F494214

General Info

Members Datasets Scaffolds Average Seq Length
1471 525 2942 175

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0472353|Ga0496115_0472353_247_798
Length 183
Sequence MAKNPAPQECQTMFVRLSAAIAAVSLLSSAALAQGAKPTDPQIAHIAYTAGVIDIAAAKQALTKTSNKDVKSFAEDMVRDHEAVNKQALDLVKKVTPEDNDTSRTLSKNAAEKLAELGKLKGAEFDKAYVANEVAYHKAVDSALETSLIPSANNAELKGLLQTGLKIFQGHEQHAEHVAAGLK

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
110 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
129 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
133 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
152 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
155 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
233 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
234 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
244 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
245 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
246 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
247 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
248 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
249 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
250 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
255 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
260 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
265 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
266 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
267 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
268 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
272 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
273 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
274 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
279 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
280 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
281 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
282 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
283 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
284 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
288 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
289 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
290 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
291 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
293 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
295 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
296 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
297 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
298 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
303 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
304 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
305 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
306 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
307 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
315 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
320 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
321 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
322 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
323 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
326 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
327 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
328 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
329 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
330 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
341 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
342 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
343 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
352 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
369 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
370 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
371 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
372 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
373 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
374 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
375 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
376 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
377 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
378 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
379 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
380 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
381 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
382 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
383 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
384 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
385 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
386 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
387 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
388 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
389 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
390 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
391 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
392 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
395 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
396 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
397 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
401 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
408 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
409 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
410 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
411 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
412 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
413 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
414 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
415 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
416 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
419 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
420 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
421 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
422 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
423 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
424 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
425 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
426 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
429 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
430 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
431 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
432 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
433 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
434 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
435 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
436 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
437 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
438 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
439 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
440 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
441 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
442 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
456 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
457 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
458 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
459 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
463 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
464 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
465 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
466 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
467 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
468 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
469 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
472 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
473 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
474 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
475 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
476 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
477 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
478 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
479 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
480 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
481 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
482 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
483 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
484 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
485 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
486 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
487 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
488 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
491 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
492 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
493 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
494 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
495 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
496 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
497 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
498 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
499 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
500 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
501 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
502 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
503 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
504 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
505 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
506 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
507 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
508 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
509 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
510 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
511 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
512 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
513 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
514 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
515 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
516 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
517 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
518 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
522 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
523 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
524 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
525 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.02
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.02
Nodule 0.68
Rhizoplane 7.21
Rhizosphere 80.49
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0472353 3300048918 Bacteria 1011
2 LJQas_1005980 3300000549 Bacteria 1525
3 JGI24743J22301_10028486 3300001991 Bacteria 1093
4 JGI24743J22301_10103649 3300001991 Bacteria 614
5 JGI24750J21931_1012237 3300002070 Bacteria 1135
6 JGI24742J22300_10013387 3300002244 Bacteria 1372
7 JGI25152J39213_1000745 3300002773 Bacteria 16620
8 Ga0006759J45824_1037742 3300003163 Unclassified 591
9 JGI25151J46595_10106669 3300003187 Bacteria 741
10 JGI25406J46586_10000059 3300003203 Bacteria 50077
11 JGI25406J46586_10007521 3300003203 Bacteria 4964
12 JGI25406J46586_10143509 3300003203 Bacteria 698
13 JGI25153J46596_10011069 3300003215 Bacteria 4018
14 JGI25153J46596_10037544 3300003215 Bacteria 1538
15 rootL2_10093812 3300003322 Bacteria 1234
16 JGI25160J50197_1054415 3300003354 Bacteria 830
17 Ga0007410J51695_1030993 3300003574 Unclassified 672
18 Ga0007409J51694_1027806 3300003575 Unclassified 735
19 Ga0007416J51690_1028980 3300003577 Unclassified 655
20 JGI25404J52841_10003695 3300003659 Bacteria 3044
21 JGI25404J52841_10030787 3300003659 Bacteria 1148
22 JGI25404J52841_10031173 3300003659 Bacteria 1140
23 Ga0032354_1044282 3300003693 Unclassified 590
24 Ga0055524_1003255 3300003775 Bacteria 7954
25 Ga0055528_1008764 3300003790 Bacteria 4285
26 Ga0070658_10083389 3300005327 Bacteria 2627
27 Ga0070658_10817691 3300005327 Bacteria 810
28 Ga0070683_100051065 3300005329 Bacteria 3829
29 Ga0070683_100080636 3300005329 Bacteria 3046
30 Ga0070683_100151700 3300005329 Bacteria 2197
31 Ga0070683_100386092 3300005329 Bacteria 1334
32 Ga0070690_100152935 3300005330 Bacteria 1576
33 Ga0070670_100132673 3300005331 Bacteria 2151
34 Ga0070670_100407803 3300005331 Bacteria 1200
35 Ga0068869_100012858 3300005334 Bacteria 5541
36 Ga0068869_100099243 3300005334 Bacteria 2200
37 Ga0070666_10713675 3300005335 Bacteria 736
38 Ga0070666_10753730 3300005335 Bacteria 716
39 Ga0070680_100080487 3300005336 Bacteria 2686
40 Ga0070680_100104534 3300005336 Bacteria 2353
41 Ga0070682_100008826 3300005337 Bacteria 5691
42 Ga0070682_100152588 3300005337 Bacteria 1587
43 Ga0068868_100084787 3300005338 Bacteria 2545
44 Ga0068868_100176070 3300005338 Bacteria 1773
45 Ga0068868_100634513 3300005338 Bacteria 950
46 Ga0068868_101067796 3300005338 Bacteria 741
47 Ga0070660_100035398 3300005339 Bacteria 3779
48 Ga0070660_100054026 3300005339 Bacteria 3100
49 Ga0070660_100097370 3300005339 Bacteria 2327
50 Ga0070660_100401839 3300005339 Bacteria 1133
51 Ga0070691_10120903 3300005341 Bacteria 1319
52 Ga0070691_10247457 3300005341 Bacteria 955
53 Ga0070691_10302377 3300005341 Unclassified 874
54 Ga0070687_100061792 3300005343 Bacteria 1981
55 Ga0070661_100198876 3300005344 Bacteria 1531
56 Ga0070661_100378467 3300005344 Bacteria 1115
57 Ga0070661_100472106 3300005344 Bacteria 1001
58 Ga0070692_10073551 3300005345 Bacteria 1826
59 Ga0070668_100031715 3300005347 Bacteria 4021
60 Ga0070668_100040421 3300005347 Bacteria 3568
61 Ga0070668_100157364 3300005347 Bacteria 1841
62 Ga0070668_100204541 3300005347 Bacteria 1622
63 Ga0070668_100561624 3300005347 Bacteria 994
64 Ga0070668_100571551 3300005347 Bacteria 986
65 Ga0070668_101086858 3300005347 Bacteria 721
66 Ga0070669_100266004 3300005353 Bacteria 1370
67 Ga0070669_100370418 3300005353 Bacteria 1166
68 Ga0070675_100079587 3300005354 Bacteria 2731
69 Ga0070675_100103521 3300005354 Bacteria 2400
70 Ga0070675_100294812 3300005354 Bacteria 1428
71 Ga0070675_100615351 3300005354 Bacteria 986
72 Ga0070671_100026694 3300005355 Bacteria 4749
73 Ga0070671_100175359 3300005355 Bacteria 1814
74 Ga0070671_100417025 3300005355 Bacteria 1150
75 Ga0070671_100603694 3300005355 Bacteria 948
76 Ga0070674_100092759 3300005356 Bacteria 2183
77 Ga0070674_100289346 3300005356 Bacteria 1302
78 Ga0070674_100461795 3300005356 Bacteria 1050
79 Ga0070673_100093160 3300005364 Bacteria 2467
80 Ga0070673_100210846 3300005364 Bacteria 1677
81 Ga0070673_100450096 3300005364 Bacteria 1158
82 Ga0070659_100050323 3300005366 Bacteria 3275
83 Ga0070659_100055590 3300005366 Bacteria 3120
84 Ga0070659_100189730 3300005366 Bacteria 1689
85 Ga0070667_100123818 3300005367 Bacteria 2251
86 Ga0070667_100410461 3300005367 Bacteria 1234
87 Ga0070667_100432849 3300005367 Bacteria 1200
88 Ga0070667_100561577 3300005367 Bacteria 1050
89 Ga0070667_100595088 3300005367 Bacteria 1019
90 Ga0070709_10002549 3300005434 Bacteria 9850
91 Ga0070709_10216301 3300005434 Bacteria 1364
92 Ga0070709_10296213 3300005434 Bacteria 1180
93 Ga0070709_10737949 3300005434 Bacteria 769
94 Ga0070714_100017549 3300005435 Bacteria 5800
95 Ga0070714_100079600 3300005435 Bacteria 2849
96 Ga0070714_100153352 3300005435 Bacteria 2078
97 Ga0070714_100171182 3300005435 Bacteria 1971
98 Ga0070714_100286614 3300005435 Bacteria 1531
99 Ga0070714_100495303 3300005435 Bacteria 1165
100 Ga0070714_101299641 3300005435 Bacteria 710
101 Ga0070713_100021104 3300005436 Bacteria 5003
102 Ga0070713_100046951 3300005436 Bacteria 3547
103 Ga0070713_100129027 3300005436 Bacteria 2227
104 Ga0070713_100141916 3300005436 Bacteria 2129
105 Ga0070713_100201879 3300005436 Bacteria 1796
106 Ga0070713_100392014 3300005436 Bacteria 1296
107 Ga0070710_10001133 3300005437 Bacteria 12625
108 Ga0070710_10001588 3300005437 Bacteria 10728
109 Ga0070710_10072511 3300005437 Bacteria 1989
110 Ga0070701_10408995 3300005438 Bacteria 862
111 Ga0070711_100022855 3300005439 Bacteria 4058
112 Ga0070711_100028547 3300005439 Bacteria 3672
113 Ga0070711_100029901 3300005439 Bacteria 3600
114 Ga0070711_100114998 3300005439 Bacteria 1981
115 Ga0070711_100149200 3300005439 Bacteria 1761
116 Ga0070711_100159380 3300005439 Bacteria 1709
117 Ga0070711_100649064 3300005439 Bacteria 885
118 Ga0070711_101025161 3300005439 Bacteria 709
119 Ga0070705_100021702 3300005440 Bacteria 3419
120 Ga0070700_100468237 3300005441 Bacteria 963
121 Ga0070694_100183472 3300005444 Bacteria 1549
122 Ga0070694_100281682 3300005444 Bacteria 1268
123 Ga0070663_100005186 3300005455 Bacteria 7717
124 Ga0070663_100024885 3300005455 Bacteria 4035
125 Ga0070663_100036027 3300005455 Bacteria 3436
126 Ga0070663_100055427 3300005455 Bacteria 2837
127 Ga0070663_100093910 3300005455 Bacteria 2226
128 Ga0070663_100105864 3300005455 Bacteria 2106
129 Ga0070663_100169900 3300005455 Bacteria 1685
130 Ga0070663_101138436 3300005455 Bacteria 683
131 Ga0070663_101360177 3300005455 Bacteria 628
132 Ga0070678_100027340 3300005456 Bacteria 3872
133 Ga0070678_100045615 3300005456 Bacteria 3137
134 Ga0070678_100048909 3300005456 Bacteria 3048
135 Ga0070678_100058003 3300005456 Bacteria 2840
136 Ga0070678_100094259 3300005456 Bacteria 2304
137 Ga0070678_100170436 3300005456 Bacteria 1772
138 Ga0070678_100196302 3300005456 Bacteria 1663
139 Ga0070678_100444595 3300005456 Bacteria 1134
140 Ga0070662_100202863 3300005457 Bacteria 1574
141 Ga0070662_100468085 3300005457 Bacteria 1048
142 Ga0070662_100970859 3300005457 Bacteria 727
143 Ga0070681_10114500 3300005458 Bacteria 2635
144 Ga0070681_10141762 3300005458 Bacteria 2333
145 Ga0070681_10230246 3300005458 Bacteria 1768
146 Ga0070681_10935179 3300005458 Bacteria 786
147 Ga0068867_100056464 3300005459 Bacteria 2905
148 Ga0068867_100340415 3300005459 Bacteria 1249
149 Ga0068867_100794978 3300005459 Bacteria 843
150 Ga0070679_100028002 3300005530 Bacteria 5552
151 Ga0070679_100130502 3300005530 Bacteria 2494
152 Ga0070679_100578181 3300005530 Bacteria 1067
153 Ga0070684_100062718 3300005535 Bacteria 3256
154 Ga0070684_100113862 3300005535 Bacteria 2428
155 Ga0070684_100900962 3300005535 Bacteria 829
156 Ga0070684_101292141 3300005535 Bacteria 687
157 Ga0070697_100044453 3300005536 Bacteria 3597
158 Ga0070697_100210890 3300005536 Bacteria 1654
159 Ga0070697_100814050 3300005536 Bacteria 827
160 Ga0068853_100043068 3300005539 Bacteria 3862
161 Ga0068853_100054893 3300005539 Bacteria 3433
162 Ga0068853_100095328 3300005539 Bacteria 2624
163 Ga0068853_100217170 3300005539 Bacteria 1745
164 Ga0068853_100848991 3300005539 Bacteria 876
165 Ga0070672_100071918 3300005543 Bacteria 2753
166 Ga0070672_100236778 3300005543 Bacteria 1535
167 Ga0070672_100304288 3300005543 Bacteria 1352
168 Ga0070672_100339287 3300005543 Bacteria 1279
169 Ga0070686_100035539 3300005544 Bacteria 3079
170 Ga0070686_100064426 3300005544 Bacteria 2377
171 Ga0070686_100080748 3300005544 Bacteria 2152
172 Ga0070686_100657932 3300005544 Bacteria 831
173 Ga0070695_100035990 3300005545 Bacteria 3113
174 Ga0070695_100056454 3300005545 Bacteria 2534
175 Ga0070695_100193301 3300005545 Bacteria 1450
176 Ga0070696_100037314 3300005546 Bacteria 3352
177 Ga0070696_100257156 3300005546 Bacteria 1323
178 Ga0070693_100142645 3300005547 Bacteria 1509
179 Ga0070665_100009678 3300005548 Bacteria 9739
180 Ga0070665_100095813 3300005548 Bacteria 2973
181 Ga0070665_100133556 3300005548 Bacteria 2484
182 Ga0070665_100332250 3300005548 Bacteria 1525
183 Ga0070665_100541937 3300005548 Bacteria 1176
184 Ga0070665_100724468 3300005548 Bacteria 1008
185 Ga0070704_100121374 3300005549 Bacteria 2008
186 Ga0070704_100512502 3300005549 Bacteria 1043
187 Ga0068855_100031250 3300005563 Bacteria 6360
188 Ga0068855_100039857 3300005563 Bacteria 5576
189 Ga0068855_100154928 3300005563 Bacteria 2603
190 Ga0068855_100190258 3300005563 Bacteria 2315
191 Ga0068855_100291605 3300005563 Bacteria 1809
192 Ga0068855_100684790 3300005563 Bacteria 1098
193 Ga0068855_101483766 3300005563 Bacteria 697
194 Ga0070664_100050996 3300005564 Bacteria 3503
195 Ga0070664_100083336 3300005564 Bacteria 2758
196 Ga0070664_100129858 3300005564 Bacteria 2213
197 Ga0070664_100494421 3300005564 Bacteria 1127
198 Ga0070664_101202557 3300005564 Bacteria 715
199 Ga0068857_100070550 3300005577 Bacteria 3113
200 Ga0068857_100181544 3300005577 Bacteria 1915
201 Ga0068857_100800249 3300005577 Bacteria 900
202 Ga0068854_100219301 3300005578 Bacteria 1504
203 Ga0068854_100286941 3300005578 Bacteria 1327
204 Ga0068854_100342789 3300005578 Bacteria 1221
205 Ga0068856_100000511 3300005614 Bacteria 42929
206 Ga0068856_100091527 3300005614 Bacteria 3026
207 Ga0068856_100225258 3300005614 Bacteria 1891
208 Ga0068856_100385155 3300005614 Bacteria 1422
209 Ga0068856_100491919 3300005614 Bacteria 1247
210 Ga0068856_100694966 3300005614 Bacteria 1037
211 Ga0068856_100940744 3300005614 Bacteria 883
212 Ga0070702_100026998 3300005615 Bacteria 3093
213 Ga0070702_100071471 3300005615 Bacteria 2051
214 Ga0070702_100246957 3300005615 Bacteria 1207
215 Ga0070702_100254808 3300005615 Bacteria 1191
216 Ga0068852_100021775 3300005616 Bacteria 5127
217 Ga0068852_100031309 3300005616 Bacteria 4388
218 Ga0068852_100441644 3300005616 Bacteria 1286
219 Ga0068852_100757262 3300005616 Bacteria 984
220 Ga0068852_101684418 3300005616 Bacteria 657
221 Ga0068859_100623050 3300005617 Bacteria 1171
222 Ga0068859_100692329 3300005617 Bacteria 1110
223 Ga0068859_101915527 3300005617 Bacteria 655
224 Ga0068864_100047146 3300005618 Bacteria 3700
225 Ga0068864_100199967 3300005618 Bacteria 1835
226 Ga0068864_100275003 3300005618 Bacteria 1570
227 Ga0068866_10011560 3300005718 Bacteria 3823
228 Ga0068866_10074048 3300005718 Bacteria 1809
229 Ga0068866_10157614 3300005718 Bacteria 1321
230 Ga0068866_10974449 3300005718 Bacteria 601
231 Ga0068861_100087226 3300005719 Bacteria 2455
232 Ga0068861_100190154 3300005719 Bacteria 1715
233 Ga0068861_100469212 3300005719 Bacteria 1132
234 Ga0068851_10061528 3300005834 Bacteria 1924
235 Ga0068870_10060195 3300005840 Bacteria 2038
236 Ga0068870_10276175 3300005840 Bacteria 1051
237 Ga0068863_100433467 3300005841 Bacteria 1289
238 Ga0068858_100093121 3300005842 Bacteria 2805
239 Ga0068858_100184258 3300005842 Bacteria 1972
240 Ga0068860_100041049 3300005843 Bacteria 4420
241 Ga0068860_100088918 3300005843 Bacteria 2940
242 Ga0068860_100120729 3300005843 Bacteria 2509
243 Ga0068860_100127254 3300005843 Bacteria 2442
244 Ga0068860_100249916 3300005843 Bacteria 1727
245 Ga0068860_100508524 3300005843 Bacteria 1203
246 Ga0068862_100414626 3300005844 Bacteria 1262
247 Ga0068862_100415954 3300005844 Bacteria 1260
248 Ga0068862_101352722 3300005844 Bacteria 714
249 Ga0081455_10004380 3300005937 Bacteria 15903
250 Ga0081455_10039149 3300005937 Bacteria 4192
251 Ga0081455_10383073 3300005937 Bacteria 982
252 Ga0081455_10559228 3300005937 Bacteria 754
253 Ga0081540_1001905 3300005983 Bacteria 17467
254 Ga0081540_1003483 3300005983 Bacteria 12420
255 Ga0081540_1005354 3300005983 Bacteria 9596
256 Ga0081540_1006055 3300005983 Bacteria 8894
257 Ga0081540_1019571 3300005983 Bacteria 4106
258 Ga0081540_1030270 3300005983 Bacteria 3001
259 Ga0081540_1036378 3300005983 Bacteria 2626
260 Ga0081540_1039455 3300005983 Bacteria 2475
261 Ga0081540_1049799 3300005983 Bacteria 2086
262 Ga0081540_1101659 3300005983 Bacteria 1237
263 Ga0081540_1265790 3300005983 Bacteria 595
264 Ga0081539_10000324 3300005985 Bacteria 106549
265 Ga0081539_10000902 3300005985 Bacteria 56412
266 Ga0081539_10014288 3300005985 Bacteria 5886
267 Ga0081539_10133752 3300005985 Bacteria 1214
268 Ga0081539_10241925 3300005985 Bacteria 807
269 Ga0070717_10010448 3300006028 Bacteria 7011
270 Ga0070717_10090385 3300006028 Bacteria 2584
271 Ga0070717_10104092 3300006028 Bacteria 2414
272 Ga0075365_10113571 3300006038 Bacteria 1863
273 Ga0075365_10121870 3300006038 Bacteria 1799
274 Ga0075365_10137142 3300006038 Bacteria 1696
275 Ga0075365_10147696 3300006038 Bacteria 1634
276 Ga0075365_10180693 3300006038 Bacteria 1475
277 Ga0075365_10192108 3300006038 Bacteria 1429
278 Ga0075365_10398178 3300006038 Bacteria 972
279 Ga0075368_10014536 3300006042 Bacteria 2909
280 Ga0075368_10083618 3300006042 Bacteria 1301
281 Ga0075363_100010231 3300006048 Bacteria 4441
282 Ga0075363_100139830 3300006048 Bacteria 1363
283 Ga0075363_100246541 3300006048 Bacteria 1028
284 Ga0075364_10169789 3300006051 Bacteria 1474
285 Ga0075432_10184630 3300006058 Bacteria 818
286 Ga0070715_10003071 3300006163 Bacteria 5236
287 Ga0070715_10110476 3300006163 Bacteria 1296
288 Ga0070715_10335473 3300006163 Bacteria 821
289 Ga0070716_100005922 3300006173 Bacteria 5950
290 Ga0070716_100178312 3300006173 Bacteria 1393
291 Ga0070716_100379680 3300006173 Bacteria 1010
292 Ga0070716_100863364 3300006173 Bacteria 706
293 Ga0070712_100010119 3300006175 Bacteria 5944
294 Ga0070712_100020318 3300006175 Bacteria 4345
295 Ga0070712_100114950 3300006175 Bacteria 2016
296 Ga0070712_100133698 3300006175 Bacteria 1883
297 Ga0070712_100234276 3300006175 Bacteria 1459
298 Ga0075362_10021643 3300006177 Bacteria 2701
299 Ga0075367_10010275 3300006178 Bacteria 4914
300 Ga0075367_10209479 3300006178 Bacteria 1219
301 Ga0075367_10576958 3300006178 Bacteria 714
302 Ga0075369_10010740 3300006186 Bacteria 3588
303 Ga0075369_10019596 3300006186 Bacteria 2763
304 Ga0075366_10308358 3300006195 Bacteria 969
305 Ga0075366_10382418 3300006195 Bacteria 866
306 Ga0097621_100025107 3300006237 Bacteria 4660
307 Ga0097621_100028310 3300006237 Bacteria 4416
308 Ga0097621_100032858 3300006237 Bacteria 4127
309 Ga0097621_100266689 3300006237 Bacteria 1503
310 Ga0097621_100378113 3300006237 Bacteria 1265
311 Ga0097621_100651191 3300006237 Bacteria 966
312 Ga0097621_100878862 3300006237 Bacteria 834
313 Ga0097621_101163198 3300006237 Bacteria 726
314 Ga0097621_101327179 3300006237 Bacteria 680
315 Ga0075370_10028939 3300006353 Bacteria 3082
316 Ga0068871_100047227 3300006358 Bacteria 3471
317 Ga0068871_100130756 3300006358 Bacteria 2128
318 Ga0068871_100591274 3300006358 Bacteria 1009
319 Ga0068871_100808336 3300006358 Bacteria 865
320 Ga0068871_101786101 3300006358 Bacteria 584
321 Ga0075428_100056503 3300006844 Bacteria 4299
322 Ga0075428_100569440 3300006844 Bacteria 1210
323 Ga0075431_100792032 3300006847 Bacteria 921
324 Ga0075434_100190918 3300006871 Bacteria 2069
325 Ga0068865_100093108 3300006881 Bacteria 2191
326 Ga0068865_100523851 3300006881 Bacteria 992
327 Ga0075436_100311240 3300006914 Bacteria 1130
328 Ga0097620_100128270 3300006931 Bacteria 2607
329 Ga0097620_100623052 3300006931 Bacteria 1171
330 Ga0097620_100692255 3300006931 Bacteria 1110
331 Ga0097620_101915539 3300006931 Bacteria 655
332 Ga0099824_1031119 3300006942 Bacteria 2061
333 Ga0099823_1072668 3300006944 Bacteria 1491
334 Ga0075435_100061313 3300007076 Bacteria 3051
335 Ga0099794_10014612 3300007265 Bacteria 3444
336 Ga0099794_10146692 3300007265 Bacteria 1197
337 Ga0099795_10002579 3300007788 Bacteria 4297
338 Ga0099795_10003041 3300007788 Bacteria 4088
339 Ga0105251_10044298 3300009011 Bacteria 2150
340 Ga0105250_10026169 3300009092 Bacteria 2350
341 Ga0105240_10213062 3300009093 Bacteria 2256
342 Ga0105240_10230194 3300009093 Bacteria 2155
343 Ga0105240_10297646 3300009093 Bacteria 1847
344 Ga0105240_10641266 3300009093 Bacteria 1165
345 Ga0111539_10050602 3300009094 Bacteria 4949
346 Ga0111539_10614822 3300009094 Bacteria 1265
347 Ga0105245_10013113 3300009098 Bacteria 7222
348 Ga0105245_10060564 3300009098 Bacteria 3409
349 Ga0105245_10104288 3300009098 Bacteria 2628
350 Ga0105245_10481730 3300009098 Bacteria 1254
351 Ga0105247_10005827 3300009101 Bacteria 7702
352 Ga0105247_10164750 3300009101 Bacteria 1470
353 Ga0114129_10107079 3300009147 Bacteria 3862
354 Ga0105243_10209302 3300009148 Bacteria 1716
355 Ga0105243_10815386 3300009148 Bacteria 921
356 Ga0105241_10035010 3300009174 Bacteria 3777
357 Ga0105241_10239602 3300009174 Bacteria 1533
358 Ga0105241_10457296 3300009174 Bacteria 1130
359 Ga0105241_10709080 3300009174 Bacteria 919
360 Ga0105242_10198297 3300009176 Bacteria 1781
361 Ga0105242_10605647 3300009176 Bacteria 1059
362 Ga0105242_10612053 3300009176 Bacteria 1054
363 Ga0105248_10073696 3300009177 Bacteria 3837
364 Ga0105248_10090767 3300009177 Bacteria 3440
365 Ga0105248_10217361 3300009177 Bacteria 2152
366 Ga0105248_10866061 3300009177 Bacteria 1020
367 Ga0105248_10921298 3300009177 Bacteria 987
368 Ga0105237_10054269 3300009545 Bacteria 4016
369 Ga0105237_10205222 3300009545 Bacteria 1971
370 Ga0105237_10291101 3300009545 Bacteria 1636
371 Ga0105237_11207395 3300009545 Bacteria 763
372 Ga0105238_10038892 3300009551 Bacteria 4829
373 Ga0105238_10073250 3300009551 Bacteria 3420
374 Ga0105238_10189980 3300009551 Bacteria 2030
375 Ga0105238_10230507 3300009551 Bacteria 1829
376 Ga0105238_11170638 3300009551 Bacteria 793
377 Ga0105249_10063495 3300009553 Bacteria 3393
378 Ga0105249_10252033 3300009553 Bacteria 1751
379 Ga0105249_10417895 3300009553 Bacteria 1374
380 Ga0123342_1013770 3300009766 Bacteria 7982
381 Ga0099796_10009589 3300010159 Bacteria 2627
382 Ga0099796_10019349 3300010159 Bacteria 2062
383 Ga0099796_10029389 3300010159 Bacteria 1773
384 Ga0099796_10052131 3300010159 Bacteria 1424
385 Ga0105239_10061201 3300010375 Bacteria 4131
386 Ga0105239_10204077 3300010375 Bacteria 2215
387 Ga0105239_10239989 3300010375 Bacteria 2034
388 Ga0105239_10370479 3300010375 Bacteria 1619
389 Ga0105239_10413193 3300010375 Bacteria 1528
390 Ga0105246_10121976 3300011119 Bacteria 1933
391 Ga0105246_10236551 3300011119 Bacteria 1441
392 Ga0157343_1009340 3300012488 Bacteria 723
393 Ga0157338_1029805 3300012515 Bacteria 689
394 Ga0157373_10016845 3300013100 Bacteria 5328
395 Ga0157370_10037503 3300013104 Bacteria 4698
396 Ga0157370_10182418 3300013104 Bacteria 1950
397 Ga0157370_10286566 3300013104 Bacteria 1521
398 Ga0157370_10523428 3300013104 Bacteria 1088
399 Ga0157369_10037064 3300013105 Bacteria 5341
400 Ga0157369_10304854 3300013105 Bacteria 1656
401 Ga0157369_10540413 3300013105 Bacteria 1205
402 Ga0157374_10077147 3300013296 Bacteria 3152
403 Ga0157374_10253496 3300013296 Bacteria 1732
404 Ga0157378_10025963 3300013297 Bacteria 5162
405 Ga0157378_10047954 3300013297 Bacteria 3798
406 Ga0157378_10087971 3300013297 Bacteria 2818
407 Ga0157378_10125516 3300013297 Bacteria 2370
408 Ga0157378_10154935 3300013297 Bacteria 2138
409 Ga0157378_10190507 3300013297 Bacteria 1934
410 Ga0157378_10203242 3300013297 Bacteria 1874
411 Ga0157378_10432789 3300013297 Bacteria 1302
412 Ga0163162_10121233 3300013306 Bacteria 2719
413 Ga0163162_10213555 3300013306 Bacteria 2059
414 Ga0163162_10562543 3300013306 Bacteria 1268
415 Ga0163162_10762381 3300013306 Bacteria 1086
416 Ga0163162_12096027 3300013306 Bacteria 649
417 Ga0157372_10548850 3300013307 Bacteria 1347
418 Ga0157375_10005808 3300013308 Bacteria 10737
419 Ga0157375_10172104 3300013308 Bacteria 2313
420 Ga0157375_10285482 3300013308 Bacteria 1814
421 Ga0157375_10335069 3300013308 Bacteria 1678
422 Ga0157375_10581556 3300013308 Bacteria 1280
423 Ga0163163_10164907 3300014325 Bacteria 2261
424 Ga0163163_11132991 3300014325 Bacteria 845
425 Ga0157380_10093471 3300014326 Bacteria 2487
426 Ga0157380_10125737 3300014326 Bacteria 2179
427 Ga0157380_10599300 3300014326 Bacteria 1090
428 Ga0157377_10167513 3300014745 Bacteria 1371
429 Ga0157379_10033296 3300014968 Bacteria 4596
430 Ga0157379_10356580 3300014968 Bacteria 1340
431 Ga0157376_10054066 3300014969 Bacteria 3346
432 Ga0157376_10341507 3300014969 Bacteria 1430
433 Ga0157376_10356886 3300014969 Bacteria 1401
434 Ga0157376_10454865 3300014969 Bacteria 1250
435 Ga0157376_11152932 3300014969 Bacteria 802
436 Ga0163161_10136471 3300017792 Bacteria 1855
437 Ga0163161_10180981 3300017792 Bacteria 1616
438 Ga0163161_10184839 3300017792 Bacteria 1600
439 Ga0163161_10280325 3300017792 Bacteria 1307
440 Ga0163161_11305941 3300017792 Bacteria 631
441 Ga0197907_10717276 3300020069 Bacteria 822
442 Ga0206356_11225785 3300020070 Bacteria 597
443 Ga0206356_11512317 3300020070 Bacteria 689
444 Ga0206349_1867187 3300020075 Bacteria 605
445 Ga0206355_1651195 3300020076 Bacteria 967
446 Ga0206352_10872787 3300020078 Bacteria 794
447 Ga0206350_11624238 3300020080 Bacteria 646
448 Ga0214543_1000018 3300021327 Bacteria 272335
449 Ga0213873_10124599 3300021358 Bacteria 759
450 Ga0213876_10001113 3300021384 Bacteria 17196
451 Ga0224712_10149526 3300022467 Bacteria 1034
452 Ga0224712_10391768 3300022467 Bacteria 661
453 Ga0207425_1025599 3300025245 Bacteria 1217
454 Ga0209129_1001217 3300025258 Bacteria 14789
455 Ga0209233_1003374 3300025261 Bacteria 5638
456 Ga0209233_1014294 3300025261 Bacteria 2240
457 Ga0209455_1003306 3300025272 Bacteria 5783
458 Ga0209673_1003224 3300025273 Bacteria 9874
459 Ga0209130_1030706 3300025284 Bacteria 1108
460 Ga0209564_1018467 3300025295 Bacteria 2655
461 Ga0209758_1003130 3300025297 Bacteria 15616
462 Ga0209758_1003447 3300025297 Bacteria 14374
463 Ga0209256_1000064 3300025299 Bacteria 250853
464 Ga0209256_1007330 3300025299 Bacteria 5482
465 Ga0209256_1012304 3300025299 Bacteria 3300
466 Ga0209256_1044906 3300025299 Bacteria 1101
467 Ga0207426_1000730 3300025302 Bacteria 37639
468 Ga0207697_10018333 3300025315 Bacteria 2871
469 Ga0207656_10041676 3300025321 Bacteria 1952
470 Ga0207696_1082278 3300025711 Bacteria 888
471 Ga0207696_1128410 3300025711 Bacteria 682
472 Ga0207653_10031965 3300025885 Bacteria 1701
473 Ga0207692_10001008 3300025898 Bacteria 10274
474 Ga0207692_10011691 3300025898 Bacteria 3746
475 Ga0207692_10490085 3300025898 Bacteria 779
476 Ga0207642_10073674 3300025899 Bacteria 1634
477 Ga0207642_10115377 3300025899 Bacteria 1375
478 Ga0207642_10421281 3300025899 Bacteria 803
479 Ga0207710_10030588 3300025900 Bacteria 2350
480 Ga0207710_10173380 3300025900 Bacteria 1055
481 Ga0207688_10066645 3300025901 Bacteria 2037
482 Ga0207688_10082682 3300025901 Bacteria 1835
483 Ga0207680_10080546 3300025903 Bacteria 2045
484 Ga0207680_10690224 3300025903 Bacteria 731
485 Ga0207647_10030400 3300025904 Bacteria 3485
486 Ga0207647_10047128 3300025904 Bacteria 2682
487 Ga0207647_10154710 3300025904 Bacteria 1339
488 Ga0207647_10192603 3300025904 Bacteria 1181
489 Ga0207647_10198710 3300025904 Bacteria 1160
490 Ga0207685_10129101 3300025905 Bacteria 1120
491 Ga0207699_10009034 3300025906 Bacteria 4945
492 Ga0207699_10024073 3300025906 Bacteria 3324
493 Ga0207699_10024173 3300025906 Bacteria 3318
494 Ga0207645_10043025 3300025907 Bacteria 2890
495 Ga0207645_10152536 3300025907 Bacteria 1509
496 Ga0207643_10035880 3300025908 Bacteria 2781
497 Ga0207643_10080885 3300025908 Bacteria 1882
498 Ga0207643_10412234 3300025908 Bacteria 855
499 Ga0207705_10053763 3300025909 Bacteria 2901
500 Ga0207705_10061369 3300025909 Bacteria 2716
501 Ga0207705_10323691 3300025909 Bacteria 1185
502 Ga0207705_10633709 3300025909 Bacteria 831
503 Ga0207654_10007233 3300025911 Bacteria 5592
504 Ga0207654_10032620 3300025911 Bacteria 2880
505 Ga0207654_10402814 3300025911 Bacteria 952
506 Ga0207654_10479192 3300025911 Bacteria 876
507 Ga0207654_10681082 3300025911 Bacteria 738
508 Ga0207654_10760857 3300025911 Bacteria 698
509 Ga0207707_10043460 3300025912 Bacteria 3920
510 Ga0207707_10701944 3300025912 Bacteria 849
511 Ga0207707_10954927 3300025912 Bacteria 706
512 Ga0207695_10066435 3300025913 Bacteria 3703
513 Ga0207695_10134456 3300025913 Bacteria 2427
514 Ga0207695_10206033 3300025913 Bacteria 1879
515 Ga0207671_10101999 3300025914 Bacteria 2175
516 Ga0207671_10339489 3300025914 Bacteria 1190
517 Ga0207671_10572691 3300025914 Bacteria 900
518 Ga0207671_10769834 3300025914 Bacteria 764
519 Ga0207693_10007911 3300025915 Bacteria 8734
520 Ga0207693_10008718 3300025915 Bacteria 8291
521 Ga0207693_10010781 3300025915 Bacteria 7420
522 Ga0207693_10283137 3300025915 Bacteria 1299
523 Ga0207693_10983398 3300025915 Bacteria 645
524 Ga0207663_10002092 3300025916 Bacteria 9516
525 Ga0207663_10052877 3300025916 Bacteria 2535
526 Ga0207663_10053354 3300025916 Bacteria 2525
527 Ga0207663_10060198 3300025916 Bacteria 2405
528 Ga0207663_10147754 3300025916 Bacteria 1645
529 Ga0207660_10217797 3300025917 Bacteria 1497
530 Ga0207660_10306467 3300025917 Bacteria 1266
531 Ga0207660_10495932 3300025917 Bacteria 990
532 Ga0207662_10689453 3300025918 Bacteria 715
533 Ga0207657_10001022 3300025919 Bacteria 29697
534 Ga0207657_10011801 3300025919 Bacteria 8650
535 Ga0207657_10046837 3300025919 Bacteria 3786
536 Ga0207657_10120971 3300025919 Bacteria 2154
537 Ga0207657_10547049 3300025919 Bacteria 905
538 Ga0207649_10106212 3300025920 Bacteria 1867
539 Ga0207649_10176396 3300025920 Bacteria 1493
540 Ga0207649_11130642 3300025920 Bacteria 618
541 Ga0207652_10013063 3300025921 Bacteria 6720
542 Ga0207652_10093561 3300025921 Bacteria 2645
543 Ga0207652_10093584 3300025921 Bacteria 2645
544 Ga0207652_10497990 3300025921 Bacteria 1097
545 Ga0207652_11037811 3300025921 Bacteria 719
546 Ga0207646_10204739 3300025922 Bacteria 1783
547 Ga0207681_10536245 3300025923 Bacteria 962
548 Ga0207694_10112809 3300025924 Bacteria 2164
549 Ga0207694_10221598 3300025924 Bacteria 1543
550 Ga0207694_10251395 3300025924 Bacteria 1446
551 Ga0207694_10363443 3300025924 Bacteria 1200
552 Ga0207694_10372990 3300025924 Bacteria 1184
553 Ga0207694_10416070 3300025924 Bacteria 1119
554 Ga0207659_10250296 3300025926 Bacteria 1437
555 Ga0207659_10345439 3300025926 Bacteria 1233
556 Ga0207687_10029474 3300025927 Bacteria 3692
557 Ga0207687_10089648 3300025927 Bacteria 2240
558 Ga0207687_10196740 3300025927 Bacteria 1572
559 Ga0207700_10040777 3300025928 Bacteria 3391
560 Ga0207700_10075769 3300025928 Bacteria 2608
561 Ga0207700_10165490 3300025928 Bacteria 1840
562 Ga0207700_10244283 3300025928 Bacteria 1531
563 Ga0207664_10030922 3300025929 Bacteria 4092
564 Ga0207664_10089899 3300025929 Bacteria 2515
565 Ga0207664_10240282 3300025929 Bacteria 1577
566 Ga0207664_10458954 3300025929 Bacteria 1138
567 Ga0207664_11263070 3300025929 Bacteria 657
568 Ga0207644_10017156 3300025931 Bacteria 4883
569 Ga0207644_10030007 3300025931 Bacteria 3776
570 Ga0207644_10123738 3300025931 Bacteria 1972
571 Ga0207644_10154893 3300025931 Bacteria 1776
572 Ga0207690_10104376 3300025932 Bacteria 2030
573 Ga0207690_10268928 3300025932 Bacteria 1323
574 Ga0207690_10348698 3300025932 Bacteria 1170
575 Ga0207706_10042611 3300025933 Bacteria 4023
576 Ga0207706_10072164 3300025933 Bacteria 3036
577 Ga0207706_10483724 3300025933 Bacteria 1069
578 Ga0207686_10014926 3300025934 Bacteria 4336
579 Ga0207686_10070179 3300025934 Bacteria 2250
580 Ga0207686_10211002 3300025934 Bacteria 1396
581 Ga0207686_10243172 3300025934 Bacteria 1311
582 Ga0207709_10034935 3300025935 Bacteria 2968
583 Ga0207709_10101353 3300025935 Bacteria 1904
584 Ga0207709_10157926 3300025935 Bacteria 1578
585 Ga0207709_10649112 3300025935 Bacteria 840
586 Ga0207669_10122502 3300025937 Bacteria 1768
587 Ga0207704_10132223 3300025938 Bacteria 1730
588 Ga0207665_10001678 3300025939 Bacteria 14897
589 Ga0207665_10058436 3300025939 Bacteria 2607
590 Ga0207665_10096824 3300025939 Bacteria 2053
591 Ga0207665_10215874 3300025939 Bacteria 1404
592 Ga0207665_10303947 3300025939 Bacteria 1193
593 Ga0207665_10592844 3300025939 Bacteria 865
594 Ga0207691_10300312 3300025940 Bacteria 1380
595 Ga0207691_10312448 3300025940 Bacteria 1348
596 Ga0207711_10005566 3300025941 Bacteria 10650
597 Ga0207711_10043522 3300025941 Bacteria 3831
598 Ga0207711_10196700 3300025941 Bacteria 1839
599 Ga0207711_10331608 3300025941 Bacteria 1407
600 Ga0207661_10018101 3300025944 Bacteria 5232
601 Ga0207661_10150545 3300025944 Bacteria 2011
602 Ga0207661_10195327 3300025944 Bacteria 1776
603 Ga0207661_10230170 3300025944 Bacteria 1641
604 Ga0207661_10363330 3300025944 Bacteria 1308
605 Ga0207679_10066116 3300025945 Bacteria 2708
606 Ga0207679_10101592 3300025945 Bacteria 2250
607 Ga0207679_10183146 3300025945 Bacteria 1734
608 Ga0207679_10312704 3300025945 Bacteria 1358
609 Ga0207667_10015870 3300025949 Bacteria 8533
610 Ga0207667_10057464 3300025949 Bacteria 4084
611 Ga0207667_10135083 3300025949 Bacteria 2540
612 Ga0207667_10200431 3300025949 Bacteria 2048
613 Ga0207667_10313716 3300025949 Bacteria 1602
614 Ga0207651_10051125 3300025960 Bacteria 2810
615 Ga0207651_10088931 3300025960 Bacteria 2253
616 Ga0207712_10026523 3300025961 Bacteria 3862
617 Ga0207712_10159976 3300025961 Bacteria 1749
618 Ga0207712_10433400 3300025961 Bacteria 1111
619 Ga0207712_11029293 3300025961 Bacteria 731
620 Ga0207668_10066056 3300025972 Bacteria 2562
621 Ga0207668_10067714 3300025972 Bacteria 2536
622 Ga0207668_10080850 3300025972 Bacteria 2355
623 Ga0207668_10319617 3300025972 Bacteria 1287
624 Ga0207668_10432764 3300025972 Bacteria 1119
625 Ga0207668_10594954 3300025972 Bacteria 963
626 Ga0207668_11094188 3300025972 Bacteria 714
627 Ga0207668_11201423 3300025972 Bacteria 681
628 Ga0207640_10067562 3300025981 Bacteria 2393
629 Ga0207640_10077098 3300025981 Bacteria 2265
630 Ga0207640_10250693 3300025981 Bacteria 1374
631 Ga0207640_10269574 3300025981 Bacteria 1331
632 Ga0207658_10172540 3300025986 Bacteria 1783
633 Ga0207658_10220275 3300025986 Bacteria 1596
634 Ga0207658_10257447 3300025986 Bacteria 1486
635 Ga0207658_10377550 3300025986 Bacteria 1241
636 Ga0207658_10384733 3300025986 Bacteria 1229
637 Ga0207677_10027403 3300026023 Bacteria 3588
638 Ga0207677_10061810 3300026023 Bacteria 2595
639 Ga0207677_10070132 3300026023 Bacteria 2468
640 Ga0207677_10116123 3300026023 Bacteria 2003
641 Ga0207677_10231946 3300026023 Bacteria 1487
642 Ga0207703_10096502 3300026035 Bacteria 2496
643 Ga0207703_10364946 3300026035 Bacteria 1332
644 Ga0207703_11668145 3300026035 Bacteria 613
645 Ga0207639_10046989 3300026041 Bacteria 3259
646 Ga0207639_10113884 3300026041 Bacteria 2209
647 Ga0207639_10512155 3300026041 Bacteria 1098
648 Ga0207639_11185318 3300026041 Bacteria 717
649 Ga0207678_10000721 3300026067 Bacteria 30188
650 Ga0207678_10002923 3300026067 Bacteria 15493
651 Ga0207678_10004603 3300026067 Bacteria 12394
652 Ga0207678_10010843 3300026067 Bacteria 8008
653 Ga0207678_10017537 3300026067 Bacteria 6288
654 Ga0207678_10021928 3300026067 Bacteria 5599
655 Ga0207678_10072348 3300026067 Bacteria 2954
656 Ga0207678_10172855 3300026067 Bacteria 1844
657 Ga0207678_10448051 3300026067 Bacteria 1122
658 Ga0207678_10825177 3300026067 Bacteria 819
659 Ga0207678_11026891 3300026067 Bacteria 730
660 Ga0207708_10033205 3300026075 Bacteria 3919
661 Ga0207702_10001649 3300026078 Bacteria 22030
662 Ga0207702_10111628 3300026078 Bacteria 2431
663 Ga0207702_10149948 3300026078 Bacteria 2120
664 Ga0207702_10201326 3300026078 Bacteria 1846
665 Ga0207702_10221719 3300026078 Bacteria 1762
666 Ga0207702_10485764 3300026078 Bacteria 1202
667 Ga0207702_10687848 3300026078 Bacteria 1007
668 Ga0207702_10907976 3300026078 Bacteria 873
669 Ga0207641_10433758 3300026088 Bacteria 1267
670 Ga0207641_11292139 3300026088 Bacteria 730
671 Ga0207648_10089012 3300026089 Bacteria 2696
672 Ga0207676_10030660 3300026095 Bacteria 4039
673 Ga0207676_10042572 3300026095 Bacteria 3493
674 Ga0207676_10154959 3300026095 Bacteria 1978
675 Ga0207674_10095474 3300026116 Bacteria 2959
676 Ga0207674_10132400 3300026116 Bacteria 2456
677 Ga0207674_10194765 3300026116 Bacteria 1976
678 Ga0207674_10874802 3300026116 Bacteria 866
679 Ga0207674_11329364 3300026116 Bacteria 688
680 Ga0207675_100121432 3300026118 Bacteria 2472
681 Ga0207675_100123678 3300026118 Bacteria 2449
682 Ga0207683_10012932 3300026121 Bacteria 7127
683 Ga0207683_10025571 3300026121 Bacteria 5093
684 Ga0207683_10030143 3300026121 Bacteria 4699
685 Ga0207683_10048432 3300026121 Bacteria 3721
686 Ga0207683_10115215 3300026121 Bacteria 2409
687 Ga0207683_10147200 3300026121 Bacteria 2125
688 Ga0207683_10244256 3300026121 Bacteria 1638
689 Ga0207683_10296334 3300026121 Bacteria 1479
690 Ga0207698_10108343 3300026142 Bacteria 2322
691 Ga0207698_10490690 3300026142 Bacteria 1193
692 Ga0209389_1000212 3300027296 Bacteria 40932
693 Ga0209589_1001280 3300027357 Bacteria 40932
694 Ga0209489_100085 3300027361 Bacteria 126199
695 Ga0209179_1009590 3300027512 Bacteria 1665
696 Ga0209179_1091515 3300027512 Bacteria 675
697 Ga0209588_1001779 3300027671 Bacteria 5718
698 Ga0209588_1041104 3300027671 Bacteria 1492
699 Ga0209588_1103050 3300027671 Bacteria 918
700 Ga0209813_10057755 3300027866 Bacteria 1231
701 Ga0209974_10216656 3300027876 Bacteria 711
702 Ga0207428_10167199 3300027907 Bacteria 1667
703 Ga0268266_10003266 3300028379 Bacteria 16328
704 Ga0268266_10024737 3300028379 Bacteria 5109
705 Ga0268266_10048039 3300028379 Bacteria 3658
706 Ga0268266_10499619 3300028379 Bacteria 1161
707 Ga0268266_10733132 3300028379 Bacteria 953
708 Ga0268266_10858120 3300028379 Bacteria 878
709 Ga0268265_10099512 3300028380 Bacteria 2344
710 Ga0268264_10000048 3300028381 Bacteria 334457
711 Ga0268264_10135428 3300028381 Bacteria 2189
712 Ga0268264_10264421 3300028381 Bacteria 1604
713 Ga0268264_10414392 3300028381 Bacteria 1298
714 Ga0268264_10760238 3300028381 Bacteria 966
715 Ga0265337_1011548 3300028556 Bacteria 3038
716 Ga0265326_10040338 3300028558 Bacteria 1326
717 Ga0265319_1033620 3300028563 Bacteria 1769
718 Ga0265334_10002347 3300028573 Bacteria 8904
719 Ga0265334_10006108 3300028573 Bacteria 5223
720 Ga0265318_10007048 3300028577 Bacteria 5118
721 Ga0265323_10002902 3300028653 Bacteria 7689
722 Ga0265322_10002295 3300028654 Bacteria 5928
723 Ga0265336_10000960 3300028666 Bacteria 14406
724 Ga0307517_10472138 3300028786 Bacteria 645
725 Ga0307515_10261516 3300028794 Bacteria 1466
726 Ga0265338_10000155 3300028800 Bacteria 125121
727 Ga0265338_10023891 3300028800 Bacteria 6266
728 Ga0265324_10007896 3300029957 Bacteria 4268
729 Ga0307511_10042827 3300030521 Bacteria 3795
730 Ga0307511_10278864 3300030521 Bacteria 775
731 Ga0265332_10048807 3300031238 Bacteria 1820
732 Ga0265328_10099045 3300031239 Bacteria 1079
733 Ga0265328_10104527 3300031239 Bacteria 1050
734 Ga0265325_10000264 3300031241 Bacteria 37210
735 Ga0265325_10038377 3300031241 Bacteria 2528
736 Ga0265340_10071225 3300031247 Bacteria 1648
737 Ga0265340_10102986 3300031247 Bacteria 1325
738 Ga0265339_10072326 3300031249 Bacteria 1835
739 Ga0265331_10104682 3300031250 Bacteria 1300
740 Ga0307509_10005003 3300031507 Bacteria 18702
741 Ga0307509_10277277 3300031507 Bacteria 1440
742 Ga0307509_10374871 3300031507 Bacteria 1138
743 Ga0307509_10600357 3300031507 Bacteria 773
744 Ga0307408_100385294 3300031548 Bacteria 1199
745 Ga0307408_100494360 3300031548 Bacteria 1070
746 Ga0265313_10010055 3300031595 Bacteria 6051
747 Ga0307508_10000120 3300031616 Bacteria 93316
748 Ga0307508_10038844 3300031616 Bacteria 4277
749 Ga0307508_10173980 3300031616 Bacteria 1756
750 Ga0265314_10015133 3300031711 Bacteria 6135
751 Ga0265314_10024194 3300031711 Bacteria 4609
752 Ga0265342_10018169 3300031712 Bacteria 4561
753 Ga0307516_10041329 3300031730 Bacteria 4583
754 Ga0307516_10220860 3300031730 Bacteria 1604
755 Ga0307405_10091828 3300031731 Bacteria 2013
756 Ga0307410_10140440 3300031852 Bacteria 1786
757 Ga0307410_11207176 3300031852 Bacteria 659
758 Ga0307410_11323951 3300031852 Bacteria 630
759 Ga0307406_10168499 3300031901 Bacteria 1582
760 Ga0307406_10349494 3300031901 Bacteria 1155
761 Ga0307407_10333610 3300031903 Bacteria 1068
762 Ga0307412_10158049 3300031911 Bacteria 1680
763 Ga0307412_10214021 3300031911 Bacteria 1473
764 Ga0307412_10677653 3300031911 Bacteria 882
765 Ga0307409_100150475 3300031995 Bacteria 2020
766 Ga0307414_10177260 3300032004 Bacteria 1710
767 Ga0307411_10143459 3300032005 Bacteria 1764
768 Ga0307411_10939714 3300032005 Bacteria 770
769 Ga0307411_11031396 3300032005 Bacteria 738
770 Ga0307415_100052907 3300032126 Bacteria 2764
771 Ga0307415_100057944 3300032126 Bacteria 2664
772 Ga0307415_100312651 3300032126 Bacteria 1306
773 Ga0307415_100346248 3300032126 Bacteria 1249
774 Ga0307507_10081029 3300033179 Bacteria 2857
775 Ga0307510_10012623 3300033180 Bacteria 10019
776 Ga0307510_10080874 3300033180 Bacteria 3156
777 Ga0307510_10241634 3300033180 Bacteria 1300
778 Ga0315911_1000037 3300033442 Bacteria 62198
779 Ga0373930_0000647 3300034816 Bacteria 4863
780 Ga0373948_0015453 3300034817 Bacteria 1402
781 Ga0373948_0022868 3300034817 Bacteria 1208
782 Ga0373950_0004698 3300034818 Bacteria 2009
783 Ga0373959_0104691 3300034820 Bacteria 677
784 Ga0373926_0196137 3300035083 Bacteria 776
785 Ga0373928_0014591 3300035084 Bacteria 1591
786 Ga0373928_0026891 3300035084 Bacteria 1249
787 Ga0373934_0002906 3300035086 Bacteria 6268
788 Ga0373934_0100799 3300035086 Bacteria 1168
789 Ga0373934_0166045 3300035086 Bacteria 906
790 Ga0373940_0041165 3300035088 Bacteria 1270
791 Ga0373949_0040775 3300035090 Bacteria 1141
792 Ga0373951_0024795 3300035091 Bacteria 1391
793 Ga0373923_0062813 3300035111 Bacteria 1581
794 Ga0373923_0169971 3300035111 Bacteria 998
795 Ga0373932_0007300 3300035112 Bacteria 2632
796 Ga0373932_0018087 3300035112 Bacteria 1818
797 Ga0373936_0020917 3300035113 Bacteria 2544
798 Ga0373936_0084368 3300035113 Bacteria 1326
799 Ga0373945_0040426 3300035116 Bacteria 1684
800 Ga0373945_0079195 3300035116 Bacteria 1256
801 Ga0373953_0008531 3300035117 Bacteria 3484
802 Ga0373953_0015360 3300035117 Bacteria 2773
803 Ga0373954_0005696 3300035118 Bacteria 5405
804 Ga0373954_0007272 3300035118 Bacteria 4839
805 Ga0373954_0200857 3300035118 Bacteria 979
806 Ga0373956_0010324 3300035119 Bacteria 3824
807 Ga0373956_0059022 3300035119 Bacteria 1735
808 Ga0373956_0401880 3300035119 Bacteria 653
809 Ga0373957_0001391 3300035120 Bacteria 6517
810 Ga0373957_0018656 3300035120 Bacteria 2433
811 Ga0373957_0030841 3300035120 Bacteria 1966
812 Ga0373957_0208436 3300035120 Bacteria 816
813 Ga0373943_0007179 3300035170 Bacteria 4998
814 Ga0373943_0033128 3300035170 Bacteria 2459
815 Ga0373946_0014352 3300035171 Bacteria 2987
816 Ga0373946_0045813 3300035171 Bacteria 1810
817 Ga0373946_0076222 3300035171 Bacteria 1459
818 Ga0373955_0004993 3300035172 Bacteria 5926
819 Ga0373955_0082675 3300035172 Bacteria 1817
820 Ga0373961_0048559 3300035241 Bacteria 1251
821 Ga0373924_0036763 3300035410 Bacteria 1991
822 Ga0373931_0004597 3300035691 Bacteria 6314
823 Ga0373931_0021136 3300035691 Bacteria 3263
824 Ga0373931_0401533 3300035691 Bacteria 868
825 Ga0373935_0015705 3300035692 Bacteria 4579
826 Ga0373935_0030972 3300035692 Bacteria 3317
827 Ga0373935_0106345 3300035692 Bacteria 1857
828 Ga0373935_0157342 3300035692 Bacteria 1546
829 Ga0373935_0189906 3300035692 Bacteria 1414
830 Ga0373935_0302721 3300035692 Bacteria 1130
831 Ga0373935_0358292 3300035692 Bacteria 1041
832 Ga0373935_0443982 3300035692 Bacteria 936
833 Ga0373927_0002813 3300035695 Bacteria 12703
834 Ga0373927_0007182 3300035695 Bacteria 7558
835 Ga0373927_0012358 3300035695 Bacteria 5682
836 Ga0373927_0014147 3300035695 Bacteria 5291
837 Ga0373927_0015983 3300035695 Bacteria 4954
838 Ga0373927_0031642 3300035695 Bacteria 3447
839 Ga0373927_0053846 3300035695 Bacteria 2603
840 Ga0373927_0274383 3300035695 Bacteria 1109
841 Ga0373927_0382358 3300035695 Bacteria 928
842 Ga0373927_0701694 3300035695 Bacteria 668
843 Ga0373933_0062945 3300035724 Bacteria 2242
844 Ga0373933_0080332 3300035724 Bacteria 1998
845 Ga0373933_0110061 3300035724 Bacteria 1717
846 Ga0373933_0117650 3300035724 Bacteria 1662
847 Ga0373947_0000441 3300035725 Bacteria 23573
848 Ga0373947_0020629 3300035725 Bacteria 3807
849 Ga0373947_0026397 3300035725 Bacteria 3394
850 Ga0373947_0078495 3300035725 Bacteria 2038
851 Ga0373947_0135053 3300035725 Bacteria 1578
852 Ga0373947_0245907 3300035725 Bacteria 1181
853 Ga0373947_0286244 3300035725 Bacteria 1096
854 Ga0373947_0749638 3300035725 Bacteria 666
855 Ga0373937_0011747 3300036401 Bacteria 7682
856 Ga0373937_0049701 3300036401 Bacteria 3840
857 Ga0373937_0098734 3300036401 Bacteria 2708
858 Ga0373937_0348558 3300036401 Bacteria 1402
859 Ga0373937_0767244 3300036401 Bacteria 912
860 Ga0373937_1130797 3300036401 Bacteria 732
861 Ga0373925_0005350 3300037068 Bacteria 9577
862 Ga0373925_0064209 3300037068 Bacteria 2763
863 Ga0373925_0122845 3300037068 Bacteria 2017
864 Ga0373925_0234168 3300037068 Bacteria 1469
865 Ga0373925_0374291 3300037068 Bacteria 1159
866 Ga0395899_0376167 3300037312 Bacteria 945
867 Ga0395900_0000134 3300037418 Bacteria 124444
868 Ga0395900_0011930 3300037418 Bacteria 8885
869 Ga0395900_0109774 3300037418 Bacteria 2834
870 Ga0395900_0360393 3300037418 Bacteria 1425
871 Ga0395898_0014296 3300037466 Bacteria 8158
872 Ga0395898_0161064 3300037466 Bacteria 2146
873 Ga0395905_0017202 3300037471 Bacteria 6868
874 Ga0395905_0049780 3300037471 Bacteria 3927
875 Ga0395905_0195869 3300037471 Bacteria 1895
876 Ga0395905_0202261 3300037471 Bacteria 1862
877 Ga0395905_1028874 3300037471 Bacteria 727
878 Ga0436364_1368466 3300037853 Bacteria 1728
879 Ga0395901_0032707 3300038443 Bacteria 5365
880 Ga0395901_0033640 3300038443 Bacteria 5293
881 Ga0395901_0237430 3300038443 Bacteria 1902
882 Ga0395901_0275230 3300038443 Bacteria 1750
883 Ga0395901_0712385 3300038443 Bacteria 1000
884 Ga0436365_0133064 3300039437 Bacteria 19710
885 Ga0436365_0511030 3300039437 Bacteria 1750
886 Ga0436363_0957639 3300039450 Bacteria 2145
887 Ga0436362_0550362 3300039453 Bacteria 8946
888 Ga0439439_0188358 3300041406 Bacteria 596
889 Ga0451798_0453507 3300041458 Bacteria 870
890 Ga0451853_0932301 3300041512 Bacteria 775
891 Ga0439458_0058958 3300042157 Bacteria 956
892 Ga0466969_0105919 3300044656 Bacteria 1320
893 Ga0466972_0042673 3300044658 Bacteria 2204
894 Ga0466972_0134945 3300044658 Bacteria 1162
895 Ga0466965_0100435 3300044683 Bacteria 1479
896 Ga0466965_0111522 3300044683 Bacteria 1406
897 Ga0466964_0243627 3300044706 Bacteria 883
898 Ga0466971_0043520 3300044719 Bacteria 2018
899 Ga0466968_0352494 3300044735 Bacteria 715
900 Ga0466970_0249448 3300044765 Bacteria 994
901 Ga0466957_0202450 3300044842 Bacteria 1304
902 Ga0466957_0263393 3300044842 Bacteria 1149
903 Ga0466959_0227312 3300045049 Bacteria 1292
904 Ga0466959_0281625 3300045049 Bacteria 1141
905 Ga0451576_2066207 3300045051 Bacteria 586
906 Ga0466967_0107132 3300045976 Bacteria 2563
907 Ga0466967_0326627 3300045976 Bacteria 1481
908 Ga0466967_1057657 3300045976 Bacteria 808
909 Ga0495592_0000962 3300046454 Bacteria 19966
910 Ga0495592_0024070 3300046454 Bacteria 4630
911 Ga0495592_0038972 3300046454 Bacteria 3572
912 Ga0495592_0047517 3300046454 Bacteria 3196
913 Ga0495592_0358461 3300046454 Bacteria 933
914 Ga0495603_0000066 3300046455 Bacteria 45635
915 Ga0495603_0017017 3300046455 Bacteria 4399
916 Ga0495603_0065087 3300046455 Bacteria 2148
917 Ga0495603_0067733 3300046455 Bacteria 2101
918 Ga0495603_0077481 3300046455 Bacteria 1950
919 Ga0495603_0273085 3300046455 Bacteria 972
920 Ga0495603_0424859 3300046455 Bacteria 761
921 Ga0495590_0265483 3300046457 Bacteria 641
922 Ga0495591_085098 3300046458 Bacteria 801
923 Ga0495629_0000131 3300046459 Bacteria 65274
924 Ga0495629_0000984 3300046459 Bacteria 22885
925 Ga0495629_0010691 3300046459 Bacteria 6673
926 Ga0495629_0063174 3300046459 Bacteria 2586
927 Ga0495629_0171694 3300046459 Bacteria 1504
928 Ga0495629_0257100 3300046459 Bacteria 1201
929 Ga0495638_0080415 3300046460 Bacteria 1980
930 Ga0495638_0288208 3300046460 Bacteria 889
931 Ga0495638_0357994 3300046460 Bacteria 768
932 Ga0495641_0004776 3300046461 Bacteria 9430
933 Ga0495641_0050560 3300046461 Bacteria 1899
934 Ga0495641_0113029 3300046461 Bacteria 1211
935 Ga0495651_0001583 3300046462 Bacteria 17578
936 Ga0495651_0011447 3300046462 Bacteria 6814
937 Ga0495651_0021274 3300046462 Bacteria 5041
938 Ga0495651_0267716 3300046462 Bacteria 1160
939 Ga0495651_0441165 3300046462 Bacteria 843
940 Ga0495653_0017838 3300046463 Bacteria 5771
941 Ga0495653_0054134 3300046463 Bacteria 3067
942 Ga0495653_0105594 3300046463 Bacteria 2033
943 Ga0495653_0106781 3300046463 Bacteria 2018
944 Ga0495650_0037267 3300046471 Bacteria 2119
945 Ga0495580_0001382 3300046472 Bacteria 21285
946 Ga0495580_0017453 3300046472 Bacteria 5368
947 Ga0495582_0000298 3300046473 Bacteria 27399
948 Ga0495582_0084205 3300046473 Bacteria 1767
949 Ga0495582_0107351 3300046473 Bacteria 1567
950 Ga0495582_0611764 3300046473 Bacteria 630
951 Ga0495605_0213934 3300046474 Bacteria 835
952 Ga0495639_0010975 3300046475 Bacteria 3900
953 Ga0495639_0031933 3300046475 Bacteria 2347
954 Ga0495639_0049337 3300046475 Bacteria 1910
955 Ga0495639_0098650 3300046475 Bacteria 1377
956 Ga0495639_0212932 3300046475 Bacteria 948
957 Ga0495662_0000058 3300046476 Bacteria 37987
958 Ga0495662_0020780 3300046476 Bacteria 3175
959 Ga0495662_0161711 3300046476 Bacteria 1103
960 Ga0495662_0203530 3300046476 Bacteria 976
961 Ga0495664_0001921 3300046477 Bacteria 11062
962 Ga0495664_0013688 3300046477 Bacteria 4602
963 Ga0495664_0090590 3300046477 Bacteria 1838
964 Ga0495664_0383721 3300046477 Bacteria 844
965 Ga0495664_0416710 3300046477 Bacteria 806
966 Ga0495664_0563980 3300046477 Bacteria 678
967 Ga0495584_0189456 3300046491 Bacteria 1045
968 Ga0495585_0005331 3300046492 Bacteria 8121
969 Ga0495585_0086414 3300046492 Bacteria 1694
970 Ga0495585_0110393 3300046492 Bacteria 1463
971 Ga0495594_0000706 3300046499 Bacteria 17171
972 Ga0495596_0319181 3300046500 Bacteria 604
973 Ga0495607_0038517 3300046501 Bacteria 2863
974 Ga0495607_0122077 3300046501 Bacteria 1366
975 Ga0495583_0084495 3300046506 Bacteria 1375
976 Ga0495606_0000244 3300046507 Bacteria 95942
977 Ga0495606_0366097 3300046507 Bacteria 760
978 Ga0495608_0003424 3300046511 Bacteria 11358
979 Ga0495608_0004308 3300046511 Bacteria 10191
980 Ga0495608_0005405 3300046511 Bacteria 9133
981 Ga0495610_0125495 3300046512 Bacteria 1120
982 Ga0495616_0197382 3300046513 Bacteria 886
983 Ga0495618_0068835 3300046514 Bacteria 2250
984 Ga0495618_0086241 3300046514 Bacteria 2007
985 Ga0495618_0104808 3300046514 Bacteria 1811
986 Ga0495618_0178503 3300046514 Bacteria 1350
987 Ga0495618_0255209 3300046514 Bacteria 1099
988 Ga0495628_0003941 3300046516 Bacteria 13224
989 Ga0495628_0033779 3300046516 Bacteria 4119
990 Ga0495628_0881022 3300046516 Bacteria 622
991 Ga0495630_0001425 3300046517 Bacteria 16552
992 Ga0495630_0186544 3300046517 Bacteria 1582
993 Ga0495631_0212565 3300046518 Bacteria 826
994 Ga0495637_0286141 3300046520 Bacteria 587
995 Ga0495644_0004455 3300046523 Bacteria 5504
996 Ga0495648_0128765 3300046524 Bacteria 1349
997 Ga0495663_0134058 3300046525 Bacteria 837
998 Ga0495666_0307377 3300046526 Bacteria 716
999 Ga0495652_0008159 3300046529 Bacteria 9575
1000 Ga0495652_0047392 3300046529 Bacteria 3686
1001 Ga0495652_0123399 3300046529 Bacteria 2061
1002 Ga0495665_0000373 3300046531 Bacteria 22557
1003 Ga0495640_0001250 3300046533 Bacteria 19944
1004 Ga0495640_0022168 3300046533 Bacteria 4648
1005 Ga0495640_0027866 3300046533 Bacteria 4069
1006 Ga0495640_0087228 3300046533 Bacteria 2064
1007 Ga0495640_0318376 3300046533 Bacteria 964
1008 Ga0495586_0009720 3300046535 Bacteria 5123
1009 Ga0495586_0045341 3300046535 Bacteria 2369
1010 Ga0495586_0266277 3300046535 Bacteria 979
1011 Ga0495587_0006700 3300046536 Bacteria 7501
1012 Ga0495587_0012091 3300046536 Bacteria 5450
1013 Ga0495587_0290775 3300046536 Bacteria 915
1014 Ga0495598_0056136 3300046537 Bacteria 1201
1015 Ga0495621_0031404 3300046539 Bacteria 1822
1016 Ga0495645_0006904 3300046543 Bacteria 7888
1017 Ga0495645_0019421 3300046543 Bacteria 4893
1018 Ga0495622_0007642 3300046557 Bacteria 5021
1019 Ga0495622_0018157 3300046557 Bacteria 3276
1020 Ga0495622_0038008 3300046557 Bacteria 2241
1021 Ga0495622_0092726 3300046557 Bacteria 1387
1022 Ga0495633_0020440 3300046558 Bacteria 3330
1023 Ga0495667_0004119 3300046559 Bacteria 9769
1024 Ga0495667_0005627 3300046559 Bacteria 8469
1025 Ga0495667_0020636 3300046559 Bacteria 4445
1026 Ga0495667_0301807 3300046559 Bacteria 1014
1027 Ga0495656_0004069 3300046615 Bacteria 4978
1028 Ga0495656_0014584 3300046615 Bacteria 2949
1029 Ga0495656_0024854 3300046615 Bacteria 2370
1030 Ga0495656_0097828 3300046615 Bacteria 1352
1031 Ga0495634_0000502 3300046642 Bacteria 38371
1032 Ga0495634_0196724 3300046642 Bacteria 1254
1033 Ga0495634_0205717 3300046642 Bacteria 1220
1034 Ga0495634_0339479 3300046642 Bacteria 901
1035 Ga0495611_0024058 3300046648 Bacteria 2647
1036 Ga0495611_0046389 3300046648 Bacteria 1948
1037 Ga0495635_0026268 3300046663 Bacteria 4054
1038 Ga0495635_0027162 3300046663 Bacteria 3982
1039 Ga0495635_0088610 3300046663 Bacteria 2117
1040 Ga0495635_0226154 3300046663 Bacteria 1264
1041 Ga0495635_0257524 3300046663 Bacteria 1175
1042 Ga0495635_0588762 3300046663 Bacteria 727
1043 Ga0495659_0113415 3300046664 Bacteria 1060
1044 Ga0495659_0131080 3300046664 Bacteria 994
1045 Ga0495661_0037544 3300046665 Bacteria 3024
1046 Ga0495588_0033151 3300046674 Bacteria 2607
1047 Ga0495588_0367329 3300046674 Bacteria 756
1048 Ga0495657_0005728 3300046675 Bacteria 9787
1049 Ga0495657_0009308 3300046675 Bacteria 7453
1050 Ga0495657_0014712 3300046675 Bacteria 5742
1051 Ga0495657_0043085 3300046675 Bacteria 3079
1052 Ga0495657_0049829 3300046675 Bacteria 2819
1053 Ga0495657_0073439 3300046675 Bacteria 2228
1054 Ga0495599_0001288 3300046678 Bacteria 14233
1055 Ga0495599_0007174 3300046678 Bacteria 6748
1056 Ga0495599_0056898 3300046678 Bacteria 2447
1057 Ga0495599_0088610 3300046678 Bacteria 1932
1058 Ga0495599_0139731 3300046678 Bacteria 1503
1059 Ga0495623_0000561 3300046679 Bacteria 24733
1060 Ga0495623_0010099 3300046679 Bacteria 6110
1061 Ga0495623_0033866 3300046679 Bacteria 3277
1062 Ga0495623_0148515 3300046679 Bacteria 1387
1063 Ga0495646_0022284 3300046680 Bacteria 3997
1064 Ga0495646_0031540 3300046680 Bacteria 3301
1065 Ga0495646_0056756 3300046680 Bacteria 2346
1066 Ga0495647_0003354 3300046681 Bacteria 5131
1067 Ga0495647_0021361 3300046681 Bacteria 2329
1068 Ga0495647_0051974 3300046681 Bacteria 1594
1069 Ga0495647_0058447 3300046681 Bacteria 1516
1070 Ga0495647_0170290 3300046681 Bacteria 943
1071 Ga0495658_0000368 3300046683 Bacteria 25300
1072 Ga0495658_0026598 3300046683 Bacteria 3102
1073 Ga0495658_0365438 3300046683 Bacteria 918
1074 Ga0495669_0013841 3300046684 Bacteria 3443
1075 Ga0495669_0033841 3300046684 Bacteria 2251
1076 Ga0495613_0014196 3300046689 Bacteria 5909
1077 Ga0495613_0027749 3300046689 Bacteria 4214
1078 Ga0495613_0071390 3300046689 Bacteria 2531
1079 Ga0495613_0073462 3300046689 Bacteria 2492
1080 Ga0495613_0365715 3300046689 Bacteria 988
1081 Ga0495613_0377767 3300046689 Bacteria 969
1082 Ga0495613_0382676 3300046689 Bacteria 962
1083 Ga0495624_0008081 3300046690 Bacteria 7365
1084 Ga0495624_0163514 3300046690 Bacteria 1359
1085 Ga0495624_0328704 3300046690 Bacteria 920
1086 Ga0495670_0029218 3300046691 Bacteria 2735
1087 Ga0495671_0179382 3300046692 Bacteria 1029
1088 Ga0495600_0011917 3300046809 Bacteria 5431
1089 Ga0495600_0023752 3300046809 Bacteria 3944
1090 Ga0495600_0076875 3300046809 Bacteria 2180
1091 Ga0495600_0102678 3300046809 Bacteria 1863
1092 Ga0495600_0185265 3300046809 Bacteria 1340
1093 Ga0495600_0271510 3300046809 Bacteria 1075
1094 Ga0495600_0360413 3300046809 Bacteria 909
1095 Ga0495600_0408156 3300046809 Bacteria 844
1096 Ga0495600_0479097 3300046809 Bacteria 767
1097 Ga0495581_0000111 3300047315 Bacteria 34508
1098 Ga0495581_0104762 3300047315 Bacteria 1644
1099 Ga0495581_0114739 3300047315 Bacteria 1567
1100 Ga0495581_0215942 3300047315 Bacteria 1121
1101 Ga0495581_0454754 3300047315 Bacteria 745
1102 Ga0495581_0455455 3300047315 Bacteria 745
1103 Ga0495581_0613048 3300047315 Bacteria 630
1104 Ga0495604_0002451 3300047317 Bacteria 14835
1105 Ga0495604_0010885 3300047317 Bacteria 7222
1106 Ga0495604_0045227 3300047317 Bacteria 3436
1107 Ga0495604_0080611 3300047317 Bacteria 2438
1108 Ga0495604_0145039 3300047317 Bacteria 1692
1109 Ga0495604_0147574 3300047317 Bacteria 1675
1110 Ga0495604_0272889 3300047317 Bacteria 1145
1111 Ga0495674_0004341 3300047319 Bacteria 13630
1112 Ga0495674_0015128 3300047319 Bacteria 7217
1113 Ga0495674_0030334 3300047319 Bacteria 4918
1114 Ga0495674_0077544 3300047319 Bacteria 2856
1115 Ga0495674_0120988 3300047319 Bacteria 2211
1116 Ga0495674_0136513 3300047319 Bacteria 2063
1117 Ga0495674_0170662 3300047319 Bacteria 1815
1118 Ga0495674_0490191 3300047319 Bacteria 984
1119 Ga0495672_0015836 3300047320 Bacteria 5104
1120 Ga0495676_0079737 3300047321 Bacteria 2488
1121 Ga0495680_0004114 3300047322 Bacteria 13987
1122 Ga0495680_0039523 3300047322 Bacteria 3762
1123 Ga0495680_0044193 3300047322 Bacteria 3523
1124 Ga0495680_0052359 3300047322 Bacteria 3182
1125 Ga0495680_0071985 3300047322 Bacteria 2630
1126 Ga0495680_0086764 3300047322 Bacteria 2354
1127 Ga0495680_0117653 3300047322 Bacteria 1964
1128 Ga0495680_0839839 3300047322 Bacteria 597
1129 Ga0495683_0190593 3300047323 Bacteria 930
1130 Ga0495683_0218220 3300047323 Bacteria 851
1131 Ga0495675_0004565 3300047444 Bacteria 8398
1132 Ga0495675_0050347 3300047444 Bacteria 2647
1133 Ga0495675_0055058 3300047444 Bacteria 2523
1134 Ga0495675_0152464 3300047444 Bacteria 1427
1135 Ga0495677_0105993 3300047445 Bacteria 1066
1136 Ga0495677_0164397 3300047445 Bacteria 857
1137 Ga0495679_025907 3300047446 Bacteria 1954
1138 Ga0495685_023471 3300047447 Bacteria 2124
1139 Ga0495673_0266038 3300047469 Bacteria 622
1140 Ga0495684_0025696 3300047471 Bacteria 4524
1141 Ga0495684_0088322 3300047471 Bacteria 2349
1142 Ga0495684_0101123 3300047471 Bacteria 2179
1143 Ga0495684_0106142 3300047471 Bacteria 2122
1144 Ga0495684_0205519 3300047471 Bacteria 1450
1145 Ga0495686_0059342 3300047472 Bacteria 2382
1146 Ga0495686_0365850 3300047472 Bacteria 781
1147 Ga0495593_0000210 3300047673 Bacteria 30957
1148 Ga0495593_0001699 3300047673 Bacteria 13052
1149 Ga0495593_0018230 3300047673 Bacteria 3947
1150 Ga0495593_0077811 3300047673 Bacteria 1718
1151 Ga0495593_0240855 3300047673 Bacteria 906
1152 Ga0495602_0007289 3300048088 Bacteria 11579
1153 Ga0495602_0023526 3300048088 Bacteria 6000
1154 Ga0495602_0085736 3300048088 Bacteria 2631
1155 Ga0495602_0169545 3300048088 Bacteria 1695
1156 Ga0495602_0834180 3300048088 Bacteria 617
1157 Ga0495615_0007972 3300048090 Bacteria 2030
1158 Ga0496100_0013868 3300048903 Bacteria 4663
1159 Ga0496100_0031298 3300048903 Bacteria 3307
1160 Ga0496100_0039813 3300048903 Bacteria 2986
1161 Ga0496100_0272099 3300048903 Bacteria 1260
1162 Ga0496100_0274677 3300048903 Bacteria 1254
1163 Ga0496101_0010824 3300048904 Bacteria 6033
1164 Ga0496101_0021299 3300048904 Bacteria 4453
1165 Ga0496101_0048045 3300048904 Bacteria 3065
1166 Ga0496101_0231465 3300048904 Bacteria 1436
1167 Ga0496101_0540858 3300048904 Bacteria 921
1168 Ga0496101_0601859 3300048904 Bacteria 869
1169 Ga0496102_0003826 3300048905 Bacteria 12731
1170 Ga0496102_0014510 3300048905 Bacteria 6845
1171 Ga0496102_0036014 3300048905 Bacteria 4457
1172 Ga0496102_0053738 3300048905 Bacteria 3671
1173 Ga0496102_0084735 3300048905 Bacteria 2926
1174 Ga0496102_0095808 3300048905 Bacteria 2751
1175 Ga0496102_0165557 3300048905 Bacteria 2080
1176 Ga0496102_0212492 3300048905 Bacteria 1824
1177 Ga0496102_0560670 3300048905 Bacteria 1065
1178 Ga0496102_0949495 3300048905 Bacteria 781
1179 Ga0496103_0027030 3300048906 Bacteria 3474
1180 Ga0496103_0031918 3300048906 Bacteria 3212
1181 Ga0496103_0047160 3300048906 Bacteria 2661
1182 Ga0496103_0082735 3300048906 Bacteria 2020
1183 Ga0496103_0222421 3300048906 Bacteria 1214
1184 Ga0496103_0355607 3300048906 Bacteria 942
1185 Ga0496103_0407292 3300048906 Bacteria 873
1186 Ga0496104_0000092 3300048907 Bacteria 87232
1187 Ga0496104_0029318 3300048907 Bacteria 5103
1188 Ga0496104_0054677 3300048907 Bacteria 3773
1189 Ga0496104_0083527 3300048907 Bacteria 3045
1190 Ga0496104_0258891 3300048907 Bacteria 1653
1191 Ga0496105_0010163 3300048908 Bacteria 7395
1192 Ga0496105_0014761 3300048908 Bacteria 6218
1193 Ga0496105_0115766 3300048908 Bacteria 2211
1194 Ga0496105_0149675 3300048908 Bacteria 1919
1195 Ga0496105_0328900 3300048908 Bacteria 1224
1196 Ga0496105_0349912 3300048908 Bacteria 1180
1197 Ga0496106_0018269 3300048909 Bacteria 5183
1198 Ga0496106_0026335 3300048909 Bacteria 4330
1199 Ga0496106_0043409 3300048909 Bacteria 3373
1200 Ga0496106_0093077 3300048909 Bacteria 2329
1201 Ga0496106_0116123 3300048909 Bacteria 2088
1202 Ga0496106_0187436 3300048909 Bacteria 1644
1203 Ga0496106_0380089 3300048909 Bacteria 1135
1204 Ga0496106_0777378 3300048909 Bacteria 760
1205 Ga0496107_0000413 3300048910 Bacteria 23209
1206 Ga0496107_0005993 3300048910 Bacteria 8332
1207 Ga0496107_0027280 3300048910 Bacteria 4055
1208 Ga0496107_0098442 3300048910 Bacteria 2142
1209 Ga0496107_0556556 3300048910 Bacteria 849
1210 Ga0496107_0737727 3300048910 Bacteria 723
1211 Ga0496107_1127447 3300048910 Bacteria 566
1212 Ga0496108_0072631 3300048911 Bacteria 2904
1213 Ga0496108_0131555 3300048911 Bacteria 2151
1214 Ga0496108_0170603 3300048911 Bacteria 1882
1215 Ga0496108_0318675 3300048911 Bacteria 1355
1216 Ga0496108_0479037 3300048911 Bacteria 1087
1217 Ga0496108_0913918 3300048911 Bacteria 753
1218 Ga0496109_0041987 3300048912 Bacteria 4142
1219 Ga0496109_0056255 3300048912 Bacteria 3590
1220 Ga0496109_0064124 3300048912 Bacteria 3361
1221 Ga0496109_0136268 3300048912 Bacteria 2294
1222 Ga0496109_0313116 3300048912 Bacteria 1481
1223 Ga0496109_0572210 3300048912 Bacteria 1065
1224 Ga0496110_0008222 3300048913 Bacteria 8385
1225 Ga0496110_0124245 3300048913 Bacteria 2327
1226 Ga0496110_0271367 3300048913 Bacteria 1544
1227 Ga0496110_0589019 3300048913 Bacteria 1009
1228 Ga0496110_0700571 3300048913 Bacteria 914
1229 Ga0496110_0826296 3300048913 Bacteria 831
1230 Ga0496111_0204487 3300048914 Bacteria 1467
1231 Ga0496111_0426690 3300048914 Bacteria 979
1232 Ga0496111_0515014 3300048914 Bacteria 880
1233 Ga0496111_0631176 3300048914 Bacteria 783
1234 Ga0496112_0000019 3300048915 Bacteria 185531
1235 Ga0496112_0033962 3300048915 Bacteria 4962
1236 Ga0496112_0035449 3300048915 Bacteria 4861
1237 Ga0496112_0091791 3300048915 Bacteria 3005
1238 Ga0496112_0115995 3300048915 Bacteria 2648
1239 Ga0496112_0121752 3300048915 Bacteria 2579
1240 Ga0496112_0135932 3300048915 Bacteria 2429
1241 Ga0496112_0425994 3300048915 Bacteria 1265
1242 Ga0496112_0888932 3300048915 Bacteria 813
1243 Ga0496112_0951924 3300048915 Bacteria 780
1244 Ga0496113_0006958 3300048916 Bacteria 7228
1245 Ga0496113_0082214 3300048916 Bacteria 2470
1246 Ga0496113_0118841 3300048916 Bacteria 2065
1247 Ga0496113_0134271 3300048916 Bacteria 1944
1248 Ga0496113_0288685 3300048916 Bacteria 1312
1249 Ga0496113_1062826 3300048916 Bacteria 636
1250 Ga0496114_0020155 3300048917 Bacteria 5410
1251 Ga0496114_0029656 3300048917 Bacteria 4498
1252 Ga0496114_0118237 3300048917 Bacteria 2277
1253 Ga0496114_0189966 3300048917 Bacteria 1797
1254 Ga0496114_0367457 3300048917 Bacteria 1273
1255 Ga0496115_0005968 3300048918 Bacteria 8892
1256 Ga0496115_0041613 3300048918 Bacteria 3657
1257 Ga0496115_0068457 3300048918 Bacteria 2874
1258 Ga0496115_0088634 3300048918 Bacteria 2526
1259 Ga0496115_0122044 3300048918 Bacteria 2144
1260 Ga0496115_0340906 3300048918 Bacteria 1223
1261 Ga0496115_0591285 3300048918 Bacteria 883
1262 Ga0496116_0235858 3300048919 Bacteria 923
1263 Ga0496118_0001892 3300048921 Bacteria 29856
1264 Ga0496118_0142679 3300048921 Bacteria 1515
1265 Ga0496119_0031735 3300048922 Bacteria 3534
1266 Ga0496119_0119999 3300048922 Bacteria 1447
1267 Ga0496120_0013537 3300048923 Bacteria 5487
1268 Ga0496121_0000041 3300048924 Bacteria 346686
1269 Ga0496121_0033571 3300048924 Bacteria 4640
1270 Ga0496121_0044283 3300048924 Bacteria 3841
1271 Ga0496121_0067477 3300048924 Bacteria 2899
1272 Ga0496121_0105901 3300048924 Bacteria 2157
1273 Ga0496121_0224299 3300048924 Bacteria 1321
1274 Ga0496121_0229998 3300048924 Bacteria 1299
1275 Ga0496121_0297335 3300048924 Bacteria 1097
1276 Ga0496124_0001646 3300048927 Bacteria 31986
1277 Ga0496124_0124699 3300048927 Bacteria 2053
1278 Ga0496124_0297680 3300048927 Bacteria 1167
1279 Ga0496125_0033775 3300048928 Bacteria 4520
1280 Ga0496125_0290992 3300048928 Bacteria 1006
1281 Ga0496125_0353060 3300048928 Bacteria 877
1282 Ga0496126_0002010 3300048929 Bacteria 28750
1283 Ga0496126_0007412 3300048929 Bacteria 12034
1284 Ga0496126_0010298 3300048929 Bacteria 9818
1285 Ga0496126_0113225 3300048929 Bacteria 2362
1286 Ga0496126_0150115 3300048929 Bacteria 1998
1287 Ga0496126_0191731 3300048929 Bacteria 1731
1288 Ga0496126_0717694 3300048929 Bacteria 775
1289 Ga0495678_046165 3300049459 Bacteria 1714
1290 Ga0495682_0090779 3300049460 Bacteria 1097
1291 Ga0501031_0029819 3300049568 Bacteria 3558
1292 Ga0501032_0103321 3300049569 Bacteria 1888
1293 Ga0501032_0407103 3300049569 Bacteria 873
1294 Ga0501033_0009836 3300049570 Bacteria 7337
1295 Ga0501033_0027573 3300049570 Bacteria 4270
1296 Ga0501033_0117230 3300049570 Bacteria 1934
1297 Ga0501034_0000676 3300049571 Bacteria 51758
1298 Ga0501034_0044391 3300049571 Bacteria 4496
1299 Ga0501034_0074265 3300049571 Bacteria 3409
1300 Ga0501034_0100985 3300049571 Bacteria 2879
1301 Ga0501034_0401934 3300049571 Bacteria 1292
1302 Ga0501036_0000390 3300049572 Bacteria 30889
1303 Ga0501036_0053603 3300049572 Bacteria 3415
1304 Ga0501036_0282978 3300049572 Bacteria 1388
1305 Ga0501037_0000755 3300049573 Bacteria 24430
1306 Ga0501037_0019397 3300049573 Bacteria 5016
1307 Ga0501037_0182774 3300049573 Bacteria 1487
1308 Ga0501038_0000089 3300049574 Bacteria 78009
1309 Ga0501038_0107188 3300049574 Bacteria 2318
1310 Ga0501038_0515883 3300049574 Bacteria 912
1311 Ga0501039_0000114 3300049575 Bacteria 54651
1312 Ga0501039_0077389 3300049575 Bacteria 2587
1313 Ga0501043_0001086 3300049579 Bacteria 23917
1314 Ga0501043_0058521 3300049579 Bacteria 3025
1315 Ga0501043_0089204 3300049579 Bacteria 2424
1316 Ga0501043_0368843 3300049579 Bacteria 1088
1317 Ga0501046_0006291 3300049580 Bacteria 10525
1318 Ga0501046_0135722 3300049580 Bacteria 1864
1319 Ga0501046_0182257 3300049580 Bacteria 1570
1320 Ga0501047_0000594 3300049581 Bacteria 38494
1321 Ga0501047_0061423 3300049581 Bacteria 3626
1322 Ga0501047_0094399 3300049581 Bacteria 2870
1323 Ga0501047_0285178 3300049581 Bacteria 1495
1324 Ga0501047_0658280 3300049581 Bacteria 866
1325 Ga0501047_0701637 3300049581 Bacteria 829
1326 Ga0501048_0015151 3300049582 Bacteria 5697
1327 Ga0501048_0040990 3300049582 Bacteria 3317
1328 Ga0501067_0000445 3300049583 Bacteria 22645
1329 Ga0501067_0239075 3300049583 Bacteria 1011
1330 Ga0501068_0004210 3300049584 Bacteria 7804
1331 Ga0501069_0037736 3300049585 Bacteria 2666
1332 Ga0501069_0126786 3300049585 Bacteria 1460
1333 Ga0501069_0262932 3300049585 Bacteria 1008
1334 Ga0501070_0017778 3300049586 Bacteria 5970
1335 Ga0501070_0318087 3300049586 Bacteria 1266
1336 Ga0501070_0509375 3300049586 Bacteria 966
1337 Ga0501071_0516444 3300049587 Bacteria 916
1338 Ga0501072_0029426 3300049588 Bacteria 4291
1339 Ga0501072_0469243 3300049588 Bacteria 996
1340 Ga0501073_0000055 3300049589 Bacteria 71726
1341 Ga0501073_0295890 3300049589 Bacteria 1117
1342 Ga0501073_0496654 3300049589 Bacteria 844
1343 Ga0501074_0000492 3300049590 Bacteria 24146
1344 Ga0501076_0049686 3300049592 Bacteria 3318
1345 Ga0501079_0355125 3300049741 Bacteria 1149
1346 Ga0501079_0888412 3300049741 Bacteria 702
1347 Ga0501080_0008079 3300049742 Bacteria 9533
1348 Ga0501080_0551719 3300049742 Bacteria 1026
1349 Ga0501081_0184085 3300049743 Bacteria 1512
1350 Ga0501083_0000570 3300049744 Bacteria 23630
1351 Ga0501268_007552 3300049765 Bacteria 1624
1352 Ga0501270_035015 3300049767 Bacteria 848
1353 Ga0501035_0000150 3300049822 Bacteria 85450
1354 Ga0501035_0015014 3300049822 Bacteria 7148
1355 Ga0501035_0041388 3300049822 Bacteria 4160
1356 Ga0501044_0000546 3300049823 Bacteria 45906
1357 Ga0501044_0133658 3300049823 Bacteria 2473
1358 Ga0501045_0004352 3300049824 Bacteria 9762
1359 nmdc:mga03683_14262_c1 3300050489 Bacteria 2938
1360 nmdc:mga03683_228854_c1 3300050489 Bacteria 859
1361 nmdc:mga03n38_228283_c1 3300050490 Bacteria 975
1362 nmdc:mga03n38_352282_c1 3300050490 Bacteria 801
1363 nmdc:mga03n38_396_c1 3300050490 Bacteria 10795
1364 nmdc:mga03n38_57464_c1 3300050490 Bacteria 1453
1365 nmdc:mga00v17_314999_c1 3300050491 Bacteria 1017
1366 nmdc:mga00v17_74792_c1 3300050491 Bacteria 2106
1367 nmdc:mga0yw44_188114_c1 3300050492 Bacteria 1361
1368 nmdc:mga0yw44_399816_c1 3300050492 Bacteria 929
1369 nmdc:mga0yw44_42855_c1 3300050492 Bacteria 2700
1370 nmdc:mga0k408_155771_c1 3300050493 Bacteria 1361
1371 nmdc:mga0k408_445384_c1 3300050493 Bacteria 769
1372 nmdc:mga06z11_303802_c1 3300050494 Bacteria 949
1373 nmdc:mga06z11_413112_c1 3300050494 Bacteria 813
1374 nmdc:mga06z11_43911_c1 3300050494 Bacteria 2252
1375 nmdc:mga06z11_46886_c1 3300050494 Bacteria 2192
1376 nmdc:mga04h51_191527_c1 3300050495 Bacteria 800
1377 nmdc:mga04h51_352799_c1 3300050495 Bacteria 608
1378 nmdc:mga04h51_59698_c1 3300050495 Bacteria 1304
1379 nmdc:mga07m45_285396_c1 3300050496 Bacteria 960
1380 nmdc:mga07m45_70970_c1 3300050496 Bacteria 1982
1381 nmdc:mga07m45_7432_c2 3300050496 Bacteria 4438
1382 nmdc:mga09592_229993_c1 3300050508 Bacteria 1606
1383 nmdc:mga08y16_196474_c1 3300050511 Bacteria 2091
1384 nmdc:mga08y16_624774_c1 3300050511 Bacteria 1084
1385 nmdc:mga08y16_822569_c1 3300050511 Bacteria 920
1386 nmdc:mga0n895_405792_c1 3300050512 Bacteria 1378
1387 nmdc:mga0rr50_18584_c1 3300050513 Bacteria 4673
1388 nmdc:mga0rr50_230449_c1 3300050513 Bacteria 1532
1389 nmdc:mga0rr50_28264_c1 3300050513 Bacteria 3940
1390 nmdc:mga0rr50_493683_c1 3300050513 Bacteria 1040
1391 nmdc:mga08x19_168362_c1 3300050514 Bacteria 1491
1392 nmdc:mga08x19_37303_c1 3300050514 Bacteria 3084
1393 Ga0495601_0005470 3300053077 Bacteria 7402
1394 Ga0495601_0006095 3300053077 Bacteria 7035
1395 Ga0495601_0009462 3300053077 Bacteria 5765
1396 Ga0495601_0044953 3300053077 Bacteria 2776
1397 Ga0495601_0055833 3300053077 Bacteria 2501
1398 Ga0495612_0004289 3300053078 Bacteria 5919
1399 Ga0495612_0004506 3300053078 Bacteria 5783
1400 Ga0495612_0121780 3300053078 Bacteria 1122
1401 Ga0495612_0229798 3300053078 Bacteria 823
1402 Ga0500635_0006552 3300053080 Bacteria 3116
1403 Ga0500635_0011829 3300053080 Bacteria 2490
1404 Ga0495595_0003866 3300053084 Bacteria 5973
1405 Ga0495595_0010491 3300053084 Bacteria 3851
1406 Ga0495595_0039038 3300053084 Bacteria 2165
1407 Ga0495595_0152050 3300053084 Bacteria 1139
1408 Ga0495595_0326670 3300053084 Bacteria 773
1409 Ga0495619_0001147 3300053085 Bacteria 17396
1410 Ga0495619_0006353 3300053085 Bacteria 7490
1411 Ga0495619_0007969 3300053085 Bacteria 6703
1412 Ga0495619_0104451 3300053085 Bacteria 1931
1413 Ga0495619_0191657 3300053085 Bacteria 1415
1414 Ga0495619_0206941 3300053085 Bacteria 1358
1415 Ga0495619_0567861 3300053085 Bacteria 777
1416 Ga0495619_0658832 3300053085 Bacteria 713
1417 Ga0500578_0228085 3300053086 Bacteria 1130
1418 Ga0500581_121507 3300053089 Bacteria 1261
1419 Ga0500647_0118789 3300053091 Bacteria 1252
1420 Ga0500583_0161163 3300053092 Bacteria 1117
1421 Ga0500651_0191125 3300053093 Bacteria 1212
1422 Ga0500651_0230419 3300053093 Bacteria 1083
1423 Ga0500566_0000047 3300053094 Bacteria 58577
1424 Ga0500566_0127826 3300053094 Bacteria 1363
1425 Ga0500640_005664 3300053095 Bacteria 4687
1426 Ga0500641_0048999 3300053096 Bacteria 1732
1427 Ga0500648_089452 3300053097 Bacteria 1724
1428 Ga0500554_001109 3300053102 Bacteria 5208
1429 Ga0500554_002996 3300053102 Bacteria 3394
1430 Ga0500555_028745 3300053103 Bacteria 1582
1431 Ga0500569_063636 3300053109 Bacteria 1145
1432 Ga0500572_000071 3300053111 Bacteria 32122
1433 Ga0500593_059848 3300053117 Bacteria 1675
1434 Ga0500594_0070853 3300053118 Bacteria 1025
1435 Ga0500595_001904 3300053119 Bacteria 10754
1436 Ga0500595_024231 3300053119 Bacteria 2121
1437 Ga0500595_031318 3300053119 Bacteria 1785
1438 Ga0500608_007594 3300053122 Bacteria 4499
1439 Ga0500559_0002362 3300053136 Bacteria 9841
1440 Ga0500559_0075491 3300053136 Bacteria 1525
1441 Ga0500559_0096906 3300053136 Bacteria 1355
1442 Ga0500568_0081443 3300053139 Bacteria 1229
1443 Ga0500568_0085017 3300053139 Bacteria 1198
1444 Ga0500573_0119855 3300053140 Bacteria 1465
1445 Ga0500603_000727 3300053150 Bacteria 8020
1446 Ga0500603_014206 3300053150 Bacteria 1856
1447 Ga0500603_037659 3300053150 Bacteria 1277
1448 Ga0500622_0111185 3300053156 Bacteria 1338
1449 Ga0500627_0080484 3300053158 Bacteria 1452
1450 Ga0500627_0362645 3300053158 Bacteria 623
1451 Ga0500638_066884 3300053162 Bacteria 1722
1452 Ga0500638_096934 3300053162 Bacteria 1381
1453 Ga0500638_118331 3300053162 Bacteria 1215
1454 Ga0500639_000087 3300053163 Bacteria 43854
1455 Ga0500639_242849 3300053163 Bacteria 729
1456 Ga0500636_0005004 3300053177 Bacteria 7522
1457 Ga0500636_0028275 3300053177 Bacteria 3312
1458 Ga0500636_0083515 3300053177 Bacteria 1837
1459 Ga0500637_0000075 3300053178 Bacteria 35551
1460 Ga0500637_0009481 3300053178 Bacteria 4957
1461 Ga0500637_0142017 3300053178 Bacteria 1389
1462 Ga0500609_040507 3300053731 Bacteria 644
1463 Ga0500596_000317 3300053735 Bacteria 8601
1464 Ga0500596_000832 3300053735 Bacteria 6123
1465 Ga0501084_0001259 3300054114 Bacteria 19951
1466 Ga0587073_0066800 3300059492 Bacteria 858
1467 Ga0466962_0069810 3300061719 Bacteria 1678
1468 2513719099 2513237104 Bacteria 10034502
1469 2818236969 2816332527 Bacteria 8933356
1470 2847937924 2847930680 Bacteria 9342022
1471 2881673577 2881665667 Bacteria 8175609
1472 Ga0496115_0472353
1473 LJQas_1005980
1474 JGI24743J22301_10028486
1475 JGI24743J22301_10103649
1476 JGI24750J21931_1012237
1477 JGI24742J22300_10013387
1478 JGI25152J39213_1000745
1479 Ga0006759J45824_1037742
1480 JGI25151J46595_10106669
1481 JGI25406J46586_10000059
1482 JGI25406J46586_10007521
1483 JGI25406J46586_10143509
1484 JGI25153J46596_10011069
1485 JGI25153J46596_10037544
1486 rootL2_10093812
1487 JGI25160J50197_1054415
1488 Ga0007410J51695_1030993
1489 Ga0007409J51694_1027806
1490 Ga0007416J51690_1028980
1491 JGI25404J52841_10003695
1492 JGI25404J52841_10030787
1493 JGI25404J52841_10031173
1494 Ga0032354_1044282
1495 Ga0055524_1003255
1496 Ga0055528_1008764
1497 Ga0070658_10083389
1498 Ga0070658_10817691
1499 Ga0070683_100051065
1500 Ga0070683_100080636
1501 Ga0070683_100151700
1502 Ga0070683_100386092
1503 Ga0070690_100152935
1504 Ga0070670_100132673
1505 Ga0070670_100407803
1506 Ga0068869_100012858
1507 Ga0068869_100099243
1508 Ga0070666_10713675
1509 Ga0070666_10753730
1510 Ga0070680_100080487
1511 Ga0070680_100104534
1512 Ga0070682_100008826
1513 Ga0070682_100152588
1514 Ga0068868_100084787
1515 Ga0068868_100176070
1516 Ga0068868_100634513
1517 Ga0068868_101067796
1518 Ga0070660_100035398
1519 Ga0070660_100054026
1520 Ga0070660_100097370
1521 Ga0070660_100401839
1522 Ga0070691_10120903
1523 Ga0070691_10247457
1524 Ga0070691_10302377
1525 Ga0070687_100061792
1526 Ga0070661_100198876
1527 Ga0070661_100378467
1528 Ga0070661_100472106
1529 Ga0070692_10073551
1530 Ga0070668_100031715
1531 Ga0070668_100040421
1532 Ga0070668_100157364
1533 Ga0070668_100204541
1534 Ga0070668_100561624
1535 Ga0070668_100571551
1536 Ga0070668_101086858
1537 Ga0070669_100266004
1538 Ga0070669_100370418
1539 Ga0070675_100079587
1540 Ga0070675_100103521
1541 Ga0070675_100294812
1542 Ga0070675_100615351
1543 Ga0070671_100026694
1544 Ga0070671_100175359
1545 Ga0070671_100417025
1546 Ga0070671_100603694
1547 Ga0070674_100092759
1548 Ga0070674_100289346
1549 Ga0070674_100461795
1550 Ga0070673_100093160
1551 Ga0070673_100210846
1552 Ga0070673_100450096
1553 Ga0070659_100050323
1554 Ga0070659_100055590
1555 Ga0070659_100189730
1556 Ga0070667_100123818
1557 Ga0070667_100410461
1558 Ga0070667_100432849
1559 Ga0070667_100561577
1560 Ga0070667_100595088
1561 Ga0070709_10002549
1562 Ga0070709_10216301
1563 Ga0070709_10296213
1564 Ga0070709_10737949
1565 Ga0070714_100017549
1566 Ga0070714_100079600
1567 Ga0070714_100153352
1568 Ga0070714_100171182
1569 Ga0070714_100286614
1570 Ga0070714_100495303
1571 Ga0070714_101299641
1572 Ga0070713_100021104
1573 Ga0070713_100046951
1574 Ga0070713_100129027
1575 Ga0070713_100141916
1576 Ga0070713_100201879
1577 Ga0070713_100392014
1578 Ga0070710_10001133
1579 Ga0070710_10001588
1580 Ga0070710_10072511
1581 Ga0070701_10408995
1582 Ga0070711_100022855
1583 Ga0070711_100028547
1584 Ga0070711_100029901
1585 Ga0070711_100114998
1586 Ga0070711_100149200
1587 Ga0070711_100159380
1588 Ga0070711_100649064
1589 Ga0070711_101025161
1590 Ga0070705_100021702
1591 Ga0070700_100468237
1592 Ga0070694_100183472
1593 Ga0070694_100281682
1594 Ga0070663_100005186
1595 Ga0070663_100024885
1596 Ga0070663_100036027
1597 Ga0070663_100055427
1598 Ga0070663_100093910
1599 Ga0070663_100105864
1600 Ga0070663_100169900
1601 Ga0070663_101138436
1602 Ga0070663_101360177
1603 Ga0070678_100027340
1604 Ga0070678_100045615
1605 Ga0070678_100048909
1606 Ga0070678_100058003
1607 Ga0070678_100094259
1608 Ga0070678_100170436
1609 Ga0070678_100196302
1610 Ga0070678_100444595
1611 Ga0070662_100202863
1612 Ga0070662_100468085
1613 Ga0070662_100970859
1614 Ga0070681_10114500
1615 Ga0070681_10141762
1616 Ga0070681_10230246
1617 Ga0070681_10935179
1618 Ga0068867_100056464
1619 Ga0068867_100340415
1620 Ga0068867_100794978
1621 Ga0070679_100028002
1622 Ga0070679_100130502
1623 Ga0070679_100578181
1624 Ga0070684_100062718
1625 Ga0070684_100113862
1626 Ga0070684_100900962
1627 Ga0070684_101292141
1628 Ga0070697_100044453
1629 Ga0070697_100210890
1630 Ga0070697_100814050
1631 Ga0068853_100043068
1632 Ga0068853_100054893
1633 Ga0068853_100095328
1634 Ga0068853_100217170
1635 Ga0068853_100848991
1636 Ga0070672_100071918
1637 Ga0070672_100236778
1638 Ga0070672_100304288
1639 Ga0070672_100339287
1640 Ga0070686_100035539
1641 Ga0070686_100064426
1642 Ga0070686_100080748
1643 Ga0070686_100657932
1644 Ga0070695_100035990
1645 Ga0070695_100056454
1646 Ga0070695_100193301
1647 Ga0070696_100037314
1648 Ga0070696_100257156
1649 Ga0070693_100142645
1650 Ga0070665_100009678
1651 Ga0070665_100095813
1652 Ga0070665_100133556
1653 Ga0070665_100332250
1654 Ga0070665_100541937
1655 Ga0070665_100724468
1656 Ga0070704_100121374
1657 Ga0070704_100512502
1658 Ga0068855_100031250
1659 Ga0068855_100039857
1660 Ga0068855_100154928
1661 Ga0068855_100190258
1662 Ga0068855_100291605
1663 Ga0068855_100684790
1664 Ga0068855_101483766
1665 Ga0070664_100050996
1666 Ga0070664_100083336
1667 Ga0070664_100129858
1668 Ga0070664_100494421
1669 Ga0070664_101202557
1670 Ga0068857_100070550
1671 Ga0068857_100181544
1672 Ga0068857_100800249
1673 Ga0068854_100219301
1674 Ga0068854_100286941
1675 Ga0068854_100342789
1676 Ga0068856_100000511
1677 Ga0068856_100091527
1678 Ga0068856_100225258
1679 Ga0068856_100385155
1680 Ga0068856_100491919
1681 Ga0068856_100694966
1682 Ga0068856_100940744
1683 Ga0070702_100026998
1684 Ga0070702_100071471
1685 Ga0070702_100246957
1686 Ga0070702_100254808
1687 Ga0068852_100021775
1688 Ga0068852_100031309
1689 Ga0068852_100441644
1690 Ga0068852_100757262
1691 Ga0068852_101684418
1692 Ga0068859_100623050
1693 Ga0068859_100692329
1694 Ga0068859_101915527
1695 Ga0068864_100047146
1696 Ga0068864_100199967
1697 Ga0068864_100275003
1698 Ga0068866_10011560
1699 Ga0068866_10074048
1700 Ga0068866_10157614
1701 Ga0068866_10974449
1702 Ga0068861_100087226
1703 Ga0068861_100190154
1704 Ga0068861_100469212
1705 Ga0068851_10061528
1706 Ga0068870_10060195
1707 Ga0068870_10276175
1708 Ga0068863_100433467
1709 Ga0068858_100093121
1710 Ga0068858_100184258
1711 Ga0068860_100041049
1712 Ga0068860_100088918
1713 Ga0068860_100120729
1714 Ga0068860_100127254
1715 Ga0068860_100249916
1716 Ga0068860_100508524
1717 Ga0068862_100414626
1718 Ga0068862_100415954
1719 Ga0068862_101352722
1720 Ga0081455_10004380
1721 Ga0081455_10039149
1722 Ga0081455_10383073
1723 Ga0081455_10559228
1724 Ga0081540_1001905
1725 Ga0081540_1003483
1726 Ga0081540_1005354
1727 Ga0081540_1006055
1728 Ga0081540_1019571
1729 Ga0081540_1030270
1730 Ga0081540_1036378
1731 Ga0081540_1039455
1732 Ga0081540_1049799
1733 Ga0081540_1101659
1734 Ga0081540_1265790
1735 Ga0081539_10000324
1736 Ga0081539_10000902
1737 Ga0081539_10014288
1738 Ga0081539_10133752
1739 Ga0081539_10241925
1740 Ga0070717_10010448
1741 Ga0070717_10090385
1742 Ga0070717_10104092
1743 Ga0075365_10113571
1744 Ga0075365_10121870
1745 Ga0075365_10137142
1746 Ga0075365_10147696
1747 Ga0075365_10180693
1748 Ga0075365_10192108
1749 Ga0075365_10398178
1750 Ga0075368_10014536
1751 Ga0075368_10083618
1752 Ga0075363_100010231
1753 Ga0075363_100139830
1754 Ga0075363_100246541
1755 Ga0075364_10169789
1756 Ga0075432_10184630
1757 Ga0070715_10003071
1758 Ga0070715_10110476
1759 Ga0070715_10335473
1760 Ga0070716_100005922
1761 Ga0070716_100178312
1762 Ga0070716_100379680
1763 Ga0070716_100863364
1764 Ga0070712_100010119
1765 Ga0070712_100020318
1766 Ga0070712_100114950
1767 Ga0070712_100133698
1768 Ga0070712_100234276
1769 Ga0075362_10021643
1770 Ga0075367_10010275
1771 Ga0075367_10209479
1772 Ga0075367_10576958
1773 Ga0075369_10010740
1774 Ga0075369_10019596
1775 Ga0075366_10308358
1776 Ga0075366_10382418
1777 Ga0097621_100025107
1778 Ga0097621_100028310
1779 Ga0097621_100032858
1780 Ga0097621_100266689
1781 Ga0097621_100378113
1782 Ga0097621_100651191
1783 Ga0097621_100878862
1784 Ga0097621_101163198
1785 Ga0097621_101327179
1786 Ga0075370_10028939
1787 Ga0068871_100047227
1788 Ga0068871_100130756
1789 Ga0068871_100591274
1790 Ga0068871_100808336
1791 Ga0068871_101786101
1792 Ga0075428_100056503
1793 Ga0075428_100569440
1794 Ga0075431_100792032
1795 Ga0075434_100190918
1796 Ga0068865_100093108
1797 Ga0068865_100523851
1798 Ga0075436_100311240
1799 Ga0097620_100128270
1800 Ga0097620_100623052
1801 Ga0097620_100692255
1802 Ga0097620_101915539
1803 Ga0099824_1031119
1804 Ga0099823_1072668
1805 Ga0075435_100061313
1806 Ga0099794_10014612
1807 Ga0099794_10146692
1808 Ga0099795_10002579
1809 Ga0099795_10003041
1810 Ga0105251_10044298
1811 Ga0105250_10026169
1812 Ga0105240_10213062
1813 Ga0105240_10230194
1814 Ga0105240_10297646
1815 Ga0105240_10641266
1816 Ga0111539_10050602
1817 Ga0111539_10614822
1818 Ga0105245_10013113
1819 Ga0105245_10060564
1820 Ga0105245_10104288
1821 Ga0105245_10481730
1822 Ga0105247_10005827
1823 Ga0105247_10164750
1824 Ga0114129_10107079
1825 Ga0105243_10209302
1826 Ga0105243_10815386
1827 Ga0105241_10035010
1828 Ga0105241_10239602
1829 Ga0105241_10457296
1830 Ga0105241_10709080
1831 Ga0105242_10198297
1832 Ga0105242_10605647
1833 Ga0105242_10612053
1834 Ga0105248_10073696
1835 Ga0105248_10090767
1836 Ga0105248_10217361
1837 Ga0105248_10866061
1838 Ga0105248_10921298
1839 Ga0105237_10054269
1840 Ga0105237_10205222
1841 Ga0105237_10291101
1842 Ga0105237_11207395
1843 Ga0105238_10038892
1844 Ga0105238_10073250
1845 Ga0105238_10189980
1846 Ga0105238_10230507
1847 Ga0105238_11170638
1848 Ga0105249_10063495
1849 Ga0105249_10252033
1850 Ga0105249_10417895
1851 Ga0123342_1013770
1852 Ga0099796_10009589
1853 Ga0099796_10019349
1854 Ga0099796_10029389
1855 Ga0099796_10052131
1856 Ga0105239_10061201
1857 Ga0105239_10204077
1858 Ga0105239_10239989
1859 Ga0105239_10370479
1860 Ga0105239_10413193
1861 Ga0105246_10121976
1862 Ga0105246_10236551
1863 Ga0157343_1009340
1864 Ga0157338_1029805
1865 Ga0157373_10016845
1866 Ga0157370_10037503
1867 Ga0157370_10182418
1868 Ga0157370_10286566
1869 Ga0157370_10523428
1870 Ga0157369_10037064
1871 Ga0157369_10304854
1872 Ga0157369_10540413
1873 Ga0157374_10077147
1874 Ga0157374_10253496
1875 Ga0157378_10025963
1876 Ga0157378_10047954
1877 Ga0157378_10087971
1878 Ga0157378_10125516
1879 Ga0157378_10154935
1880 Ga0157378_10190507
1881 Ga0157378_10203242
1882 Ga0157378_10432789
1883 Ga0163162_10121233
1884 Ga0163162_10213555
1885 Ga0163162_10562543
1886 Ga0163162_10762381
1887 Ga0163162_12096027
1888 Ga0157372_10548850
1889 Ga0157375_10005808
1890 Ga0157375_10172104
1891 Ga0157375_10285482
1892 Ga0157375_10335069
1893 Ga0157375_10581556
1894 Ga0163163_10164907
1895 Ga0163163_11132991
1896 Ga0157380_10093471
1897 Ga0157380_10125737
1898 Ga0157380_10599300
1899 Ga0157377_10167513
1900 Ga0157379_10033296
1901 Ga0157379_10356580
1902 Ga0157376_10054066
1903 Ga0157376_10341507
1904 Ga0157376_10356886
1905 Ga0157376_10454865
1906 Ga0157376_11152932
1907 Ga0163161_10136471
1908 Ga0163161_10180981
1909 Ga0163161_10184839
1910 Ga0163161_10280325
1911 Ga0163161_11305941
1912 Ga0197907_10717276
1913 Ga0206356_11225785
1914 Ga0206356_11512317
1915 Ga0206349_1867187
1916 Ga0206355_1651195
1917 Ga0206352_10872787
1918 Ga0206350_11624238
1919 Ga0214543_1000018
1920 Ga0213873_10124599
1921 Ga0213876_10001113
1922 Ga0224712_10149526
1923 Ga0224712_10391768
1924 Ga0207425_1025599
1925 Ga0209129_1001217
1926 Ga0209233_1003374
1927 Ga0209233_1014294
1928 Ga0209455_1003306
1929 Ga0209673_1003224
1930 Ga0209130_1030706
1931 Ga0209564_1018467
1932 Ga0209758_1003130
1933 Ga0209758_1003447
1934 Ga0209256_1000064
1935 Ga0209256_1007330
1936 Ga0209256_1012304
1937 Ga0209256_1044906
1938 Ga0207426_1000730
1939 Ga0207697_10018333
1940 Ga0207656_10041676
1941 Ga0207696_1082278
1942 Ga0207696_1128410
1943 Ga0207653_10031965
1944 Ga0207692_10001008
1945 Ga0207692_10011691
1946 Ga0207692_10490085
1947 Ga0207642_10073674
1948 Ga0207642_10115377
1949 Ga0207642_10421281
1950 Ga0207710_10030588
1951 Ga0207710_10173380
1952 Ga0207688_10066645
1953 Ga0207688_10082682
1954 Ga0207680_10080546
1955 Ga0207680_10690224
1956 Ga0207647_10030400
1957 Ga0207647_10047128
1958 Ga0207647_10154710
1959 Ga0207647_10192603
1960 Ga0207647_10198710
1961 Ga0207685_10129101
1962 Ga0207699_10009034
1963 Ga0207699_10024073
1964 Ga0207699_10024173
1965 Ga0207645_10043025
1966 Ga0207645_10152536
1967 Ga0207643_10035880
1968 Ga0207643_10080885
1969 Ga0207643_10412234
1970 Ga0207705_10053763
1971 Ga0207705_10061369
1972 Ga0207705_10323691
1973 Ga0207705_10633709
1974 Ga0207654_10007233
1975 Ga0207654_10032620
1976 Ga0207654_10402814
1977 Ga0207654_10479192
1978 Ga0207654_10681082
1979 Ga0207654_10760857
1980 Ga0207707_10043460
1981 Ga0207707_10701944
1982 Ga0207707_10954927
1983 Ga0207695_10066435
1984 Ga0207695_10134456
1985 Ga0207695_10206033
1986 Ga0207671_10101999
1987 Ga0207671_10339489
1988 Ga0207671_10572691
1989 Ga0207671_10769834
1990 Ga0207693_10007911
1991 Ga0207693_10008718
1992 Ga0207693_10010781
1993 Ga0207693_10283137
1994 Ga0207693_10983398
1995 Ga0207663_10002092
1996 Ga0207663_10052877
1997 Ga0207663_10053354
1998 Ga0207663_10060198
1999 Ga0207663_10147754
2000 Ga0207660_10217797
2001 Ga0207660_10306467
2002 Ga0207660_10495932
2003 Ga0207662_10689453
2004 Ga0207657_10001022
2005 Ga0207657_10011801
2006 Ga0207657_10046837
2007 Ga0207657_10120971
2008 Ga0207657_10547049
2009 Ga0207649_10106212
2010 Ga0207649_10176396
2011 Ga0207649_11130642
2012 Ga0207652_10013063
2013 Ga0207652_10093561
2014 Ga0207652_10093584
2015 Ga0207652_10497990
2016 Ga0207652_11037811
2017 Ga0207646_10204739
2018 Ga0207681_10536245
2019 Ga0207694_10112809
2020 Ga0207694_10221598
2021 Ga0207694_10251395
2022 Ga0207694_10363443
2023 Ga0207694_10372990
2024 Ga0207694_10416070
2025 Ga0207659_10250296
2026 Ga0207659_10345439
2027 Ga0207687_10029474
2028 Ga0207687_10089648
2029 Ga0207687_10196740
2030 Ga0207700_10040777
2031 Ga0207700_10075769
2032 Ga0207700_10165490
2033 Ga0207700_10244283
2034 Ga0207664_10030922
2035 Ga0207664_10089899
2036 Ga0207664_10240282
2037 Ga0207664_10458954
2038 Ga0207664_11263070
2039 Ga0207644_10017156
2040 Ga0207644_10030007
2041 Ga0207644_10123738
2042 Ga0207644_10154893
2043 Ga0207690_10104376
2044 Ga0207690_10268928
2045 Ga0207690_10348698
2046 Ga0207706_10042611
2047 Ga0207706_10072164
2048 Ga0207706_10483724
2049 Ga0207686_10014926
2050 Ga0207686_10070179
2051 Ga0207686_10211002
2052 Ga0207686_10243172
2053 Ga0207709_10034935
2054 Ga0207709_10101353
2055 Ga0207709_10157926
2056 Ga0207709_10649112
2057 Ga0207669_10122502
2058 Ga0207704_10132223
2059 Ga0207665_10001678
2060 Ga0207665_10058436
2061 Ga0207665_10096824
2062 Ga0207665_10215874
2063 Ga0207665_10303947
2064 Ga0207665_10592844
2065 Ga0207691_10300312
2066 Ga0207691_10312448
2067 Ga0207711_10005566
2068 Ga0207711_10043522
2069 Ga0207711_10196700
2070 Ga0207711_10331608
2071 Ga0207661_10018101
2072 Ga0207661_10150545
2073 Ga0207661_10195327
2074 Ga0207661_10230170
2075 Ga0207661_10363330
2076 Ga0207679_10066116
2077 Ga0207679_10101592
2078 Ga0207679_10183146
2079 Ga0207679_10312704
2080 Ga0207667_10015870
2081 Ga0207667_10057464
2082 Ga0207667_10135083
2083 Ga0207667_10200431
2084 Ga0207667_10313716
2085 Ga0207651_10051125
2086 Ga0207651_10088931
2087 Ga0207712_10026523
2088 Ga0207712_10159976
2089 Ga0207712_10433400
2090 Ga0207712_11029293
2091 Ga0207668_10066056
2092 Ga0207668_10067714
2093 Ga0207668_10080850
2094 Ga0207668_10319617
2095 Ga0207668_10432764
2096 Ga0207668_10594954
2097 Ga0207668_11094188
2098 Ga0207668_11201423
2099 Ga0207640_10067562
2100 Ga0207640_10077098
2101 Ga0207640_10250693
2102 Ga0207640_10269574
2103 Ga0207658_10172540
2104 Ga0207658_10220275
2105 Ga0207658_10257447
2106 Ga0207658_10377550
2107 Ga0207658_10384733
2108 Ga0207677_10027403
2109 Ga0207677_10061810
2110 Ga0207677_10070132
2111 Ga0207677_10116123
2112 Ga0207677_10231946
2113 Ga0207703_10096502
2114 Ga0207703_10364946
2115 Ga0207703_11668145
2116 Ga0207639_10046989
2117 Ga0207639_10113884
2118 Ga0207639_10512155
2119 Ga0207639_11185318
2120 Ga0207678_10000721
2121 Ga0207678_10002923
2122 Ga0207678_10004603
2123 Ga0207678_10010843
2124 Ga0207678_10017537
2125 Ga0207678_10021928
2126 Ga0207678_10072348
2127 Ga0207678_10172855
2128 Ga0207678_10448051
2129 Ga0207678_10825177
2130 Ga0207678_11026891
2131 Ga0207708_10033205
2132 Ga0207702_10001649
2133 Ga0207702_10111628
2134 Ga0207702_10149948
2135 Ga0207702_10201326
2136 Ga0207702_10221719
2137 Ga0207702_10485764
2138 Ga0207702_10687848
2139 Ga0207702_10907976
2140 Ga0207641_10433758
2141 Ga0207641_11292139
2142 Ga0207648_10089012
2143 Ga0207676_10030660
2144 Ga0207676_10042572
2145 Ga0207676_10154959
2146 Ga0207674_10095474
2147 Ga0207674_10132400
2148 Ga0207674_10194765
2149 Ga0207674_10874802
2150 Ga0207674_11329364
2151 Ga0207675_100121432
2152 Ga0207675_100123678
2153 Ga0207683_10012932
2154 Ga0207683_10025571
2155 Ga0207683_10030143
2156 Ga0207683_10048432
2157 Ga0207683_10115215
2158 Ga0207683_10147200
2159 Ga0207683_10244256
2160 Ga0207683_10296334
2161 Ga0207698_10108343
2162 Ga0207698_10490690
2163 Ga0209389_1000212
2164 Ga0209589_1001280
2165 Ga0209489_100085
2166 Ga0209179_1009590
2167 Ga0209179_1091515
2168 Ga0209588_1001779
2169 Ga0209588_1041104
2170 Ga0209588_1103050
2171 Ga0209813_10057755
2172 Ga0209974_10216656
2173 Ga0207428_10167199
2174 Ga0268266_10003266
2175 Ga0268266_10024737
2176 Ga0268266_10048039
2177 Ga0268266_10499619
2178 Ga0268266_10733132
2179 Ga0268266_10858120
2180 Ga0268265_10099512
2181 Ga0268264_10000048
2182 Ga0268264_10135428
2183 Ga0268264_10264421
2184 Ga0268264_10414392
2185 Ga0268264_10760238
2186 Ga0265337_1011548
2187 Ga0265326_10040338
2188 Ga0265319_1033620
2189 Ga0265334_10002347
2190 Ga0265334_10006108
2191 Ga0265318_10007048
2192 Ga0265323_10002902
2193 Ga0265322_10002295
2194 Ga0265336_10000960
2195 Ga0307517_10472138
2196 Ga0307515_10261516
2197 Ga0265338_10000155
2198 Ga0265338_10023891
2199 Ga0265324_10007896
2200 Ga0307511_10042827
2201 Ga0307511_10278864
2202 Ga0265332_10048807
2203 Ga0265328_10099045
2204 Ga0265328_10104527
2205 Ga0265325_10000264
2206 Ga0265325_10038377
2207 Ga0265340_10071225
2208 Ga0265340_10102986
2209 Ga0265339_10072326
2210 Ga0265331_10104682
2211 Ga0307509_10005003
2212 Ga0307509_10277277
2213 Ga0307509_10374871
2214 Ga0307509_10600357
2215 Ga0307408_100385294
2216 Ga0307408_100494360
2217 Ga0265313_10010055
2218 Ga0307508_10000120
2219 Ga0307508_10038844
2220 Ga0307508_10173980
2221 Ga0265314_10015133
2222 Ga0265314_10024194
2223 Ga0265342_10018169
2224 Ga0307516_10041329
2225 Ga0307516_10220860
2226 Ga0307405_10091828
2227 Ga0307410_10140440
2228 Ga0307410_11207176
2229 Ga0307410_11323951
2230 Ga0307406_10168499
2231 Ga0307406_10349494
2232 Ga0307407_10333610
2233 Ga0307412_10158049
2234 Ga0307412_10214021
2235 Ga0307412_10677653
2236 Ga0307409_100150475
2237 Ga0307414_10177260
2238 Ga0307411_10143459
2239 Ga0307411_10939714
2240 Ga0307411_11031396
2241 Ga0307415_100052907
2242 Ga0307415_100057944
2243 Ga0307415_100312651
2244 Ga0307415_100346248
2245 Ga0307507_10081029
2246 Ga0307510_10012623
2247 Ga0307510_10080874
2248 Ga0307510_10241634
2249 Ga0315911_1000037
2250 Ga0373930_0000647
2251 Ga0373948_0015453
2252 Ga0373948_0022868
2253 Ga0373950_0004698
2254 Ga0373959_0104691
2255 Ga0373926_0196137
2256 Ga0373928_0014591
2257 Ga0373928_0026891
2258 Ga0373934_0002906
2259 Ga0373934_0100799
2260 Ga0373934_0166045
2261 Ga0373940_0041165
2262 Ga0373949_0040775
2263 Ga0373951_0024795
2264 Ga0373923_0062813
2265 Ga0373923_0169971
2266 Ga0373932_0007300
2267 Ga0373932_0018087
2268 Ga0373936_0020917
2269 Ga0373936_0084368
2270 Ga0373945_0040426
2271 Ga0373945_0079195
2272 Ga0373953_0008531
2273 Ga0373953_0015360
2274 Ga0373954_0005696
2275 Ga0373954_0007272
2276 Ga0373954_0200857
2277 Ga0373956_0010324
2278 Ga0373956_0059022
2279 Ga0373956_0401880
2280 Ga0373957_0001391
2281 Ga0373957_0018656
2282 Ga0373957_0030841
2283 Ga0373957_0208436
2284 Ga0373943_0007179
2285 Ga0373943_0033128
2286 Ga0373946_0014352
2287 Ga0373946_0045813
2288 Ga0373946_0076222
2289 Ga0373955_0004993
2290 Ga0373955_0082675
2291 Ga0373961_0048559
2292 Ga0373924_0036763
2293 Ga0373931_0004597
2294 Ga0373931_0021136
2295 Ga0373931_0401533
2296 Ga0373935_0015705
2297 Ga0373935_0030972
2298 Ga0373935_0106345
2299 Ga0373935_0157342
2300 Ga0373935_0189906
2301 Ga0373935_0302721
2302 Ga0373935_0358292
2303 Ga0373935_0443982
2304 Ga0373927_0002813
2305 Ga0373927_0007182
2306 Ga0373927_0012358
2307 Ga0373927_0014147
2308 Ga0373927_0015983
2309 Ga0373927_0031642
2310 Ga0373927_0053846
2311 Ga0373927_0274383
2312 Ga0373927_0382358
2313 Ga0373927_0701694
2314 Ga0373933_0062945
2315 Ga0373933_0080332
2316 Ga0373933_0110061
2317 Ga0373933_0117650
2318 Ga0373947_0000441
2319 Ga0373947_0020629
2320 Ga0373947_0026397
2321 Ga0373947_0078495
2322 Ga0373947_0135053
2323 Ga0373947_0245907
2324 Ga0373947_0286244
2325 Ga0373947_0749638
2326 Ga0373937_0011747
2327 Ga0373937_0049701
2328 Ga0373937_0098734
2329 Ga0373937_0348558
2330 Ga0373937_0767244
2331 Ga0373937_1130797
2332 Ga0373925_0005350
2333 Ga0373925_0064209
2334 Ga0373925_0122845
2335 Ga0373925_0234168
2336 Ga0373925_0374291
2337 Ga0395899_0376167
2338 Ga0395900_0000134
2339 Ga0395900_0011930
2340 Ga0395900_0109774
2341 Ga0395900_0360393
2342 Ga0395898_0014296
2343 Ga0395898_0161064
2344 Ga0395905_0017202
2345 Ga0395905_0049780
2346 Ga0395905_0195869
2347 Ga0395905_0202261
2348 Ga0395905_1028874
2349 Ga0436364_1368466
2350 Ga0395901_0032707
2351 Ga0395901_0033640
2352 Ga0395901_0237430
2353 Ga0395901_0275230
2354 Ga0395901_0712385
2355 Ga0436365_0133064
2356 Ga0436365_0511030
2357 Ga0436363_0957639
2358 Ga0436362_0550362
2359 Ga0439439_0188358
2360 Ga0451798_0453507
2361 Ga0451853_0932301
2362 Ga0439458_0058958
2363 Ga0466969_0105919
2364 Ga0466972_0042673
2365 Ga0466972_0134945
2366 Ga0466965_0100435
2367 Ga0466965_0111522
2368 Ga0466964_0243627
2369 Ga0466971_0043520
2370 Ga0466968_0352494
2371 Ga0466970_0249448
2372 Ga0466957_0202450
2373 Ga0466957_0263393
2374 Ga0466959_0227312
2375 Ga0466959_0281625
2376 Ga0451576_2066207
2377 Ga0466967_0107132
2378 Ga0466967_0326627
2379 Ga0466967_1057657
2380 Ga0495592_0000962
2381 Ga0495592_0024070
2382 Ga0495592_0038972
2383 Ga0495592_0047517
2384 Ga0495592_0358461
2385 Ga0495603_0000066
2386 Ga0495603_0017017
2387 Ga0495603_0065087
2388 Ga0495603_0067733
2389 Ga0495603_0077481
2390 Ga0495603_0273085
2391 Ga0495603_0424859
2392 Ga0495590_0265483
2393 Ga0495591_085098
2394 Ga0495629_0000131
2395 Ga0495629_0000984
2396 Ga0495629_0010691
2397 Ga0495629_0063174
2398 Ga0495629_0171694
2399 Ga0495629_0257100
2400 Ga0495638_0080415
2401 Ga0495638_0288208
2402 Ga0495638_0357994
2403 Ga0495641_0004776
2404 Ga0495641_0050560
2405 Ga0495641_0113029
2406 Ga0495651_0001583
2407 Ga0495651_0011447
2408 Ga0495651_0021274
2409 Ga0495651_0267716
2410 Ga0495651_0441165
2411 Ga0495653_0017838
2412 Ga0495653_0054134
2413 Ga0495653_0105594
2414 Ga0495653_0106781
2415 Ga0495650_0037267
2416 Ga0495580_0001382
2417 Ga0495580_0017453
2418 Ga0495582_0000298
2419 Ga0495582_0084205
2420 Ga0495582_0107351
2421 Ga0495582_0611764
2422 Ga0495605_0213934
2423 Ga0495639_0010975
2424 Ga0495639_0031933
2425 Ga0495639_0049337
2426 Ga0495639_0098650
2427 Ga0495639_0212932
2428 Ga0495662_0000058
2429 Ga0495662_0020780
2430 Ga0495662_0161711
2431 Ga0495662_0203530
2432 Ga0495664_0001921
2433 Ga0495664_0013688
2434 Ga0495664_0090590
2435 Ga0495664_0383721
2436 Ga0495664_0416710
2437 Ga0495664_0563980
2438 Ga0495584_0189456
2439 Ga0495585_0005331
2440 Ga0495585_0086414
2441 Ga0495585_0110393
2442 Ga0495594_0000706
2443 Ga0495596_0319181
2444 Ga0495607_0038517
2445 Ga0495607_0122077
2446 Ga0495583_0084495
2447 Ga0495606_0000244
2448 Ga0495606_0366097
2449 Ga0495608_0003424
2450 Ga0495608_0004308
2451 Ga0495608_0005405
2452 Ga0495610_0125495
2453 Ga0495616_0197382
2454 Ga0495618_0068835
2455 Ga0495618_0086241
2456 Ga0495618_0104808
2457 Ga0495618_0178503
2458 Ga0495618_0255209
2459 Ga0495628_0003941
2460 Ga0495628_0033779
2461 Ga0495628_0881022
2462 Ga0495630_0001425
2463 Ga0495630_0186544
2464 Ga0495631_0212565
2465 Ga0495637_0286141
2466 Ga0495644_0004455
2467 Ga0495648_0128765
2468 Ga0495663_0134058
2469 Ga0495666_0307377
2470 Ga0495652_0008159
2471 Ga0495652_0047392
2472 Ga0495652_0123399
2473 Ga0495665_0000373
2474 Ga0495640_0001250
2475 Ga0495640_0022168
2476 Ga0495640_0027866
2477 Ga0495640_0087228
2478 Ga0495640_0318376
2479 Ga0495586_0009720
2480 Ga0495586_0045341
2481 Ga0495586_0266277
2482 Ga0495587_0006700
2483 Ga0495587_0012091
2484 Ga0495587_0290775
2485 Ga0495598_0056136
2486 Ga0495621_0031404
2487 Ga0495645_0006904
2488 Ga0495645_0019421
2489 Ga0495622_0007642
2490 Ga0495622_0018157
2491 Ga0495622_0038008
2492 Ga0495622_0092726
2493 Ga0495633_0020440
2494 Ga0495667_0004119
2495 Ga0495667_0005627
2496 Ga0495667_0020636
2497 Ga0495667_0301807
2498 Ga0495656_0004069
2499 Ga0495656_0014584
2500 Ga0495656_0024854
2501 Ga0495656_0097828
2502 Ga0495634_0000502
2503 Ga0495634_0196724
2504 Ga0495634_0205717
2505 Ga0495634_0339479
2506 Ga0495611_0024058
2507 Ga0495611_0046389
2508 Ga0495635_0026268
2509 Ga0495635_0027162
2510 Ga0495635_0088610
2511 Ga0495635_0226154
2512 Ga0495635_0257524
2513 Ga0495635_0588762
2514 Ga0495659_0113415
2515 Ga0495659_0131080
2516 Ga0495661_0037544
2517 Ga0495588_0033151
2518 Ga0495588_0367329
2519 Ga0495657_0005728
2520 Ga0495657_0009308
2521 Ga0495657_0014712
2522 Ga0495657_0043085
2523 Ga0495657_0049829
2524 Ga0495657_0073439
2525 Ga0495599_0001288
2526 Ga0495599_0007174
2527 Ga0495599_0056898
2528 Ga0495599_0088610
2529 Ga0495599_0139731
2530 Ga0495623_0000561
2531 Ga0495623_0010099
2532 Ga0495623_0033866
2533 Ga0495623_0148515
2534 Ga0495646_0022284
2535 Ga0495646_0031540
2536 Ga0495646_0056756
2537 Ga0495647_0003354
2538 Ga0495647_0021361
2539 Ga0495647_0051974
2540 Ga0495647_0058447
2541 Ga0495647_0170290
2542 Ga0495658_0000368
2543 Ga0495658_0026598
2544 Ga0495658_0365438
2545 Ga0495669_0013841
2546 Ga0495669_0033841
2547 Ga0495613_0014196
2548 Ga0495613_0027749
2549 Ga0495613_0071390
2550 Ga0495613_0073462
2551 Ga0495613_0365715
2552 Ga0495613_0377767
2553 Ga0495613_0382676
2554 Ga0495624_0008081
2555 Ga0495624_0163514
2556 Ga0495624_0328704
2557 Ga0495670_0029218
2558 Ga0495671_0179382
2559 Ga0495600_0011917
2560 Ga0495600_0023752
2561 Ga0495600_0076875
2562 Ga0495600_0102678
2563 Ga0495600_0185265
2564 Ga0495600_0271510
2565 Ga0495600_0360413
2566 Ga0495600_0408156
2567 Ga0495600_0479097
2568 Ga0495581_0000111
2569 Ga0495581_0104762
2570 Ga0495581_0114739
2571 Ga0495581_0215942
2572 Ga0495581_0454754
2573 Ga0495581_0455455
2574 Ga0495581_0613048
2575 Ga0495604_0002451
2576 Ga0495604_0010885
2577 Ga0495604_0045227
2578 Ga0495604_0080611
2579 Ga0495604_0145039
2580 Ga0495604_0147574
2581 Ga0495604_0272889
2582 Ga0495674_0004341
2583 Ga0495674_0015128
2584 Ga0495674_0030334
2585 Ga0495674_0077544
2586 Ga0495674_0120988
2587 Ga0495674_0136513
2588 Ga0495674_0170662
2589 Ga0495674_0490191
2590 Ga0495672_0015836
2591 Ga0495676_0079737
2592 Ga0495680_0004114
2593 Ga0495680_0039523
2594 Ga0495680_0044193
2595 Ga0495680_0052359
2596 Ga0495680_0071985
2597 Ga0495680_0086764
2598 Ga0495680_0117653
2599 Ga0495680_0839839
2600 Ga0495683_0190593
2601 Ga0495683_0218220
2602 Ga0495675_0004565
2603 Ga0495675_0050347
2604 Ga0495675_0055058
2605 Ga0495675_0152464
2606 Ga0495677_0105993
2607 Ga0495677_0164397
2608 Ga0495679_025907
2609 Ga0495685_023471
2610 Ga0495673_0266038
2611 Ga0495684_0025696
2612 Ga0495684_0088322
2613 Ga0495684_0101123
2614 Ga0495684_0106142
2615 Ga0495684_0205519
2616 Ga0495686_0059342
2617 Ga0495686_0365850
2618 Ga0495593_0000210
2619 Ga0495593_0001699
2620 Ga0495593_0018230
2621 Ga0495593_0077811
2622 Ga0495593_0240855
2623 Ga0495602_0007289
2624 Ga0495602_0023526
2625 Ga0495602_0085736
2626 Ga0495602_0169545
2627 Ga0495602_0834180
2628 Ga0495615_0007972
2629 Ga0496100_0013868
2630 Ga0496100_0031298
2631 Ga0496100_0039813
2632 Ga0496100_0272099
2633 Ga0496100_0274677
2634 Ga0496101_0010824
2635 Ga0496101_0021299
2636 Ga0496101_0048045
2637 Ga0496101_0231465
2638 Ga0496101_0540858
2639 Ga0496101_0601859
2640 Ga0496102_0003826
2641 Ga0496102_0014510
2642 Ga0496102_0036014
2643 Ga0496102_0053738
2644 Ga0496102_0084735
2645 Ga0496102_0095808
2646 Ga0496102_0165557
2647 Ga0496102_0212492
2648 Ga0496102_0560670
2649 Ga0496102_0949495
2650 Ga0496103_0027030
2651 Ga0496103_0031918
2652 Ga0496103_0047160
2653 Ga0496103_0082735
2654 Ga0496103_0222421
2655 Ga0496103_0355607
2656 Ga0496103_0407292
2657 Ga0496104_0000092
2658 Ga0496104_0029318
2659 Ga0496104_0054677
2660 Ga0496104_0083527
2661 Ga0496104_0258891
2662 Ga0496105_0010163
2663 Ga0496105_0014761
2664 Ga0496105_0115766
2665 Ga0496105_0149675
2666 Ga0496105_0328900
2667 Ga0496105_0349912
2668 Ga0496106_0018269
2669 Ga0496106_0026335
2670 Ga0496106_0043409
2671 Ga0496106_0093077
2672 Ga0496106_0116123
2673 Ga0496106_0187436
2674 Ga0496106_0380089
2675 Ga0496106_0777378
2676 Ga0496107_0000413
2677 Ga0496107_0005993
2678 Ga0496107_0027280
2679 Ga0496107_0098442
2680 Ga0496107_0556556
2681 Ga0496107_0737727
2682 Ga0496107_1127447
2683 Ga0496108_0072631
2684 Ga0496108_0131555
2685 Ga0496108_0170603
2686 Ga0496108_0318675
2687 Ga0496108_0479037
2688 Ga0496108_0913918
2689 Ga0496109_0041987
2690 Ga0496109_0056255
2691 Ga0496109_0064124
2692 Ga0496109_0136268
2693 Ga0496109_0313116
2694 Ga0496109_0572210
2695 Ga0496110_0008222
2696 Ga0496110_0124245
2697 Ga0496110_0271367
2698 Ga0496110_0589019
2699 Ga0496110_0700571
2700 Ga0496110_0826296
2701 Ga0496111_0204487
2702 Ga0496111_0426690
2703 Ga0496111_0515014
2704 Ga0496111_0631176
2705 Ga0496112_0000019
2706 Ga0496112_0033962
2707 Ga0496112_0035449
2708 Ga0496112_0091791
2709 Ga0496112_0115995
2710 Ga0496112_0121752
2711 Ga0496112_0135932
2712 Ga0496112_0425994
2713 Ga0496112_0888932
2714 Ga0496112_0951924
2715 Ga0496113_0006958
2716 Ga0496113_0082214
2717 Ga0496113_0118841
2718 Ga0496113_0134271
2719 Ga0496113_0288685
2720 Ga0496113_1062826
2721 Ga0496114_0020155
2722 Ga0496114_0029656
2723 Ga0496114_0118237
2724 Ga0496114_0189966
2725 Ga0496114_0367457
2726 Ga0496115_0005968
2727 Ga0496115_0041613
2728 Ga0496115_0068457
2729 Ga0496115_0088634
2730 Ga0496115_0122044
2731 Ga0496115_0340906
2732 Ga0496115_0591285
2733 Ga0496116_0235858
2734 Ga0496118_0001892
2735 Ga0496118_0142679
2736 Ga0496119_0031735
2737 Ga0496119_0119999
2738 Ga0496120_0013537
2739 Ga0496121_0000041
2740 Ga0496121_0033571
2741 Ga0496121_0044283
2742 Ga0496121_0067477
2743 Ga0496121_0105901
2744 Ga0496121_0224299
2745 Ga0496121_0229998
2746 Ga0496121_0297335
2747 Ga0496124_0001646
2748 Ga0496124_0124699
2749 Ga0496124_0297680
2750 Ga0496125_0033775
2751 Ga0496125_0290992
2752 Ga0496125_0353060
2753 Ga0496126_0002010
2754 Ga0496126_0007412
2755 Ga0496126_0010298
2756 Ga0496126_0113225
2757 Ga0496126_0150115
2758 Ga0496126_0191731
2759 Ga0496126_0717694
2760 Ga0495678_046165
2761 Ga0495682_0090779
2762 Ga0501031_0029819
2763 Ga0501032_0103321
2764 Ga0501032_0407103
2765 Ga0501033_0009836
2766 Ga0501033_0027573
2767 Ga0501033_0117230
2768 Ga0501034_0000676
2769 Ga0501034_0044391
2770 Ga0501034_0074265
2771 Ga0501034_0100985
2772 Ga0501034_0401934
2773 Ga0501036_0000390
2774 Ga0501036_0053603
2775 Ga0501036_0282978
2776 Ga0501037_0000755
2777 Ga0501037_0019397
2778 Ga0501037_0182774
2779 Ga0501038_0000089
2780 Ga0501038_0107188
2781 Ga0501038_0515883
2782 Ga0501039_0000114
2783 Ga0501039_0077389
2784 Ga0501043_0001086
2785 Ga0501043_0058521
2786 Ga0501043_0089204
2787 Ga0501043_0368843
2788 Ga0501046_0006291
2789 Ga0501046_0135722
2790 Ga0501046_0182257
2791 Ga0501047_0000594
2792 Ga0501047_0061423
2793 Ga0501047_0094399
2794 Ga0501047_0285178
2795 Ga0501047_0658280
2796 Ga0501047_0701637
2797 Ga0501048_0015151
2798 Ga0501048_0040990
2799 Ga0501067_0000445
2800 Ga0501067_0239075
2801 Ga0501068_0004210
2802 Ga0501069_0037736
2803 Ga0501069_0126786
2804 Ga0501069_0262932
2805 Ga0501070_0017778
2806 Ga0501070_0318087
2807 Ga0501070_0509375
2808 Ga0501071_0516444
2809 Ga0501072_0029426
2810 Ga0501072_0469243
2811 Ga0501073_0000055
2812 Ga0501073_0295890
2813 Ga0501073_0496654
2814 Ga0501074_0000492
2815 Ga0501076_0049686
2816 Ga0501079_0355125
2817 Ga0501079_0888412
2818 Ga0501080_0008079
2819 Ga0501080_0551719
2820 Ga0501081_0184085
2821 Ga0501083_0000570
2822 Ga0501268_007552
2823 Ga0501270_035015
2824 Ga0501035_0000150
2825 Ga0501035_0015014
2826 Ga0501035_0041388
2827 Ga0501044_0000546
2828 Ga0501044_0133658
2829 Ga0501045_0004352
2830 nmdc:mga03683_14262_c1
2831 nmdc:mga03683_228854_c1
2832 nmdc:mga03n38_228283_c1
2833 nmdc:mga03n38_352282_c1
2834 nmdc:mga03n38_396_c1
2835 nmdc:mga03n38_57464_c1
2836 nmdc:mga00v17_314999_c1
2837 nmdc:mga00v17_74792_c1
2838 nmdc:mga0yw44_188114_c1
2839 nmdc:mga0yw44_399816_c1
2840 nmdc:mga0yw44_42855_c1
2841 nmdc:mga0k408_155771_c1
2842 nmdc:mga0k408_445384_c1
2843 nmdc:mga06z11_303802_c1
2844 nmdc:mga06z11_413112_c1
2845 nmdc:mga06z11_43911_c1
2846 nmdc:mga06z11_46886_c1
2847 nmdc:mga04h51_191527_c1
2848 nmdc:mga04h51_352799_c1
2849 nmdc:mga04h51_59698_c1
2850 nmdc:mga07m45_285396_c1
2851 nmdc:mga07m45_70970_c1
2852 nmdc:mga07m45_7432_c2
2853 nmdc:mga09592_229993_c1
2854 nmdc:mga08y16_196474_c1
2855 nmdc:mga08y16_624774_c1
2856 nmdc:mga08y16_822569_c1
2857 nmdc:mga0n895_405792_c1
2858 nmdc:mga0rr50_18584_c1
2859 nmdc:mga0rr50_230449_c1
2860 nmdc:mga0rr50_28264_c1
2861 nmdc:mga0rr50_493683_c1
2862 nmdc:mga08x19_168362_c1
2863 nmdc:mga08x19_37303_c1
2864 Ga0495601_0005470
2865 Ga0495601_0006095
2866 Ga0495601_0009462
2867 Ga0495601_0044953
2868 Ga0495601_0055833
2869 Ga0495612_0004289
2870 Ga0495612_0004506
2871 Ga0495612_0121780
2872 Ga0495612_0229798
2873 Ga0500635_0006552
2874 Ga0500635_0011829
2875 Ga0495595_0003866
2876 Ga0495595_0010491
2877 Ga0495595_0039038
2878 Ga0495595_0152050
2879 Ga0495595_0326670
2880 Ga0495619_0001147
2881 Ga0495619_0006353
2882 Ga0495619_0007969
2883 Ga0495619_0104451
2884 Ga0495619_0191657
2885 Ga0495619_0206941
2886 Ga0495619_0567861
2887 Ga0495619_0658832
2888 Ga0500578_0228085
2889 Ga0500581_121507
2890 Ga0500647_0118789
2891 Ga0500583_0161163
2892 Ga0500651_0191125
2893 Ga0500651_0230419
2894 Ga0500566_0000047
2895 Ga0500566_0127826
2896 Ga0500640_005664
2897 Ga0500641_0048999
2898 Ga0500648_089452
2899 Ga0500554_001109
2900 Ga0500554_002996
2901 Ga0500555_028745
2902 Ga0500569_063636
2903 Ga0500572_000071
2904 Ga0500593_059848
2905 Ga0500594_0070853
2906 Ga0500595_001904
2907 Ga0500595_024231
2908 Ga0500595_031318
2909 Ga0500608_007594
2910 Ga0500559_0002362
2911 Ga0500559_0075491
2912 Ga0500559_0096906
2913 Ga0500568_0081443
2914 Ga0500568_0085017
2915 Ga0500573_0119855
2916 Ga0500603_000727
2917 Ga0500603_014206
2918 Ga0500603_037659
2919 Ga0500622_0111185
2920 Ga0500627_0080484
2921 Ga0500627_0362645
2922 Ga0500638_066884
2923 Ga0500638_096934
2924 Ga0500638_118331
2925 Ga0500639_000087
2926 Ga0500639_242849
2927 Ga0500636_0005004
2928 Ga0500636_0028275
2929 Ga0500636_0083515
2930 Ga0500637_0000075
2931 Ga0500637_0009481
2932 Ga0500637_0142017
2933 Ga0500609_040507
2934 Ga0500596_000317
2935 Ga0500596_000832
2936 Ga0501084_0001259
2937 Ga0587073_0066800
2938 Ga0466962_0069810
2939 2513719099
2940 2818236969
2941 2847937924
2942 2881673577

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13628

DUF4142

Domain of unknown function (DUF4142)

38

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5k-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.9088 116 173
7s5c-assembly1.cif.gz_G m. xanthus ferritin-like protein encb 0.9039 116 173
1mft-assembly1.cif.gz_B crystal structure of four-helix bundle model 0.9032 119 166
7s5c-assembly1.cif.gz_I m. xanthus ferritin-like protein encb 0.9016 116 173
5ffe-assembly2.cif.gz_B copm in the ag-bound form (by soaking) 0.8565 24 171
ID Description Score Start End Superfamily
5fejD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8448 28 171 1.20.1260.10
5ffcB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8435 27 171 1.20.1260.10
3mq1E01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8222 113 172 1.20.58.970
5ffcB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.821 27 171 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8189 28 171 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A4V2WPE8-F1-model_v4 DUF4142 domain-containing protein 0.955 23 172
AF-A0A371K7C3-F1-model_v4 DUF4142 domain-containing protein 0.9533 28 171
AF-A0A1A6Y1E2-F1-model_v4 DUF4142 domain-containing protein 0.9527 28 172
AF-A0A2C9A4E8-F1-model_v4 deleted 0.9514 32 172
AF-A0A2E5BPK4-F1-model_v4 DUF4142 domain-containing protein 0.9511 23 172

Map