1392 3300050507 nmdc:mga05p37_181698_c1 nmdc:mga05p37_181698_c1_594_911 105
1393 3300050507 nmdc:mga05p37_2800_c1 nmdc:mga05p37_2800_c1_13826_14143 105
1394 3300050507 nmdc:mga05p37_431_c1 nmdc:mga05p37_431_c1_6012_6329 105
1395 3300050507 nmdc:mga05p37_546585_c1 nmdc:mga05p37_546585_c1_773_1105 105
1396 3300050507 nmdc:mga05p37_75636_c1 nmdc:mga05p37_75636_c1_3814_4131 105
1397 3300050507 nmdc:mga05p37_771975_c1 nmdc:mga05p37_771975_c1_618_935 105
1398 3300050507 nmdc:mga05p37_96645_c1 nmdc:mga05p37_96645_c1_1341_1658 105
1399 3300050508 nmdc:mga09592_133603_c1 nmdc:mga09592_133603_c1_1147_1464 105
1400 3300050508 nmdc:mga09592_1477_c1 nmdc:mga09592_1477_c1_11223_11540 105
1401 3300050508 nmdc:mga09592_16325_c1 nmdc:mga09592_16325_c1_3719_4036 105
1402 3300050508 nmdc:mga09592_190628_c1 nmdc:mga09592_190628_c1_363_680 105
1403 3300050508 nmdc:mga09592_229_c1 nmdc:mga09592_229_c1_33325_33642 105
1404 3300050508 nmdc:mga09592_256466_c1 nmdc:mga09592_256466_c1_552_869 105
1405 3300050508 nmdc:mga09592_37298_c1 nmdc:mga09592_37298_c1_1530_1847 105
1406 3300050508 nmdc:mga09592_592887_c1 nmdc:mga09592_592887_c1_358_675 105
1407 3300050509 nmdc:mga0qj67_1196818_c1 nmdc:mga0qj67_1196818_c1_165_482 105
1408 3300050509 nmdc:mga0qj67_1448373_c1 nmdc:mga0qj67_1448373_c1_22_339 105
1409 3300050509 nmdc:mga0qj67_1458_c1 nmdc:mga0qj67_1458_c1_15224_15541 105
1410 3300050509 nmdc:mga0qj67_148226_c1 nmdc:mga0qj67_148226_c1_574_891 105
1411 3300050509 nmdc:mga0qj67_21577_c1 nmdc:mga0qj67_21577_c1_1774_2091 105
1412 3300050509 nmdc:mga0qj67_237097_c1 nmdc:mga0qj67_237097_c1_331_648 105
1413 3300050509 nmdc:mga0qj67_41193_c1 nmdc:mga0qj67_41193_c1_1599_1916 105
1414 3300050509 nmdc:mga0qj67_56501_c1 nmdc:mga0qj67_56501_c1_2164_2481 105
1415 3300050509 nmdc:mga0qj67_9221_c1 nmdc:mga0qj67_9221_c1_2947_3264 105
1416 3300050510 nmdc:mga06r32_14300_c1 nmdc:mga06r32_14300_c1_5113_5430 105
1417 3300050510 nmdc:mga06r32_18350_c1 nmdc:mga06r32_18350_c1_4956_5273 105
1418 3300050510 nmdc:mga06r32_220612_c2 nmdc:mga06r32_220612_c2_579_896 105
1419 3300050510 nmdc:mga06r32_24235_c1 nmdc:mga06r32_24235_c1_2564_2881 105
1420 3300050510 nmdc:mga06r32_352410_c1 nmdc:mga06r32_352410_c1_671_988 105
1421 3300050510 nmdc:mga06r32_59716_c1 nmdc:mga06r32_59716_c1_190_507 105
1422 3300050510 nmdc:mga06r32_610336_c1 nmdc:mga06r32_610336_c1_284_601 105
1423 3300050510 nmdc:mga06r32_842809_c1 nmdc:mga06r32_842809_c1_20_337 105
1424 3300050511 nmdc:mga08y16_1752187_c1 nmdc:mga08y16_1752187_c1_174_491 105
1425 3300050511 nmdc:mga08y16_1885287_c1 nmdc:mga08y16_1885287_c1_117_434 105
1426 3300050511 nmdc:mga08y16_20591_c1 nmdc:mga08y16_20591_c1_5121_5438 105
1427 3300050511 nmdc:mga08y16_239934_c1 nmdc:mga08y16_239934_c1_50_367 105
1428 3300050511 nmdc:mga08y16_2559_c1 nmdc:mga08y16_2559_c1_14535_14852 105
1429 3300050511 nmdc:mga08y16_26203_c1 nmdc:mga08y16_26203_c1_1804_2121 105
1430 3300050511 nmdc:mga08y16_4095_c1 nmdc:mga08y16_4095_c1_712_1029 105
1431 3300050511 nmdc:mga08y16_55149_c1 nmdc:mga08y16_55149_c1_3745_4062 105
1432 3300050511 nmdc:mga08y16_649085_c1 nmdc:mga08y16_649085_c1_402_719 105
1433 3300050511 nmdc:mga08y16_69771_c1 nmdc:mga08y16_69771_c1_1338_1655 105
1434 3300050511 nmdc:mga08y16_804414_c1 nmdc:mga08y16_804414_c1_484_801 105
1435 3300050511 nmdc:mga08y16_81215_c1 nmdc:mga08y16_81215_c1_2337_2654 105
1436 3300050512 nmdc:mga0n895_12383_c1 nmdc:mga0n895_12383_c1_5127_5444 105
1437 3300050512 nmdc:mga0n895_1761888_c1 nmdc:mga0n895_1761888_c1_231_548 105
1438 3300050512 nmdc:mga0n895_206995_c1 nmdc:mga0n895_206995_c1_1618_1935 105
1439 3300050512 nmdc:mga0n895_2822_c1 nmdc:mga0n895_2822_c1_704_1021 105
1440 3300050512 nmdc:mga0n895_512190_c1 nmdc:mga0n895_512190_c1_609_929 105
1441 3300050512 nmdc:mga0n895_570_c1 nmdc:mga0n895_570_c1_18976_19293 105
1442 3300050512 nmdc:mga0n895_67348_c1 nmdc:mga0n895_67348_c1_3175_3492 105
1443 3300050513 nmdc:mga0rr50_134057_c1 nmdc:mga0rr50_134057_c1_444_761 105
1444 3300050513 nmdc:mga0rr50_25139_c1 nmdc:mga0rr50_25139_c1_1458_1775 105
1445 3300050513 nmdc:mga0rr50_402689_c1 nmdc:mga0rr50_402689_c1_305_622 105
1446 3300050513 nmdc:mga0rr50_590347_c1 nmdc:mga0rr50_590347_c1_197_514 105
1447 3300050513 nmdc:mga0rr50_7779_c1 nmdc:mga0rr50_7779_c1_6005_6322 105
1448 3300050513 nmdc:mga0rr50_807895_c1 nmdc:mga0rr50_807895_c1_339_656 105
1449 3300050514 nmdc:mga08x19_2636_c1 nmdc:mga08x19_2636_c1_4371_4688 105
1450 3300050514 nmdc:mga08x19_285719_c1 nmdc:mga08x19_285719_c1_804_1124 105
1451 3300050514 nmdc:mga08x19_370697_c1 nmdc:mga08x19_370697_c1_152_469 105
1452 3300050514 nmdc:mga08x19_6329_c1 nmdc:mga08x19_6329_c1_3562_3879 105
1453 3300050514 nmdc:mga08x19_6648_c1 nmdc:mga08x19_6648_c1_4113_4430 105
1454 3300050514 nmdc:mga08x19_945_c1 nmdc:mga08x19_945_c1_6016_6333 105
1455 3300050515 nmdc:mga0a205_1075782_c1 nmdc:mga0a205_1075782_c1_57_374 105
1456 3300050515 nmdc:mga0a205_1142975_c1 nmdc:mga0a205_1142975_c1_14_331 105
1457 3300050515 nmdc:mga0a205_157568_c1 nmdc:mga0a205_157568_c1_295_612 105
1458 3300050515 nmdc:mga0a205_217_c1 nmdc:mga0a205_217_c1_6182_6499 105
1459 3300050515 nmdc:mga0a205_298168_c1 nmdc:mga0a205_298168_c1_1027_1344 105
1460 3300050515 nmdc:mga0a205_392853_c1 nmdc:mga0a205_392853_c1_263_580 105
1461 3300050515 nmdc:mga0a205_67555_c1 nmdc:mga0a205_67555_c1_695_1012 105
1462 3300050515 nmdc:mga0a205_714297_c1 nmdc:mga0a205_714297_c1_158_475 105
1463 3300050515 nmdc:mga0a205_837210_c1 nmdc:mga0a205_837210_c1_107_424 105
1464 3300053077 Ga0495601_0002356 Ga0495601_0002356_5710_6027 105
1465 3300053077 Ga0495601_0024247 Ga0495601_0024247_3345_3662 105
1466 3300053077 Ga0495601_0066863 Ga0495601_0066863_496_813 105
1467 3300053077 Ga0495601_0095238 Ga0495601_0095238_386_703 105
1468 3300053077 Ga0495601_0355633 Ga0495601_0355633_608_925 105
1469 3300053084 Ga0495595_0005561 Ga0495595_0005561_2683_3000 105
1470 3300053084 Ga0495595_0137752 Ga0495595_0137752_691_1008 105
1471 3300053085 Ga0495619_0003862 Ga0495619_0003862_4477_4794 105
1472 3300053085 Ga0495619_1146364 Ga0495619_1146364_106_423 105
1473 3300053094 Ga0500566_0103447 Ga0500566_0103447_326_643 105
1474 3300054114 Ga0501084_0219012 Ga0501084_0219012_92_409 105
1475 3300054114 Ga0501084_0348423 Ga0501084_0348423_683_1000 105
1476 3300054114 Ga0501084_0859640 Ga0501084_0859640_112_429 105
1477 3300054114 Ga0501084_1479133 Ga0501084_1479133_223_540 105
1478 3300059421 Ga0590071_029698 Ga0590071_029698_468_785 105
1479 3300059421 Ga0590071_077420 Ga0590071_077420_22_339 105
1480 3300059426 Ga0590077_005746 Ga0590077_005746_1843_2160 105
1481 3300059426 Ga0590077_044788 Ga0590077_044788_112_429 105
1482 3300059493 Ga0587077_181878 Ga0587077_181878_232_549 105
1483 3300060353 Ga0501082_0023114 Ga0501082_0023114_1366_1683 105
1484 3300060353 Ga0501082_0024226 Ga0501082_0024226_4230_4547 105
1485 3300060353 Ga0501082_0559110 Ga0501082_0559110_647_964 105
1486 3300060353 Ga0501082_0893334 Ga0501082_0893334_89_406 105
1487 3300061734 Ga0530510_0001565 Ga0530510_0001565_7227_7544 105
1488 3300061734 Ga0530510_0227808 Ga0530510_0227808_599_916 105
1489 3300061734 Ga0530510_1485314 Ga0530510_1485314_76_393 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

44

109

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9604 3 103
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9559 3 103
7nwt-assembly1.cif.gz_U initiated 70s ribosome in complex with 2a protein from encephalomyocarditis virus (emcv) 0.9533 3 104
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.953 3 103
6vwl-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9504 3 103
ID Description Score Start End Superfamily
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9136 3 100 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9125 1 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9018 4 101 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8702 4 101 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8691 2 100 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7C3GS56-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9846 1 66 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-T1CBJ6-F1-model_v4 50S ribosomal protein L24 0.9837 2 64 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2S8H2I7-F1-model_v4 deleted 0.9748 1 105
AF-A0A7V9INT9-F1-model_v4 Large ribosomal subunit protein uL24 0.9739 1 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2V3VNT6-F1-model_v4 Large ribosomal subunit protein uL24 0.9737 1 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
91.1 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map