F494214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1471 | 525 | 2942 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0472353|Ga0496115_0472353_247_798 |
| Length | 183 |
| Sequence | MAKNPAPQECQTMFVRLSAAIAAVSLLSSAALAQGAKPTDPQIAHIAYTAGVIDIAAAKQALTKTSNKDVKSFAEDMVRDHEAVNKQALDLVKKVTPEDNDTSRTLSKNAAEKLAELGKLKGAEFDKAYVANEVAYHKAVDSALETSLIPSANNAELKGLLQTGLKIFQGHEQHAEHVAAGLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 110 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 133 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 152 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 155 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 248 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 260 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 263 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 264 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 266 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 268 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 269 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 270 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 271 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 272 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 273 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 274 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 277 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 278 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 279 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 280 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 281 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 282 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 283 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 286 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 305 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 307 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 308 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 309 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 312 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 313 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 314 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 315 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 316 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 317 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 318 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 319 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 320 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 321 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 323 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 324 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 325 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 326 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 327 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 328 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 329 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 330 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 333 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 334 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 335 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 429 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 430 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 431 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 432 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 433 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 434 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 435 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 436 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 468 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 469 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 473 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 474 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 476 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 477 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 478 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 479 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 480 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 488 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 491 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 493 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 494 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 495 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 496 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 497 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 498 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 499 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 500 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 501 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 502 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 503 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 504 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 505 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 506 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 507 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 509 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 510 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 512 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 514 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 515 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 517 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 518 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 519 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 522 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 523 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 524 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 525 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 1.02 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.02 |
| Nodule | 0.68 |
| Rhizoplane | 7.21 |
| Rhizosphere | 80.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496115_0472353 | 3300048918 | Bacteria | 1011 |
| 2 | LJQas_1005980 | 3300000549 | Bacteria | 1525 |
| 3 | JGI24743J22301_10028486 | 3300001991 | Bacteria | 1093 |
| 4 | JGI24743J22301_10103649 | 3300001991 | Bacteria | 614 |
| 5 | JGI24750J21931_1012237 | 3300002070 | Bacteria | 1135 |
| 6 | JGI24742J22300_10013387 | 3300002244 | Bacteria | 1372 |
| 7 | JGI25152J39213_1000745 | 3300002773 | Bacteria | 16620 |
| 8 | Ga0006759J45824_1037742 | 3300003163 | Unclassified | 591 |
| 9 | JGI25151J46595_10106669 | 3300003187 | Bacteria | 741 |
| 10 | JGI25406J46586_10000059 | 3300003203 | Bacteria | 50077 |
| 11 | JGI25406J46586_10007521 | 3300003203 | Bacteria | 4964 |
| 12 | JGI25406J46586_10143509 | 3300003203 | Bacteria | 698 |
| 13 | JGI25153J46596_10011069 | 3300003215 | Bacteria | 4018 |
| 14 | JGI25153J46596_10037544 | 3300003215 | Bacteria | 1538 |
| 15 | rootL2_10093812 | 3300003322 | Bacteria | 1234 |
| 16 | JGI25160J50197_1054415 | 3300003354 | Bacteria | 830 |
| 17 | Ga0007410J51695_1030993 | 3300003574 | Unclassified | 672 |
| 18 | Ga0007409J51694_1027806 | 3300003575 | Unclassified | 735 |
| 19 | Ga0007416J51690_1028980 | 3300003577 | Unclassified | 655 |
| 20 | JGI25404J52841_10003695 | 3300003659 | Bacteria | 3044 |
| 21 | JGI25404J52841_10030787 | 3300003659 | Bacteria | 1148 |
| 22 | JGI25404J52841_10031173 | 3300003659 | Bacteria | 1140 |
| 23 | Ga0032354_1044282 | 3300003693 | Unclassified | 590 |
| 24 | Ga0055524_1003255 | 3300003775 | Bacteria | 7954 |
| 25 | Ga0055528_1008764 | 3300003790 | Bacteria | 4285 |
| 26 | Ga0070658_10083389 | 3300005327 | Bacteria | 2627 |
| 27 | Ga0070658_10817691 | 3300005327 | Bacteria | 810 |
| 28 | Ga0070683_100051065 | 3300005329 | Bacteria | 3829 |
| 29 | Ga0070683_100080636 | 3300005329 | Bacteria | 3046 |
| 30 | Ga0070683_100151700 | 3300005329 | Bacteria | 2197 |
| 31 | Ga0070683_100386092 | 3300005329 | Bacteria | 1334 |
| 32 | Ga0070690_100152935 | 3300005330 | Bacteria | 1576 |
| 33 | Ga0070670_100132673 | 3300005331 | Bacteria | 2151 |
| 34 | Ga0070670_100407803 | 3300005331 | Bacteria | 1200 |
| 35 | Ga0068869_100012858 | 3300005334 | Bacteria | 5541 |
| 36 | Ga0068869_100099243 | 3300005334 | Bacteria | 2200 |
| 37 | Ga0070666_10713675 | 3300005335 | Bacteria | 736 |
| 38 | Ga0070666_10753730 | 3300005335 | Bacteria | 716 |
| 39 | Ga0070680_100080487 | 3300005336 | Bacteria | 2686 |
| 40 | Ga0070680_100104534 | 3300005336 | Bacteria | 2353 |
| 41 | Ga0070682_100008826 | 3300005337 | Bacteria | 5691 |
| 42 | Ga0070682_100152588 | 3300005337 | Bacteria | 1587 |
| 43 | Ga0068868_100084787 | 3300005338 | Bacteria | 2545 |
| 44 | Ga0068868_100176070 | 3300005338 | Bacteria | 1773 |
| 45 | Ga0068868_100634513 | 3300005338 | Bacteria | 950 |
| 46 | Ga0068868_101067796 | 3300005338 | Bacteria | 741 |
| 47 | Ga0070660_100035398 | 3300005339 | Bacteria | 3779 |
| 48 | Ga0070660_100054026 | 3300005339 | Bacteria | 3100 |
| 49 | Ga0070660_100097370 | 3300005339 | Bacteria | 2327 |
| 50 | Ga0070660_100401839 | 3300005339 | Bacteria | 1133 |
| 51 | Ga0070691_10120903 | 3300005341 | Bacteria | 1319 |
| 52 | Ga0070691_10247457 | 3300005341 | Bacteria | 955 |
| 53 | Ga0070691_10302377 | 3300005341 | Unclassified | 874 |
| 54 | Ga0070687_100061792 | 3300005343 | Bacteria | 1981 |
| 55 | Ga0070661_100198876 | 3300005344 | Bacteria | 1531 |
| 56 | Ga0070661_100378467 | 3300005344 | Bacteria | 1115 |
| 57 | Ga0070661_100472106 | 3300005344 | Bacteria | 1001 |
| 58 | Ga0070692_10073551 | 3300005345 | Bacteria | 1826 |
| 59 | Ga0070668_100031715 | 3300005347 | Bacteria | 4021 |
| 60 | Ga0070668_100040421 | 3300005347 | Bacteria | 3568 |
| 61 | Ga0070668_100157364 | 3300005347 | Bacteria | 1841 |
| 62 | Ga0070668_100204541 | 3300005347 | Bacteria | 1622 |
| 63 | Ga0070668_100561624 | 3300005347 | Bacteria | 994 |
| 64 | Ga0070668_100571551 | 3300005347 | Bacteria | 986 |
| 65 | Ga0070668_101086858 | 3300005347 | Bacteria | 721 |
| 66 | Ga0070669_100266004 | 3300005353 | Bacteria | 1370 |
| 67 | Ga0070669_100370418 | 3300005353 | Bacteria | 1166 |
| 68 | Ga0070675_100079587 | 3300005354 | Bacteria | 2731 |
| 69 | Ga0070675_100103521 | 3300005354 | Bacteria | 2400 |
| 70 | Ga0070675_100294812 | 3300005354 | Bacteria | 1428 |
| 71 | Ga0070675_100615351 | 3300005354 | Bacteria | 986 |
| 72 | Ga0070671_100026694 | 3300005355 | Bacteria | 4749 |
| 73 | Ga0070671_100175359 | 3300005355 | Bacteria | 1814 |
| 74 | Ga0070671_100417025 | 3300005355 | Bacteria | 1150 |
| 75 | Ga0070671_100603694 | 3300005355 | Bacteria | 948 |
| 76 | Ga0070674_100092759 | 3300005356 | Bacteria | 2183 |
| 77 | Ga0070674_100289346 | 3300005356 | Bacteria | 1302 |
| 78 | Ga0070674_100461795 | 3300005356 | Bacteria | 1050 |
| 79 | Ga0070673_100093160 | 3300005364 | Bacteria | 2467 |
| 80 | Ga0070673_100210846 | 3300005364 | Bacteria | 1677 |
| 81 | Ga0070673_100450096 | 3300005364 | Bacteria | 1158 |
| 82 | Ga0070659_100050323 | 3300005366 | Bacteria | 3275 |
| 83 | Ga0070659_100055590 | 3300005366 | Bacteria | 3120 |
| 84 | Ga0070659_100189730 | 3300005366 | Bacteria | 1689 |
| 85 | Ga0070667_100123818 | 3300005367 | Bacteria | 2251 |
| 86 | Ga0070667_100410461 | 3300005367 | Bacteria | 1234 |
| 87 | Ga0070667_100432849 | 3300005367 | Bacteria | 1200 |
| 88 | Ga0070667_100561577 | 3300005367 | Bacteria | 1050 |
| 89 | Ga0070667_100595088 | 3300005367 | Bacteria | 1019 |
| 90 | Ga0070709_10002549 | 3300005434 | Bacteria | 9850 |
| 91 | Ga0070709_10216301 | 3300005434 | Bacteria | 1364 |
| 92 | Ga0070709_10296213 | 3300005434 | Bacteria | 1180 |
| 93 | Ga0070709_10737949 | 3300005434 | Bacteria | 769 |
| 94 | Ga0070714_100017549 | 3300005435 | Bacteria | 5800 |
| 95 | Ga0070714_100079600 | 3300005435 | Bacteria | 2849 |
| 96 | Ga0070714_100153352 | 3300005435 | Bacteria | 2078 |
| 97 | Ga0070714_100171182 | 3300005435 | Bacteria | 1971 |
| 98 | Ga0070714_100286614 | 3300005435 | Bacteria | 1531 |
| 99 | Ga0070714_100495303 | 3300005435 | Bacteria | 1165 |
| 100 | Ga0070714_101299641 | 3300005435 | Bacteria | 710 |
| 101 | Ga0070713_100021104 | 3300005436 | Bacteria | 5003 |
| 102 | Ga0070713_100046951 | 3300005436 | Bacteria | 3547 |
| 103 | Ga0070713_100129027 | 3300005436 | Bacteria | 2227 |
| 104 | Ga0070713_100141916 | 3300005436 | Bacteria | 2129 |
| 105 | Ga0070713_100201879 | 3300005436 | Bacteria | 1796 |
| 106 | Ga0070713_100392014 | 3300005436 | Bacteria | 1296 |
| 107 | Ga0070710_10001133 | 3300005437 | Bacteria | 12625 |
| 108 | Ga0070710_10001588 | 3300005437 | Bacteria | 10728 |
| 109 | Ga0070710_10072511 | 3300005437 | Bacteria | 1989 |
| 110 | Ga0070701_10408995 | 3300005438 | Bacteria | 862 |
| 111 | Ga0070711_100022855 | 3300005439 | Bacteria | 4058 |
| 112 | Ga0070711_100028547 | 3300005439 | Bacteria | 3672 |
| 113 | Ga0070711_100029901 | 3300005439 | Bacteria | 3600 |
| 114 | Ga0070711_100114998 | 3300005439 | Bacteria | 1981 |
| 115 | Ga0070711_100149200 | 3300005439 | Bacteria | 1761 |
| 116 | Ga0070711_100159380 | 3300005439 | Bacteria | 1709 |
| 117 | Ga0070711_100649064 | 3300005439 | Bacteria | 885 |
| 118 | Ga0070711_101025161 | 3300005439 | Bacteria | 709 |
| 119 | Ga0070705_100021702 | 3300005440 | Bacteria | 3419 |
| 120 | Ga0070700_100468237 | 3300005441 | Bacteria | 963 |
| 121 | Ga0070694_100183472 | 3300005444 | Bacteria | 1549 |
| 122 | Ga0070694_100281682 | 3300005444 | Bacteria | 1268 |
| 123 | Ga0070663_100005186 | 3300005455 | Bacteria | 7717 |
| 124 | Ga0070663_100024885 | 3300005455 | Bacteria | 4035 |
| 125 | Ga0070663_100036027 | 3300005455 | Bacteria | 3436 |
| 126 | Ga0070663_100055427 | 3300005455 | Bacteria | 2837 |
| 127 | Ga0070663_100093910 | 3300005455 | Bacteria | 2226 |
| 128 | Ga0070663_100105864 | 3300005455 | Bacteria | 2106 |
| 129 | Ga0070663_100169900 | 3300005455 | Bacteria | 1685 |
| 130 | Ga0070663_101138436 | 3300005455 | Bacteria | 683 |
| 131 | Ga0070663_101360177 | 3300005455 | Bacteria | 628 |
| 132 | Ga0070678_100027340 | 3300005456 | Bacteria | 3872 |
| 133 | Ga0070678_100045615 | 3300005456 | Bacteria | 3137 |
| 134 | Ga0070678_100048909 | 3300005456 | Bacteria | 3048 |
| 135 | Ga0070678_100058003 | 3300005456 | Bacteria | 2840 |
| 136 | Ga0070678_100094259 | 3300005456 | Bacteria | 2304 |
| 137 | Ga0070678_100170436 | 3300005456 | Bacteria | 1772 |
| 138 | Ga0070678_100196302 | 3300005456 | Bacteria | 1663 |
| 139 | Ga0070678_100444595 | 3300005456 | Bacteria | 1134 |
| 140 | Ga0070662_100202863 | 3300005457 | Bacteria | 1574 |
| 141 | Ga0070662_100468085 | 3300005457 | Bacteria | 1048 |
| 142 | Ga0070662_100970859 | 3300005457 | Bacteria | 727 |
| 143 | Ga0070681_10114500 | 3300005458 | Bacteria | 2635 |
| 144 | Ga0070681_10141762 | 3300005458 | Bacteria | 2333 |
| 145 | Ga0070681_10230246 | 3300005458 | Bacteria | 1768 |
| 146 | Ga0070681_10935179 | 3300005458 | Bacteria | 786 |
| 147 | Ga0068867_100056464 | 3300005459 | Bacteria | 2905 |
| 148 | Ga0068867_100340415 | 3300005459 | Bacteria | 1249 |
| 149 | Ga0068867_100794978 | 3300005459 | Bacteria | 843 |
| 150 | Ga0070679_100028002 | 3300005530 | Bacteria | 5552 |
| 151 | Ga0070679_100130502 | 3300005530 | Bacteria | 2494 |
| 152 | Ga0070679_100578181 | 3300005530 | Bacteria | 1067 |
| 153 | Ga0070684_100062718 | 3300005535 | Bacteria | 3256 |
| 154 | Ga0070684_100113862 | 3300005535 | Bacteria | 2428 |
| 155 | Ga0070684_100900962 | 3300005535 | Bacteria | 829 |
| 156 | Ga0070684_101292141 | 3300005535 | Bacteria | 687 |
| 157 | Ga0070697_100044453 | 3300005536 | Bacteria | 3597 |
| 158 | Ga0070697_100210890 | 3300005536 | Bacteria | 1654 |
| 159 | Ga0070697_100814050 | 3300005536 | Bacteria | 827 |
| 160 | Ga0068853_100043068 | 3300005539 | Bacteria | 3862 |
| 161 | Ga0068853_100054893 | 3300005539 | Bacteria | 3433 |
| 162 | Ga0068853_100095328 | 3300005539 | Bacteria | 2624 |
| 163 | Ga0068853_100217170 | 3300005539 | Bacteria | 1745 |
| 164 | Ga0068853_100848991 | 3300005539 | Bacteria | 876 |
| 165 | Ga0070672_100071918 | 3300005543 | Bacteria | 2753 |
| 166 | Ga0070672_100236778 | 3300005543 | Bacteria | 1535 |
| 167 | Ga0070672_100304288 | 3300005543 | Bacteria | 1352 |
| 168 | Ga0070672_100339287 | 3300005543 | Bacteria | 1279 |
| 169 | Ga0070686_100035539 | 3300005544 | Bacteria | 3079 |
| 170 | Ga0070686_100064426 | 3300005544 | Bacteria | 2377 |
| 171 | Ga0070686_100080748 | 3300005544 | Bacteria | 2152 |
| 172 | Ga0070686_100657932 | 3300005544 | Bacteria | 831 |
| 173 | Ga0070695_100035990 | 3300005545 | Bacteria | 3113 |
| 174 | Ga0070695_100056454 | 3300005545 | Bacteria | 2534 |
| 175 | Ga0070695_100193301 | 3300005545 | Bacteria | 1450 |
| 176 | Ga0070696_100037314 | 3300005546 | Bacteria | 3352 |
| 177 | Ga0070696_100257156 | 3300005546 | Bacteria | 1323 |
| 178 | Ga0070693_100142645 | 3300005547 | Bacteria | 1509 |
| 179 | Ga0070665_100009678 | 3300005548 | Bacteria | 9739 |
| 180 | Ga0070665_100095813 | 3300005548 | Bacteria | 2973 |
| 181 | Ga0070665_100133556 | 3300005548 | Bacteria | 2484 |
| 182 | Ga0070665_100332250 | 3300005548 | Bacteria | 1525 |
| 183 | Ga0070665_100541937 | 3300005548 | Bacteria | 1176 |
| 184 | Ga0070665_100724468 | 3300005548 | Bacteria | 1008 |
| 185 | Ga0070704_100121374 | 3300005549 | Bacteria | 2008 |
| 186 | Ga0070704_100512502 | 3300005549 | Bacteria | 1043 |
| 187 | Ga0068855_100031250 | 3300005563 | Bacteria | 6360 |
| 188 | Ga0068855_100039857 | 3300005563 | Bacteria | 5576 |
| 189 | Ga0068855_100154928 | 3300005563 | Bacteria | 2603 |
| 190 | Ga0068855_100190258 | 3300005563 | Bacteria | 2315 |
| 191 | Ga0068855_100291605 | 3300005563 | Bacteria | 1809 |
| 192 | Ga0068855_100684790 | 3300005563 | Bacteria | 1098 |
| 193 | Ga0068855_101483766 | 3300005563 | Bacteria | 697 |
| 194 | Ga0070664_100050996 | 3300005564 | Bacteria | 3503 |
| 195 | Ga0070664_100083336 | 3300005564 | Bacteria | 2758 |
| 196 | Ga0070664_100129858 | 3300005564 | Bacteria | 2213 |
| 197 | Ga0070664_100494421 | 3300005564 | Bacteria | 1127 |
| 198 | Ga0070664_101202557 | 3300005564 | Bacteria | 715 |
| 199 | Ga0068857_100070550 | 3300005577 | Bacteria | 3113 |
| 200 | Ga0068857_100181544 | 3300005577 | Bacteria | 1915 |
| 201 | Ga0068857_100800249 | 3300005577 | Bacteria | 900 |
| 202 | Ga0068854_100219301 | 3300005578 | Bacteria | 1504 |
| 203 | Ga0068854_100286941 | 3300005578 | Bacteria | 1327 |
| 204 | Ga0068854_100342789 | 3300005578 | Bacteria | 1221 |
| 205 | Ga0068856_100000511 | 3300005614 | Bacteria | 42929 |
| 206 | Ga0068856_100091527 | 3300005614 | Bacteria | 3026 |
| 207 | Ga0068856_100225258 | 3300005614 | Bacteria | 1891 |
| 208 | Ga0068856_100385155 | 3300005614 | Bacteria | 1422 |
| 209 | Ga0068856_100491919 | 3300005614 | Bacteria | 1247 |
| 210 | Ga0068856_100694966 | 3300005614 | Bacteria | 1037 |
| 211 | Ga0068856_100940744 | 3300005614 | Bacteria | 883 |
| 212 | Ga0070702_100026998 | 3300005615 | Bacteria | 3093 |
| 213 | Ga0070702_100071471 | 3300005615 | Bacteria | 2051 |
| 214 | Ga0070702_100246957 | 3300005615 | Bacteria | 1207 |
| 215 | Ga0070702_100254808 | 3300005615 | Bacteria | 1191 |
| 216 | Ga0068852_100021775 | 3300005616 | Bacteria | 5127 |
| 217 | Ga0068852_100031309 | 3300005616 | Bacteria | 4388 |
| 218 | Ga0068852_100441644 | 3300005616 | Bacteria | 1286 |
| 219 | Ga0068852_100757262 | 3300005616 | Bacteria | 984 |
| 220 | Ga0068852_101684418 | 3300005616 | Bacteria | 657 |
| 221 | Ga0068859_100623050 | 3300005617 | Bacteria | 1171 |
| 222 | Ga0068859_100692329 | 3300005617 | Bacteria | 1110 |
| 223 | Ga0068859_101915527 | 3300005617 | Bacteria | 655 |
| 224 | Ga0068864_100047146 | 3300005618 | Bacteria | 3700 |
| 225 | Ga0068864_100199967 | 3300005618 | Bacteria | 1835 |
| 226 | Ga0068864_100275003 | 3300005618 | Bacteria | 1570 |
| 227 | Ga0068866_10011560 | 3300005718 | Bacteria | 3823 |
| 228 | Ga0068866_10074048 | 3300005718 | Bacteria | 1809 |
| 229 | Ga0068866_10157614 | 3300005718 | Bacteria | 1321 |
| 230 | Ga0068866_10974449 | 3300005718 | Bacteria | 601 |
| 231 | Ga0068861_100087226 | 3300005719 | Bacteria | 2455 |
| 232 | Ga0068861_100190154 | 3300005719 | Bacteria | 1715 |
| 233 | Ga0068861_100469212 | 3300005719 | Bacteria | 1132 |
| 234 | Ga0068851_10061528 | 3300005834 | Bacteria | 1924 |
| 235 | Ga0068870_10060195 | 3300005840 | Bacteria | 2038 |
| 236 | Ga0068870_10276175 | 3300005840 | Bacteria | 1051 |
| 237 | Ga0068863_100433467 | 3300005841 | Bacteria | 1289 |
| 238 | Ga0068858_100093121 | 3300005842 | Bacteria | 2805 |
| 239 | Ga0068858_100184258 | 3300005842 | Bacteria | 1972 |
| 240 | Ga0068860_100041049 | 3300005843 | Bacteria | 4420 |
| 241 | Ga0068860_100088918 | 3300005843 | Bacteria | 2940 |
| 242 | Ga0068860_100120729 | 3300005843 | Bacteria | 2509 |
| 243 | Ga0068860_100127254 | 3300005843 | Bacteria | 2442 |
| 244 | Ga0068860_100249916 | 3300005843 | Bacteria | 1727 |
| 245 | Ga0068860_100508524 | 3300005843 | Bacteria | 1203 |
| 246 | Ga0068862_100414626 | 3300005844 | Bacteria | 1262 |
| 247 | Ga0068862_100415954 | 3300005844 | Bacteria | 1260 |
| 248 | Ga0068862_101352722 | 3300005844 | Bacteria | 714 |
| 249 | Ga0081455_10004380 | 3300005937 | Bacteria | 15903 |
| 250 | Ga0081455_10039149 | 3300005937 | Bacteria | 4192 |
| 251 | Ga0081455_10383073 | 3300005937 | Bacteria | 982 |
| 252 | Ga0081455_10559228 | 3300005937 | Bacteria | 754 |
| 253 | Ga0081540_1001905 | 3300005983 | Bacteria | 17467 |
| 254 | Ga0081540_1003483 | 3300005983 | Bacteria | 12420 |
| 255 | Ga0081540_1005354 | 3300005983 | Bacteria | 9596 |
| 256 | Ga0081540_1006055 | 3300005983 | Bacteria | 8894 |
| 257 | Ga0081540_1019571 | 3300005983 | Bacteria | 4106 |
| 258 | Ga0081540_1030270 | 3300005983 | Bacteria | 3001 |
| 259 | Ga0081540_1036378 | 3300005983 | Bacteria | 2626 |
| 260 | Ga0081540_1039455 | 3300005983 | Bacteria | 2475 |
| 261 | Ga0081540_1049799 | 3300005983 | Bacteria | 2086 |
| 262 | Ga0081540_1101659 | 3300005983 | Bacteria | 1237 |
| 263 | Ga0081540_1265790 | 3300005983 | Bacteria | 595 |
| 264 | Ga0081539_10000324 | 3300005985 | Bacteria | 106549 |
| 265 | Ga0081539_10000902 | 3300005985 | Bacteria | 56412 |
| 266 | Ga0081539_10014288 | 3300005985 | Bacteria | 5886 |
| 267 | Ga0081539_10133752 | 3300005985 | Bacteria | 1214 |
| 268 | Ga0081539_10241925 | 3300005985 | Bacteria | 807 |
| 269 | Ga0070717_10010448 | 3300006028 | Bacteria | 7011 |
| 270 | Ga0070717_10090385 | 3300006028 | Bacteria | 2584 |
| 271 | Ga0070717_10104092 | 3300006028 | Bacteria | 2414 |
| 272 | Ga0075365_10113571 | 3300006038 | Bacteria | 1863 |
| 273 | Ga0075365_10121870 | 3300006038 | Bacteria | 1799 |
| 274 | Ga0075365_10137142 | 3300006038 | Bacteria | 1696 |
| 275 | Ga0075365_10147696 | 3300006038 | Bacteria | 1634 |
| 276 | Ga0075365_10180693 | 3300006038 | Bacteria | 1475 |
| 277 | Ga0075365_10192108 | 3300006038 | Bacteria | 1429 |
| 278 | Ga0075365_10398178 | 3300006038 | Bacteria | 972 |
| 279 | Ga0075368_10014536 | 3300006042 | Bacteria | 2909 |
| 280 | Ga0075368_10083618 | 3300006042 | Bacteria | 1301 |
| 281 | Ga0075363_100010231 | 3300006048 | Bacteria | 4441 |
| 282 | Ga0075363_100139830 | 3300006048 | Bacteria | 1363 |
| 283 | Ga0075363_100246541 | 3300006048 | Bacteria | 1028 |
| 284 | Ga0075364_10169789 | 3300006051 | Bacteria | 1474 |
| 285 | Ga0075432_10184630 | 3300006058 | Bacteria | 818 |
| 286 | Ga0070715_10003071 | 3300006163 | Bacteria | 5236 |
| 287 | Ga0070715_10110476 | 3300006163 | Bacteria | 1296 |
| 288 | Ga0070715_10335473 | 3300006163 | Bacteria | 821 |
| 289 | Ga0070716_100005922 | 3300006173 | Bacteria | 5950 |
| 290 | Ga0070716_100178312 | 3300006173 | Bacteria | 1393 |
| 291 | Ga0070716_100379680 | 3300006173 | Bacteria | 1010 |
| 292 | Ga0070716_100863364 | 3300006173 | Bacteria | 706 |
| 293 | Ga0070712_100010119 | 3300006175 | Bacteria | 5944 |
| 294 | Ga0070712_100020318 | 3300006175 | Bacteria | 4345 |
| 295 | Ga0070712_100114950 | 3300006175 | Bacteria | 2016 |
| 296 | Ga0070712_100133698 | 3300006175 | Bacteria | 1883 |
| 297 | Ga0070712_100234276 | 3300006175 | Bacteria | 1459 |
| 298 | Ga0075362_10021643 | 3300006177 | Bacteria | 2701 |
| 299 | Ga0075367_10010275 | 3300006178 | Bacteria | 4914 |
| 300 | Ga0075367_10209479 | 3300006178 | Bacteria | 1219 |
| 301 | Ga0075367_10576958 | 3300006178 | Bacteria | 714 |
| 302 | Ga0075369_10010740 | 3300006186 | Bacteria | 3588 |
| 303 | Ga0075369_10019596 | 3300006186 | Bacteria | 2763 |
| 304 | Ga0075366_10308358 | 3300006195 | Bacteria | 969 |
| 305 | Ga0075366_10382418 | 3300006195 | Bacteria | 866 |
| 306 | Ga0097621_100025107 | 3300006237 | Bacteria | 4660 |
| 307 | Ga0097621_100028310 | 3300006237 | Bacteria | 4416 |
| 308 | Ga0097621_100032858 | 3300006237 | Bacteria | 4127 |
| 309 | Ga0097621_100266689 | 3300006237 | Bacteria | 1503 |
| 310 | Ga0097621_100378113 | 3300006237 | Bacteria | 1265 |
| 311 | Ga0097621_100651191 | 3300006237 | Bacteria | 966 |
| 312 | Ga0097621_100878862 | 3300006237 | Bacteria | 834 |
| 313 | Ga0097621_101163198 | 3300006237 | Bacteria | 726 |
| 314 | Ga0097621_101327179 | 3300006237 | Bacteria | 680 |
| 315 | Ga0075370_10028939 | 3300006353 | Bacteria | 3082 |
| 316 | Ga0068871_100047227 | 3300006358 | Bacteria | 3471 |
| 317 | Ga0068871_100130756 | 3300006358 | Bacteria | 2128 |
| 318 | Ga0068871_100591274 | 3300006358 | Bacteria | 1009 |
| 319 | Ga0068871_100808336 | 3300006358 | Bacteria | 865 |
| 320 | Ga0068871_101786101 | 3300006358 | Bacteria | 584 |
| 321 | Ga0075428_100056503 | 3300006844 | Bacteria | 4299 |
| 322 | Ga0075428_100569440 | 3300006844 | Bacteria | 1210 |
| 323 | Ga0075431_100792032 | 3300006847 | Bacteria | 921 |
| 324 | Ga0075434_100190918 | 3300006871 | Bacteria | 2069 |
| 325 | Ga0068865_100093108 | 3300006881 | Bacteria | 2191 |
| 326 | Ga0068865_100523851 | 3300006881 | Bacteria | 992 |
| 327 | Ga0075436_100311240 | 3300006914 | Bacteria | 1130 |
| 328 | Ga0097620_100128270 | 3300006931 | Bacteria | 2607 |
| 329 | Ga0097620_100623052 | 3300006931 | Bacteria | 1171 |
| 330 | Ga0097620_100692255 | 3300006931 | Bacteria | 1110 |
| 331 | Ga0097620_101915539 | 3300006931 | Bacteria | 655 |
| 332 | Ga0099824_1031119 | 3300006942 | Bacteria | 2061 |
| 333 | Ga0099823_1072668 | 3300006944 | Bacteria | 1491 |
| 334 | Ga0075435_100061313 | 3300007076 | Bacteria | 3051 |
| 335 | Ga0099794_10014612 | 3300007265 | Bacteria | 3444 |
| 336 | Ga0099794_10146692 | 3300007265 | Bacteria | 1197 |
| 337 | Ga0099795_10002579 | 3300007788 | Bacteria | 4297 |
| 338 | Ga0099795_10003041 | 3300007788 | Bacteria | 4088 |
| 339 | Ga0105251_10044298 | 3300009011 | Bacteria | 2150 |
| 340 | Ga0105250_10026169 | 3300009092 | Bacteria | 2350 |
| 341 | Ga0105240_10213062 | 3300009093 | Bacteria | 2256 |
| 342 | Ga0105240_10230194 | 3300009093 | Bacteria | 2155 |
| 343 | Ga0105240_10297646 | 3300009093 | Bacteria | 1847 |
| 344 | Ga0105240_10641266 | 3300009093 | Bacteria | 1165 |
| 345 | Ga0111539_10050602 | 3300009094 | Bacteria | 4949 |
| 346 | Ga0111539_10614822 | 3300009094 | Bacteria | 1265 |
| 347 | Ga0105245_10013113 | 3300009098 | Bacteria | 7222 |
| 348 | Ga0105245_10060564 | 3300009098 | Bacteria | 3409 |
| 349 | Ga0105245_10104288 | 3300009098 | Bacteria | 2628 |
| 350 | Ga0105245_10481730 | 3300009098 | Bacteria | 1254 |
| 351 | Ga0105247_10005827 | 3300009101 | Bacteria | 7702 |
| 352 | Ga0105247_10164750 | 3300009101 | Bacteria | 1470 |
| 353 | Ga0114129_10107079 | 3300009147 | Bacteria | 3862 |
| 354 | Ga0105243_10209302 | 3300009148 | Bacteria | 1716 |
| 355 | Ga0105243_10815386 | 3300009148 | Bacteria | 921 |
| 356 | Ga0105241_10035010 | 3300009174 | Bacteria | 3777 |
| 357 | Ga0105241_10239602 | 3300009174 | Bacteria | 1533 |
| 358 | Ga0105241_10457296 | 3300009174 | Bacteria | 1130 |
| 359 | Ga0105241_10709080 | 3300009174 | Bacteria | 919 |
| 360 | Ga0105242_10198297 | 3300009176 | Bacteria | 1781 |
| 361 | Ga0105242_10605647 | 3300009176 | Bacteria | 1059 |
| 362 | Ga0105242_10612053 | 3300009176 | Bacteria | 1054 |
| 363 | Ga0105248_10073696 | 3300009177 | Bacteria | 3837 |
| 364 | Ga0105248_10090767 | 3300009177 | Bacteria | 3440 |
| 365 | Ga0105248_10217361 | 3300009177 | Bacteria | 2152 |
| 366 | Ga0105248_10866061 | 3300009177 | Bacteria | 1020 |
| 367 | Ga0105248_10921298 | 3300009177 | Bacteria | 987 |
| 368 | Ga0105237_10054269 | 3300009545 | Bacteria | 4016 |
| 369 | Ga0105237_10205222 | 3300009545 | Bacteria | 1971 |
| 370 | Ga0105237_10291101 | 3300009545 | Bacteria | 1636 |
| 371 | Ga0105237_11207395 | 3300009545 | Bacteria | 763 |
| 372 | Ga0105238_10038892 | 3300009551 | Bacteria | 4829 |
| 373 | Ga0105238_10073250 | 3300009551 | Bacteria | 3420 |
| 374 | Ga0105238_10189980 | 3300009551 | Bacteria | 2030 |
| 375 | Ga0105238_10230507 | 3300009551 | Bacteria | 1829 |
| 376 | Ga0105238_11170638 | 3300009551 | Bacteria | 793 |
| 377 | Ga0105249_10063495 | 3300009553 | Bacteria | 3393 |
| 378 | Ga0105249_10252033 | 3300009553 | Bacteria | 1751 |
| 379 | Ga0105249_10417895 | 3300009553 | Bacteria | 1374 |
| 380 | Ga0123342_1013770 | 3300009766 | Bacteria | 7982 |
| 381 | Ga0099796_10009589 | 3300010159 | Bacteria | 2627 |
| 382 | Ga0099796_10019349 | 3300010159 | Bacteria | 2062 |
| 383 | Ga0099796_10029389 | 3300010159 | Bacteria | 1773 |
| 384 | Ga0099796_10052131 | 3300010159 | Bacteria | 1424 |
| 385 | Ga0105239_10061201 | 3300010375 | Bacteria | 4131 |
| 386 | Ga0105239_10204077 | 3300010375 | Bacteria | 2215 |
| 387 | Ga0105239_10239989 | 3300010375 | Bacteria | 2034 |
| 388 | Ga0105239_10370479 | 3300010375 | Bacteria | 1619 |
| 389 | Ga0105239_10413193 | 3300010375 | Bacteria | 1528 |
| 390 | Ga0105246_10121976 | 3300011119 | Bacteria | 1933 |
| 391 | Ga0105246_10236551 | 3300011119 | Bacteria | 1441 |
| 392 | Ga0157343_1009340 | 3300012488 | Bacteria | 723 |
| 393 | Ga0157338_1029805 | 3300012515 | Bacteria | 689 |
| 394 | Ga0157373_10016845 | 3300013100 | Bacteria | 5328 |
| 395 | Ga0157370_10037503 | 3300013104 | Bacteria | 4698 |
| 396 | Ga0157370_10182418 | 3300013104 | Bacteria | 1950 |
| 397 | Ga0157370_10286566 | 3300013104 | Bacteria | 1521 |
| 398 | Ga0157370_10523428 | 3300013104 | Bacteria | 1088 |
| 399 | Ga0157369_10037064 | 3300013105 | Bacteria | 5341 |
| 400 | Ga0157369_10304854 | 3300013105 | Bacteria | 1656 |
| 401 | Ga0157369_10540413 | 3300013105 | Bacteria | 1205 |
| 402 | Ga0157374_10077147 | 3300013296 | Bacteria | 3152 |
| 403 | Ga0157374_10253496 | 3300013296 | Bacteria | 1732 |
| 404 | Ga0157378_10025963 | 3300013297 | Bacteria | 5162 |
| 405 | Ga0157378_10047954 | 3300013297 | Bacteria | 3798 |
| 406 | Ga0157378_10087971 | 3300013297 | Bacteria | 2818 |
| 407 | Ga0157378_10125516 | 3300013297 | Bacteria | 2370 |
| 408 | Ga0157378_10154935 | 3300013297 | Bacteria | 2138 |
| 409 | Ga0157378_10190507 | 3300013297 | Bacteria | 1934 |
| 410 | Ga0157378_10203242 | 3300013297 | Bacteria | 1874 |
| 411 | Ga0157378_10432789 | 3300013297 | Bacteria | 1302 |
| 412 | Ga0163162_10121233 | 3300013306 | Bacteria | 2719 |
| 413 | Ga0163162_10213555 | 3300013306 | Bacteria | 2059 |
| 414 | Ga0163162_10562543 | 3300013306 | Bacteria | 1268 |
| 415 | Ga0163162_10762381 | 3300013306 | Bacteria | 1086 |
| 416 | Ga0163162_12096027 | 3300013306 | Bacteria | 649 |
| 417 | Ga0157372_10548850 | 3300013307 | Bacteria | 1347 |
| 418 | Ga0157375_10005808 | 3300013308 | Bacteria | 10737 |
| 419 | Ga0157375_10172104 | 3300013308 | Bacteria | 2313 |
| 420 | Ga0157375_10285482 | 3300013308 | Bacteria | 1814 |
| 421 | Ga0157375_10335069 | 3300013308 | Bacteria | 1678 |
| 422 | Ga0157375_10581556 | 3300013308 | Bacteria | 1280 |
| 423 | Ga0163163_10164907 | 3300014325 | Bacteria | 2261 |
| 424 | Ga0163163_11132991 | 3300014325 | Bacteria | 845 |
| 425 | Ga0157380_10093471 | 3300014326 | Bacteria | 2487 |
| 426 | Ga0157380_10125737 | 3300014326 | Bacteria | 2179 |
| 427 | Ga0157380_10599300 | 3300014326 | Bacteria | 1090 |
| 428 | Ga0157377_10167513 | 3300014745 | Bacteria | 1371 |
| 429 | Ga0157379_10033296 | 3300014968 | Bacteria | 4596 |
| 430 | Ga0157379_10356580 | 3300014968 | Bacteria | 1340 |
| 431 | Ga0157376_10054066 | 3300014969 | Bacteria | 3346 |
| 432 | Ga0157376_10341507 | 3300014969 | Bacteria | 1430 |
| 433 | Ga0157376_10356886 | 3300014969 | Bacteria | 1401 |
| 434 | Ga0157376_10454865 | 3300014969 | Bacteria | 1250 |
| 435 | Ga0157376_11152932 | 3300014969 | Bacteria | 802 |
| 436 | Ga0163161_10136471 | 3300017792 | Bacteria | 1855 |
| 437 | Ga0163161_10180981 | 3300017792 | Bacteria | 1616 |
| 438 | Ga0163161_10184839 | 3300017792 | Bacteria | 1600 |
| 439 | Ga0163161_10280325 | 3300017792 | Bacteria | 1307 |
| 440 | Ga0163161_11305941 | 3300017792 | Bacteria | 631 |
| 441 | Ga0197907_10717276 | 3300020069 | Bacteria | 822 |
| 442 | Ga0206356_11225785 | 3300020070 | Bacteria | 597 |
| 443 | Ga0206356_11512317 | 3300020070 | Bacteria | 689 |
| 444 | Ga0206349_1867187 | 3300020075 | Bacteria | 605 |
| 445 | Ga0206355_1651195 | 3300020076 | Bacteria | 967 |
| 446 | Ga0206352_10872787 | 3300020078 | Bacteria | 794 |
| 447 | Ga0206350_11624238 | 3300020080 | Bacteria | 646 |
| 448 | Ga0214543_1000018 | 3300021327 | Bacteria | 272335 |
| 449 | Ga0213873_10124599 | 3300021358 | Bacteria | 759 |
| 450 | Ga0213876_10001113 | 3300021384 | Bacteria | 17196 |
| 451 | Ga0224712_10149526 | 3300022467 | Bacteria | 1034 |
| 452 | Ga0224712_10391768 | 3300022467 | Bacteria | 661 |
| 453 | Ga0207425_1025599 | 3300025245 | Bacteria | 1217 |
| 454 | Ga0209129_1001217 | 3300025258 | Bacteria | 14789 |
| 455 | Ga0209233_1003374 | 3300025261 | Bacteria | 5638 |
| 456 | Ga0209233_1014294 | 3300025261 | Bacteria | 2240 |
| 457 | Ga0209455_1003306 | 3300025272 | Bacteria | 5783 |
| 458 | Ga0209673_1003224 | 3300025273 | Bacteria | 9874 |
| 459 | Ga0209130_1030706 | 3300025284 | Bacteria | 1108 |
| 460 | Ga0209564_1018467 | 3300025295 | Bacteria | 2655 |
| 461 | Ga0209758_1003130 | 3300025297 | Bacteria | 15616 |
| 462 | Ga0209758_1003447 | 3300025297 | Bacteria | 14374 |
| 463 | Ga0209256_1000064 | 3300025299 | Bacteria | 250853 |
| 464 | Ga0209256_1007330 | 3300025299 | Bacteria | 5482 |
| 465 | Ga0209256_1012304 | 3300025299 | Bacteria | 3300 |
| 466 | Ga0209256_1044906 | 3300025299 | Bacteria | 1101 |
| 467 | Ga0207426_1000730 | 3300025302 | Bacteria | 37639 |
| 468 | Ga0207697_10018333 | 3300025315 | Bacteria | 2871 |
| 469 | Ga0207656_10041676 | 3300025321 | Bacteria | 1952 |
| 470 | Ga0207696_1082278 | 3300025711 | Bacteria | 888 |
| 471 | Ga0207696_1128410 | 3300025711 | Bacteria | 682 |
| 472 | Ga0207653_10031965 | 3300025885 | Bacteria | 1701 |
| 473 | Ga0207692_10001008 | 3300025898 | Bacteria | 10274 |
| 474 | Ga0207692_10011691 | 3300025898 | Bacteria | 3746 |
| 475 | Ga0207692_10490085 | 3300025898 | Bacteria | 779 |
| 476 | Ga0207642_10073674 | 3300025899 | Bacteria | 1634 |
| 477 | Ga0207642_10115377 | 3300025899 | Bacteria | 1375 |
| 478 | Ga0207642_10421281 | 3300025899 | Bacteria | 803 |
| 479 | Ga0207710_10030588 | 3300025900 | Bacteria | 2350 |
| 480 | Ga0207710_10173380 | 3300025900 | Bacteria | 1055 |
| 481 | Ga0207688_10066645 | 3300025901 | Bacteria | 2037 |
| 482 | Ga0207688_10082682 | 3300025901 | Bacteria | 1835 |
| 483 | Ga0207680_10080546 | 3300025903 | Bacteria | 2045 |
| 484 | Ga0207680_10690224 | 3300025903 | Bacteria | 731 |
| 485 | Ga0207647_10030400 | 3300025904 | Bacteria | 3485 |
| 486 | Ga0207647_10047128 | 3300025904 | Bacteria | 2682 |
| 487 | Ga0207647_10154710 | 3300025904 | Bacteria | 1339 |
| 488 | Ga0207647_10192603 | 3300025904 | Bacteria | 1181 |
| 489 | Ga0207647_10198710 | 3300025904 | Bacteria | 1160 |
| 490 | Ga0207685_10129101 | 3300025905 | Bacteria | 1120 |
| 491 | Ga0207699_10009034 | 3300025906 | Bacteria | 4945 |
| 492 | Ga0207699_10024073 | 3300025906 | Bacteria | 3324 |
| 493 | Ga0207699_10024173 | 3300025906 | Bacteria | 3318 |
| 494 | Ga0207645_10043025 | 3300025907 | Bacteria | 2890 |
| 495 | Ga0207645_10152536 | 3300025907 | Bacteria | 1509 |
| 496 | Ga0207643_10035880 | 3300025908 | Bacteria | 2781 |
| 497 | Ga0207643_10080885 | 3300025908 | Bacteria | 1882 |
| 498 | Ga0207643_10412234 | 3300025908 | Bacteria | 855 |
| 499 | Ga0207705_10053763 | 3300025909 | Bacteria | 2901 |
| 500 | Ga0207705_10061369 | 3300025909 | Bacteria | 2716 |
| 501 | Ga0207705_10323691 | 3300025909 | Bacteria | 1185 |
| 502 | Ga0207705_10633709 | 3300025909 | Bacteria | 831 |
| 503 | Ga0207654_10007233 | 3300025911 | Bacteria | 5592 |
| 504 | Ga0207654_10032620 | 3300025911 | Bacteria | 2880 |
| 505 | Ga0207654_10402814 | 3300025911 | Bacteria | 952 |
| 506 | Ga0207654_10479192 | 3300025911 | Bacteria | 876 |
| 507 | Ga0207654_10681082 | 3300025911 | Bacteria | 738 |
| 508 | Ga0207654_10760857 | 3300025911 | Bacteria | 698 |
| 509 | Ga0207707_10043460 | 3300025912 | Bacteria | 3920 |
| 510 | Ga0207707_10701944 | 3300025912 | Bacteria | 849 |
| 511 | Ga0207707_10954927 | 3300025912 | Bacteria | 706 |
| 512 | Ga0207695_10066435 | 3300025913 | Bacteria | 3703 |
| 513 | Ga0207695_10134456 | 3300025913 | Bacteria | 2427 |
| 514 | Ga0207695_10206033 | 3300025913 | Bacteria | 1879 |
| 515 | Ga0207671_10101999 | 3300025914 | Bacteria | 2175 |
| 516 | Ga0207671_10339489 | 3300025914 | Bacteria | 1190 |
| 517 | Ga0207671_10572691 | 3300025914 | Bacteria | 900 |
| 518 | Ga0207671_10769834 | 3300025914 | Bacteria | 764 |
| 519 | Ga0207693_10007911 | 3300025915 | Bacteria | 8734 |
| 520 | Ga0207693_10008718 | 3300025915 | Bacteria | 8291 |
| 521 | Ga0207693_10010781 | 3300025915 | Bacteria | 7420 |
| 522 | Ga0207693_10283137 | 3300025915 | Bacteria | 1299 |
| 523 | Ga0207693_10983398 | 3300025915 | Bacteria | 645 |
| 524 | Ga0207663_10002092 | 3300025916 | Bacteria | 9516 |
| 525 | Ga0207663_10052877 | 3300025916 | Bacteria | 2535 |
| 526 | Ga0207663_10053354 | 3300025916 | Bacteria | 2525 |
| 527 | Ga0207663_10060198 | 3300025916 | Bacteria | 2405 |
| 528 | Ga0207663_10147754 | 3300025916 | Bacteria | 1645 |
| 529 | Ga0207660_10217797 | 3300025917 | Bacteria | 1497 |
| 530 | Ga0207660_10306467 | 3300025917 | Bacteria | 1266 |
| 531 | Ga0207660_10495932 | 3300025917 | Bacteria | 990 |
| 532 | Ga0207662_10689453 | 3300025918 | Bacteria | 715 |
| 533 | Ga0207657_10001022 | 3300025919 | Bacteria | 29697 |
| 534 | Ga0207657_10011801 | 3300025919 | Bacteria | 8650 |
| 535 | Ga0207657_10046837 | 3300025919 | Bacteria | 3786 |
| 536 | Ga0207657_10120971 | 3300025919 | Bacteria | 2154 |
| 537 | Ga0207657_10547049 | 3300025919 | Bacteria | 905 |
| 538 | Ga0207649_10106212 | 3300025920 | Bacteria | 1867 |
| 539 | Ga0207649_10176396 | 3300025920 | Bacteria | 1493 |
| 540 | Ga0207649_11130642 | 3300025920 | Bacteria | 618 |
| 541 | Ga0207652_10013063 | 3300025921 | Bacteria | 6720 |
| 542 | Ga0207652_10093561 | 3300025921 | Bacteria | 2645 |
| 543 | Ga0207652_10093584 | 3300025921 | Bacteria | 2645 |
| 544 | Ga0207652_10497990 | 3300025921 | Bacteria | 1097 |
| 545 | Ga0207652_11037811 | 3300025921 | Bacteria | 719 |
| 546 | Ga0207646_10204739 | 3300025922 | Bacteria | 1783 |
| 547 | Ga0207681_10536245 | 3300025923 | Bacteria | 962 |
| 548 | Ga0207694_10112809 | 3300025924 | Bacteria | 2164 |
| 549 | Ga0207694_10221598 | 3300025924 | Bacteria | 1543 |
| 550 | Ga0207694_10251395 | 3300025924 | Bacteria | 1446 |
| 551 | Ga0207694_10363443 | 3300025924 | Bacteria | 1200 |
| 552 | Ga0207694_10372990 | 3300025924 | Bacteria | 1184 |
| 553 | Ga0207694_10416070 | 3300025924 | Bacteria | 1119 |
| 554 | Ga0207659_10250296 | 3300025926 | Bacteria | 1437 |
| 555 | Ga0207659_10345439 | 3300025926 | Bacteria | 1233 |
| 556 | Ga0207687_10029474 | 3300025927 | Bacteria | 3692 |
| 557 | Ga0207687_10089648 | 3300025927 | Bacteria | 2240 |
| 558 | Ga0207687_10196740 | 3300025927 | Bacteria | 1572 |
| 559 | Ga0207700_10040777 | 3300025928 | Bacteria | 3391 |
| 560 | Ga0207700_10075769 | 3300025928 | Bacteria | 2608 |
| 561 | Ga0207700_10165490 | 3300025928 | Bacteria | 1840 |
| 562 | Ga0207700_10244283 | 3300025928 | Bacteria | 1531 |
| 563 | Ga0207664_10030922 | 3300025929 | Bacteria | 4092 |
| 564 | Ga0207664_10089899 | 3300025929 | Bacteria | 2515 |
| 565 | Ga0207664_10240282 | 3300025929 | Bacteria | 1577 |
| 566 | Ga0207664_10458954 | 3300025929 | Bacteria | 1138 |
| 567 | Ga0207664_11263070 | 3300025929 | Bacteria | 657 |
| 568 | Ga0207644_10017156 | 3300025931 | Bacteria | 4883 |
| 569 | Ga0207644_10030007 | 3300025931 | Bacteria | 3776 |
| 570 | Ga0207644_10123738 | 3300025931 | Bacteria | 1972 |
| 571 | Ga0207644_10154893 | 3300025931 | Bacteria | 1776 |
| 572 | Ga0207690_10104376 | 3300025932 | Bacteria | 2030 |
| 573 | Ga0207690_10268928 | 3300025932 | Bacteria | 1323 |
| 574 | Ga0207690_10348698 | 3300025932 | Bacteria | 1170 |
| 575 | Ga0207706_10042611 | 3300025933 | Bacteria | 4023 |
| 576 | Ga0207706_10072164 | 3300025933 | Bacteria | 3036 |
| 577 | Ga0207706_10483724 | 3300025933 | Bacteria | 1069 |
| 578 | Ga0207686_10014926 | 3300025934 | Bacteria | 4336 |
| 579 | Ga0207686_10070179 | 3300025934 | Bacteria | 2250 |
| 580 | Ga0207686_10211002 | 3300025934 | Bacteria | 1396 |
| 581 | Ga0207686_10243172 | 3300025934 | Bacteria | 1311 |
| 582 | Ga0207709_10034935 | 3300025935 | Bacteria | 2968 |
| 583 | Ga0207709_10101353 | 3300025935 | Bacteria | 1904 |
| 584 | Ga0207709_10157926 | 3300025935 | Bacteria | 1578 |
| 585 | Ga0207709_10649112 | 3300025935 | Bacteria | 840 |
| 586 | Ga0207669_10122502 | 3300025937 | Bacteria | 1768 |
| 587 | Ga0207704_10132223 | 3300025938 | Bacteria | 1730 |
| 588 | Ga0207665_10001678 | 3300025939 | Bacteria | 14897 |
| 589 | Ga0207665_10058436 | 3300025939 | Bacteria | 2607 |
| 590 | Ga0207665_10096824 | 3300025939 | Bacteria | 2053 |
| 591 | Ga0207665_10215874 | 3300025939 | Bacteria | 1404 |
| 592 | Ga0207665_10303947 | 3300025939 | Bacteria | 1193 |
| 593 | Ga0207665_10592844 | 3300025939 | Bacteria | 865 |
| 594 | Ga0207691_10300312 | 3300025940 | Bacteria | 1380 |
| 595 | Ga0207691_10312448 | 3300025940 | Bacteria | 1348 |
| 596 | Ga0207711_10005566 | 3300025941 | Bacteria | 10650 |
| 597 | Ga0207711_10043522 | 3300025941 | Bacteria | 3831 |
| 598 | Ga0207711_10196700 | 3300025941 | Bacteria | 1839 |
| 599 | Ga0207711_10331608 | 3300025941 | Bacteria | 1407 |
| 600 | Ga0207661_10018101 | 3300025944 | Bacteria | 5232 |
| 601 | Ga0207661_10150545 | 3300025944 | Bacteria | 2011 |
| 602 | Ga0207661_10195327 | 3300025944 | Bacteria | 1776 |
| 603 | Ga0207661_10230170 | 3300025944 | Bacteria | 1641 |
| 604 | Ga0207661_10363330 | 3300025944 | Bacteria | 1308 |
| 605 | Ga0207679_10066116 | 3300025945 | Bacteria | 2708 |
| 606 | Ga0207679_10101592 | 3300025945 | Bacteria | 2250 |
| 607 | Ga0207679_10183146 | 3300025945 | Bacteria | 1734 |
| 608 | Ga0207679_10312704 | 3300025945 | Bacteria | 1358 |
| 609 | Ga0207667_10015870 | 3300025949 | Bacteria | 8533 |
| 610 | Ga0207667_10057464 | 3300025949 | Bacteria | 4084 |
| 611 | Ga0207667_10135083 | 3300025949 | Bacteria | 2540 |
| 612 | Ga0207667_10200431 | 3300025949 | Bacteria | 2048 |
| 613 | Ga0207667_10313716 | 3300025949 | Bacteria | 1602 |
| 614 | Ga0207651_10051125 | 3300025960 | Bacteria | 2810 |
| 615 | Ga0207651_10088931 | 3300025960 | Bacteria | 2253 |
| 616 | Ga0207712_10026523 | 3300025961 | Bacteria | 3862 |
| 617 | Ga0207712_10159976 | 3300025961 | Bacteria | 1749 |
| 618 | Ga0207712_10433400 | 3300025961 | Bacteria | 1111 |
| 619 | Ga0207712_11029293 | 3300025961 | Bacteria | 731 |
| 620 | Ga0207668_10066056 | 3300025972 | Bacteria | 2562 |
| 621 | Ga0207668_10067714 | 3300025972 | Bacteria | 2536 |
| 622 | Ga0207668_10080850 | 3300025972 | Bacteria | 2355 |
| 623 | Ga0207668_10319617 | 3300025972 | Bacteria | 1287 |
| 624 | Ga0207668_10432764 | 3300025972 | Bacteria | 1119 |
| 625 | Ga0207668_10594954 | 3300025972 | Bacteria | 963 |
| 626 | Ga0207668_11094188 | 3300025972 | Bacteria | 714 |
| 627 | Ga0207668_11201423 | 3300025972 | Bacteria | 681 |
| 628 | Ga0207640_10067562 | 3300025981 | Bacteria | 2393 |
| 629 | Ga0207640_10077098 | 3300025981 | Bacteria | 2265 |
| 630 | Ga0207640_10250693 | 3300025981 | Bacteria | 1374 |
| 631 | Ga0207640_10269574 | 3300025981 | Bacteria | 1331 |
| 632 | Ga0207658_10172540 | 3300025986 | Bacteria | 1783 |
| 633 | Ga0207658_10220275 | 3300025986 | Bacteria | 1596 |
| 634 | Ga0207658_10257447 | 3300025986 | Bacteria | 1486 |
| 635 | Ga0207658_10377550 | 3300025986 | Bacteria | 1241 |
| 636 | Ga0207658_10384733 | 3300025986 | Bacteria | 1229 |
| 637 | Ga0207677_10027403 | 3300026023 | Bacteria | 3588 |
| 638 | Ga0207677_10061810 | 3300026023 | Bacteria | 2595 |
| 639 | Ga0207677_10070132 | 3300026023 | Bacteria | 2468 |
| 640 | Ga0207677_10116123 | 3300026023 | Bacteria | 2003 |
| 641 | Ga0207677_10231946 | 3300026023 | Bacteria | 1487 |
| 642 | Ga0207703_10096502 | 3300026035 | Bacteria | 2496 |
| 643 | Ga0207703_10364946 | 3300026035 | Bacteria | 1332 |
| 644 | Ga0207703_11668145 | 3300026035 | Bacteria | 613 |
| 645 | Ga0207639_10046989 | 3300026041 | Bacteria | 3259 |
| 646 | Ga0207639_10113884 | 3300026041 | Bacteria | 2209 |
| 647 | Ga0207639_10512155 | 3300026041 | Bacteria | 1098 |
| 648 | Ga0207639_11185318 | 3300026041 | Bacteria | 717 |
| 649 | Ga0207678_10000721 | 3300026067 | Bacteria | 30188 |
| 650 | Ga0207678_10002923 | 3300026067 | Bacteria | 15493 |
| 651 | Ga0207678_10004603 | 3300026067 | Bacteria | 12394 |
| 652 | Ga0207678_10010843 | 3300026067 | Bacteria | 8008 |
| 653 | Ga0207678_10017537 | 3300026067 | Bacteria | 6288 |
| 654 | Ga0207678_10021928 | 3300026067 | Bacteria | 5599 |
| 655 | Ga0207678_10072348 | 3300026067 | Bacteria | 2954 |
| 656 | Ga0207678_10172855 | 3300026067 | Bacteria | 1844 |
| 657 | Ga0207678_10448051 | 3300026067 | Bacteria | 1122 |
| 658 | Ga0207678_10825177 | 3300026067 | Bacteria | 819 |
| 659 | Ga0207678_11026891 | 3300026067 | Bacteria | 730 |
| 660 | Ga0207708_10033205 | 3300026075 | Bacteria | 3919 |
| 661 | Ga0207702_10001649 | 3300026078 | Bacteria | 22030 |
| 662 | Ga0207702_10111628 | 3300026078 | Bacteria | 2431 |
| 663 | Ga0207702_10149948 | 3300026078 | Bacteria | 2120 |
| 664 | Ga0207702_10201326 | 3300026078 | Bacteria | 1846 |
| 665 | Ga0207702_10221719 | 3300026078 | Bacteria | 1762 |
| 666 | Ga0207702_10485764 | 3300026078 | Bacteria | 1202 |
| 667 | Ga0207702_10687848 | 3300026078 | Bacteria | 1007 |
| 668 | Ga0207702_10907976 | 3300026078 | Bacteria | 873 |
| 669 | Ga0207641_10433758 | 3300026088 | Bacteria | 1267 |
| 670 | Ga0207641_11292139 | 3300026088 | Bacteria | 730 |
| 671 | Ga0207648_10089012 | 3300026089 | Bacteria | 2696 |
| 672 | Ga0207676_10030660 | 3300026095 | Bacteria | 4039 |
| 673 | Ga0207676_10042572 | 3300026095 | Bacteria | 3493 |
| 674 | Ga0207676_10154959 | 3300026095 | Bacteria | 1978 |
| 675 | Ga0207674_10095474 | 3300026116 | Bacteria | 2959 |
| 676 | Ga0207674_10132400 | 3300026116 | Bacteria | 2456 |
| 677 | Ga0207674_10194765 | 3300026116 | Bacteria | 1976 |
| 678 | Ga0207674_10874802 | 3300026116 | Bacteria | 866 |
| 679 | Ga0207674_11329364 | 3300026116 | Bacteria | 688 |
| 680 | Ga0207675_100121432 | 3300026118 | Bacteria | 2472 |
| 681 | Ga0207675_100123678 | 3300026118 | Bacteria | 2449 |
| 682 | Ga0207683_10012932 | 3300026121 | Bacteria | 7127 |
| 683 | Ga0207683_10025571 | 3300026121 | Bacteria | 5093 |
| 684 | Ga0207683_10030143 | 3300026121 | Bacteria | 4699 |
| 685 | Ga0207683_10048432 | 3300026121 | Bacteria | 3721 |
| 686 | Ga0207683_10115215 | 3300026121 | Bacteria | 2409 |
| 687 | Ga0207683_10147200 | 3300026121 | Bacteria | 2125 |
| 688 | Ga0207683_10244256 | 3300026121 | Bacteria | 1638 |
| 689 | Ga0207683_10296334 | 3300026121 | Bacteria | 1479 |
| 690 | Ga0207698_10108343 | 3300026142 | Bacteria | 2322 |
| 691 | Ga0207698_10490690 | 3300026142 | Bacteria | 1193 |
| 692 | Ga0209389_1000212 | 3300027296 | Bacteria | 40932 |
| 693 | Ga0209589_1001280 | 3300027357 | Bacteria | 40932 |
| 694 | Ga0209489_100085 | 3300027361 | Bacteria | 126199 |
| 695 | Ga0209179_1009590 | 3300027512 | Bacteria | 1665 |
| 696 | Ga0209179_1091515 | 3300027512 | Bacteria | 675 |
| 697 | Ga0209588_1001779 | 3300027671 | Bacteria | 5718 |
| 698 | Ga0209588_1041104 | 3300027671 | Bacteria | 1492 |
| 699 | Ga0209588_1103050 | 3300027671 | Bacteria | 918 |
| 700 | Ga0209813_10057755 | 3300027866 | Bacteria | 1231 |
| 701 | Ga0209974_10216656 | 3300027876 | Bacteria | 711 |
| 702 | Ga0207428_10167199 | 3300027907 | Bacteria | 1667 |
| 703 | Ga0268266_10003266 | 3300028379 | Bacteria | 16328 |
| 704 | Ga0268266_10024737 | 3300028379 | Bacteria | 5109 |
| 705 | Ga0268266_10048039 | 3300028379 | Bacteria | 3658 |
| 706 | Ga0268266_10499619 | 3300028379 | Bacteria | 1161 |
| 707 | Ga0268266_10733132 | 3300028379 | Bacteria | 953 |
| 708 | Ga0268266_10858120 | 3300028379 | Bacteria | 878 |
| 709 | Ga0268265_10099512 | 3300028380 | Bacteria | 2344 |
| 710 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 711 | Ga0268264_10135428 | 3300028381 | Bacteria | 2189 |
| 712 | Ga0268264_10264421 | 3300028381 | Bacteria | 1604 |
| 713 | Ga0268264_10414392 | 3300028381 | Bacteria | 1298 |
| 714 | Ga0268264_10760238 | 3300028381 | Bacteria | 966 |
| 715 | Ga0265337_1011548 | 3300028556 | Bacteria | 3038 |
| 716 | Ga0265326_10040338 | 3300028558 | Bacteria | 1326 |
| 717 | Ga0265319_1033620 | 3300028563 | Bacteria | 1769 |
| 718 | Ga0265334_10002347 | 3300028573 | Bacteria | 8904 |
| 719 | Ga0265334_10006108 | 3300028573 | Bacteria | 5223 |
| 720 | Ga0265318_10007048 | 3300028577 | Bacteria | 5118 |
| 721 | Ga0265323_10002902 | 3300028653 | Bacteria | 7689 |
| 722 | Ga0265322_10002295 | 3300028654 | Bacteria | 5928 |
| 723 | Ga0265336_10000960 | 3300028666 | Bacteria | 14406 |
| 724 | Ga0307517_10472138 | 3300028786 | Bacteria | 645 |
| 725 | Ga0307515_10261516 | 3300028794 | Bacteria | 1466 |
| 726 | Ga0265338_10000155 | 3300028800 | Bacteria | 125121 |
| 727 | Ga0265338_10023891 | 3300028800 | Bacteria | 6266 |
| 728 | Ga0265324_10007896 | 3300029957 | Bacteria | 4268 |
| 729 | Ga0307511_10042827 | 3300030521 | Bacteria | 3795 |
| 730 | Ga0307511_10278864 | 3300030521 | Bacteria | 775 |
| 731 | Ga0265332_10048807 | 3300031238 | Bacteria | 1820 |
| 732 | Ga0265328_10099045 | 3300031239 | Bacteria | 1079 |
| 733 | Ga0265328_10104527 | 3300031239 | Bacteria | 1050 |
| 734 | Ga0265325_10000264 | 3300031241 | Bacteria | 37210 |
| 735 | Ga0265325_10038377 | 3300031241 | Bacteria | 2528 |
| 736 | Ga0265340_10071225 | 3300031247 | Bacteria | 1648 |
| 737 | Ga0265340_10102986 | 3300031247 | Bacteria | 1325 |
| 738 | Ga0265339_10072326 | 3300031249 | Bacteria | 1835 |
| 739 | Ga0265331_10104682 | 3300031250 | Bacteria | 1300 |
| 740 | Ga0307509_10005003 | 3300031507 | Bacteria | 18702 |
| 741 | Ga0307509_10277277 | 3300031507 | Bacteria | 1440 |
| 742 | Ga0307509_10374871 | 3300031507 | Bacteria | 1138 |
| 743 | Ga0307509_10600357 | 3300031507 | Bacteria | 773 |
| 744 | Ga0307408_100385294 | 3300031548 | Bacteria | 1199 |
| 745 | Ga0307408_100494360 | 3300031548 | Bacteria | 1070 |
| 746 | Ga0265313_10010055 | 3300031595 | Bacteria | 6051 |
| 747 | Ga0307508_10000120 | 3300031616 | Bacteria | 93316 |
| 748 | Ga0307508_10038844 | 3300031616 | Bacteria | 4277 |
| 749 | Ga0307508_10173980 | 3300031616 | Bacteria | 1756 |
| 750 | Ga0265314_10015133 | 3300031711 | Bacteria | 6135 |
| 751 | Ga0265314_10024194 | 3300031711 | Bacteria | 4609 |
| 752 | Ga0265342_10018169 | 3300031712 | Bacteria | 4561 |
| 753 | Ga0307516_10041329 | 3300031730 | Bacteria | 4583 |
| 754 | Ga0307516_10220860 | 3300031730 | Bacteria | 1604 |
| 755 | Ga0307405_10091828 | 3300031731 | Bacteria | 2013 |
| 756 | Ga0307410_10140440 | 3300031852 | Bacteria | 1786 |
| 757 | Ga0307410_11207176 | 3300031852 | Bacteria | 659 |
| 758 | Ga0307410_11323951 | 3300031852 | Bacteria | 630 |
| 759 | Ga0307406_10168499 | 3300031901 | Bacteria | 1582 |
| 760 | Ga0307406_10349494 | 3300031901 | Bacteria | 1155 |
| 761 | Ga0307407_10333610 | 3300031903 | Bacteria | 1068 |
| 762 | Ga0307412_10158049 | 3300031911 | Bacteria | 1680 |
| 763 | Ga0307412_10214021 | 3300031911 | Bacteria | 1473 |
| 764 | Ga0307412_10677653 | 3300031911 | Bacteria | 882 |
| 765 | Ga0307409_100150475 | 3300031995 | Bacteria | 2020 |
| 766 | Ga0307414_10177260 | 3300032004 | Bacteria | 1710 |
| 767 | Ga0307411_10143459 | 3300032005 | Bacteria | 1764 |
| 768 | Ga0307411_10939714 | 3300032005 | Bacteria | 770 |
| 769 | Ga0307411_11031396 | 3300032005 | Bacteria | 738 |
| 770 | Ga0307415_100052907 | 3300032126 | Bacteria | 2764 |
| 771 | Ga0307415_100057944 | 3300032126 | Bacteria | 2664 |
| 772 | Ga0307415_100312651 | 3300032126 | Bacteria | 1306 |
| 773 | Ga0307415_100346248 | 3300032126 | Bacteria | 1249 |
| 774 | Ga0307507_10081029 | 3300033179 | Bacteria | 2857 |
| 775 | Ga0307510_10012623 | 3300033180 | Bacteria | 10019 |
| 776 | Ga0307510_10080874 | 3300033180 | Bacteria | 3156 |
| 777 | Ga0307510_10241634 | 3300033180 | Bacteria | 1300 |
| 778 | Ga0315911_1000037 | 3300033442 | Bacteria | 62198 |
| 779 | Ga0373930_0000647 | 3300034816 | Bacteria | 4863 |
| 780 | Ga0373948_0015453 | 3300034817 | Bacteria | 1402 |
| 781 | Ga0373948_0022868 | 3300034817 | Bacteria | 1208 |
| 782 | Ga0373950_0004698 | 3300034818 | Bacteria | 2009 |
| 783 | Ga0373959_0104691 | 3300034820 | Bacteria | 677 |
| 784 | Ga0373926_0196137 | 3300035083 | Bacteria | 776 |
| 785 | Ga0373928_0014591 | 3300035084 | Bacteria | 1591 |
| 786 | Ga0373928_0026891 | 3300035084 | Bacteria | 1249 |
| 787 | Ga0373934_0002906 | 3300035086 | Bacteria | 6268 |
| 788 | Ga0373934_0100799 | 3300035086 | Bacteria | 1168 |
| 789 | Ga0373934_0166045 | 3300035086 | Bacteria | 906 |
| 790 | Ga0373940_0041165 | 3300035088 | Bacteria | 1270 |
| 791 | Ga0373949_0040775 | 3300035090 | Bacteria | 1141 |
| 792 | Ga0373951_0024795 | 3300035091 | Bacteria | 1391 |
| 793 | Ga0373923_0062813 | 3300035111 | Bacteria | 1581 |
| 794 | Ga0373923_0169971 | 3300035111 | Bacteria | 998 |
| 795 | Ga0373932_0007300 | 3300035112 | Bacteria | 2632 |
| 796 | Ga0373932_0018087 | 3300035112 | Bacteria | 1818 |
| 797 | Ga0373936_0020917 | 3300035113 | Bacteria | 2544 |
| 798 | Ga0373936_0084368 | 3300035113 | Bacteria | 1326 |
| 799 | Ga0373945_0040426 | 3300035116 | Bacteria | 1684 |
| 800 | Ga0373945_0079195 | 3300035116 | Bacteria | 1256 |
| 801 | Ga0373953_0008531 | 3300035117 | Bacteria | 3484 |
| 802 | Ga0373953_0015360 | 3300035117 | Bacteria | 2773 |
| 803 | Ga0373954_0005696 | 3300035118 | Bacteria | 5405 |
| 804 | Ga0373954_0007272 | 3300035118 | Bacteria | 4839 |
| 805 | Ga0373954_0200857 | 3300035118 | Bacteria | 979 |
| 806 | Ga0373956_0010324 | 3300035119 | Bacteria | 3824 |
| 807 | Ga0373956_0059022 | 3300035119 | Bacteria | 1735 |
| 808 | Ga0373956_0401880 | 3300035119 | Bacteria | 653 |
| 809 | Ga0373957_0001391 | 3300035120 | Bacteria | 6517 |
| 810 | Ga0373957_0018656 | 3300035120 | Bacteria | 2433 |
| 811 | Ga0373957_0030841 | 3300035120 | Bacteria | 1966 |
| 812 | Ga0373957_0208436 | 3300035120 | Bacteria | 816 |
| 813 | Ga0373943_0007179 | 3300035170 | Bacteria | 4998 |
| 814 | Ga0373943_0033128 | 3300035170 | Bacteria | 2459 |
| 815 | Ga0373946_0014352 | 3300035171 | Bacteria | 2987 |
| 816 | Ga0373946_0045813 | 3300035171 | Bacteria | 1810 |
| 817 | Ga0373946_0076222 | 3300035171 | Bacteria | 1459 |
| 818 | Ga0373955_0004993 | 3300035172 | Bacteria | 5926 |
| 819 | Ga0373955_0082675 | 3300035172 | Bacteria | 1817 |
| 820 | Ga0373961_0048559 | 3300035241 | Bacteria | 1251 |
| 821 | Ga0373924_0036763 | 3300035410 | Bacteria | 1991 |
| 822 | Ga0373931_0004597 | 3300035691 | Bacteria | 6314 |
| 823 | Ga0373931_0021136 | 3300035691 | Bacteria | 3263 |
| 824 | Ga0373931_0401533 | 3300035691 | Bacteria | 868 |
| 825 | Ga0373935_0015705 | 3300035692 | Bacteria | 4579 |
| 826 | Ga0373935_0030972 | 3300035692 | Bacteria | 3317 |
| 827 | Ga0373935_0106345 | 3300035692 | Bacteria | 1857 |
| 828 | Ga0373935_0157342 | 3300035692 | Bacteria | 1546 |
| 829 | Ga0373935_0189906 | 3300035692 | Bacteria | 1414 |
| 830 | Ga0373935_0302721 | 3300035692 | Bacteria | 1130 |
| 831 | Ga0373935_0358292 | 3300035692 | Bacteria | 1041 |
| 832 | Ga0373935_0443982 | 3300035692 | Bacteria | 936 |
| 833 | Ga0373927_0002813 | 3300035695 | Bacteria | 12703 |
| 834 | Ga0373927_0007182 | 3300035695 | Bacteria | 7558 |
| 835 | Ga0373927_0012358 | 3300035695 | Bacteria | 5682 |
| 836 | Ga0373927_0014147 | 3300035695 | Bacteria | 5291 |
| 837 | Ga0373927_0015983 | 3300035695 | Bacteria | 4954 |
| 838 | Ga0373927_0031642 | 3300035695 | Bacteria | 3447 |
| 839 | Ga0373927_0053846 | 3300035695 | Bacteria | 2603 |
| 840 | Ga0373927_0274383 | 3300035695 | Bacteria | 1109 |
| 841 | Ga0373927_0382358 | 3300035695 | Bacteria | 928 |
| 842 | Ga0373927_0701694 | 3300035695 | Bacteria | 668 |
| 843 | Ga0373933_0062945 | 3300035724 | Bacteria | 2242 |
| 844 | Ga0373933_0080332 | 3300035724 | Bacteria | 1998 |
| 845 | Ga0373933_0110061 | 3300035724 | Bacteria | 1717 |
| 846 | Ga0373933_0117650 | 3300035724 | Bacteria | 1662 |
| 847 | Ga0373947_0000441 | 3300035725 | Bacteria | 23573 |
| 848 | Ga0373947_0020629 | 3300035725 | Bacteria | 3807 |
| 849 | Ga0373947_0026397 | 3300035725 | Bacteria | 3394 |
| 850 | Ga0373947_0078495 | 3300035725 | Bacteria | 2038 |
| 851 | Ga0373947_0135053 | 3300035725 | Bacteria | 1578 |
| 852 | Ga0373947_0245907 | 3300035725 | Bacteria | 1181 |
| 853 | Ga0373947_0286244 | 3300035725 | Bacteria | 1096 |
| 854 | Ga0373947_0749638 | 3300035725 | Bacteria | 666 |
| 855 | Ga0373937_0011747 | 3300036401 | Bacteria | 7682 |
| 856 | Ga0373937_0049701 | 3300036401 | Bacteria | 3840 |
| 857 | Ga0373937_0098734 | 3300036401 | Bacteria | 2708 |
| 858 | Ga0373937_0348558 | 3300036401 | Bacteria | 1402 |
| 859 | Ga0373937_0767244 | 3300036401 | Bacteria | 912 |
| 860 | Ga0373937_1130797 | 3300036401 | Bacteria | 732 |
| 861 | Ga0373925_0005350 | 3300037068 | Bacteria | 9577 |
| 862 | Ga0373925_0064209 | 3300037068 | Bacteria | 2763 |
| 863 | Ga0373925_0122845 | 3300037068 | Bacteria | 2017 |
| 864 | Ga0373925_0234168 | 3300037068 | Bacteria | 1469 |
| 865 | Ga0373925_0374291 | 3300037068 | Bacteria | 1159 |
| 866 | Ga0395899_0376167 | 3300037312 | Bacteria | 945 |
| 867 | Ga0395900_0000134 | 3300037418 | Bacteria | 124444 |
| 868 | Ga0395900_0011930 | 3300037418 | Bacteria | 8885 |
| 869 | Ga0395900_0109774 | 3300037418 | Bacteria | 2834 |
| 870 | Ga0395900_0360393 | 3300037418 | Bacteria | 1425 |
| 871 | Ga0395898_0014296 | 3300037466 | Bacteria | 8158 |
| 872 | Ga0395898_0161064 | 3300037466 | Bacteria | 2146 |
| 873 | Ga0395905_0017202 | 3300037471 | Bacteria | 6868 |
| 874 | Ga0395905_0049780 | 3300037471 | Bacteria | 3927 |
| 875 | Ga0395905_0195869 | 3300037471 | Bacteria | 1895 |
| 876 | Ga0395905_0202261 | 3300037471 | Bacteria | 1862 |
| 877 | Ga0395905_1028874 | 3300037471 | Bacteria | 727 |
| 878 | Ga0436364_1368466 | 3300037853 | Bacteria | 1728 |
| 879 | Ga0395901_0032707 | 3300038443 | Bacteria | 5365 |
| 880 | Ga0395901_0033640 | 3300038443 | Bacteria | 5293 |
| 881 | Ga0395901_0237430 | 3300038443 | Bacteria | 1902 |
| 882 | Ga0395901_0275230 | 3300038443 | Bacteria | 1750 |
| 883 | Ga0395901_0712385 | 3300038443 | Bacteria | 1000 |
| 884 | Ga0436365_0133064 | 3300039437 | Bacteria | 19710 |
| 885 | Ga0436365_0511030 | 3300039437 | Bacteria | 1750 |
| 886 | Ga0436363_0957639 | 3300039450 | Bacteria | 2145 |
| 887 | Ga0436362_0550362 | 3300039453 | Bacteria | 8946 |
| 888 | Ga0439439_0188358 | 3300041406 | Bacteria | 596 |
| 889 | Ga0451798_0453507 | 3300041458 | Bacteria | 870 |
| 890 | Ga0451853_0932301 | 3300041512 | Bacteria | 775 |
| 891 | Ga0439458_0058958 | 3300042157 | Bacteria | 956 |
| 892 | Ga0466969_0105919 | 3300044656 | Bacteria | 1320 |
| 893 | Ga0466972_0042673 | 3300044658 | Bacteria | 2204 |
| 894 | Ga0466972_0134945 | 3300044658 | Bacteria | 1162 |
| 895 | Ga0466965_0100435 | 3300044683 | Bacteria | 1479 |
| 896 | Ga0466965_0111522 | 3300044683 | Bacteria | 1406 |
| 897 | Ga0466964_0243627 | 3300044706 | Bacteria | 883 |
| 898 | Ga0466971_0043520 | 3300044719 | Bacteria | 2018 |
| 899 | Ga0466968_0352494 | 3300044735 | Bacteria | 715 |
| 900 | Ga0466970_0249448 | 3300044765 | Bacteria | 994 |
| 901 | Ga0466957_0202450 | 3300044842 | Bacteria | 1304 |
| 902 | Ga0466957_0263393 | 3300044842 | Bacteria | 1149 |
| 903 | Ga0466959_0227312 | 3300045049 | Bacteria | 1292 |
| 904 | Ga0466959_0281625 | 3300045049 | Bacteria | 1141 |
| 905 | Ga0451576_2066207 | 3300045051 | Bacteria | 586 |
| 906 | Ga0466967_0107132 | 3300045976 | Bacteria | 2563 |
| 907 | Ga0466967_0326627 | 3300045976 | Bacteria | 1481 |
| 908 | Ga0466967_1057657 | 3300045976 | Bacteria | 808 |
| 909 | Ga0495592_0000962 | 3300046454 | Bacteria | 19966 |
| 910 | Ga0495592_0024070 | 3300046454 | Bacteria | 4630 |
| 911 | Ga0495592_0038972 | 3300046454 | Bacteria | 3572 |
| 912 | Ga0495592_0047517 | 3300046454 | Bacteria | 3196 |
| 913 | Ga0495592_0358461 | 3300046454 | Bacteria | 933 |
| 914 | Ga0495603_0000066 | 3300046455 | Bacteria | 45635 |
| 915 | Ga0495603_0017017 | 3300046455 | Bacteria | 4399 |
| 916 | Ga0495603_0065087 | 3300046455 | Bacteria | 2148 |
| 917 | Ga0495603_0067733 | 3300046455 | Bacteria | 2101 |
| 918 | Ga0495603_0077481 | 3300046455 | Bacteria | 1950 |
| 919 | Ga0495603_0273085 | 3300046455 | Bacteria | 972 |
| 920 | Ga0495603_0424859 | 3300046455 | Bacteria | 761 |
| 921 | Ga0495590_0265483 | 3300046457 | Bacteria | 641 |
| 922 | Ga0495591_085098 | 3300046458 | Bacteria | 801 |
| 923 | Ga0495629_0000131 | 3300046459 | Bacteria | 65274 |
| 924 | Ga0495629_0000984 | 3300046459 | Bacteria | 22885 |
| 925 | Ga0495629_0010691 | 3300046459 | Bacteria | 6673 |
| 926 | Ga0495629_0063174 | 3300046459 | Bacteria | 2586 |
| 927 | Ga0495629_0171694 | 3300046459 | Bacteria | 1504 |
| 928 | Ga0495629_0257100 | 3300046459 | Bacteria | 1201 |
| 929 | Ga0495638_0080415 | 3300046460 | Bacteria | 1980 |
| 930 | Ga0495638_0288208 | 3300046460 | Bacteria | 889 |
| 931 | Ga0495638_0357994 | 3300046460 | Bacteria | 768 |
| 932 | Ga0495641_0004776 | 3300046461 | Bacteria | 9430 |
| 933 | Ga0495641_0050560 | 3300046461 | Bacteria | 1899 |
| 934 | Ga0495641_0113029 | 3300046461 | Bacteria | 1211 |
| 935 | Ga0495651_0001583 | 3300046462 | Bacteria | 17578 |
| 936 | Ga0495651_0011447 | 3300046462 | Bacteria | 6814 |
| 937 | Ga0495651_0021274 | 3300046462 | Bacteria | 5041 |
| 938 | Ga0495651_0267716 | 3300046462 | Bacteria | 1160 |
| 939 | Ga0495651_0441165 | 3300046462 | Bacteria | 843 |
| 940 | Ga0495653_0017838 | 3300046463 | Bacteria | 5771 |
| 941 | Ga0495653_0054134 | 3300046463 | Bacteria | 3067 |
| 942 | Ga0495653_0105594 | 3300046463 | Bacteria | 2033 |
| 943 | Ga0495653_0106781 | 3300046463 | Bacteria | 2018 |
| 944 | Ga0495650_0037267 | 3300046471 | Bacteria | 2119 |
| 945 | Ga0495580_0001382 | 3300046472 | Bacteria | 21285 |
| 946 | Ga0495580_0017453 | 3300046472 | Bacteria | 5368 |
| 947 | Ga0495582_0000298 | 3300046473 | Bacteria | 27399 |
| 948 | Ga0495582_0084205 | 3300046473 | Bacteria | 1767 |
| 949 | Ga0495582_0107351 | 3300046473 | Bacteria | 1567 |
| 950 | Ga0495582_0611764 | 3300046473 | Bacteria | 630 |
| 951 | Ga0495605_0213934 | 3300046474 | Bacteria | 835 |
| 952 | Ga0495639_0010975 | 3300046475 | Bacteria | 3900 |
| 953 | Ga0495639_0031933 | 3300046475 | Bacteria | 2347 |
| 954 | Ga0495639_0049337 | 3300046475 | Bacteria | 1910 |
| 955 | Ga0495639_0098650 | 3300046475 | Bacteria | 1377 |
| 956 | Ga0495639_0212932 | 3300046475 | Bacteria | 948 |
| 957 | Ga0495662_0000058 | 3300046476 | Bacteria | 37987 |
| 958 | Ga0495662_0020780 | 3300046476 | Bacteria | 3175 |
| 959 | Ga0495662_0161711 | 3300046476 | Bacteria | 1103 |
| 960 | Ga0495662_0203530 | 3300046476 | Bacteria | 976 |
| 961 | Ga0495664_0001921 | 3300046477 | Bacteria | 11062 |
| 962 | Ga0495664_0013688 | 3300046477 | Bacteria | 4602 |
| 963 | Ga0495664_0090590 | 3300046477 | Bacteria | 1838 |
| 964 | Ga0495664_0383721 | 3300046477 | Bacteria | 844 |
| 965 | Ga0495664_0416710 | 3300046477 | Bacteria | 806 |
| 966 | Ga0495664_0563980 | 3300046477 | Bacteria | 678 |
| 967 | Ga0495584_0189456 | 3300046491 | Bacteria | 1045 |
| 968 | Ga0495585_0005331 | 3300046492 | Bacteria | 8121 |
| 969 | Ga0495585_0086414 | 3300046492 | Bacteria | 1694 |
| 970 | Ga0495585_0110393 | 3300046492 | Bacteria | 1463 |
| 971 | Ga0495594_0000706 | 3300046499 | Bacteria | 17171 |
| 972 | Ga0495596_0319181 | 3300046500 | Bacteria | 604 |
| 973 | Ga0495607_0038517 | 3300046501 | Bacteria | 2863 |
| 974 | Ga0495607_0122077 | 3300046501 | Bacteria | 1366 |
| 975 | Ga0495583_0084495 | 3300046506 | Bacteria | 1375 |
| 976 | Ga0495606_0000244 | 3300046507 | Bacteria | 95942 |
| 977 | Ga0495606_0366097 | 3300046507 | Bacteria | 760 |
| 978 | Ga0495608_0003424 | 3300046511 | Bacteria | 11358 |
| 979 | Ga0495608_0004308 | 3300046511 | Bacteria | 10191 |
| 980 | Ga0495608_0005405 | 3300046511 | Bacteria | 9133 |
| 981 | Ga0495610_0125495 | 3300046512 | Bacteria | 1120 |
| 982 | Ga0495616_0197382 | 3300046513 | Bacteria | 886 |
| 983 | Ga0495618_0068835 | 3300046514 | Bacteria | 2250 |
| 984 | Ga0495618_0086241 | 3300046514 | Bacteria | 2007 |
| 985 | Ga0495618_0104808 | 3300046514 | Bacteria | 1811 |
| 986 | Ga0495618_0178503 | 3300046514 | Bacteria | 1350 |
| 987 | Ga0495618_0255209 | 3300046514 | Bacteria | 1099 |
| 988 | Ga0495628_0003941 | 3300046516 | Bacteria | 13224 |
| 989 | Ga0495628_0033779 | 3300046516 | Bacteria | 4119 |
| 990 | Ga0495628_0881022 | 3300046516 | Bacteria | 622 |
| 991 | Ga0495630_0001425 | 3300046517 | Bacteria | 16552 |
| 992 | Ga0495630_0186544 | 3300046517 | Bacteria | 1582 |
| 993 | Ga0495631_0212565 | 3300046518 | Bacteria | 826 |
| 994 | Ga0495637_0286141 | 3300046520 | Bacteria | 587 |
| 995 | Ga0495644_0004455 | 3300046523 | Bacteria | 5504 |
| 996 | Ga0495648_0128765 | 3300046524 | Bacteria | 1349 |
| 997 | Ga0495663_0134058 | 3300046525 | Bacteria | 837 |
| 998 | Ga0495666_0307377 | 3300046526 | Bacteria | 716 |
| 999 | Ga0495652_0008159 | 3300046529 | Bacteria | 9575 |
| 1000 | Ga0495652_0047392 | 3300046529 | Bacteria | 3686 |
| 1001 | Ga0495652_0123399 | 3300046529 | Bacteria | 2061 |
| 1002 | Ga0495665_0000373 | 3300046531 | Bacteria | 22557 |
| 1003 | Ga0495640_0001250 | 3300046533 | Bacteria | 19944 |
| 1004 | Ga0495640_0022168 | 3300046533 | Bacteria | 4648 |
| 1005 | Ga0495640_0027866 | 3300046533 | Bacteria | 4069 |
| 1006 | Ga0495640_0087228 | 3300046533 | Bacteria | 2064 |
| 1007 | Ga0495640_0318376 | 3300046533 | Bacteria | 964 |
| 1008 | Ga0495586_0009720 | 3300046535 | Bacteria | 5123 |
| 1009 | Ga0495586_0045341 | 3300046535 | Bacteria | 2369 |
| 1010 | Ga0495586_0266277 | 3300046535 | Bacteria | 979 |
| 1011 | Ga0495587_0006700 | 3300046536 | Bacteria | 7501 |
| 1012 | Ga0495587_0012091 | 3300046536 | Bacteria | 5450 |
| 1013 | Ga0495587_0290775 | 3300046536 | Bacteria | 915 |
| 1014 | Ga0495598_0056136 | 3300046537 | Bacteria | 1201 |
| 1015 | Ga0495621_0031404 | 3300046539 | Bacteria | 1822 |
| 1016 | Ga0495645_0006904 | 3300046543 | Bacteria | 7888 |
| 1017 | Ga0495645_0019421 | 3300046543 | Bacteria | 4893 |
| 1018 | Ga0495622_0007642 | 3300046557 | Bacteria | 5021 |
| 1019 | Ga0495622_0018157 | 3300046557 | Bacteria | 3276 |
| 1020 | Ga0495622_0038008 | 3300046557 | Bacteria | 2241 |
| 1021 | Ga0495622_0092726 | 3300046557 | Bacteria | 1387 |
| 1022 | Ga0495633_0020440 | 3300046558 | Bacteria | 3330 |
| 1023 | Ga0495667_0004119 | 3300046559 | Bacteria | 9769 |
| 1024 | Ga0495667_0005627 | 3300046559 | Bacteria | 8469 |
| 1025 | Ga0495667_0020636 | 3300046559 | Bacteria | 4445 |
| 1026 | Ga0495667_0301807 | 3300046559 | Bacteria | 1014 |
| 1027 | Ga0495656_0004069 | 3300046615 | Bacteria | 4978 |
| 1028 | Ga0495656_0014584 | 3300046615 | Bacteria | 2949 |
| 1029 | Ga0495656_0024854 | 3300046615 | Bacteria | 2370 |
| 1030 | Ga0495656_0097828 | 3300046615 | Bacteria | 1352 |
| 1031 | Ga0495634_0000502 | 3300046642 | Bacteria | 38371 |
| 1032 | Ga0495634_0196724 | 3300046642 | Bacteria | 1254 |
| 1033 | Ga0495634_0205717 | 3300046642 | Bacteria | 1220 |
| 1034 | Ga0495634_0339479 | 3300046642 | Bacteria | 901 |
| 1035 | Ga0495611_0024058 | 3300046648 | Bacteria | 2647 |
| 1036 | Ga0495611_0046389 | 3300046648 | Bacteria | 1948 |
| 1037 | Ga0495635_0026268 | 3300046663 | Bacteria | 4054 |
| 1038 | Ga0495635_0027162 | 3300046663 | Bacteria | 3982 |
| 1039 | Ga0495635_0088610 | 3300046663 | Bacteria | 2117 |
| 1040 | Ga0495635_0226154 | 3300046663 | Bacteria | 1264 |
| 1041 | Ga0495635_0257524 | 3300046663 | Bacteria | 1175 |
| 1042 | Ga0495635_0588762 | 3300046663 | Bacteria | 727 |
| 1043 | Ga0495659_0113415 | 3300046664 | Bacteria | 1060 |
| 1044 | Ga0495659_0131080 | 3300046664 | Bacteria | 994 |
| 1045 | Ga0495661_0037544 | 3300046665 | Bacteria | 3024 |
| 1046 | Ga0495588_0033151 | 3300046674 | Bacteria | 2607 |
| 1047 | Ga0495588_0367329 | 3300046674 | Bacteria | 756 |
| 1048 | Ga0495657_0005728 | 3300046675 | Bacteria | 9787 |
| 1049 | Ga0495657_0009308 | 3300046675 | Bacteria | 7453 |
| 1050 | Ga0495657_0014712 | 3300046675 | Bacteria | 5742 |
| 1051 | Ga0495657_0043085 | 3300046675 | Bacteria | 3079 |
| 1052 | Ga0495657_0049829 | 3300046675 | Bacteria | 2819 |
| 1053 | Ga0495657_0073439 | 3300046675 | Bacteria | 2228 |
| 1054 | Ga0495599_0001288 | 3300046678 | Bacteria | 14233 |
| 1055 | Ga0495599_0007174 | 3300046678 | Bacteria | 6748 |
| 1056 | Ga0495599_0056898 | 3300046678 | Bacteria | 2447 |
| 1057 | Ga0495599_0088610 | 3300046678 | Bacteria | 1932 |
| 1058 | Ga0495599_0139731 | 3300046678 | Bacteria | 1503 |
| 1059 | Ga0495623_0000561 | 3300046679 | Bacteria | 24733 |
| 1060 | Ga0495623_0010099 | 3300046679 | Bacteria | 6110 |
| 1061 | Ga0495623_0033866 | 3300046679 | Bacteria | 3277 |
| 1062 | Ga0495623_0148515 | 3300046679 | Bacteria | 1387 |
| 1063 | Ga0495646_0022284 | 3300046680 | Bacteria | 3997 |
| 1064 | Ga0495646_0031540 | 3300046680 | Bacteria | 3301 |
| 1065 | Ga0495646_0056756 | 3300046680 | Bacteria | 2346 |
| 1066 | Ga0495647_0003354 | 3300046681 | Bacteria | 5131 |
| 1067 | Ga0495647_0021361 | 3300046681 | Bacteria | 2329 |
| 1068 | Ga0495647_0051974 | 3300046681 | Bacteria | 1594 |
| 1069 | Ga0495647_0058447 | 3300046681 | Bacteria | 1516 |
| 1070 | Ga0495647_0170290 | 3300046681 | Bacteria | 943 |
| 1071 | Ga0495658_0000368 | 3300046683 | Bacteria | 25300 |
| 1072 | Ga0495658_0026598 | 3300046683 | Bacteria | 3102 |
| 1073 | Ga0495658_0365438 | 3300046683 | Bacteria | 918 |
| 1074 | Ga0495669_0013841 | 3300046684 | Bacteria | 3443 |
| 1075 | Ga0495669_0033841 | 3300046684 | Bacteria | 2251 |
| 1076 | Ga0495613_0014196 | 3300046689 | Bacteria | 5909 |
| 1077 | Ga0495613_0027749 | 3300046689 | Bacteria | 4214 |
| 1078 | Ga0495613_0071390 | 3300046689 | Bacteria | 2531 |
| 1079 | Ga0495613_0073462 | 3300046689 | Bacteria | 2492 |
| 1080 | Ga0495613_0365715 | 3300046689 | Bacteria | 988 |
| 1081 | Ga0495613_0377767 | 3300046689 | Bacteria | 969 |
| 1082 | Ga0495613_0382676 | 3300046689 | Bacteria | 962 |
| 1083 | Ga0495624_0008081 | 3300046690 | Bacteria | 7365 |
| 1084 | Ga0495624_0163514 | 3300046690 | Bacteria | 1359 |
| 1085 | Ga0495624_0328704 | 3300046690 | Bacteria | 920 |
| 1086 | Ga0495670_0029218 | 3300046691 | Bacteria | 2735 |
| 1087 | Ga0495671_0179382 | 3300046692 | Bacteria | 1029 |
| 1088 | Ga0495600_0011917 | 3300046809 | Bacteria | 5431 |
| 1089 | Ga0495600_0023752 | 3300046809 | Bacteria | 3944 |
| 1090 | Ga0495600_0076875 | 3300046809 | Bacteria | 2180 |
| 1091 | Ga0495600_0102678 | 3300046809 | Bacteria | 1863 |
| 1092 | Ga0495600_0185265 | 3300046809 | Bacteria | 1340 |
| 1093 | Ga0495600_0271510 | 3300046809 | Bacteria | 1075 |
| 1094 | Ga0495600_0360413 | 3300046809 | Bacteria | 909 |
| 1095 | Ga0495600_0408156 | 3300046809 | Bacteria | 844 |
| 1096 | Ga0495600_0479097 | 3300046809 | Bacteria | 767 |
| 1097 | Ga0495581_0000111 | 3300047315 | Bacteria | 34508 |
| 1098 | Ga0495581_0104762 | 3300047315 | Bacteria | 1644 |
| 1099 | Ga0495581_0114739 | 3300047315 | Bacteria | 1567 |
| 1100 | Ga0495581_0215942 | 3300047315 | Bacteria | 1121 |
| 1101 | Ga0495581_0454754 | 3300047315 | Bacteria | 745 |
| 1102 | Ga0495581_0455455 | 3300047315 | Bacteria | 745 |
| 1103 | Ga0495581_0613048 | 3300047315 | Bacteria | 630 |
| 1104 | Ga0495604_0002451 | 3300047317 | Bacteria | 14835 |
| 1105 | Ga0495604_0010885 | 3300047317 | Bacteria | 7222 |
| 1106 | Ga0495604_0045227 | 3300047317 | Bacteria | 3436 |
| 1107 | Ga0495604_0080611 | 3300047317 | Bacteria | 2438 |
| 1108 | Ga0495604_0145039 | 3300047317 | Bacteria | 1692 |
| 1109 | Ga0495604_0147574 | 3300047317 | Bacteria | 1675 |
| 1110 | Ga0495604_0272889 | 3300047317 | Bacteria | 1145 |
| 1111 | Ga0495674_0004341 | 3300047319 | Bacteria | 13630 |
| 1112 | Ga0495674_0015128 | 3300047319 | Bacteria | 7217 |
| 1113 | Ga0495674_0030334 | 3300047319 | Bacteria | 4918 |
| 1114 | Ga0495674_0077544 | 3300047319 | Bacteria | 2856 |
| 1115 | Ga0495674_0120988 | 3300047319 | Bacteria | 2211 |
| 1116 | Ga0495674_0136513 | 3300047319 | Bacteria | 2063 |
| 1117 | Ga0495674_0170662 | 3300047319 | Bacteria | 1815 |
| 1118 | Ga0495674_0490191 | 3300047319 | Bacteria | 984 |
| 1119 | Ga0495672_0015836 | 3300047320 | Bacteria | 5104 |
| 1120 | Ga0495676_0079737 | 3300047321 | Bacteria | 2488 |
| 1121 | Ga0495680_0004114 | 3300047322 | Bacteria | 13987 |
| 1122 | Ga0495680_0039523 | 3300047322 | Bacteria | 3762 |
| 1123 | Ga0495680_0044193 | 3300047322 | Bacteria | 3523 |
| 1124 | Ga0495680_0052359 | 3300047322 | Bacteria | 3182 |
| 1125 | Ga0495680_0071985 | 3300047322 | Bacteria | 2630 |
| 1126 | Ga0495680_0086764 | 3300047322 | Bacteria | 2354 |
| 1127 | Ga0495680_0117653 | 3300047322 | Bacteria | 1964 |
| 1128 | Ga0495680_0839839 | 3300047322 | Bacteria | 597 |
| 1129 | Ga0495683_0190593 | 3300047323 | Bacteria | 930 |
| 1130 | Ga0495683_0218220 | 3300047323 | Bacteria | 851 |
| 1131 | Ga0495675_0004565 | 3300047444 | Bacteria | 8398 |
| 1132 | Ga0495675_0050347 | 3300047444 | Bacteria | 2647 |
| 1133 | Ga0495675_0055058 | 3300047444 | Bacteria | 2523 |
| 1134 | Ga0495675_0152464 | 3300047444 | Bacteria | 1427 |
| 1135 | Ga0495677_0105993 | 3300047445 | Bacteria | 1066 |
| 1136 | Ga0495677_0164397 | 3300047445 | Bacteria | 857 |
| 1137 | Ga0495679_025907 | 3300047446 | Bacteria | 1954 |
| 1138 | Ga0495685_023471 | 3300047447 | Bacteria | 2124 |
| 1139 | Ga0495673_0266038 | 3300047469 | Bacteria | 622 |
| 1140 | Ga0495684_0025696 | 3300047471 | Bacteria | 4524 |
| 1141 | Ga0495684_0088322 | 3300047471 | Bacteria | 2349 |
| 1142 | Ga0495684_0101123 | 3300047471 | Bacteria | 2179 |
| 1143 | Ga0495684_0106142 | 3300047471 | Bacteria | 2122 |
| 1144 | Ga0495684_0205519 | 3300047471 | Bacteria | 1450 |
| 1145 | Ga0495686_0059342 | 3300047472 | Bacteria | 2382 |
| 1146 | Ga0495686_0365850 | 3300047472 | Bacteria | 781 |
| 1147 | Ga0495593_0000210 | 3300047673 | Bacteria | 30957 |
| 1148 | Ga0495593_0001699 | 3300047673 | Bacteria | 13052 |
| 1149 | Ga0495593_0018230 | 3300047673 | Bacteria | 3947 |
| 1150 | Ga0495593_0077811 | 3300047673 | Bacteria | 1718 |
| 1151 | Ga0495593_0240855 | 3300047673 | Bacteria | 906 |
| 1152 | Ga0495602_0007289 | 3300048088 | Bacteria | 11579 |
| 1153 | Ga0495602_0023526 | 3300048088 | Bacteria | 6000 |
| 1154 | Ga0495602_0085736 | 3300048088 | Bacteria | 2631 |
| 1155 | Ga0495602_0169545 | 3300048088 | Bacteria | 1695 |
| 1156 | Ga0495602_0834180 | 3300048088 | Bacteria | 617 |
| 1157 | Ga0495615_0007972 | 3300048090 | Bacteria | 2030 |
| 1158 | Ga0496100_0013868 | 3300048903 | Bacteria | 4663 |
| 1159 | Ga0496100_0031298 | 3300048903 | Bacteria | 3307 |
| 1160 | Ga0496100_0039813 | 3300048903 | Bacteria | 2986 |
| 1161 | Ga0496100_0272099 | 3300048903 | Bacteria | 1260 |
| 1162 | Ga0496100_0274677 | 3300048903 | Bacteria | 1254 |
| 1163 | Ga0496101_0010824 | 3300048904 | Bacteria | 6033 |
| 1164 | Ga0496101_0021299 | 3300048904 | Bacteria | 4453 |
| 1165 | Ga0496101_0048045 | 3300048904 | Bacteria | 3065 |
| 1166 | Ga0496101_0231465 | 3300048904 | Bacteria | 1436 |
| 1167 | Ga0496101_0540858 | 3300048904 | Bacteria | 921 |
| 1168 | Ga0496101_0601859 | 3300048904 | Bacteria | 869 |
| 1169 | Ga0496102_0003826 | 3300048905 | Bacteria | 12731 |
| 1170 | Ga0496102_0014510 | 3300048905 | Bacteria | 6845 |
| 1171 | Ga0496102_0036014 | 3300048905 | Bacteria | 4457 |
| 1172 | Ga0496102_0053738 | 3300048905 | Bacteria | 3671 |
| 1173 | Ga0496102_0084735 | 3300048905 | Bacteria | 2926 |
| 1174 | Ga0496102_0095808 | 3300048905 | Bacteria | 2751 |
| 1175 | Ga0496102_0165557 | 3300048905 | Bacteria | 2080 |
| 1176 | Ga0496102_0212492 | 3300048905 | Bacteria | 1824 |
| 1177 | Ga0496102_0560670 | 3300048905 | Bacteria | 1065 |
| 1178 | Ga0496102_0949495 | 3300048905 | Bacteria | 781 |
| 1179 | Ga0496103_0027030 | 3300048906 | Bacteria | 3474 |
| 1180 | Ga0496103_0031918 | 3300048906 | Bacteria | 3212 |
| 1181 | Ga0496103_0047160 | 3300048906 | Bacteria | 2661 |
| 1182 | Ga0496103_0082735 | 3300048906 | Bacteria | 2020 |
| 1183 | Ga0496103_0222421 | 3300048906 | Bacteria | 1214 |
| 1184 | Ga0496103_0355607 | 3300048906 | Bacteria | 942 |
| 1185 | Ga0496103_0407292 | 3300048906 | Bacteria | 873 |
| 1186 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 1187 | Ga0496104_0029318 | 3300048907 | Bacteria | 5103 |
| 1188 | Ga0496104_0054677 | 3300048907 | Bacteria | 3773 |
| 1189 | Ga0496104_0083527 | 3300048907 | Bacteria | 3045 |
| 1190 | Ga0496104_0258891 | 3300048907 | Bacteria | 1653 |
| 1191 | Ga0496105_0010163 | 3300048908 | Bacteria | 7395 |
| 1192 | Ga0496105_0014761 | 3300048908 | Bacteria | 6218 |
| 1193 | Ga0496105_0115766 | 3300048908 | Bacteria | 2211 |
| 1194 | Ga0496105_0149675 | 3300048908 | Bacteria | 1919 |
| 1195 | Ga0496105_0328900 | 3300048908 | Bacteria | 1224 |
| 1196 | Ga0496105_0349912 | 3300048908 | Bacteria | 1180 |
| 1197 | Ga0496106_0018269 | 3300048909 | Bacteria | 5183 |
| 1198 | Ga0496106_0026335 | 3300048909 | Bacteria | 4330 |
| 1199 | Ga0496106_0043409 | 3300048909 | Bacteria | 3373 |
| 1200 | Ga0496106_0093077 | 3300048909 | Bacteria | 2329 |
| 1201 | Ga0496106_0116123 | 3300048909 | Bacteria | 2088 |
| 1202 | Ga0496106_0187436 | 3300048909 | Bacteria | 1644 |
| 1203 | Ga0496106_0380089 | 3300048909 | Bacteria | 1135 |
| 1204 | Ga0496106_0777378 | 3300048909 | Bacteria | 760 |
| 1205 | Ga0496107_0000413 | 3300048910 | Bacteria | 23209 |
| 1206 | Ga0496107_0005993 | 3300048910 | Bacteria | 8332 |
| 1207 | Ga0496107_0027280 | 3300048910 | Bacteria | 4055 |
| 1208 | Ga0496107_0098442 | 3300048910 | Bacteria | 2142 |
| 1209 | Ga0496107_0556556 | 3300048910 | Bacteria | 849 |
| 1210 | Ga0496107_0737727 | 3300048910 | Bacteria | 723 |
| 1211 | Ga0496107_1127447 | 3300048910 | Bacteria | 566 |
| 1212 | Ga0496108_0072631 | 3300048911 | Bacteria | 2904 |
| 1213 | Ga0496108_0131555 | 3300048911 | Bacteria | 2151 |
| 1214 | Ga0496108_0170603 | 3300048911 | Bacteria | 1882 |
| 1215 | Ga0496108_0318675 | 3300048911 | Bacteria | 1355 |
| 1216 | Ga0496108_0479037 | 3300048911 | Bacteria | 1087 |
| 1217 | Ga0496108_0913918 | 3300048911 | Bacteria | 753 |
| 1218 | Ga0496109_0041987 | 3300048912 | Bacteria | 4142 |
| 1219 | Ga0496109_0056255 | 3300048912 | Bacteria | 3590 |
| 1220 | Ga0496109_0064124 | 3300048912 | Bacteria | 3361 |
| 1221 | Ga0496109_0136268 | 3300048912 | Bacteria | 2294 |
| 1222 | Ga0496109_0313116 | 3300048912 | Bacteria | 1481 |
| 1223 | Ga0496109_0572210 | 3300048912 | Bacteria | 1065 |
| 1224 | Ga0496110_0008222 | 3300048913 | Bacteria | 8385 |
| 1225 | Ga0496110_0124245 | 3300048913 | Bacteria | 2327 |
| 1226 | Ga0496110_0271367 | 3300048913 | Bacteria | 1544 |
| 1227 | Ga0496110_0589019 | 3300048913 | Bacteria | 1009 |
| 1228 | Ga0496110_0700571 | 3300048913 | Bacteria | 914 |
| 1229 | Ga0496110_0826296 | 3300048913 | Bacteria | 831 |
| 1230 | Ga0496111_0204487 | 3300048914 | Bacteria | 1467 |
| 1231 | Ga0496111_0426690 | 3300048914 | Bacteria | 979 |
| 1232 | Ga0496111_0515014 | 3300048914 | Bacteria | 880 |
| 1233 | Ga0496111_0631176 | 3300048914 | Bacteria | 783 |
| 1234 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 1235 | Ga0496112_0033962 | 3300048915 | Bacteria | 4962 |
| 1236 | Ga0496112_0035449 | 3300048915 | Bacteria | 4861 |
| 1237 | Ga0496112_0091791 | 3300048915 | Bacteria | 3005 |
| 1238 | Ga0496112_0115995 | 3300048915 | Bacteria | 2648 |
| 1239 | Ga0496112_0121752 | 3300048915 | Bacteria | 2579 |
| 1240 | Ga0496112_0135932 | 3300048915 | Bacteria | 2429 |
| 1241 | Ga0496112_0425994 | 3300048915 | Bacteria | 1265 |
| 1242 | Ga0496112_0888932 | 3300048915 | Bacteria | 813 |
| 1243 | Ga0496112_0951924 | 3300048915 | Bacteria | 780 |
| 1244 | Ga0496113_0006958 | 3300048916 | Bacteria | 7228 |
| 1245 | Ga0496113_0082214 | 3300048916 | Bacteria | 2470 |
| 1246 | Ga0496113_0118841 | 3300048916 | Bacteria | 2065 |
| 1247 | Ga0496113_0134271 | 3300048916 | Bacteria | 1944 |
| 1248 | Ga0496113_0288685 | 3300048916 | Bacteria | 1312 |
| 1249 | Ga0496113_1062826 | 3300048916 | Bacteria | 636 |
| 1250 | Ga0496114_0020155 | 3300048917 | Bacteria | 5410 |
| 1251 | Ga0496114_0029656 | 3300048917 | Bacteria | 4498 |
| 1252 | Ga0496114_0118237 | 3300048917 | Bacteria | 2277 |
| 1253 | Ga0496114_0189966 | 3300048917 | Bacteria | 1797 |
| 1254 | Ga0496114_0367457 | 3300048917 | Bacteria | 1273 |
| 1255 | Ga0496115_0005968 | 3300048918 | Bacteria | 8892 |
| 1256 | Ga0496115_0041613 | 3300048918 | Bacteria | 3657 |
| 1257 | Ga0496115_0068457 | 3300048918 | Bacteria | 2874 |
| 1258 | Ga0496115_0088634 | 3300048918 | Bacteria | 2526 |
| 1259 | Ga0496115_0122044 | 3300048918 | Bacteria | 2144 |
| 1260 | Ga0496115_0340906 | 3300048918 | Bacteria | 1223 |
| 1261 | Ga0496115_0591285 | 3300048918 | Bacteria | 883 |
| 1262 | Ga0496116_0235858 | 3300048919 | Bacteria | 923 |
| 1263 | Ga0496118_0001892 | 3300048921 | Bacteria | 29856 |
| 1264 | Ga0496118_0142679 | 3300048921 | Bacteria | 1515 |
| 1265 | Ga0496119_0031735 | 3300048922 | Bacteria | 3534 |
| 1266 | Ga0496119_0119999 | 3300048922 | Bacteria | 1447 |
| 1267 | Ga0496120_0013537 | 3300048923 | Bacteria | 5487 |
| 1268 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 1269 | Ga0496121_0033571 | 3300048924 | Bacteria | 4640 |
| 1270 | Ga0496121_0044283 | 3300048924 | Bacteria | 3841 |
| 1271 | Ga0496121_0067477 | 3300048924 | Bacteria | 2899 |
| 1272 | Ga0496121_0105901 | 3300048924 | Bacteria | 2157 |
| 1273 | Ga0496121_0224299 | 3300048924 | Bacteria | 1321 |
| 1274 | Ga0496121_0229998 | 3300048924 | Bacteria | 1299 |
| 1275 | Ga0496121_0297335 | 3300048924 | Bacteria | 1097 |
| 1276 | Ga0496124_0001646 | 3300048927 | Bacteria | 31986 |
| 1277 | Ga0496124_0124699 | 3300048927 | Bacteria | 2053 |
| 1278 | Ga0496124_0297680 | 3300048927 | Bacteria | 1167 |
| 1279 | Ga0496125_0033775 | 3300048928 | Bacteria | 4520 |
| 1280 | Ga0496125_0290992 | 3300048928 | Bacteria | 1006 |
| 1281 | Ga0496125_0353060 | 3300048928 | Bacteria | 877 |
| 1282 | Ga0496126_0002010 | 3300048929 | Bacteria | 28750 |
| 1283 | Ga0496126_0007412 | 3300048929 | Bacteria | 12034 |
| 1284 | Ga0496126_0010298 | 3300048929 | Bacteria | 9818 |
| 1285 | Ga0496126_0113225 | 3300048929 | Bacteria | 2362 |
| 1286 | Ga0496126_0150115 | 3300048929 | Bacteria | 1998 |
| 1287 | Ga0496126_0191731 | 3300048929 | Bacteria | 1731 |
| 1288 | Ga0496126_0717694 | 3300048929 | Bacteria | 775 |
| 1289 | Ga0495678_046165 | 3300049459 | Bacteria | 1714 |
| 1290 | Ga0495682_0090779 | 3300049460 | Bacteria | 1097 |
| 1291 | Ga0501031_0029819 | 3300049568 | Bacteria | 3558 |
| 1292 | Ga0501032_0103321 | 3300049569 | Bacteria | 1888 |
| 1293 | Ga0501032_0407103 | 3300049569 | Bacteria | 873 |
| 1294 | Ga0501033_0009836 | 3300049570 | Bacteria | 7337 |
| 1295 | Ga0501033_0027573 | 3300049570 | Bacteria | 4270 |
| 1296 | Ga0501033_0117230 | 3300049570 | Bacteria | 1934 |
| 1297 | Ga0501034_0000676 | 3300049571 | Bacteria | 51758 |
| 1298 | Ga0501034_0044391 | 3300049571 | Bacteria | 4496 |
| 1299 | Ga0501034_0074265 | 3300049571 | Bacteria | 3409 |
| 1300 | Ga0501034_0100985 | 3300049571 | Bacteria | 2879 |
| 1301 | Ga0501034_0401934 | 3300049571 | Bacteria | 1292 |
| 1302 | Ga0501036_0000390 | 3300049572 | Bacteria | 30889 |
| 1303 | Ga0501036_0053603 | 3300049572 | Bacteria | 3415 |
| 1304 | Ga0501036_0282978 | 3300049572 | Bacteria | 1388 |
| 1305 | Ga0501037_0000755 | 3300049573 | Bacteria | 24430 |
| 1306 | Ga0501037_0019397 | 3300049573 | Bacteria | 5016 |
| 1307 | Ga0501037_0182774 | 3300049573 | Bacteria | 1487 |
| 1308 | Ga0501038_0000089 | 3300049574 | Bacteria | 78009 |
| 1309 | Ga0501038_0107188 | 3300049574 | Bacteria | 2318 |
| 1310 | Ga0501038_0515883 | 3300049574 | Bacteria | 912 |
| 1311 | Ga0501039_0000114 | 3300049575 | Bacteria | 54651 |
| 1312 | Ga0501039_0077389 | 3300049575 | Bacteria | 2587 |
| 1313 | Ga0501043_0001086 | 3300049579 | Bacteria | 23917 |
| 1314 | Ga0501043_0058521 | 3300049579 | Bacteria | 3025 |
| 1315 | Ga0501043_0089204 | 3300049579 | Bacteria | 2424 |
| 1316 | Ga0501043_0368843 | 3300049579 | Bacteria | 1088 |
| 1317 | Ga0501046_0006291 | 3300049580 | Bacteria | 10525 |
| 1318 | Ga0501046_0135722 | 3300049580 | Bacteria | 1864 |
| 1319 | Ga0501046_0182257 | 3300049580 | Bacteria | 1570 |
| 1320 | Ga0501047_0000594 | 3300049581 | Bacteria | 38494 |
| 1321 | Ga0501047_0061423 | 3300049581 | Bacteria | 3626 |
| 1322 | Ga0501047_0094399 | 3300049581 | Bacteria | 2870 |
| 1323 | Ga0501047_0285178 | 3300049581 | Bacteria | 1495 |
| 1324 | Ga0501047_0658280 | 3300049581 | Bacteria | 866 |
| 1325 | Ga0501047_0701637 | 3300049581 | Bacteria | 829 |
| 1326 | Ga0501048_0015151 | 3300049582 | Bacteria | 5697 |
| 1327 | Ga0501048_0040990 | 3300049582 | Bacteria | 3317 |
| 1328 | Ga0501067_0000445 | 3300049583 | Bacteria | 22645 |
| 1329 | Ga0501067_0239075 | 3300049583 | Bacteria | 1011 |
| 1330 | Ga0501068_0004210 | 3300049584 | Bacteria | 7804 |
| 1331 | Ga0501069_0037736 | 3300049585 | Bacteria | 2666 |
| 1332 | Ga0501069_0126786 | 3300049585 | Bacteria | 1460 |
| 1333 | Ga0501069_0262932 | 3300049585 | Bacteria | 1008 |
| 1334 | Ga0501070_0017778 | 3300049586 | Bacteria | 5970 |
| 1335 | Ga0501070_0318087 | 3300049586 | Bacteria | 1266 |
| 1336 | Ga0501070_0509375 | 3300049586 | Bacteria | 966 |
| 1337 | Ga0501071_0516444 | 3300049587 | Bacteria | 916 |
| 1338 | Ga0501072_0029426 | 3300049588 | Bacteria | 4291 |
| 1339 | Ga0501072_0469243 | 3300049588 | Bacteria | 996 |
| 1340 | Ga0501073_0000055 | 3300049589 | Bacteria | 71726 |
| 1341 | Ga0501073_0295890 | 3300049589 | Bacteria | 1117 |
| 1342 | Ga0501073_0496654 | 3300049589 | Bacteria | 844 |
| 1343 | Ga0501074_0000492 | 3300049590 | Bacteria | 24146 |
| 1344 | Ga0501076_0049686 | 3300049592 | Bacteria | 3318 |
| 1345 | Ga0501079_0355125 | 3300049741 | Bacteria | 1149 |
| 1346 | Ga0501079_0888412 | 3300049741 | Bacteria | 702 |
| 1347 | Ga0501080_0008079 | 3300049742 | Bacteria | 9533 |
| 1348 | Ga0501080_0551719 | 3300049742 | Bacteria | 1026 |
| 1349 | Ga0501081_0184085 | 3300049743 | Bacteria | 1512 |
| 1350 | Ga0501083_0000570 | 3300049744 | Bacteria | 23630 |
| 1351 | Ga0501268_007552 | 3300049765 | Bacteria | 1624 |
| 1352 | Ga0501270_035015 | 3300049767 | Bacteria | 848 |
| 1353 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 1354 | Ga0501035_0015014 | 3300049822 | Bacteria | 7148 |
| 1355 | Ga0501035_0041388 | 3300049822 | Bacteria | 4160 |
| 1356 | Ga0501044_0000546 | 3300049823 | Bacteria | 45906 |
| 1357 | Ga0501044_0133658 | 3300049823 | Bacteria | 2473 |
| 1358 | Ga0501045_0004352 | 3300049824 | Bacteria | 9762 |
| 1359 | nmdc:mga03683_14262_c1 | 3300050489 | Bacteria | 2938 |
| 1360 | nmdc:mga03683_228854_c1 | 3300050489 | Bacteria | 859 |
| 1361 | nmdc:mga03n38_228283_c1 | 3300050490 | Bacteria | 975 |
| 1362 | nmdc:mga03n38_352282_c1 | 3300050490 | Bacteria | 801 |
| 1363 | nmdc:mga03n38_396_c1 | 3300050490 | Bacteria | 10795 |
| 1364 | nmdc:mga03n38_57464_c1 | 3300050490 | Bacteria | 1453 |
| 1365 | nmdc:mga00v17_314999_c1 | 3300050491 | Bacteria | 1017 |
| 1366 | nmdc:mga00v17_74792_c1 | 3300050491 | Bacteria | 2106 |
| 1367 | nmdc:mga0yw44_188114_c1 | 3300050492 | Bacteria | 1361 |
| 1368 | nmdc:mga0yw44_399816_c1 | 3300050492 | Bacteria | 929 |
| 1369 | nmdc:mga0yw44_42855_c1 | 3300050492 | Bacteria | 2700 |
| 1370 | nmdc:mga0k408_155771_c1 | 3300050493 | Bacteria | 1361 |
| 1371 | nmdc:mga0k408_445384_c1 | 3300050493 | Bacteria | 769 |
| 1372 | nmdc:mga06z11_303802_c1 | 3300050494 | Bacteria | 949 |
| 1373 | nmdc:mga06z11_413112_c1 | 3300050494 | Bacteria | 813 |
| 1374 | nmdc:mga06z11_43911_c1 | 3300050494 | Bacteria | 2252 |
| 1375 | nmdc:mga06z11_46886_c1 | 3300050494 | Bacteria | 2192 |
| 1376 | nmdc:mga04h51_191527_c1 | 3300050495 | Bacteria | 800 |
| 1377 | nmdc:mga04h51_352799_c1 | 3300050495 | Bacteria | 608 |
| 1378 | nmdc:mga04h51_59698_c1 | 3300050495 | Bacteria | 1304 |
| 1379 | nmdc:mga07m45_285396_c1 | 3300050496 | Bacteria | 960 |
| 1380 | nmdc:mga07m45_70970_c1 | 3300050496 | Bacteria | 1982 |
| 1381 | nmdc:mga07m45_7432_c2 | 3300050496 | Bacteria | 4438 |
| 1382 | nmdc:mga09592_229993_c1 | 3300050508 | Bacteria | 1606 |
| 1383 | nmdc:mga08y16_196474_c1 | 3300050511 | Bacteria | 2091 |
| 1384 | nmdc:mga08y16_624774_c1 | 3300050511 | Bacteria | 1084 |
| 1385 | nmdc:mga08y16_822569_c1 | 3300050511 | Bacteria | 920 |
| 1386 | nmdc:mga0n895_405792_c1 | 3300050512 | Bacteria | 1378 |
| 1387 | nmdc:mga0rr50_18584_c1 | 3300050513 | Bacteria | 4673 |
| 1388 | nmdc:mga0rr50_230449_c1 | 3300050513 | Bacteria | 1532 |
| 1389 | nmdc:mga0rr50_28264_c1 | 3300050513 | Bacteria | 3940 |
| 1390 | nmdc:mga0rr50_493683_c1 | 3300050513 | Bacteria | 1040 |
| 1391 | nmdc:mga08x19_168362_c1 | 3300050514 | Bacteria | 1491 |
| 1392 | nmdc:mga08x19_37303_c1 | 3300050514 | Bacteria | 3084 |
| 1393 | Ga0495601_0005470 | 3300053077 | Bacteria | 7402 |
| 1394 | Ga0495601_0006095 | 3300053077 | Bacteria | 7035 |
| 1395 | Ga0495601_0009462 | 3300053077 | Bacteria | 5765 |
| 1396 | Ga0495601_0044953 | 3300053077 | Bacteria | 2776 |
| 1397 | Ga0495601_0055833 | 3300053077 | Bacteria | 2501 |
| 1398 | Ga0495612_0004289 | 3300053078 | Bacteria | 5919 |
| 1399 | Ga0495612_0004506 | 3300053078 | Bacteria | 5783 |
| 1400 | Ga0495612_0121780 | 3300053078 | Bacteria | 1122 |
| 1401 | Ga0495612_0229798 | 3300053078 | Bacteria | 823 |
| 1402 | Ga0500635_0006552 | 3300053080 | Bacteria | 3116 |
| 1403 | Ga0500635_0011829 | 3300053080 | Bacteria | 2490 |
| 1404 | Ga0495595_0003866 | 3300053084 | Bacteria | 5973 |
| 1405 | Ga0495595_0010491 | 3300053084 | Bacteria | 3851 |
| 1406 | Ga0495595_0039038 | 3300053084 | Bacteria | 2165 |
| 1407 | Ga0495595_0152050 | 3300053084 | Bacteria | 1139 |
| 1408 | Ga0495595_0326670 | 3300053084 | Bacteria | 773 |
| 1409 | Ga0495619_0001147 | 3300053085 | Bacteria | 17396 |
| 1410 | Ga0495619_0006353 | 3300053085 | Bacteria | 7490 |
| 1411 | Ga0495619_0007969 | 3300053085 | Bacteria | 6703 |
| 1412 | Ga0495619_0104451 | 3300053085 | Bacteria | 1931 |
| 1413 | Ga0495619_0191657 | 3300053085 | Bacteria | 1415 |
| 1414 | Ga0495619_0206941 | 3300053085 | Bacteria | 1358 |
| 1415 | Ga0495619_0567861 | 3300053085 | Bacteria | 777 |
| 1416 | Ga0495619_0658832 | 3300053085 | Bacteria | 713 |
| 1417 | Ga0500578_0228085 | 3300053086 | Bacteria | 1130 |
| 1418 | Ga0500581_121507 | 3300053089 | Bacteria | 1261 |
| 1419 | Ga0500647_0118789 | 3300053091 | Bacteria | 1252 |
| 1420 | Ga0500583_0161163 | 3300053092 | Bacteria | 1117 |
| 1421 | Ga0500651_0191125 | 3300053093 | Bacteria | 1212 |
| 1422 | Ga0500651_0230419 | 3300053093 | Bacteria | 1083 |
| 1423 | Ga0500566_0000047 | 3300053094 | Bacteria | 58577 |
| 1424 | Ga0500566_0127826 | 3300053094 | Bacteria | 1363 |
| 1425 | Ga0500640_005664 | 3300053095 | Bacteria | 4687 |
| 1426 | Ga0500641_0048999 | 3300053096 | Bacteria | 1732 |
| 1427 | Ga0500648_089452 | 3300053097 | Bacteria | 1724 |
| 1428 | Ga0500554_001109 | 3300053102 | Bacteria | 5208 |
| 1429 | Ga0500554_002996 | 3300053102 | Bacteria | 3394 |
| 1430 | Ga0500555_028745 | 3300053103 | Bacteria | 1582 |
| 1431 | Ga0500569_063636 | 3300053109 | Bacteria | 1145 |
| 1432 | Ga0500572_000071 | 3300053111 | Bacteria | 32122 |
| 1433 | Ga0500593_059848 | 3300053117 | Bacteria | 1675 |
| 1434 | Ga0500594_0070853 | 3300053118 | Bacteria | 1025 |
| 1435 | Ga0500595_001904 | 3300053119 | Bacteria | 10754 |
| 1436 | Ga0500595_024231 | 3300053119 | Bacteria | 2121 |
| 1437 | Ga0500595_031318 | 3300053119 | Bacteria | 1785 |
| 1438 | Ga0500608_007594 | 3300053122 | Bacteria | 4499 |
| 1439 | Ga0500559_0002362 | 3300053136 | Bacteria | 9841 |
| 1440 | Ga0500559_0075491 | 3300053136 | Bacteria | 1525 |
| 1441 | Ga0500559_0096906 | 3300053136 | Bacteria | 1355 |
| 1442 | Ga0500568_0081443 | 3300053139 | Bacteria | 1229 |
| 1443 | Ga0500568_0085017 | 3300053139 | Bacteria | 1198 |
| 1444 | Ga0500573_0119855 | 3300053140 | Bacteria | 1465 |
| 1445 | Ga0500603_000727 | 3300053150 | Bacteria | 8020 |
| 1446 | Ga0500603_014206 | 3300053150 | Bacteria | 1856 |
| 1447 | Ga0500603_037659 | 3300053150 | Bacteria | 1277 |
| 1448 | Ga0500622_0111185 | 3300053156 | Bacteria | 1338 |
| 1449 | Ga0500627_0080484 | 3300053158 | Bacteria | 1452 |
| 1450 | Ga0500627_0362645 | 3300053158 | Bacteria | 623 |
| 1451 | Ga0500638_066884 | 3300053162 | Bacteria | 1722 |
| 1452 | Ga0500638_096934 | 3300053162 | Bacteria | 1381 |
| 1453 | Ga0500638_118331 | 3300053162 | Bacteria | 1215 |
| 1454 | Ga0500639_000087 | 3300053163 | Bacteria | 43854 |
| 1455 | Ga0500639_242849 | 3300053163 | Bacteria | 729 |
| 1456 | Ga0500636_0005004 | 3300053177 | Bacteria | 7522 |
| 1457 | Ga0500636_0028275 | 3300053177 | Bacteria | 3312 |
| 1458 | Ga0500636_0083515 | 3300053177 | Bacteria | 1837 |
| 1459 | Ga0500637_0000075 | 3300053178 | Bacteria | 35551 |
| 1460 | Ga0500637_0009481 | 3300053178 | Bacteria | 4957 |
| 1461 | Ga0500637_0142017 | 3300053178 | Bacteria | 1389 |
| 1462 | Ga0500609_040507 | 3300053731 | Bacteria | 644 |
| 1463 | Ga0500596_000317 | 3300053735 | Bacteria | 8601 |
| 1464 | Ga0500596_000832 | 3300053735 | Bacteria | 6123 |
| 1465 | Ga0501084_0001259 | 3300054114 | Bacteria | 19951 |
| 1466 | Ga0587073_0066800 | 3300059492 | Bacteria | 858 |
| 1467 | Ga0466962_0069810 | 3300061719 | Bacteria | 1678 |
| 1468 | 2513719099 | 2513237104 | Bacteria | 10034502 |
| 1469 | 2818236969 | 2816332527 | Bacteria | 8933356 |
| 1470 | 2847937924 | 2847930680 | Bacteria | 9342022 |
| 1471 | 2881673577 | 2881665667 | Bacteria | 8175609 |
| 1472 | Ga0496115_0472353 | |||
| 1473 | LJQas_1005980 | |||
| 1474 | JGI24743J22301_10028486 | |||
| 1475 | JGI24743J22301_10103649 | |||
| 1476 | JGI24750J21931_1012237 | |||
| 1477 | JGI24742J22300_10013387 | |||
| 1478 | JGI25152J39213_1000745 | |||
| 1479 | Ga0006759J45824_1037742 | |||
| 1480 | JGI25151J46595_10106669 | |||
| 1481 | JGI25406J46586_10000059 | |||
| 1482 | JGI25406J46586_10007521 | |||
| 1483 | JGI25406J46586_10143509 | |||
| 1484 | JGI25153J46596_10011069 | |||
| 1485 | JGI25153J46596_10037544 | |||
| 1486 | rootL2_10093812 | |||
| 1487 | JGI25160J50197_1054415 | |||
| 1488 | Ga0007410J51695_1030993 | |||
| 1489 | Ga0007409J51694_1027806 | |||
| 1490 | Ga0007416J51690_1028980 | |||
| 1491 | JGI25404J52841_10003695 | |||
| 1492 | JGI25404J52841_10030787 | |||
| 1493 | JGI25404J52841_10031173 | |||
| 1494 | Ga0032354_1044282 | |||
| 1495 | Ga0055524_1003255 | |||
| 1496 | Ga0055528_1008764 | |||
| 1497 | Ga0070658_10083389 | |||
| 1498 | Ga0070658_10817691 | |||
| 1499 | Ga0070683_100051065 | |||
| 1500 | Ga0070683_100080636 | |||
| 1501 | Ga0070683_100151700 | |||
| 1502 | Ga0070683_100386092 | |||
| 1503 | Ga0070690_100152935 | |||
| 1504 | Ga0070670_100132673 | |||
| 1505 | Ga0070670_100407803 | |||
| 1506 | Ga0068869_100012858 | |||
| 1507 | Ga0068869_100099243 | |||
| 1508 | Ga0070666_10713675 | |||
| 1509 | Ga0070666_10753730 | |||
| 1510 | Ga0070680_100080487 | |||
| 1511 | Ga0070680_100104534 | |||
| 1512 | Ga0070682_100008826 | |||
| 1513 | Ga0070682_100152588 | |||
| 1514 | Ga0068868_100084787 | |||
| 1515 | Ga0068868_100176070 | |||
| 1516 | Ga0068868_100634513 | |||
| 1517 | Ga0068868_101067796 | |||
| 1518 | Ga0070660_100035398 | |||
| 1519 | Ga0070660_100054026 | |||
| 1520 | Ga0070660_100097370 | |||
| 1521 | Ga0070660_100401839 | |||
| 1522 | Ga0070691_10120903 | |||
| 1523 | Ga0070691_10247457 | |||
| 1524 | Ga0070691_10302377 | |||
| 1525 | Ga0070687_100061792 | |||
| 1526 | Ga0070661_100198876 | |||
| 1527 | Ga0070661_100378467 | |||
| 1528 | Ga0070661_100472106 | |||
| 1529 | Ga0070692_10073551 | |||
| 1530 | Ga0070668_100031715 | |||
| 1531 | Ga0070668_100040421 | |||
| 1532 | Ga0070668_100157364 | |||
| 1533 | Ga0070668_100204541 | |||
| 1534 | Ga0070668_100561624 | |||
| 1535 | Ga0070668_100571551 | |||
| 1536 | Ga0070668_101086858 | |||
| 1537 | Ga0070669_100266004 | |||
| 1538 | Ga0070669_100370418 | |||
| 1539 | Ga0070675_100079587 | |||
| 1540 | Ga0070675_100103521 | |||
| 1541 | Ga0070675_100294812 | |||
| 1542 | Ga0070675_100615351 | |||
| 1543 | Ga0070671_100026694 | |||
| 1544 | Ga0070671_100175359 | |||
| 1545 | Ga0070671_100417025 | |||
| 1546 | Ga0070671_100603694 | |||
| 1547 | Ga0070674_100092759 | |||
| 1548 | Ga0070674_100289346 | |||
| 1549 | Ga0070674_100461795 | |||
| 1550 | Ga0070673_100093160 | |||
| 1551 | Ga0070673_100210846 | |||
| 1552 | Ga0070673_100450096 | |||
| 1553 | Ga0070659_100050323 | |||
| 1554 | Ga0070659_100055590 | |||
| 1555 | Ga0070659_100189730 | |||
| 1556 | Ga0070667_100123818 | |||
| 1557 | Ga0070667_100410461 | |||
| 1558 | Ga0070667_100432849 | |||
| 1559 | Ga0070667_100561577 | |||
| 1560 | Ga0070667_100595088 | |||
| 1561 | Ga0070709_10002549 | |||
| 1562 | Ga0070709_10216301 | |||
| 1563 | Ga0070709_10296213 | |||
| 1564 | Ga0070709_10737949 | |||
| 1565 | Ga0070714_100017549 | |||
| 1566 | Ga0070714_100079600 | |||
| 1567 | Ga0070714_100153352 | |||
| 1568 | Ga0070714_100171182 | |||
| 1569 | Ga0070714_100286614 | |||
| 1570 | Ga0070714_100495303 | |||
| 1571 | Ga0070714_101299641 | |||
| 1572 | Ga0070713_100021104 | |||
| 1573 | Ga0070713_100046951 | |||
| 1574 | Ga0070713_100129027 | |||
| 1575 | Ga0070713_100141916 | |||
| 1576 | Ga0070713_100201879 | |||
| 1577 | Ga0070713_100392014 | |||
| 1578 | Ga0070710_10001133 | |||
| 1579 | Ga0070710_10001588 | |||
| 1580 | Ga0070710_10072511 | |||
| 1581 | Ga0070701_10408995 | |||
| 1582 | Ga0070711_100022855 | |||
| 1583 | Ga0070711_100028547 | |||
| 1584 | Ga0070711_100029901 | |||
| 1585 | Ga0070711_100114998 | |||
| 1586 | Ga0070711_100149200 | |||
| 1587 | Ga0070711_100159380 | |||
| 1588 | Ga0070711_100649064 | |||
| 1589 | Ga0070711_101025161 | |||
| 1590 | Ga0070705_100021702 | |||
| 1591 | Ga0070700_100468237 | |||
| 1592 | Ga0070694_100183472 | |||
| 1593 | Ga0070694_100281682 | |||
| 1594 | Ga0070663_100005186 | |||
| 1595 | Ga0070663_100024885 | |||
| 1596 | Ga0070663_100036027 | |||
| 1597 | Ga0070663_100055427 | |||
| 1598 | Ga0070663_100093910 | |||
| 1599 | Ga0070663_100105864 | |||
| 1600 | Ga0070663_100169900 | |||
| 1601 | Ga0070663_101138436 | |||
| 1602 | Ga0070663_101360177 | |||
| 1603 | Ga0070678_100027340 | |||
| 1604 | Ga0070678_100045615 | |||
| 1605 | Ga0070678_100048909 | |||
| 1606 | Ga0070678_100058003 | |||
| 1607 | Ga0070678_100094259 | |||
| 1608 | Ga0070678_100170436 | |||
| 1609 | Ga0070678_100196302 | |||
| 1610 | Ga0070678_100444595 | |||
| 1611 | Ga0070662_100202863 | |||
| 1612 | Ga0070662_100468085 | |||
| 1613 | Ga0070662_100970859 | |||
| 1614 | Ga0070681_10114500 | |||
| 1615 | Ga0070681_10141762 | |||
| 1616 | Ga0070681_10230246 | |||
| 1617 | Ga0070681_10935179 | |||
| 1618 | Ga0068867_100056464 | |||
| 1619 | Ga0068867_100340415 | |||
| 1620 | Ga0068867_100794978 | |||
| 1621 | Ga0070679_100028002 | |||
| 1622 | Ga0070679_100130502 | |||
| 1623 | Ga0070679_100578181 | |||
| 1624 | Ga0070684_100062718 | |||
| 1625 | Ga0070684_100113862 | |||
| 1626 | Ga0070684_100900962 | |||
| 1627 | Ga0070684_101292141 | |||
| 1628 | Ga0070697_100044453 | |||
| 1629 | Ga0070697_100210890 | |||
| 1630 | Ga0070697_100814050 | |||
| 1631 | Ga0068853_100043068 | |||
| 1632 | Ga0068853_100054893 | |||
| 1633 | Ga0068853_100095328 | |||
| 1634 | Ga0068853_100217170 | |||
| 1635 | Ga0068853_100848991 | |||
| 1636 | Ga0070672_100071918 | |||
| 1637 | Ga0070672_100236778 | |||
| 1638 | Ga0070672_100304288 | |||
| 1639 | Ga0070672_100339287 | |||
| 1640 | Ga0070686_100035539 | |||
| 1641 | Ga0070686_100064426 | |||
| 1642 | Ga0070686_100080748 | |||
| 1643 | Ga0070686_100657932 | |||
| 1644 | Ga0070695_100035990 | |||
| 1645 | Ga0070695_100056454 | |||
| 1646 | Ga0070695_100193301 | |||
| 1647 | Ga0070696_100037314 | |||
| 1648 | Ga0070696_100257156 | |||
| 1649 | Ga0070693_100142645 | |||
| 1650 | Ga0070665_100009678 | |||
| 1651 | Ga0070665_100095813 | |||
| 1652 | Ga0070665_100133556 | |||
| 1653 | Ga0070665_100332250 | |||
| 1654 | Ga0070665_100541937 | |||
| 1655 | Ga0070665_100724468 | |||
| 1656 | Ga0070704_100121374 | |||
| 1657 | Ga0070704_100512502 | |||
| 1658 | Ga0068855_100031250 | |||
| 1659 | Ga0068855_100039857 | |||
| 1660 | Ga0068855_100154928 | |||
| 1661 | Ga0068855_100190258 | |||
| 1662 | Ga0068855_100291605 | |||
| 1663 | Ga0068855_100684790 | |||
| 1664 | Ga0068855_101483766 | |||
| 1665 | Ga0070664_100050996 | |||
| 1666 | Ga0070664_100083336 | |||
| 1667 | Ga0070664_100129858 | |||
| 1668 | Ga0070664_100494421 | |||
| 1669 | Ga0070664_101202557 | |||
| 1670 | Ga0068857_100070550 | |||
| 1671 | Ga0068857_100181544 | |||
| 1672 | Ga0068857_100800249 | |||
| 1673 | Ga0068854_100219301 | |||
| 1674 | Ga0068854_100286941 | |||
| 1675 | Ga0068854_100342789 | |||
| 1676 | Ga0068856_100000511 | |||
| 1677 | Ga0068856_100091527 | |||
| 1678 | Ga0068856_100225258 | |||
| 1679 | Ga0068856_100385155 | |||
| 1680 | Ga0068856_100491919 | |||
| 1681 | Ga0068856_100694966 | |||
| 1682 | Ga0068856_100940744 | |||
| 1683 | Ga0070702_100026998 | |||
| 1684 | Ga0070702_100071471 | |||
| 1685 | Ga0070702_100246957 | |||
| 1686 | Ga0070702_100254808 | |||
| 1687 | Ga0068852_100021775 | |||
| 1688 | Ga0068852_100031309 | |||
| 1689 | Ga0068852_100441644 | |||
| 1690 | Ga0068852_100757262 | |||
| 1691 | Ga0068852_101684418 | |||
| 1692 | Ga0068859_100623050 | |||
| 1693 | Ga0068859_100692329 | |||
| 1694 | Ga0068859_101915527 | |||
| 1695 | Ga0068864_100047146 | |||
| 1696 | Ga0068864_100199967 | |||
| 1697 | Ga0068864_100275003 | |||
| 1698 | Ga0068866_10011560 | |||
| 1699 | Ga0068866_10074048 | |||
| 1700 | Ga0068866_10157614 | |||
| 1701 | Ga0068866_10974449 | |||
| 1702 | Ga0068861_100087226 | |||
| 1703 | Ga0068861_100190154 | |||
| 1704 | Ga0068861_100469212 | |||
| 1705 | Ga0068851_10061528 | |||
| 1706 | Ga0068870_10060195 | |||
| 1707 | Ga0068870_10276175 | |||
| 1708 | Ga0068863_100433467 | |||
| 1709 | Ga0068858_100093121 | |||
| 1710 | Ga0068858_100184258 | |||
| 1711 | Ga0068860_100041049 | |||
| 1712 | Ga0068860_100088918 | |||
| 1713 | Ga0068860_100120729 | |||
| 1714 | Ga0068860_100127254 | |||
| 1715 | Ga0068860_100249916 | |||
| 1716 | Ga0068860_100508524 | |||
| 1717 | Ga0068862_100414626 | |||
| 1718 | Ga0068862_100415954 | |||
| 1719 | Ga0068862_101352722 | |||
| 1720 | Ga0081455_10004380 | |||
| 1721 | Ga0081455_10039149 | |||
| 1722 | Ga0081455_10383073 | |||
| 1723 | Ga0081455_10559228 | |||
| 1724 | Ga0081540_1001905 | |||
| 1725 | Ga0081540_1003483 | |||
| 1726 | Ga0081540_1005354 | |||
| 1727 | Ga0081540_1006055 | |||
| 1728 | Ga0081540_1019571 | |||
| 1729 | Ga0081540_1030270 | |||
| 1730 | Ga0081540_1036378 | |||
| 1731 | Ga0081540_1039455 | |||
| 1732 | Ga0081540_1049799 | |||
| 1733 | Ga0081540_1101659 | |||
| 1734 | Ga0081540_1265790 | |||
| 1735 | Ga0081539_10000324 | |||
| 1736 | Ga0081539_10000902 | |||
| 1737 | Ga0081539_10014288 | |||
| 1738 | Ga0081539_10133752 | |||
| 1739 | Ga0081539_10241925 | |||
| 1740 | Ga0070717_10010448 | |||
| 1741 | Ga0070717_10090385 | |||
| 1742 | Ga0070717_10104092 | |||
| 1743 | Ga0075365_10113571 | |||
| 1744 | Ga0075365_10121870 | |||
| 1745 | Ga0075365_10137142 | |||
| 1746 | Ga0075365_10147696 | |||
| 1747 | Ga0075365_10180693 | |||
| 1748 | Ga0075365_10192108 | |||
| 1749 | Ga0075365_10398178 | |||
| 1750 | Ga0075368_10014536 | |||
| 1751 | Ga0075368_10083618 | |||
| 1752 | Ga0075363_100010231 | |||
| 1753 | Ga0075363_100139830 | |||
| 1754 | Ga0075363_100246541 | |||
| 1755 | Ga0075364_10169789 | |||
| 1756 | Ga0075432_10184630 | |||
| 1757 | Ga0070715_10003071 | |||
| 1758 | Ga0070715_10110476 | |||
| 1759 | Ga0070715_10335473 | |||
| 1760 | Ga0070716_100005922 | |||
| 1761 | Ga0070716_100178312 | |||
| 1762 | Ga0070716_100379680 | |||
| 1763 | Ga0070716_100863364 | |||
| 1764 | Ga0070712_100010119 | |||
| 1765 | Ga0070712_100020318 | |||
| 1766 | Ga0070712_100114950 | |||
| 1767 | Ga0070712_100133698 | |||
| 1768 | Ga0070712_100234276 | |||
| 1769 | Ga0075362_10021643 | |||
| 1770 | Ga0075367_10010275 | |||
| 1771 | Ga0075367_10209479 | |||
| 1772 | Ga0075367_10576958 | |||
| 1773 | Ga0075369_10010740 | |||
| 1774 | Ga0075369_10019596 | |||
| 1775 | Ga0075366_10308358 | |||
| 1776 | Ga0075366_10382418 | |||
| 1777 | Ga0097621_100025107 | |||
| 1778 | Ga0097621_100028310 | |||
| 1779 | Ga0097621_100032858 | |||
| 1780 | Ga0097621_100266689 | |||
| 1781 | Ga0097621_100378113 | |||
| 1782 | Ga0097621_100651191 | |||
| 1783 | Ga0097621_100878862 | |||
| 1784 | Ga0097621_101163198 | |||
| 1785 | Ga0097621_101327179 | |||
| 1786 | Ga0075370_10028939 | |||
| 1787 | Ga0068871_100047227 | |||
| 1788 | Ga0068871_100130756 | |||
| 1789 | Ga0068871_100591274 | |||
| 1790 | Ga0068871_100808336 | |||
| 1791 | Ga0068871_101786101 | |||
| 1792 | Ga0075428_100056503 | |||
| 1793 | Ga0075428_100569440 | |||
| 1794 | Ga0075431_100792032 | |||
| 1795 | Ga0075434_100190918 | |||
| 1796 | Ga0068865_100093108 | |||
| 1797 | Ga0068865_100523851 | |||
| 1798 | Ga0075436_100311240 | |||
| 1799 | Ga0097620_100128270 | |||
| 1800 | Ga0097620_100623052 | |||
| 1801 | Ga0097620_100692255 | |||
| 1802 | Ga0097620_101915539 | |||
| 1803 | Ga0099824_1031119 | |||
| 1804 | Ga0099823_1072668 | |||
| 1805 | Ga0075435_100061313 | |||
| 1806 | Ga0099794_10014612 | |||
| 1807 | Ga0099794_10146692 | |||
| 1808 | Ga0099795_10002579 | |||
| 1809 | Ga0099795_10003041 | |||
| 1810 | Ga0105251_10044298 | |||
| 1811 | Ga0105250_10026169 | |||
| 1812 | Ga0105240_10213062 | |||
| 1813 | Ga0105240_10230194 | |||
| 1814 | Ga0105240_10297646 | |||
| 1815 | Ga0105240_10641266 | |||
| 1816 | Ga0111539_10050602 | |||
| 1817 | Ga0111539_10614822 | |||
| 1818 | Ga0105245_10013113 | |||
| 1819 | Ga0105245_10060564 | |||
| 1820 | Ga0105245_10104288 | |||
| 1821 | Ga0105245_10481730 | |||
| 1822 | Ga0105247_10005827 | |||
| 1823 | Ga0105247_10164750 | |||
| 1824 | Ga0114129_10107079 | |||
| 1825 | Ga0105243_10209302 | |||
| 1826 | Ga0105243_10815386 | |||
| 1827 | Ga0105241_10035010 | |||
| 1828 | Ga0105241_10239602 | |||
| 1829 | Ga0105241_10457296 | |||
| 1830 | Ga0105241_10709080 | |||
| 1831 | Ga0105242_10198297 | |||
| 1832 | Ga0105242_10605647 | |||
| 1833 | Ga0105242_10612053 | |||
| 1834 | Ga0105248_10073696 | |||
| 1835 | Ga0105248_10090767 | |||
| 1836 | Ga0105248_10217361 | |||
| 1837 | Ga0105248_10866061 | |||
| 1838 | Ga0105248_10921298 | |||
| 1839 | Ga0105237_10054269 | |||
| 1840 | Ga0105237_10205222 | |||
| 1841 | Ga0105237_10291101 | |||
| 1842 | Ga0105237_11207395 | |||
| 1843 | Ga0105238_10038892 | |||
| 1844 | Ga0105238_10073250 | |||
| 1845 | Ga0105238_10189980 | |||
| 1846 | Ga0105238_10230507 | |||
| 1847 | Ga0105238_11170638 | |||
| 1848 | Ga0105249_10063495 | |||
| 1849 | Ga0105249_10252033 | |||
| 1850 | Ga0105249_10417895 | |||
| 1851 | Ga0123342_1013770 | |||
| 1852 | Ga0099796_10009589 | |||
| 1853 | Ga0099796_10019349 | |||
| 1854 | Ga0099796_10029389 | |||
| 1855 | Ga0099796_10052131 | |||
| 1856 | Ga0105239_10061201 | |||
| 1857 | Ga0105239_10204077 | |||
| 1858 | Ga0105239_10239989 | |||
| 1859 | Ga0105239_10370479 | |||
| 1860 | Ga0105239_10413193 | |||
| 1861 | Ga0105246_10121976 | |||
| 1862 | Ga0105246_10236551 | |||
| 1863 | Ga0157343_1009340 | |||
| 1864 | Ga0157338_1029805 | |||
| 1865 | Ga0157373_10016845 | |||
| 1866 | Ga0157370_10037503 | |||
| 1867 | Ga0157370_10182418 | |||
| 1868 | Ga0157370_10286566 | |||
| 1869 | Ga0157370_10523428 | |||
| 1870 | Ga0157369_10037064 | |||
| 1871 | Ga0157369_10304854 | |||
| 1872 | Ga0157369_10540413 | |||
| 1873 | Ga0157374_10077147 | |||
| 1874 | Ga0157374_10253496 | |||
| 1875 | Ga0157378_10025963 | |||
| 1876 | Ga0157378_10047954 | |||
| 1877 | Ga0157378_10087971 | |||
| 1878 | Ga0157378_10125516 | |||
| 1879 | Ga0157378_10154935 | |||
| 1880 | Ga0157378_10190507 | |||
| 1881 | Ga0157378_10203242 | |||
| 1882 | Ga0157378_10432789 | |||
| 1883 | Ga0163162_10121233 | |||
| 1884 | Ga0163162_10213555 | |||
| 1885 | Ga0163162_10562543 | |||
| 1886 | Ga0163162_10762381 | |||
| 1887 | Ga0163162_12096027 | |||
| 1888 | Ga0157372_10548850 | |||
| 1889 | Ga0157375_10005808 | |||
| 1890 | Ga0157375_10172104 | |||
| 1891 | Ga0157375_10285482 | |||
| 1892 | Ga0157375_10335069 | |||
| 1893 | Ga0157375_10581556 | |||
| 1894 | Ga0163163_10164907 | |||
| 1895 | Ga0163163_11132991 | |||
| 1896 | Ga0157380_10093471 | |||
| 1897 | Ga0157380_10125737 | |||
| 1898 | Ga0157380_10599300 | |||
| 1899 | Ga0157377_10167513 | |||
| 1900 | Ga0157379_10033296 | |||
| 1901 | Ga0157379_10356580 | |||
| 1902 | Ga0157376_10054066 | |||
| 1903 | Ga0157376_10341507 | |||
| 1904 | Ga0157376_10356886 | |||
| 1905 | Ga0157376_10454865 | |||
| 1906 | Ga0157376_11152932 | |||
| 1907 | Ga0163161_10136471 | |||
| 1908 | Ga0163161_10180981 | |||
| 1909 | Ga0163161_10184839 | |||
| 1910 | Ga0163161_10280325 | |||
| 1911 | Ga0163161_11305941 | |||
| 1912 | Ga0197907_10717276 | |||
| 1913 | Ga0206356_11225785 | |||
| 1914 | Ga0206356_11512317 | |||
| 1915 | Ga0206349_1867187 | |||
| 1916 | Ga0206355_1651195 | |||
| 1917 | Ga0206352_10872787 | |||
| 1918 | Ga0206350_11624238 | |||
| 1919 | Ga0214543_1000018 | |||
| 1920 | Ga0213873_10124599 | |||
| 1921 | Ga0213876_10001113 | |||
| 1922 | Ga0224712_10149526 | |||
| 1923 | Ga0224712_10391768 | |||
| 1924 | Ga0207425_1025599 | |||
| 1925 | Ga0209129_1001217 | |||
| 1926 | Ga0209233_1003374 | |||
| 1927 | Ga0209233_1014294 | |||
| 1928 | Ga0209455_1003306 | |||
| 1929 | Ga0209673_1003224 | |||
| 1930 | Ga0209130_1030706 | |||
| 1931 | Ga0209564_1018467 | |||
| 1932 | Ga0209758_1003130 | |||
| 1933 | Ga0209758_1003447 | |||
| 1934 | Ga0209256_1000064 | |||
| 1935 | Ga0209256_1007330 | |||
| 1936 | Ga0209256_1012304 | |||
| 1937 | Ga0209256_1044906 | |||
| 1938 | Ga0207426_1000730 | |||
| 1939 | Ga0207697_10018333 | |||
| 1940 | Ga0207656_10041676 | |||
| 1941 | Ga0207696_1082278 | |||
| 1942 | Ga0207696_1128410 | |||
| 1943 | Ga0207653_10031965 | |||
| 1944 | Ga0207692_10001008 | |||
| 1945 | Ga0207692_10011691 | |||
| 1946 | Ga0207692_10490085 | |||
| 1947 | Ga0207642_10073674 | |||
| 1948 | Ga0207642_10115377 | |||
| 1949 | Ga0207642_10421281 | |||
| 1950 | Ga0207710_10030588 | |||
| 1951 | Ga0207710_10173380 | |||
| 1952 | Ga0207688_10066645 | |||
| 1953 | Ga0207688_10082682 | |||
| 1954 | Ga0207680_10080546 | |||
| 1955 | Ga0207680_10690224 | |||
| 1956 | Ga0207647_10030400 | |||
| 1957 | Ga0207647_10047128 | |||
| 1958 | Ga0207647_10154710 | |||
| 1959 | Ga0207647_10192603 | |||
| 1960 | Ga0207647_10198710 | |||
| 1961 | Ga0207685_10129101 | |||
| 1962 | Ga0207699_10009034 | |||
| 1963 | Ga0207699_10024073 | |||
| 1964 | Ga0207699_10024173 | |||
| 1965 | Ga0207645_10043025 | |||
| 1966 | Ga0207645_10152536 | |||
| 1967 | Ga0207643_10035880 | |||
| 1968 | Ga0207643_10080885 | |||
| 1969 | Ga0207643_10412234 | |||
| 1970 | Ga0207705_10053763 | |||
| 1971 | Ga0207705_10061369 | |||
| 1972 | Ga0207705_10323691 | |||
| 1973 | Ga0207705_10633709 | |||
| 1974 | Ga0207654_10007233 | |||
| 1975 | Ga0207654_10032620 | |||
| 1976 | Ga0207654_10402814 | |||
| 1977 | Ga0207654_10479192 | |||
| 1978 | Ga0207654_10681082 | |||
| 1979 | Ga0207654_10760857 | |||
| 1980 | Ga0207707_10043460 | |||
| 1981 | Ga0207707_10701944 | |||
| 1982 | Ga0207707_10954927 | |||
| 1983 | Ga0207695_10066435 | |||
| 1984 | Ga0207695_10134456 | |||
| 1985 | Ga0207695_10206033 | |||
| 1986 | Ga0207671_10101999 | |||
| 1987 | Ga0207671_10339489 | |||
| 1988 | Ga0207671_10572691 | |||
| 1989 | Ga0207671_10769834 | |||
| 1990 | Ga0207693_10007911 | |||
| 1991 | Ga0207693_10008718 | |||
| 1992 | Ga0207693_10010781 | |||
| 1993 | Ga0207693_10283137 | |||
| 1994 | Ga0207693_10983398 | |||
| 1995 | Ga0207663_10002092 | |||
| 1996 | Ga0207663_10052877 | |||
| 1997 | Ga0207663_10053354 | |||
| 1998 | Ga0207663_10060198 | |||
| 1999 | Ga0207663_10147754 | |||
| 2000 | Ga0207660_10217797 | |||
| 2001 | Ga0207660_10306467 | |||
| 2002 | Ga0207660_10495932 | |||
| 2003 | Ga0207662_10689453 | |||
| 2004 | Ga0207657_10001022 | |||
| 2005 | Ga0207657_10011801 | |||
| 2006 | Ga0207657_10046837 | |||
| 2007 | Ga0207657_10120971 | |||
| 2008 | Ga0207657_10547049 | |||
| 2009 | Ga0207649_10106212 | |||
| 2010 | Ga0207649_10176396 | |||
| 2011 | Ga0207649_11130642 | |||
| 2012 | Ga0207652_10013063 | |||
| 2013 | Ga0207652_10093561 | |||
| 2014 | Ga0207652_10093584 | |||
| 2015 | Ga0207652_10497990 | |||
| 2016 | Ga0207652_11037811 | |||
| 2017 | Ga0207646_10204739 | |||
| 2018 | Ga0207681_10536245 | |||
| 2019 | Ga0207694_10112809 | |||
| 2020 | Ga0207694_10221598 | |||
| 2021 | Ga0207694_10251395 | |||
| 2022 | Ga0207694_10363443 | |||
| 2023 | Ga0207694_10372990 | |||
| 2024 | Ga0207694_10416070 | |||
| 2025 | Ga0207659_10250296 | |||
| 2026 | Ga0207659_10345439 | |||
| 2027 | Ga0207687_10029474 | |||
| 2028 | Ga0207687_10089648 | |||
| 2029 | Ga0207687_10196740 | |||
| 2030 | Ga0207700_10040777 | |||
| 2031 | Ga0207700_10075769 | |||
| 2032 | Ga0207700_10165490 | |||
| 2033 | Ga0207700_10244283 | |||
| 2034 | Ga0207664_10030922 | |||
| 2035 | Ga0207664_10089899 | |||
| 2036 | Ga0207664_10240282 | |||
| 2037 | Ga0207664_10458954 | |||
| 2038 | Ga0207664_11263070 | |||
| 2039 | Ga0207644_10017156 | |||
| 2040 | Ga0207644_10030007 | |||
| 2041 | Ga0207644_10123738 | |||
| 2042 | Ga0207644_10154893 | |||
| 2043 | Ga0207690_10104376 | |||
| 2044 | Ga0207690_10268928 | |||
| 2045 | Ga0207690_10348698 | |||
| 2046 | Ga0207706_10042611 | |||
| 2047 | Ga0207706_10072164 | |||
| 2048 | Ga0207706_10483724 | |||
| 2049 | Ga0207686_10014926 | |||
| 2050 | Ga0207686_10070179 | |||
| 2051 | Ga0207686_10211002 | |||
| 2052 | Ga0207686_10243172 | |||
| 2053 | Ga0207709_10034935 | |||
| 2054 | Ga0207709_10101353 | |||
| 2055 | Ga0207709_10157926 | |||
| 2056 | Ga0207709_10649112 | |||
| 2057 | Ga0207669_10122502 | |||
| 2058 | Ga0207704_10132223 | |||
| 2059 | Ga0207665_10001678 | |||
| 2060 | Ga0207665_10058436 | |||
| 2061 | Ga0207665_10096824 | |||
| 2062 | Ga0207665_10215874 | |||
| 2063 | Ga0207665_10303947 | |||
| 2064 | Ga0207665_10592844 | |||
| 2065 | Ga0207691_10300312 | |||
| 2066 | Ga0207691_10312448 | |||
| 2067 | Ga0207711_10005566 | |||
| 2068 | Ga0207711_10043522 | |||
| 2069 | Ga0207711_10196700 | |||
| 2070 | Ga0207711_10331608 | |||
| 2071 | Ga0207661_10018101 | |||
| 2072 | Ga0207661_10150545 | |||
| 2073 | Ga0207661_10195327 | |||
| 2074 | Ga0207661_10230170 | |||
| 2075 | Ga0207661_10363330 | |||
| 2076 | Ga0207679_10066116 | |||
| 2077 | Ga0207679_10101592 | |||
| 2078 | Ga0207679_10183146 | |||
| 2079 | Ga0207679_10312704 | |||
| 2080 | Ga0207667_10015870 | |||
| 2081 | Ga0207667_10057464 | |||
| 2082 | Ga0207667_10135083 | |||
| 2083 | Ga0207667_10200431 | |||
| 2084 | Ga0207667_10313716 | |||
| 2085 | Ga0207651_10051125 | |||
| 2086 | Ga0207651_10088931 | |||
| 2087 | Ga0207712_10026523 | |||
| 2088 | Ga0207712_10159976 | |||
| 2089 | Ga0207712_10433400 | |||
| 2090 | Ga0207712_11029293 | |||
| 2091 | Ga0207668_10066056 | |||
| 2092 | Ga0207668_10067714 | |||
| 2093 | Ga0207668_10080850 | |||
| 2094 | Ga0207668_10319617 | |||
| 2095 | Ga0207668_10432764 | |||
| 2096 | Ga0207668_10594954 | |||
| 2097 | Ga0207668_11094188 | |||
| 2098 | Ga0207668_11201423 | |||
| 2099 | Ga0207640_10067562 | |||
| 2100 | Ga0207640_10077098 | |||
| 2101 | Ga0207640_10250693 | |||
| 2102 | Ga0207640_10269574 | |||
| 2103 | Ga0207658_10172540 | |||
| 2104 | Ga0207658_10220275 | |||
| 2105 | Ga0207658_10257447 | |||
| 2106 | Ga0207658_10377550 | |||
| 2107 | Ga0207658_10384733 | |||
| 2108 | Ga0207677_10027403 | |||
| 2109 | Ga0207677_10061810 | |||
| 2110 | Ga0207677_10070132 | |||
| 2111 | Ga0207677_10116123 | |||
| 2112 | Ga0207677_10231946 | |||
| 2113 | Ga0207703_10096502 | |||
| 2114 | Ga0207703_10364946 | |||
| 2115 | Ga0207703_11668145 | |||
| 2116 | Ga0207639_10046989 | |||
| 2117 | Ga0207639_10113884 | |||
| 2118 | Ga0207639_10512155 | |||
| 2119 | Ga0207639_11185318 | |||
| 2120 | Ga0207678_10000721 | |||
| 2121 | Ga0207678_10002923 | |||
| 2122 | Ga0207678_10004603 | |||
| 2123 | Ga0207678_10010843 | |||
| 2124 | Ga0207678_10017537 | |||
| 2125 | Ga0207678_10021928 | |||
| 2126 | Ga0207678_10072348 | |||
| 2127 | Ga0207678_10172855 | |||
| 2128 | Ga0207678_10448051 | |||
| 2129 | Ga0207678_10825177 | |||
| 2130 | Ga0207678_11026891 | |||
| 2131 | Ga0207708_10033205 | |||
| 2132 | Ga0207702_10001649 | |||
| 2133 | Ga0207702_10111628 | |||
| 2134 | Ga0207702_10149948 | |||
| 2135 | Ga0207702_10201326 | |||
| 2136 | Ga0207702_10221719 | |||
| 2137 | Ga0207702_10485764 | |||
| 2138 | Ga0207702_10687848 | |||
| 2139 | Ga0207702_10907976 | |||
| 2140 | Ga0207641_10433758 | |||
| 2141 | Ga0207641_11292139 | |||
| 2142 | Ga0207648_10089012 | |||
| 2143 | Ga0207676_10030660 | |||
| 2144 | Ga0207676_10042572 | |||
| 2145 | Ga0207676_10154959 | |||
| 2146 | Ga0207674_10095474 | |||
| 2147 | Ga0207674_10132400 | |||
| 2148 | Ga0207674_10194765 | |||
| 2149 | Ga0207674_10874802 | |||
| 2150 | Ga0207674_11329364 | |||
| 2151 | Ga0207675_100121432 | |||
| 2152 | Ga0207675_100123678 | |||
| 2153 | Ga0207683_10012932 | |||
| 2154 | Ga0207683_10025571 | |||
| 2155 | Ga0207683_10030143 | |||
| 2156 | Ga0207683_10048432 | |||
| 2157 | Ga0207683_10115215 | |||
| 2158 | Ga0207683_10147200 | |||
| 2159 | Ga0207683_10244256 | |||
| 2160 | Ga0207683_10296334 | |||
| 2161 | Ga0207698_10108343 | |||
| 2162 | Ga0207698_10490690 | |||
| 2163 | Ga0209389_1000212 | |||
| 2164 | Ga0209589_1001280 | |||
| 2165 | Ga0209489_100085 | |||
| 2166 | Ga0209179_1009590 | |||
| 2167 | Ga0209179_1091515 | |||
| 2168 | Ga0209588_1001779 | |||
| 2169 | Ga0209588_1041104 | |||
| 2170 | Ga0209588_1103050 | |||
| 2171 | Ga0209813_10057755 | |||
| 2172 | Ga0209974_10216656 | |||
| 2173 | Ga0207428_10167199 | |||
| 2174 | Ga0268266_10003266 | |||
| 2175 | Ga0268266_10024737 | |||
| 2176 | Ga0268266_10048039 | |||
| 2177 | Ga0268266_10499619 | |||
| 2178 | Ga0268266_10733132 | |||
| 2179 | Ga0268266_10858120 | |||
| 2180 | Ga0268265_10099512 | |||
| 2181 | Ga0268264_10000048 | |||
| 2182 | Ga0268264_10135428 | |||
| 2183 | Ga0268264_10264421 | |||
| 2184 | Ga0268264_10414392 | |||
| 2185 | Ga0268264_10760238 | |||
| 2186 | Ga0265337_1011548 | |||
| 2187 | Ga0265326_10040338 | |||
| 2188 | Ga0265319_1033620 | |||
| 2189 | Ga0265334_10002347 | |||
| 2190 | Ga0265334_10006108 | |||
| 2191 | Ga0265318_10007048 | |||
| 2192 | Ga0265323_10002902 | |||
| 2193 | Ga0265322_10002295 | |||
| 2194 | Ga0265336_10000960 | |||
| 2195 | Ga0307517_10472138 | |||
| 2196 | Ga0307515_10261516 | |||
| 2197 | Ga0265338_10000155 | |||
| 2198 | Ga0265338_10023891 | |||
| 2199 | Ga0265324_10007896 | |||
| 2200 | Ga0307511_10042827 | |||
| 2201 | Ga0307511_10278864 | |||
| 2202 | Ga0265332_10048807 | |||
| 2203 | Ga0265328_10099045 | |||
| 2204 | Ga0265328_10104527 | |||
| 2205 | Ga0265325_10000264 | |||
| 2206 | Ga0265325_10038377 | |||
| 2207 | Ga0265340_10071225 | |||
| 2208 | Ga0265340_10102986 | |||
| 2209 | Ga0265339_10072326 | |||
| 2210 | Ga0265331_10104682 | |||
| 2211 | Ga0307509_10005003 | |||
| 2212 | Ga0307509_10277277 | |||
| 2213 | Ga0307509_10374871 | |||
| 2214 | Ga0307509_10600357 | |||
| 2215 | Ga0307408_100385294 | |||
| 2216 | Ga0307408_100494360 | |||
| 2217 | Ga0265313_10010055 | |||
| 2218 | Ga0307508_10000120 | |||
| 2219 | Ga0307508_10038844 | |||
| 2220 | Ga0307508_10173980 | |||
| 2221 | Ga0265314_10015133 | |||
| 2222 | Ga0265314_10024194 | |||
| 2223 | Ga0265342_10018169 | |||
| 2224 | Ga0307516_10041329 | |||
| 2225 | Ga0307516_10220860 | |||
| 2226 | Ga0307405_10091828 | |||
| 2227 | Ga0307410_10140440 | |||
| 2228 | Ga0307410_11207176 | |||
| 2229 | Ga0307410_11323951 | |||
| 2230 | Ga0307406_10168499 | |||
| 2231 | Ga0307406_10349494 | |||
| 2232 | Ga0307407_10333610 | |||
| 2233 | Ga0307412_10158049 | |||
| 2234 | Ga0307412_10214021 | |||
| 2235 | Ga0307412_10677653 | |||
| 2236 | Ga0307409_100150475 | |||
| 2237 | Ga0307414_10177260 | |||
| 2238 | Ga0307411_10143459 | |||
| 2239 | Ga0307411_10939714 | |||
| 2240 | Ga0307411_11031396 | |||
| 2241 | Ga0307415_100052907 | |||
| 2242 | Ga0307415_100057944 | |||
| 2243 | Ga0307415_100312651 | |||
| 2244 | Ga0307415_100346248 | |||
| 2245 | Ga0307507_10081029 | |||
| 2246 | Ga0307510_10012623 | |||
| 2247 | Ga0307510_10080874 | |||
| 2248 | Ga0307510_10241634 | |||
| 2249 | Ga0315911_1000037 | |||
| 2250 | Ga0373930_0000647 | |||
| 2251 | Ga0373948_0015453 | |||
| 2252 | Ga0373948_0022868 | |||
| 2253 | Ga0373950_0004698 | |||
| 2254 | Ga0373959_0104691 | |||
| 2255 | Ga0373926_0196137 | |||
| 2256 | Ga0373928_0014591 | |||
| 2257 | Ga0373928_0026891 | |||
| 2258 | Ga0373934_0002906 | |||
| 2259 | Ga0373934_0100799 | |||
| 2260 | Ga0373934_0166045 | |||
| 2261 | Ga0373940_0041165 | |||
| 2262 | Ga0373949_0040775 | |||
| 2263 | Ga0373951_0024795 | |||
| 2264 | Ga0373923_0062813 | |||
| 2265 | Ga0373923_0169971 | |||
| 2266 | Ga0373932_0007300 | |||
| 2267 | Ga0373932_0018087 | |||
| 2268 | Ga0373936_0020917 | |||
| 2269 | Ga0373936_0084368 | |||
| 2270 | Ga0373945_0040426 | |||
| 2271 | Ga0373945_0079195 | |||
| 2272 | Ga0373953_0008531 | |||
| 2273 | Ga0373953_0015360 | |||
| 2274 | Ga0373954_0005696 | |||
| 2275 | Ga0373954_0007272 | |||
| 2276 | Ga0373954_0200857 | |||
| 2277 | Ga0373956_0010324 | |||
| 2278 | Ga0373956_0059022 | |||
| 2279 | Ga0373956_0401880 | |||
| 2280 | Ga0373957_0001391 | |||
| 2281 | Ga0373957_0018656 | |||
| 2282 | Ga0373957_0030841 | |||
| 2283 | Ga0373957_0208436 | |||
| 2284 | Ga0373943_0007179 | |||
| 2285 | Ga0373943_0033128 | |||
| 2286 | Ga0373946_0014352 | |||
| 2287 | Ga0373946_0045813 | |||
| 2288 | Ga0373946_0076222 | |||
| 2289 | Ga0373955_0004993 | |||
| 2290 | Ga0373955_0082675 | |||
| 2291 | Ga0373961_0048559 | |||
| 2292 | Ga0373924_0036763 | |||
| 2293 | Ga0373931_0004597 | |||
| 2294 | Ga0373931_0021136 | |||
| 2295 | Ga0373931_0401533 | |||
| 2296 | Ga0373935_0015705 | |||
| 2297 | Ga0373935_0030972 | |||
| 2298 | Ga0373935_0106345 | |||
| 2299 | Ga0373935_0157342 | |||
| 2300 | Ga0373935_0189906 | |||
| 2301 | Ga0373935_0302721 | |||
| 2302 | Ga0373935_0358292 | |||
| 2303 | Ga0373935_0443982 | |||
| 2304 | Ga0373927_0002813 | |||
| 2305 | Ga0373927_0007182 | |||
| 2306 | Ga0373927_0012358 | |||
| 2307 | Ga0373927_0014147 | |||
| 2308 | Ga0373927_0015983 | |||
| 2309 | Ga0373927_0031642 | |||
| 2310 | Ga0373927_0053846 | |||
| 2311 | Ga0373927_0274383 | |||
| 2312 | Ga0373927_0382358 | |||
| 2313 | Ga0373927_0701694 | |||
| 2314 | Ga0373933_0062945 | |||
| 2315 | Ga0373933_0080332 | |||
| 2316 | Ga0373933_0110061 | |||
| 2317 | Ga0373933_0117650 | |||
| 2318 | Ga0373947_0000441 | |||
| 2319 | Ga0373947_0020629 | |||
| 2320 | Ga0373947_0026397 | |||
| 2321 | Ga0373947_0078495 | |||
| 2322 | Ga0373947_0135053 | |||
| 2323 | Ga0373947_0245907 | |||
| 2324 | Ga0373947_0286244 | |||
| 2325 | Ga0373947_0749638 | |||
| 2326 | Ga0373937_0011747 | |||
| 2327 | Ga0373937_0049701 | |||
| 2328 | Ga0373937_0098734 | |||
| 2329 | Ga0373937_0348558 | |||
| 2330 | Ga0373937_0767244 | |||
| 2331 | Ga0373937_1130797 | |||
| 2332 | Ga0373925_0005350 | |||
| 2333 | Ga0373925_0064209 | |||
| 2334 | Ga0373925_0122845 | |||
| 2335 | Ga0373925_0234168 | |||
| 2336 | Ga0373925_0374291 | |||
| 2337 | Ga0395899_0376167 | |||
| 2338 | Ga0395900_0000134 | |||
| 2339 | Ga0395900_0011930 | |||
| 2340 | Ga0395900_0109774 | |||
| 2341 | Ga0395900_0360393 | |||
| 2342 | Ga0395898_0014296 | |||
| 2343 | Ga0395898_0161064 | |||
| 2344 | Ga0395905_0017202 | |||
| 2345 | Ga0395905_0049780 | |||
| 2346 | Ga0395905_0195869 | |||
| 2347 | Ga0395905_0202261 | |||
| 2348 | Ga0395905_1028874 | |||
| 2349 | Ga0436364_1368466 | |||
| 2350 | Ga0395901_0032707 | |||
| 2351 | Ga0395901_0033640 | |||
| 2352 | Ga0395901_0237430 | |||
| 2353 | Ga0395901_0275230 | |||
| 2354 | Ga0395901_0712385 | |||
| 2355 | Ga0436365_0133064 | |||
| 2356 | Ga0436365_0511030 | |||
| 2357 | Ga0436363_0957639 | |||
| 2358 | Ga0436362_0550362 | |||
| 2359 | Ga0439439_0188358 | |||
| 2360 | Ga0451798_0453507 | |||
| 2361 | Ga0451853_0932301 | |||
| 2362 | Ga0439458_0058958 | |||
| 2363 | Ga0466969_0105919 | |||
| 2364 | Ga0466972_0042673 | |||
| 2365 | Ga0466972_0134945 | |||
| 2366 | Ga0466965_0100435 | |||
| 2367 | Ga0466965_0111522 | |||
| 2368 | Ga0466964_0243627 | |||
| 2369 | Ga0466971_0043520 | |||
| 2370 | Ga0466968_0352494 | |||
| 2371 | Ga0466970_0249448 | |||
| 2372 | Ga0466957_0202450 | |||
| 2373 | Ga0466957_0263393 | |||
| 2374 | Ga0466959_0227312 | |||
| 2375 | Ga0466959_0281625 | |||
| 2376 | Ga0451576_2066207 | |||
| 2377 | Ga0466967_0107132 | |||
| 2378 | Ga0466967_0326627 | |||
| 2379 | Ga0466967_1057657 | |||
| 2380 | Ga0495592_0000962 | |||
| 2381 | Ga0495592_0024070 | |||
| 2382 | Ga0495592_0038972 | |||
| 2383 | Ga0495592_0047517 | |||
| 2384 | Ga0495592_0358461 | |||
| 2385 | Ga0495603_0000066 | |||
| 2386 | Ga0495603_0017017 | |||
| 2387 | Ga0495603_0065087 | |||
| 2388 | Ga0495603_0067733 | |||
| 2389 | Ga0495603_0077481 | |||
| 2390 | Ga0495603_0273085 | |||
| 2391 | Ga0495603_0424859 | |||
| 2392 | Ga0495590_0265483 | |||
| 2393 | Ga0495591_085098 | |||
| 2394 | Ga0495629_0000131 | |||
| 2395 | Ga0495629_0000984 | |||
| 2396 | Ga0495629_0010691 | |||
| 2397 | Ga0495629_0063174 | |||
| 2398 | Ga0495629_0171694 | |||
| 2399 | Ga0495629_0257100 | |||
| 2400 | Ga0495638_0080415 | |||
| 2401 | Ga0495638_0288208 | |||
| 2402 | Ga0495638_0357994 | |||
| 2403 | Ga0495641_0004776 | |||
| 2404 | Ga0495641_0050560 | |||
| 2405 | Ga0495641_0113029 | |||
| 2406 | Ga0495651_0001583 | |||
| 2407 | Ga0495651_0011447 | |||
| 2408 | Ga0495651_0021274 | |||
| 2409 | Ga0495651_0267716 | |||
| 2410 | Ga0495651_0441165 | |||
| 2411 | Ga0495653_0017838 | |||
| 2412 | Ga0495653_0054134 | |||
| 2413 | Ga0495653_0105594 | |||
| 2414 | Ga0495653_0106781 | |||
| 2415 | Ga0495650_0037267 | |||
| 2416 | Ga0495580_0001382 | |||
| 2417 | Ga0495580_0017453 | |||
| 2418 | Ga0495582_0000298 | |||
| 2419 | Ga0495582_0084205 | |||
| 2420 | Ga0495582_0107351 | |||
| 2421 | Ga0495582_0611764 | |||
| 2422 | Ga0495605_0213934 | |||
| 2423 | Ga0495639_0010975 | |||
| 2424 | Ga0495639_0031933 | |||
| 2425 | Ga0495639_0049337 | |||
| 2426 | Ga0495639_0098650 | |||
| 2427 | Ga0495639_0212932 | |||
| 2428 | Ga0495662_0000058 | |||
| 2429 | Ga0495662_0020780 | |||
| 2430 | Ga0495662_0161711 | |||
| 2431 | Ga0495662_0203530 | |||
| 2432 | Ga0495664_0001921 | |||
| 2433 | Ga0495664_0013688 | |||
| 2434 | Ga0495664_0090590 | |||
| 2435 | Ga0495664_0383721 | |||
| 2436 | Ga0495664_0416710 | |||
| 2437 | Ga0495664_0563980 | |||
| 2438 | Ga0495584_0189456 | |||
| 2439 | Ga0495585_0005331 | |||
| 2440 | Ga0495585_0086414 | |||
| 2441 | Ga0495585_0110393 | |||
| 2442 | Ga0495594_0000706 | |||
| 2443 | Ga0495596_0319181 | |||
| 2444 | Ga0495607_0038517 | |||
| 2445 | Ga0495607_0122077 | |||
| 2446 | Ga0495583_0084495 | |||
| 2447 | Ga0495606_0000244 | |||
| 2448 | Ga0495606_0366097 | |||
| 2449 | Ga0495608_0003424 | |||
| 2450 | Ga0495608_0004308 | |||
| 2451 | Ga0495608_0005405 | |||
| 2452 | Ga0495610_0125495 | |||
| 2453 | Ga0495616_0197382 | |||
| 2454 | Ga0495618_0068835 | |||
| 2455 | Ga0495618_0086241 | |||
| 2456 | Ga0495618_0104808 | |||
| 2457 | Ga0495618_0178503 | |||
| 2458 | Ga0495618_0255209 | |||
| 2459 | Ga0495628_0003941 | |||
| 2460 | Ga0495628_0033779 | |||
| 2461 | Ga0495628_0881022 | |||
| 2462 | Ga0495630_0001425 | |||
| 2463 | Ga0495630_0186544 | |||
| 2464 | Ga0495631_0212565 | |||
| 2465 | Ga0495637_0286141 | |||
| 2466 | Ga0495644_0004455 | |||
| 2467 | Ga0495648_0128765 | |||
| 2468 | Ga0495663_0134058 | |||
| 2469 | Ga0495666_0307377 | |||
| 2470 | Ga0495652_0008159 | |||
| 2471 | Ga0495652_0047392 | |||
| 2472 | Ga0495652_0123399 | |||
| 2473 | Ga0495665_0000373 | |||
| 2474 | Ga0495640_0001250 | |||
| 2475 | Ga0495640_0022168 | |||
| 2476 | Ga0495640_0027866 | |||
| 2477 | Ga0495640_0087228 | |||
| 2478 | Ga0495640_0318376 | |||
| 2479 | Ga0495586_0009720 | |||
| 2480 | Ga0495586_0045341 | |||
| 2481 | Ga0495586_0266277 | |||
| 2482 | Ga0495587_0006700 | |||
| 2483 | Ga0495587_0012091 | |||
| 2484 | Ga0495587_0290775 | |||
| 2485 | Ga0495598_0056136 | |||
| 2486 | Ga0495621_0031404 | |||
| 2487 | Ga0495645_0006904 | |||
| 2488 | Ga0495645_0019421 | |||
| 2489 | Ga0495622_0007642 | |||
| 2490 | Ga0495622_0018157 | |||
| 2491 | Ga0495622_0038008 | |||
| 2492 | Ga0495622_0092726 | |||
| 2493 | Ga0495633_0020440 | |||
| 2494 | Ga0495667_0004119 | |||
| 2495 | Ga0495667_0005627 | |||
| 2496 | Ga0495667_0020636 | |||
| 2497 | Ga0495667_0301807 | |||
| 2498 | Ga0495656_0004069 | |||
| 2499 | Ga0495656_0014584 | |||
| 2500 | Ga0495656_0024854 | |||
| 2501 | Ga0495656_0097828 | |||
| 2502 | Ga0495634_0000502 | |||
| 2503 | Ga0495634_0196724 | |||
| 2504 | Ga0495634_0205717 | |||
| 2505 | Ga0495634_0339479 | |||
| 2506 | Ga0495611_0024058 | |||
| 2507 | Ga0495611_0046389 | |||
| 2508 | Ga0495635_0026268 | |||
| 2509 | Ga0495635_0027162 | |||
| 2510 | Ga0495635_0088610 | |||
| 2511 | Ga0495635_0226154 | |||
| 2512 | Ga0495635_0257524 | |||
| 2513 | Ga0495635_0588762 | |||
| 2514 | Ga0495659_0113415 | |||
| 2515 | Ga0495659_0131080 | |||
| 2516 | Ga0495661_0037544 | |||
| 2517 | Ga0495588_0033151 | |||
| 2518 | Ga0495588_0367329 | |||
| 2519 | Ga0495657_0005728 | |||
| 2520 | Ga0495657_0009308 | |||
| 2521 | Ga0495657_0014712 | |||
| 2522 | Ga0495657_0043085 | |||
| 2523 | Ga0495657_0049829 | |||
| 2524 | Ga0495657_0073439 | |||
| 2525 | Ga0495599_0001288 | |||
| 2526 | Ga0495599_0007174 | |||
| 2527 | Ga0495599_0056898 | |||
| 2528 | Ga0495599_0088610 | |||
| 2529 | Ga0495599_0139731 | |||
| 2530 | Ga0495623_0000561 | |||
| 2531 | Ga0495623_0010099 | |||
| 2532 | Ga0495623_0033866 | |||
| 2533 | Ga0495623_0148515 | |||
| 2534 | Ga0495646_0022284 | |||
| 2535 | Ga0495646_0031540 | |||
| 2536 | Ga0495646_0056756 | |||
| 2537 | Ga0495647_0003354 | |||
| 2538 | Ga0495647_0021361 | |||
| 2539 | Ga0495647_0051974 | |||
| 2540 | Ga0495647_0058447 | |||
| 2541 | Ga0495647_0170290 | |||
| 2542 | Ga0495658_0000368 | |||
| 2543 | Ga0495658_0026598 | |||
| 2544 | Ga0495658_0365438 | |||
| 2545 | Ga0495669_0013841 | |||
| 2546 | Ga0495669_0033841 | |||
| 2547 | Ga0495613_0014196 | |||
| 2548 | Ga0495613_0027749 | |||
| 2549 | Ga0495613_0071390 | |||
| 2550 | Ga0495613_0073462 | |||
| 2551 | Ga0495613_0365715 | |||
| 2552 | Ga0495613_0377767 | |||
| 2553 | Ga0495613_0382676 | |||
| 2554 | Ga0495624_0008081 | |||
| 2555 | Ga0495624_0163514 | |||
| 2556 | Ga0495624_0328704 | |||
| 2557 | Ga0495670_0029218 | |||
| 2558 | Ga0495671_0179382 | |||
| 2559 | Ga0495600_0011917 | |||
| 2560 | Ga0495600_0023752 | |||
| 2561 | Ga0495600_0076875 | |||
| 2562 | Ga0495600_0102678 | |||
| 2563 | Ga0495600_0185265 | |||
| 2564 | Ga0495600_0271510 | |||
| 2565 | Ga0495600_0360413 | |||
| 2566 | Ga0495600_0408156 | |||
| 2567 | Ga0495600_0479097 | |||
| 2568 | Ga0495581_0000111 | |||
| 2569 | Ga0495581_0104762 | |||
| 2570 | Ga0495581_0114739 | |||
| 2571 | Ga0495581_0215942 | |||
| 2572 | Ga0495581_0454754 | |||
| 2573 | Ga0495581_0455455 | |||
| 2574 | Ga0495581_0613048 | |||
| 2575 | Ga0495604_0002451 | |||
| 2576 | Ga0495604_0010885 | |||
| 2577 | Ga0495604_0045227 | |||
| 2578 | Ga0495604_0080611 | |||
| 2579 | Ga0495604_0145039 | |||
| 2580 | Ga0495604_0147574 | |||
| 2581 | Ga0495604_0272889 | |||
| 2582 | Ga0495674_0004341 | |||
| 2583 | Ga0495674_0015128 | |||
| 2584 | Ga0495674_0030334 | |||
| 2585 | Ga0495674_0077544 | |||
| 2586 | Ga0495674_0120988 | |||
| 2587 | Ga0495674_0136513 | |||
| 2588 | Ga0495674_0170662 | |||
| 2589 | Ga0495674_0490191 | |||
| 2590 | Ga0495672_0015836 | |||
| 2591 | Ga0495676_0079737 | |||
| 2592 | Ga0495680_0004114 | |||
| 2593 | Ga0495680_0039523 | |||
| 2594 | Ga0495680_0044193 | |||
| 2595 | Ga0495680_0052359 | |||
| 2596 | Ga0495680_0071985 | |||
| 2597 | Ga0495680_0086764 | |||
| 2598 | Ga0495680_0117653 | |||
| 2599 | Ga0495680_0839839 | |||
| 2600 | Ga0495683_0190593 | |||
| 2601 | Ga0495683_0218220 | |||
| 2602 | Ga0495675_0004565 | |||
| 2603 | Ga0495675_0050347 | |||
| 2604 | Ga0495675_0055058 | |||
| 2605 | Ga0495675_0152464 | |||
| 2606 | Ga0495677_0105993 | |||
| 2607 | Ga0495677_0164397 | |||
| 2608 | Ga0495679_025907 | |||
| 2609 | Ga0495685_023471 | |||
| 2610 | Ga0495673_0266038 | |||
| 2611 | Ga0495684_0025696 | |||
| 2612 | Ga0495684_0088322 | |||
| 2613 | Ga0495684_0101123 | |||
| 2614 | Ga0495684_0106142 | |||
| 2615 | Ga0495684_0205519 | |||
| 2616 | Ga0495686_0059342 | |||
| 2617 | Ga0495686_0365850 | |||
| 2618 | Ga0495593_0000210 | |||
| 2619 | Ga0495593_0001699 | |||
| 2620 | Ga0495593_0018230 | |||
| 2621 | Ga0495593_0077811 | |||
| 2622 | Ga0495593_0240855 | |||
| 2623 | Ga0495602_0007289 | |||
| 2624 | Ga0495602_0023526 | |||
| 2625 | Ga0495602_0085736 | |||
| 2626 | Ga0495602_0169545 | |||
| 2627 | Ga0495602_0834180 | |||
| 2628 | Ga0495615_0007972 | |||
| 2629 | Ga0496100_0013868 | |||
| 2630 | Ga0496100_0031298 | |||
| 2631 | Ga0496100_0039813 | |||
| 2632 | Ga0496100_0272099 | |||
| 2633 | Ga0496100_0274677 | |||
| 2634 | Ga0496101_0010824 | |||
| 2635 | Ga0496101_0021299 | |||
| 2636 | Ga0496101_0048045 | |||
| 2637 | Ga0496101_0231465 | |||
| 2638 | Ga0496101_0540858 | |||
| 2639 | Ga0496101_0601859 | |||
| 2640 | Ga0496102_0003826 | |||
| 2641 | Ga0496102_0014510 | |||
| 2642 | Ga0496102_0036014 | |||
| 2643 | Ga0496102_0053738 | |||
| 2644 | Ga0496102_0084735 | |||
| 2645 | Ga0496102_0095808 | |||
| 2646 | Ga0496102_0165557 | |||
| 2647 | Ga0496102_0212492 | |||
| 2648 | Ga0496102_0560670 | |||
| 2649 | Ga0496102_0949495 | |||
| 2650 | Ga0496103_0027030 | |||
| 2651 | Ga0496103_0031918 | |||
| 2652 | Ga0496103_0047160 | |||
| 2653 | Ga0496103_0082735 | |||
| 2654 | Ga0496103_0222421 | |||
| 2655 | Ga0496103_0355607 | |||
| 2656 | Ga0496103_0407292 | |||
| 2657 | Ga0496104_0000092 | |||
| 2658 | Ga0496104_0029318 | |||
| 2659 | Ga0496104_0054677 | |||
| 2660 | Ga0496104_0083527 | |||
| 2661 | Ga0496104_0258891 | |||
| 2662 | Ga0496105_0010163 | |||
| 2663 | Ga0496105_0014761 | |||
| 2664 | Ga0496105_0115766 | |||
| 2665 | Ga0496105_0149675 | |||
| 2666 | Ga0496105_0328900 | |||
| 2667 | Ga0496105_0349912 | |||
| 2668 | Ga0496106_0018269 | |||
| 2669 | Ga0496106_0026335 | |||
| 2670 | Ga0496106_0043409 | |||
| 2671 | Ga0496106_0093077 | |||
| 2672 | Ga0496106_0116123 | |||
| 2673 | Ga0496106_0187436 | |||
| 2674 | Ga0496106_0380089 | |||
| 2675 | Ga0496106_0777378 | |||
| 2676 | Ga0496107_0000413 | |||
| 2677 | Ga0496107_0005993 | |||
| 2678 | Ga0496107_0027280 | |||
| 2679 | Ga0496107_0098442 | |||
| 2680 | Ga0496107_0556556 | |||
| 2681 | Ga0496107_0737727 | |||
| 2682 | Ga0496107_1127447 | |||
| 2683 | Ga0496108_0072631 | |||
| 2684 | Ga0496108_0131555 | |||
| 2685 | Ga0496108_0170603 | |||
| 2686 | Ga0496108_0318675 | |||
| 2687 | Ga0496108_0479037 | |||
| 2688 | Ga0496108_0913918 | |||
| 2689 | Ga0496109_0041987 | |||
| 2690 | Ga0496109_0056255 | |||
| 2691 | Ga0496109_0064124 | |||
| 2692 | Ga0496109_0136268 | |||
| 2693 | Ga0496109_0313116 | |||
| 2694 | Ga0496109_0572210 | |||
| 2695 | Ga0496110_0008222 | |||
| 2696 | Ga0496110_0124245 | |||
| 2697 | Ga0496110_0271367 | |||
| 2698 | Ga0496110_0589019 | |||
| 2699 | Ga0496110_0700571 | |||
| 2700 | Ga0496110_0826296 | |||
| 2701 | Ga0496111_0204487 | |||
| 2702 | Ga0496111_0426690 | |||
| 2703 | Ga0496111_0515014 | |||
| 2704 | Ga0496111_0631176 | |||
| 2705 | Ga0496112_0000019 | |||
| 2706 | Ga0496112_0033962 | |||
| 2707 | Ga0496112_0035449 | |||
| 2708 | Ga0496112_0091791 | |||
| 2709 | Ga0496112_0115995 | |||
| 2710 | Ga0496112_0121752 | |||
| 2711 | Ga0496112_0135932 | |||
| 2712 | Ga0496112_0425994 | |||
| 2713 | Ga0496112_0888932 | |||
| 2714 | Ga0496112_0951924 | |||
| 2715 | Ga0496113_0006958 | |||
| 2716 | Ga0496113_0082214 | |||
| 2717 | Ga0496113_0118841 | |||
| 2718 | Ga0496113_0134271 | |||
| 2719 | Ga0496113_0288685 | |||
| 2720 | Ga0496113_1062826 | |||
| 2721 | Ga0496114_0020155 | |||
| 2722 | Ga0496114_0029656 | |||
| 2723 | Ga0496114_0118237 | |||
| 2724 | Ga0496114_0189966 | |||
| 2725 | Ga0496114_0367457 | |||
| 2726 | Ga0496115_0005968 | |||
| 2727 | Ga0496115_0041613 | |||
| 2728 | Ga0496115_0068457 | |||
| 2729 | Ga0496115_0088634 | |||
| 2730 | Ga0496115_0122044 | |||
| 2731 | Ga0496115_0340906 | |||
| 2732 | Ga0496115_0591285 | |||
| 2733 | Ga0496116_0235858 | |||
| 2734 | Ga0496118_0001892 | |||
| 2735 | Ga0496118_0142679 | |||
| 2736 | Ga0496119_0031735 | |||
| 2737 | Ga0496119_0119999 | |||
| 2738 | Ga0496120_0013537 | |||
| 2739 | Ga0496121_0000041 | |||
| 2740 | Ga0496121_0033571 | |||
| 2741 | Ga0496121_0044283 | |||
| 2742 | Ga0496121_0067477 | |||
| 2743 | Ga0496121_0105901 | |||
| 2744 | Ga0496121_0224299 | |||
| 2745 | Ga0496121_0229998 | |||
| 2746 | Ga0496121_0297335 | |||
| 2747 | Ga0496124_0001646 | |||
| 2748 | Ga0496124_0124699 | |||
| 2749 | Ga0496124_0297680 | |||
| 2750 | Ga0496125_0033775 | |||
| 2751 | Ga0496125_0290992 | |||
| 2752 | Ga0496125_0353060 | |||
| 2753 | Ga0496126_0002010 | |||
| 2754 | Ga0496126_0007412 | |||
| 2755 | Ga0496126_0010298 | |||
| 2756 | Ga0496126_0113225 | |||
| 2757 | Ga0496126_0150115 | |||
| 2758 | Ga0496126_0191731 | |||
| 2759 | Ga0496126_0717694 | |||
| 2760 | Ga0495678_046165 | |||
| 2761 | Ga0495682_0090779 | |||
| 2762 | Ga0501031_0029819 | |||
| 2763 | Ga0501032_0103321 | |||
| 2764 | Ga0501032_0407103 | |||
| 2765 | Ga0501033_0009836 | |||
| 2766 | Ga0501033_0027573 | |||
| 2767 | Ga0501033_0117230 | |||
| 2768 | Ga0501034_0000676 | |||
| 2769 | Ga0501034_0044391 | |||
| 2770 | Ga0501034_0074265 | |||
| 2771 | Ga0501034_0100985 | |||
| 2772 | Ga0501034_0401934 | |||
| 2773 | Ga0501036_0000390 | |||
| 2774 | Ga0501036_0053603 | |||
| 2775 | Ga0501036_0282978 | |||
| 2776 | Ga0501037_0000755 | |||
| 2777 | Ga0501037_0019397 | |||
| 2778 | Ga0501037_0182774 | |||
| 2779 | Ga0501038_0000089 | |||
| 2780 | Ga0501038_0107188 | |||
| 2781 | Ga0501038_0515883 | |||
| 2782 | Ga0501039_0000114 | |||
| 2783 | Ga0501039_0077389 | |||
| 2784 | Ga0501043_0001086 | |||
| 2785 | Ga0501043_0058521 | |||
| 2786 | Ga0501043_0089204 | |||
| 2787 | Ga0501043_0368843 | |||
| 2788 | Ga0501046_0006291 | |||
| 2789 | Ga0501046_0135722 | |||
| 2790 | Ga0501046_0182257 | |||
| 2791 | Ga0501047_0000594 | |||
| 2792 | Ga0501047_0061423 | |||
| 2793 | Ga0501047_0094399 | |||
| 2794 | Ga0501047_0285178 | |||
| 2795 | Ga0501047_0658280 | |||
| 2796 | Ga0501047_0701637 | |||
| 2797 | Ga0501048_0015151 | |||
| 2798 | Ga0501048_0040990 | |||
| 2799 | Ga0501067_0000445 | |||
| 2800 | Ga0501067_0239075 | |||
| 2801 | Ga0501068_0004210 | |||
| 2802 | Ga0501069_0037736 | |||
| 2803 | Ga0501069_0126786 | |||
| 2804 | Ga0501069_0262932 | |||
| 2805 | Ga0501070_0017778 | |||
| 2806 | Ga0501070_0318087 | |||
| 2807 | Ga0501070_0509375 | |||
| 2808 | Ga0501071_0516444 | |||
| 2809 | Ga0501072_0029426 | |||
| 2810 | Ga0501072_0469243 | |||
| 2811 | Ga0501073_0000055 | |||
| 2812 | Ga0501073_0295890 | |||
| 2813 | Ga0501073_0496654 | |||
| 2814 | Ga0501074_0000492 | |||
| 2815 | Ga0501076_0049686 | |||
| 2816 | Ga0501079_0355125 | |||
| 2817 | Ga0501079_0888412 | |||
| 2818 | Ga0501080_0008079 | |||
| 2819 | Ga0501080_0551719 | |||
| 2820 | Ga0501081_0184085 | |||
| 2821 | Ga0501083_0000570 | |||
| 2822 | Ga0501268_007552 | |||
| 2823 | Ga0501270_035015 | |||
| 2824 | Ga0501035_0000150 | |||
| 2825 | Ga0501035_0015014 | |||
| 2826 | Ga0501035_0041388 | |||
| 2827 | Ga0501044_0000546 | |||
| 2828 | Ga0501044_0133658 | |||
| 2829 | Ga0501045_0004352 | |||
| 2830 | nmdc:mga03683_14262_c1 | |||
| 2831 | nmdc:mga03683_228854_c1 | |||
| 2832 | nmdc:mga03n38_228283_c1 | |||
| 2833 | nmdc:mga03n38_352282_c1 | |||
| 2834 | nmdc:mga03n38_396_c1 | |||
| 2835 | nmdc:mga03n38_57464_c1 | |||
| 2836 | nmdc:mga00v17_314999_c1 | |||
| 2837 | nmdc:mga00v17_74792_c1 | |||
| 2838 | nmdc:mga0yw44_188114_c1 | |||
| 2839 | nmdc:mga0yw44_399816_c1 | |||
| 2840 | nmdc:mga0yw44_42855_c1 | |||
| 2841 | nmdc:mga0k408_155771_c1 | |||
| 2842 | nmdc:mga0k408_445384_c1 | |||
| 2843 | nmdc:mga06z11_303802_c1 | |||
| 2844 | nmdc:mga06z11_413112_c1 | |||
| 2845 | nmdc:mga06z11_43911_c1 | |||
| 2846 | nmdc:mga06z11_46886_c1 | |||
| 2847 | nmdc:mga04h51_191527_c1 | |||
| 2848 | nmdc:mga04h51_352799_c1 | |||
| 2849 | nmdc:mga04h51_59698_c1 | |||
| 2850 | nmdc:mga07m45_285396_c1 | |||
| 2851 | nmdc:mga07m45_70970_c1 | |||
| 2852 | nmdc:mga07m45_7432_c2 | |||
| 2853 | nmdc:mga09592_229993_c1 | |||
| 2854 | nmdc:mga08y16_196474_c1 | |||
| 2855 | nmdc:mga08y16_624774_c1 | |||
| 2856 | nmdc:mga08y16_822569_c1 | |||
| 2857 | nmdc:mga0n895_405792_c1 | |||
| 2858 | nmdc:mga0rr50_18584_c1 | |||
| 2859 | nmdc:mga0rr50_230449_c1 | |||
| 2860 | nmdc:mga0rr50_28264_c1 | |||
| 2861 | nmdc:mga0rr50_493683_c1 | |||
| 2862 | nmdc:mga08x19_168362_c1 | |||
| 2863 | nmdc:mga08x19_37303_c1 | |||
| 2864 | Ga0495601_0005470 | |||
| 2865 | Ga0495601_0006095 | |||
| 2866 | Ga0495601_0009462 | |||
| 2867 | Ga0495601_0044953 | |||
| 2868 | Ga0495601_0055833 | |||
| 2869 | Ga0495612_0004289 | |||
| 2870 | Ga0495612_0004506 | |||
| 2871 | Ga0495612_0121780 | |||
| 2872 | Ga0495612_0229798 | |||
| 2873 | Ga0500635_0006552 | |||
| 2874 | Ga0500635_0011829 | |||
| 2875 | Ga0495595_0003866 | |||
| 2876 | Ga0495595_0010491 | |||
| 2877 | Ga0495595_0039038 | |||
| 2878 | Ga0495595_0152050 | |||
| 2879 | Ga0495595_0326670 | |||
| 2880 | Ga0495619_0001147 | |||
| 2881 | Ga0495619_0006353 | |||
| 2882 | Ga0495619_0007969 | |||
| 2883 | Ga0495619_0104451 | |||
| 2884 | Ga0495619_0191657 | |||
| 2885 | Ga0495619_0206941 | |||
| 2886 | Ga0495619_0567861 | |||
| 2887 | Ga0495619_0658832 | |||
| 2888 | Ga0500578_0228085 | |||
| 2889 | Ga0500581_121507 | |||
| 2890 | Ga0500647_0118789 | |||
| 2891 | Ga0500583_0161163 | |||
| 2892 | Ga0500651_0191125 | |||
| 2893 | Ga0500651_0230419 | |||
| 2894 | Ga0500566_0000047 | |||
| 2895 | Ga0500566_0127826 | |||
| 2896 | Ga0500640_005664 | |||
| 2897 | Ga0500641_0048999 | |||
| 2898 | Ga0500648_089452 | |||
| 2899 | Ga0500554_001109 | |||
| 2900 | Ga0500554_002996 | |||
| 2901 | Ga0500555_028745 | |||
| 2902 | Ga0500569_063636 | |||
| 2903 | Ga0500572_000071 | |||
| 2904 | Ga0500593_059848 | |||
| 2905 | Ga0500594_0070853 | |||
| 2906 | Ga0500595_001904 | |||
| 2907 | Ga0500595_024231 | |||
| 2908 | Ga0500595_031318 | |||
| 2909 | Ga0500608_007594 | |||
| 2910 | Ga0500559_0002362 | |||
| 2911 | Ga0500559_0075491 | |||
| 2912 | Ga0500559_0096906 | |||
| 2913 | Ga0500568_0081443 | |||
| 2914 | Ga0500568_0085017 | |||
| 2915 | Ga0500573_0119855 | |||
| 2916 | Ga0500603_000727 | |||
| 2917 | Ga0500603_014206 | |||
| 2918 | Ga0500603_037659 | |||
| 2919 | Ga0500622_0111185 | |||
| 2920 | Ga0500627_0080484 | |||
| 2921 | Ga0500627_0362645 | |||
| 2922 | Ga0500638_066884 | |||
| 2923 | Ga0500638_096934 | |||
| 2924 | Ga0500638_118331 | |||
| 2925 | Ga0500639_000087 | |||
| 2926 | Ga0500639_242849 | |||
| 2927 | Ga0500636_0005004 | |||
| 2928 | Ga0500636_0028275 | |||
| 2929 | Ga0500636_0083515 | |||
| 2930 | Ga0500637_0000075 | |||
| 2931 | Ga0500637_0009481 | |||
| 2932 | Ga0500637_0142017 | |||
| 2933 | Ga0500609_040507 | |||
| 2934 | Ga0500596_000317 | |||
| 2935 | Ga0500596_000832 | |||
| 2936 | Ga0501084_0001259 | |||
| 2937 | Ga0587073_0066800 | |||
| 2938 | Ga0466962_0069810 | |||
| 2939 | 2513719099 | |||
| 2940 | 2818236969 | |||
| 2941 | 2847937924 | |||
| 2942 | 2881673577 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7s5k-assembly1.cif.gz_F | m. xanthus ferritin-like protein encb | 0.9088 | 116 | 173 |
| 7s5c-assembly1.cif.gz_G | m. xanthus ferritin-like protein encb | 0.9039 | 116 | 173 |
| 1mft-assembly1.cif.gz_B | crystal structure of four-helix bundle model | 0.9032 | 119 | 166 |
| 7s5c-assembly1.cif.gz_I | m. xanthus ferritin-like protein encb | 0.9016 | 116 | 173 |
| 5ffe-assembly2.cif.gz_B | copm in the ag-bound form (by soaking) | 0.8565 | 24 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5fejD00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8448 | 28 | 171 | 1.20.1260.10 |
| 5ffcB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8435 | 27 | 171 | 1.20.1260.10 |
| 3mq1E01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8222 | 113 | 172 | 1.20.58.970 |
| 5ffcB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.821 | 27 | 171 | 1.20.1260.10 |
| 5fejA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8189 | 28 | 171 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2WPE8-F1-model_v4 | DUF4142 domain-containing protein | 0.955 | 23 | 172 |
|
| AF-A0A371K7C3-F1-model_v4 | DUF4142 domain-containing protein | 0.9533 | 28 | 171 |
|
| AF-A0A1A6Y1E2-F1-model_v4 | DUF4142 domain-containing protein | 0.9527 | 28 | 172 |
|
| AF-A0A2C9A4E8-F1-model_v4 | deleted | 0.9514 | 32 | 172 |
|
| AF-A0A2E5BPK4-F1-model_v4 | DUF4142 domain-containing protein | 0.9511 | 23 | 172 |
|