F494174

General Info

Members Datasets Scaffolds Average Seq Length
1466 668 2932 130

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0711160|Ga0453684_0711160_571_987
Length 138
Sequence MSVNDPIADMLTRVRNAILAGQAVAAMPASKVKAEIARILKEEGYIESFDVVSEELMPTHSVLRVRIKYVGERRERRPVITGIVRISRPGRRIYTRKQDIPWVLSGLGISIISTPKGIMTGQRARQLGVGGEILCKVW

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002864 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
31 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
43 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
123 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
124 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
136 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
140 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
141 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
160 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
241 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
246 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
249 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
250 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
251 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
252 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
253 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
254 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
255 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
256 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
263 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
267 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
268 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
269 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
273 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
276 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
287 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
296 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
297 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
298 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
299 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
300 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
301 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
302 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
303 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
304 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
305 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
306 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
307 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
308 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
309 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
310 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
311 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
312 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
313 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
314 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
315 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
316 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
317 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
318 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
319 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
320 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
321 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
322 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
323 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
324 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
325 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
326 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
327 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
328 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
329 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
330 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
331 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
332 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
333 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
334 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
335 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
336 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
337 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
338 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
341 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
342 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
348 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
351 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
361 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
362 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
363 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
364 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
365 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
366 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
367 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
368 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
369 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
370 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
371 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
380 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
381 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
382 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
383 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
384 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
385 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
386 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
387 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
388 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
389 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
390 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
391 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
392 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
393 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
394 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
395 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
396 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
397 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
398 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
399 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
400 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
401 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
402 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
403 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
404 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
405 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
406 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
407 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
408 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
411 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
414 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
415 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
416 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
417 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
418 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
419 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
420 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
421 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
422 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
423 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
424 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
425 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
426 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
427 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
430 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
431 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
439 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
440 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
441 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
444 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
445 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
451 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
452 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
453 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
454 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
455 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
467 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
468 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
469 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
470 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
471 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
507 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
508 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
509 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
510 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
511 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
512 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
513 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
514 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
515 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
516 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
517 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
518 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
519 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
520 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
521 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
522 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
523 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
524 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
526 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
527 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
528 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
529 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
530 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
531 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
532 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
533 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
534 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
535 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
536 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
537 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
591 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
592 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
593 2547132374 Acidovorax radicis N35 Isolate Unclassified
594 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
595 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
596 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
597 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
598 2643221556 Massilia sp. Root1485 Isolate Unclassified
599 2643221570 Acidovorax sp. Root568 Isolate Unclassified
600 2643221596 Acidovorax sp. Root70 Isolate Unclassified
601 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
602 2643221609 Acidovorax sp. Root217 Isolate Unclassified
603 2643221611 Acidovorax sp. Root219 Isolate Unclassified
604 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
605 2643221638 Duganella sp. Root336D2 Isolate Unclassified
606 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
607 2643221645 Massilia sp. Root351 Isolate Unclassified
608 2643221652 Acidovorax sp. Root402 Isolate Unclassified
609 2643221664 Massilia sp. Root418 Isolate Unclassified
610 2643221684 Massilia sp. Root133 Isolate Unclassified
611 2643221717 Acidovorax sp. Root267 Isolate Unclassified
612 2721755523 Delftia sp. HK171 Isolate Unclassified
613 2738541280 Massilia sp. GV090 Isolate Unclassified
614 2738541297 Duganella sp. GV083 Isolate Unclassified
615 2738541300 Massilia sp. GV016 Isolate Unclassified
616 2738541357 Duganella sp. GV053 Isolate Unclassified
617 2738543003 Duganella sp. GV066 Isolate Unclassified
618 2738543012 Acidovorax sp. CF301 Isolate Unclassified
619 2738543018 Massilia sp. GV045 Isolate Unclassified
620 2738543026 Duganella sp. GV089 Isolate Unclassified
621 2738543029 Duganella sp. GV039 Isolate Unclassified
622 2738543030 Massilia sp. GV097 Isolate Unclassified
623 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
624 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
625 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
626 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
627 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
628 2816332133 Acidovorax radicis 2721A Isolate Unclassified
629 2818991436 Collimonas arenae 515 Isolate Unclassified
630 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
631 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
632 2821131069 Duganella sp. 1224 Isolate Unclassified
633 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
634 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
635 2842711865 Duganella sp. R-73148 Isolate Unclassified
636 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
637 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
638 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
639 2857553236 Duganella sp. R-74557 Isolate Unclassified
640 2857558681 Duganella sp. R-74565 Isolate Unclassified
641 2857564685 Duganella sp. R-74599 Isolate Unclassified
642 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
643 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
644 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
645 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
646 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
647 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
648 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
649 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
650 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
651 2904424332 Duganella sp. 1411 Isolate Rhizosphere
652 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
653 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
654 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
655 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
656 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
657 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
658 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
659 2919476304 Duganella sp. 3397 Isolate Unclassified
660 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
661 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
662 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
663 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
664 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
665 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
666 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
667 639633007 Azoarcus olearius BH72 Isolate Unclassified
668 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.89
Metatranscriptomes 25.72
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.66
Nodule 0.75
Rhizoplane 2.73
Rhizosphere 80.49
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0711160 3300044712 Bacteria 1091
2 JGI24740J21852_10001487 3300001979 Bacteria 10770
3 JGI24740J21852_10106123 3300001979 Bacteria 711
4 JGI24737J22298_10004492 3300001990 Bacteria 4859
5 JGI24738J21930_10088537 3300002075 Bacteria 653
6 JGI25156J39149_1016366 3300002705 Bacteria 1443
7 JGI25156J39149_1017873 3300002705 Bacteria 1330
8 JGI25162J39368_1000154 3300002737 Bacteria 75240
9 JGI25154J39366_1001042 3300002738 Bacteria 11063
10 JGI25157J39369_1011385 3300002741 Bacteria 1152
11 JGI25164J39214_1003736 3300002772 Bacteria 1860
12 JGI25150J39212_1001923 3300002774 Bacteria 5456
13 JGI25150J39212_1003501 3300002774 Bacteria 3664
14 Ga0006764J43180_105416 3300002864 Bacteria 2303
15 Ga0006767J43181_105098 3300002868 Bacteria 2522
16 Ga0006763J43179_104166 3300002870 Bacteria 5040
17 Ga0006762J43184_106210 3300002872 Bacteria 1019
18 JGI25159J45721_1059041 3300002987 Bacteria 506
19 Ga0006760J45825_101715 3300003158 Bacteria 2437
20 Ga0006760J45825_103029 3300003158 Bacteria 14292
21 Ga0006779J45831_104820 3300003160 Bacteria 2487
22 Ga0006765J45826_105454 3300003161 Bacteria 4839
23 Ga0006778J45830_1013714 3300003162 Bacteria 8778
24 Ga0006759J45824_1007037 3300003163 Bacteria 1508
25 Ga0006759J45824_1011122 3300003163 Bacteria 15613
26 Ga0006759J45824_1018706 3300003163 Bacteria 1553
27 Ga0006759J45824_1019946 3300003163 Bacteria 12757
28 Ga0006759J45824_1028038 3300003163 Bacteria 4414
29 Ga0006759J45824_1059282 3300003163 Bacteria 1344
30 Ga0006759J45824_1078589 3300003163 Bacteria 918
31 JGI25165J46597_1000239 3300003214 Bacteria 75240
32 JGI25153J46596_10002258 3300003215 Bacteria 11225
33 JGI25153J46596_10024994 3300003215 Bacteria 2143
34 Ga0007428J48920_101526 3300003288 Bacteria 3934
35 Ga0007421J48921_104512 3300003291 Bacteria 6358
36 Ga0006758J48902_1003545 3300003300 Bacteria 8441
37 Ga0006758J48902_1003546 3300003300 Bacteria 6400
38 Ga0006758J48902_1008804 3300003300 Bacteria 15348
39 Ga0006758J48902_1008911 3300003300 Bacteria 7674
40 Ga0006758J48902_1015405 3300003300 Bacteria 1839
41 Ga0006758J48902_1024042 3300003300 Bacteria 1099
42 Ga0006770J48903_1019658 3300003305 Bacteria 2060
43 Ga0006770J48903_1026191 3300003305 Bacteria 3112
44 Ga0006770J48903_1040316 3300003305 Bacteria 4936
45 Ga0006777J48905_1009816 3300003308 Bacteria 3090
46 Ga0006777J48905_1091218 3300003308 Bacteria 1296
47 rootH2_10116477 3300003320 Bacteria 1101
48 JGI25160J50197_1001051 3300003354 Bacteria 14224
49 JGI26142J50222_101156 3300003379 Bacteria 793
50 Ga0007417J51691_1002612 3300003544 Bacteria 14201
51 Ga0007417J51691_1007850 3300003544 Bacteria 19719
52 Ga0007417J51691_1010268 3300003544 Bacteria 1565
53 Ga0007417J51691_1011781 3300003544 Bacteria 8032
54 Ga0007417J51691_1048714 3300003544 Bacteria 1042
55 Ga0007427J51700_104411 3300003559 Bacteria 3323
56 Ga0007427J51700_113492 3300003559 Bacteria 2911
57 Ga0006781J51513_1010997 3300003568 Bacteria 3463
58 Ga0007410J51695_1002373 3300003574 Bacteria 2540
59 Ga0007410J51695_1004597 3300003574 Bacteria 14339
60 Ga0007410J51695_1005374 3300003574 Bacteria 15855
61 Ga0007410J51695_1012689 3300003574 Bacteria 12724
62 Ga0007410J51695_1025455 3300003574 Bacteria 2936
63 Ga0007410J51695_1041210 3300003574 Bacteria 3148
64 Ga0007410J51695_1041265 3300003574 Bacteria 753
65 Ga0007410J51695_1058196 3300003574 Bacteria 1167
66 Ga0007409J51694_1000685 3300003575 Bacteria 1950
67 Ga0007409J51694_1002576 3300003575 Bacteria 16363
68 Ga0007409J51694_1029110 3300003575 Bacteria 1244
69 Ga0007409J51694_1063905 3300003575 Bacteria 568
70 Ga0007409J51694_1070581 3300003575 Bacteria 1247
71 Ga0007416J51690_1004870 3300003577 Bacteria 16169
72 Ga0007416J51690_1005292 3300003577 Bacteria 1546
73 Ga0007416J51690_1050288 3300003577 Bacteria 661
74 Ga0007416J51690_1051380 3300003577 Bacteria 1428
75 Ga0007429J51699_1014434 3300003579 Bacteria 928
76 Ga0007429J51699_1081817 3300003579 Bacteria 2946
77 Ga0007411J51799_103551 3300003611 Bacteria 13349
78 Ga0007411J51799_103780 3300003611 Bacteria 16516
79 Ga0007411J51799_109076 3300003611 Bacteria 2033
80 Ga0007415J51800_102854 3300003613 Bacteria 5009
81 Ga0007415J51800_105493 3300003613 Bacteria 2566
82 Ga0007415J51800_106957 3300003613 Bacteria 14800
83 Ga0007415J51800_109761 3300003613 Bacteria 1239
84 Ga0032354_1003171 3300003693 Bacteria 2717
85 Ga0032354_1010694 3300003693 Bacteria 15995
86 Ga0032354_1020687 3300003693 Bacteria 6503
87 Ga0032354_1038818 3300003693 Bacteria 1084
88 Ga0032354_1045145 3300003693 Bacteria 2372
89 Ga0032354_1054804 3300003693 Bacteria 1134
90 Ga0006766_111745 3300003717 Bacteria 2278
91 Ga0006780_1003428 3300003735 Bacteria 4512
92 Ga0006780_1036212 3300003735 Bacteria 701
93 Ga0055538_1000094 3300003751 Bacteria 75240
94 Ga0055538_1000138 3300003751 Bacteria 51369
95 Ga0055539_1000136 3300003752 Bacteria 76284
96 Ga0055539_1000187 3300003752 Bacteria 51369
97 Ga0055533_1000143 3300003756 Bacteria 75240
98 Ga0055533_1000189 3300003756 Bacteria 51369
99 Ga0055532_1000184 3300003758 Bacteria 52595
100 Ga0055525_1000018 3300003759 Bacteria 393974
101 Ga0055525_1000188 3300003759 Bacteria 75240
102 Ga0055525_1000254 3300003759 Bacteria 51369
103 Ga0055535_1004814 3300003761 Bacteria 3154
104 Ga0055542_1007983 3300003762 Bacteria 2102
105 Ga0055529_1000079 3300003763 Bacteria 149370
106 Ga0055526_1006085 3300003771 Bacteria 6666
107 Ga0055526_1008246 3300003771 Bacteria 5232
108 Ga0055526_1008253 3300003771 Bacteria 5230
109 Ga0055526_1037912 3300003771 Bacteria 1251
110 Ga0055537_1008487 3300003773 Bacteria 2366
111 Ga0055537_1016447 3300003773 Bacteria 1251
112 Ga0055524_1000024 3300003775 Bacteria 217953
113 Ga0055524_1000140 3300003775 Bacteria 85990
114 Ga0055524_1003212 3300003775 Bacteria 8017
115 Ga0055524_1048599 3300003775 Bacteria 988
116 Ga0055534_1017762 3300003784 Bacteria 1251
117 Ga0055528_1018874 3300003790 Bacteria 2316
118 Ga0055528_1034347 3300003790 Bacteria 1251
119 Ga0055530_10006458 3300003791 Bacteria 5230
120 Ga0055530_10013385 3300003791 Bacteria 2803
121 Ga0055540_1000133 3300003792 Bacteria 75104
122 Ga0055540_1005791 3300003792 Bacteria 5078
123 Ga0055540_1025018 3300003792 Bacteria 1470
124 Ga0055540_1037600 3300003792 Bacteria 1066
125 Ga0055531_10002079 3300003794 Bacteria 13764
126 Ga0055531_10006076 3300003794 Bacteria 6916
127 Ga0055541_1000092 3300003841 Bacteria 75240
128 Ga0055541_1000122 3300003841 Bacteria 51369
129 Ga0055543_1075013 3300004625 Bacteria 526
130 Ga0058859_11666848 3300004798 Bacteria 6681
131 Ga0058863_10085600 3300004799 Bacteria 3459
132 Ga0058861_10170907 3300004800 Bacteria 1513
133 Ga0058861_11590956 3300004800 Bacteria 516
134 Ga0058860_12074819 3300004801 Bacteria 657
135 Ga0058862_10086046 3300004803 Bacteria 2163
136 Ga0058862_12189764 3300004803 Bacteria 565
137 Ga0065165_1006561 3300005262 Bacteria 6061
138 Ga0065165_1075084 3300005262 Bacteria 889
139 Ga0065165_1139912 3300005262 Bacteria 572
140 Ga0065165_1161401 3300005262 Bacteria 517
141 Ga0065714_10003225 3300005288 Bacteria 8263
142 Ga0065714_10022125 3300005288 Bacteria 1710
143 Ga0065714_10025602 3300005288 Bacteria 1737
144 Ga0065704_10109441 3300005289 Bacteria 1994
145 Ga0065704_10314924 3300005289 Bacteria 862
146 Ga0065715_10030875 3300005293 Bacteria 1888
147 Ga0065715_10471438 3300005293 Bacteria 806
148 Ga0065707_10413103 3300005295 Bacteria 839
149 Ga0070658_10018142 3300005327 Bacteria 5631
150 Ga0070658_10130450 3300005327 Bacteria 2094
151 Ga0070658_10651962 3300005327 Bacteria 913
152 Ga0070676_10039416 3300005328 Bacteria 2732
153 Ga0070683_100088965 3300005329 Bacteria 2897
154 Ga0070670_100033911 3300005331 Bacteria 4395
155 Ga0068869_101478616 3300005334 Bacteria 603
156 Ga0068869_101497089 3300005334 Bacteria 599
157 Ga0070666_10340547 3300005335 Bacteria 1072
158 Ga0070682_100098928 3300005337 Bacteria 1922
159 Ga0068868_100185626 3300005338 Bacteria 1727
160 Ga0070660_100001978 3300005339 Bacteria 14153
161 Ga0070661_100008785 3300005344 Bacteria 6991
162 Ga0070669_101914429 3300005353 Bacteria 518
163 Ga0070671_100170542 3300005355 Bacteria 1840
164 Ga0070688_100531111 3300005365 Bacteria 892
165 Ga0070659_100004652 3300005366 Bacteria 9804
166 Ga0070659_100341638 3300005366 Bacteria 1254
167 Ga0070667_100001546 3300005367 Bacteria 20614
168 Ga0070667_100013556 3300005367 Bacteria 6734
169 Ga0070667_101644246 3300005367 Bacteria 604
170 Ga0070713_100850446 3300005436 Bacteria 876
171 Ga0070711_100954273 3300005439 Bacteria 734
172 Ga0070705_101010293 3300005440 Bacteria 676
173 Ga0070663_100255852 3300005455 Bacteria 1387
174 Ga0070663_100389895 3300005455 Bacteria 1136
175 Ga0070678_100297921 3300005456 Bacteria 1369
176 Ga0070662_100119099 3300005457 Bacteria 2021
177 Ga0068867_100076663 3300005459 Bacteria 2511
178 Ga0070706_100446918 3300005467 Bacteria 1203
179 Ga0070679_100237339 3300005530 Bacteria 1782
180 Ga0070684_100098831 3300005535 Bacteria 2604
181 Ga0068853_100029320 3300005539 Bacteria 4637
182 Ga0068853_100679372 3300005539 Bacteria 981
183 Ga0070665_100113328 3300005548 Bacteria 2714
184 Ga0068855_100217302 3300005563 Bacteria 2145
185 Ga0068855_100301252 3300005563 Bacteria 1775
186 Ga0068855_100592398 3300005563 Bacteria 1196
187 Ga0068855_101964641 3300005563 Bacteria 591
188 Ga0070664_100027769 3300005564 Bacteria 4705
189 Ga0070664_100575074 3300005564 Bacteria 1043
190 Ga0068857_100009923 3300005577 Bacteria 8264
191 Ga0068857_100129652 3300005577 Bacteria 2274
192 Ga0068857_100148498 3300005577 Bacteria 2122
193 Ga0068857_100196425 3300005577 Bacteria 1838
194 Ga0068854_100016031 3300005578 Bacteria 4985
195 Ga0068854_100069183 3300005578 Bacteria 2576
196 Ga0068856_100049792 3300005614 Bacteria 4130
197 Ga0068856_100784861 3300005614 Bacteria 972
198 Ga0070702_100090534 3300005615 Bacteria 1854
199 Ga0068852_100004987 3300005616 Bacteria 9445
200 Ga0068852_100141024 3300005616 Bacteria 2230
201 Ga0068852_101287319 3300005616 Bacteria 753
202 Ga0068859_100364845 3300005617 Bacteria 1539
203 Ga0068864_100060451 3300005618 Bacteria 3280
204 Ga0068851_10001517 3300005834 Bacteria 10195
205 Ga0068851_10026076 3300005834 Bacteria 2870
206 Ga0068851_10034122 3300005834 Bacteria 2539
207 Ga0068863_100167300 3300005841 Bacteria 2108
208 Ga0068863_100362205 3300005841 Bacteria 1414
209 Ga0068858_100249510 3300005842 Bacteria 1685
210 Ga0068860_100125619 3300005843 Bacteria 2458
211 Ga0068860_100439747 3300005843 Bacteria 1295
212 Ga0070717_11201204 3300006028 Unclassified 690
213 Ga0075363_100057573 3300006048 Bacteria 2086
214 Ga0075364_10402497 3300006051 Bacteria 934
215 Ga0075432_10050036 3300006058 Bacteria 1473
216 Ga0075362_10000565 3300006177 Bacteria 10784
217 Ga0075362_10248447 3300006177 Bacteria 875
218 Ga0075366_10054228 3300006195 Bacteria 2381
219 Ga0075366_10055751 3300006195 Bacteria 2347
220 Ga0075366_10207954 3300006195 Bacteria 1191
221 Ga0097621_100254993 3300006237 Bacteria 1537
222 Ga0097621_101518870 3300006237 Bacteria 636
223 Ga0075370_10036206 3300006353 Bacteria 2772
224 Ga0075370_10212361 3300006353 Bacteria 1143
225 Ga0075370_10281646 3300006353 Bacteria 987
226 Ga0068871_100015656 3300006358 Bacteria 5684
227 Ga0068865_100140074 3300006881 Bacteria 1823
228 Ga0097620_100364841 3300006931 Bacteria 1539
229 Ga0079104_1000053 3300006946 Bacteria 168604
230 Ga0079104_1002693 3300006946 Bacteria 9148
231 Ga0079104_1004078 3300006946 Bacteria 6424
232 Ga0099826_10000010 3300006948 Bacteria 314346
233 Ga0099794_10024211 3300007265 Bacteria 2785
234 Ga0105244_10023517 3300009036 Bacteria 3377
235 Ga0105244_10028871 3300009036 Bacteria 2972
236 Ga0105244_10034566 3300009036 Bacteria 2660
237 Ga0105250_10074461 3300009092 Bacteria 1373
238 Ga0105240_10009383 3300009093 Bacteria 13863
239 Ga0105240_10108670 3300009093 Bacteria 3360
240 Ga0105240_10740893 3300009093 Bacteria 1069
241 Ga0105245_10023078 3300009098 Bacteria 5460
242 Ga0105243_10006860 3300009148 Bacteria 8779
243 Ga0105243_10231805 3300009148 Bacteria 1638
244 Ga0105243_11009752 3300009148 Bacteria 835
245 Ga0105243_11855132 3300009148 Bacteria 635
246 Ga0105241_10057980 3300009174 Bacteria 2972
247 Ga0105241_11279784 3300009174 Bacteria 698
248 Ga0105242_10007953 3300009176 Bacteria 8168
249 Ga0105242_11775528 3300009176 Bacteria 655
250 Ga0105248_10243333 3300009177 Bacteria 2025
251 Ga0105248_10673758 3300009177 Bacteria 1167
252 Ga0105237_10056847 3300009545 Bacteria 3915
253 Ga0105237_10360625 3300009545 Bacteria 1458
254 Ga0105238_10000255 3300009551 Bacteria 59531
255 Ga0105238_10006249 3300009551 Bacteria 11834
256 Ga0105238_10181832 3300009551 Bacteria 2079
257 Ga0130086_1083152 3300009829 Bacteria 503
258 Ga0130085_1065905 3300009850 Bacteria 503
259 Ga0105239_10001561 3300010375 Bacteria 30314
260 Ga0105239_10159405 3300010375 Bacteria 2520
261 Ga0105239_10168833 3300010375 Bacteria 2446
262 Ga0105239_11818894 3300010375 Bacteria 706
263 Ga0105246_10722820 3300011119 Bacteria 875
264 Ga0105246_10964055 3300011119 Bacteria 769
265 Ga0157323_1039635 3300012495 Bacteria 535
266 Ga0157319_1000005 3300012497 Bacteria 372810
267 Ga0157327_1037212 3300012512 Bacteria 638
268 Ga0157373_10015732 3300013100 Bacteria 5524
269 Ga0157373_10076108 3300013100 Bacteria 2368
270 Ga0157371_10061649 3300013102 Bacteria 2659
271 Ga0157370_10062522 3300013104 Bacteria 3530
272 Ga0157370_11169816 3300013104 Bacteria 694
273 Ga0157369_10093282 3300013105 Bacteria 3214
274 Ga0157374_10143777 3300013296 Bacteria 2316
275 Ga0157378_10027087 3300013297 Bacteria 5057
276 Ga0157378_10058938 3300013297 Bacteria 3425
277 Ga0163162_10060438 3300013306 Bacteria 3825
278 Ga0163162_10475400 3300013306 Bacteria 1381
279 Ga0157372_10466393 3300013307 Bacteria 1472
280 Ga0157372_10545256 3300013307 Bacteria 1352
281 Ga0157372_12890446 3300013307 Bacteria 550
282 Ga0182008_10001808 3300014497 Bacteria 13967
283 Ga0182008_10089080 3300014497 Bacteria 1521
284 Ga0157377_10643684 3300014745 Bacteria 762
285 Ga0157376_10741967 3300014969 Bacteria 990
286 Ga0182006_1000240 3300015261 Bacteria 51334
287 Ga0182006_1000274 3300015261 Bacteria 46140
288 Ga0182006_1002682 3300015261 Bacteria 9566
289 Ga0182006_1048484 3300015261 Bacteria 1643
290 Ga0182007_10000196 3300015262 Bacteria 40434
291 Ga0182007_10014439 3300015262 Bacteria 2977
292 Ga0182007_10054753 3300015262 Bacteria 1312
293 Ga0182005_1000016 3300015265 Bacteria 346889
294 Ga0182005_1000163 3300015265 Bacteria 46142
295 Ga0182005_1000370 3300015265 Bacteria 24872
296 Ga0163161_10007196 3300017792 Bacteria 7692
297 Ga0163161_10136578 3300017792 Bacteria 1854
298 Ga0163161_10252609 3300017792 Bacteria 1375
299 Ga0163161_10253434 3300017792 Bacteria 1372
300 Ga0197907_11499114 3300020069 Bacteria 1409
301 Ga0206349_1212656 3300020075 Bacteria 703
302 Ga0206355_1623195 3300020076 Bacteria 1223
303 Ga0206355_1637204 3300020076 Bacteria 604
304 Ga0206351_10065238 3300020077 Bacteria 1639
305 Ga0206352_10851379 3300020078 Bacteria 1458
306 Ga0206352_11092684 3300020078 Bacteria 931
307 Ga0206350_10425581 3300020080 Bacteria 3340
308 Ga0206354_10609314 3300020081 Bacteria 1073
309 Ga0213872_10010693 3300021361 Bacteria 4359
310 Ga0213872_10079633 3300021361 Bacteria 1472
311 Ga0213872_10171118 3300021361 Bacteria 941
312 Ga0209435_100079 3300025206 Bacteria 51612
313 Ga0209435_100343 3300025206 Bacteria 10794
314 Ga0209436_100401 3300025208 Bacteria 19545
315 Ga0209784_100010 3300025224 Bacteria 683664
316 Ga0209784_100035 3300025224 Bacteria 299760
317 Ga0209566_100008 3300025225 Bacteria 683664
318 Ga0209566_100040 3300025225 Bacteria 299760
319 Ga0209674_100019 3300025226 Bacteria 683664
320 Ga0209674_100057 3300025226 Bacteria 299760
321 Ga0209672_107144 3300025228 Bacteria 1747
322 Ga0209147_100060 3300025229 Bacteria 249588
323 Ga0209563_100011 3300025230 Bacteria 1187808
324 Ga0209563_100021 3300025230 Bacteria 683764
325 Ga0209563_100059 3300025230 Bacteria 299760
326 Ga0207427_100342 3300025231 Bacteria 30270
327 Ga0209437_100019 3300025233 Bacteria 683764
328 Ga0209437_100081 3300025233 Bacteria 271072
329 Ga0209258_100141 3300025242 Bacteria 166385
330 Ga0207425_1000021 3300025245 Bacteria 367537
331 Ga0207425_1000845 3300025245 Bacteria 15112
332 Ga0207425_1000932 3300025245 Bacteria 13905
333 Ga0209646_1000068 3300025246 Bacteria 233765
334 Ga0209646_1000265 3300025246 Bacteria 50897
335 Ga0209026_1000330 3300025250 Bacteria 47453
336 Ga0209026_1003315 3300025250 Bacteria 5361
337 Ga0209026_1020065 3300025250 Bacteria 1042
338 Ga0209677_100011 3300025253 Bacteria 683664
339 Ga0209677_100036 3300025253 Bacteria 299760
340 Ga0209677_102227 3300025253 Bacteria 7521
341 Ga0209148_1000444 3300025254 Bacteria 45400
342 Ga0209759_1000473 3300025256 Bacteria 44908
343 Ga0209129_1000020 3300025258 Bacteria 457053
344 Ga0209233_1000025 3300025261 Bacteria 683764
345 Ga0209565_1001042 3300025263 Bacteria 14043
346 Ga0209565_1003095 3300025263 Bacteria 5581
347 Ga0209565_1022600 3300025263 Bacteria 1301
348 Ga0209565_1026953 3300025263 Bacteria 1147
349 Ga0209565_1063764 3300025263 Bacteria 634
350 Ga0209455_1000070 3300025272 Bacteria 307867
351 Ga0209673_1000730 3300025273 Bacteria 45590
352 Ga0209673_1010299 3300025273 Bacteria 3948
353 Ga0209673_1057800 3300025273 Bacteria 986
354 Ga0209130_1010313 3300025284 Bacteria 2584
355 Ga0209675_1012428 3300025291 Bacteria 2743
356 Ga0209675_1038432 3300025291 Bacteria 1066
357 Ga0209564_1000027 3300025295 Bacteria 518458
358 Ga0209564_1000047 3300025295 Bacteria 368031
359 Ga0209564_1002740 3300025295 Bacteria 13260
360 Ga0209564_1079189 3300025295 Bacteria 648
361 Ga0209758_1000077 3300025297 Bacteria 268195
362 Ga0209758_1000322 3300025297 Bacteria 92458
363 Ga0209050_1000050 3300025298 Bacteria 362578
364 Ga0209050_1001097 3300025298 Bacteria 32856
365 Ga0209050_1002922 3300025298 Bacteria 13390
366 Ga0209256_1000045 3300025299 Bacteria 325506
367 Ga0209256_1000054 3300025299 Bacteria 298431
368 Ga0209256_1002719 3300025299 Bacteria 13723
369 Ga0209256_1004416 3300025299 Bacteria 8844
370 Ga0207426_1000802 3300025302 Bacteria 34010
371 Ga0209051_1000004 3300025303 Bacteria 1155596
372 Ga0209051_1073300 3300025303 Bacteria 1020
373 Ga0209257_1000075 3300025304 Bacteria 324855
374 Ga0209257_1000315 3300025304 Bacteria 102293
375 Ga0207697_10084711 3300025315 Bacteria 1338
376 Ga0207656_10040557 3300025321 Bacteria 1974
377 Ga0207656_10313374 3300025321 Bacteria 778
378 Ga0207656_10481553 3300025321 Bacteria 629
379 Ga0207696_1038621 3300025711 Bacteria 1408
380 Ga0207655_1000499 3300025728 Bacteria 50341
381 Ga0207655_1028515 3300025728 Bacteria 2632
382 Ga0207655_1031488 3300025728 Bacteria 2443
383 Ga0207647_10029480 3300025904 Bacteria 3551
384 Ga0207645_10052858 3300025907 Bacteria 2596
385 Ga0207705_10016800 3300025909 Bacteria 5240
386 Ga0207684_10409189 3300025910 Bacteria 1166
387 Ga0207654_10002111 3300025911 Bacteria 10175
388 Ga0207695_10001345 3300025913 Bacteria 41663
389 Ga0207695_10522141 3300025913 Bacteria 1069
390 Ga0207671_10007790 3300025914 Bacteria 9221
391 Ga0207671_10322971 3300025914 Bacteria 1222
392 Ga0207663_10739341 3300025916 Bacteria 781
393 Ga0207660_10096089 3300025917 Bacteria 2205
394 Ga0207662_10605482 3300025918 Bacteria 763
395 Ga0207657_10001495 3300025919 Bacteria 25015
396 Ga0207657_10030110 3300025919 Bacteria 4931
397 Ga0207649_10125160 3300025920 Bacteria 1738
398 Ga0207652_10959634 3300025921 Bacteria 753
399 Ga0207694_10000193 3300025924 Bacteria 61887
400 Ga0207694_10049485 3300025924 Bacteria 3254
401 Ga0207694_10051172 3300025924 Bacteria 3201
402 Ga0207650_10013708 3300025925 Bacteria 5620
403 Ga0207659_10170020 3300025926 Bacteria 1719
404 Ga0207687_10038586 3300025927 Bacteria 3265
405 Ga0207687_10042371 3300025927 Bacteria 3131
406 Ga0207644_10023313 3300025931 Bacteria 4238
407 Ga0207644_10288580 3300025931 Bacteria 1319
408 Ga0207690_10000959 3300025932 Bacteria 18469
409 Ga0207690_10175406 3300025932 Bacteria 1609
410 Ga0207706_10008025 3300025933 Bacteria 9741
411 Ga0207709_10019899 3300025935 Bacteria 3780
412 Ga0207709_10164903 3300025935 Bacteria 1549
413 Ga0207669_10254786 3300025937 Bacteria 1309
414 Ga0207704_10041905 3300025938 Bacteria 2689
415 Ga0207711_10109982 3300025941 Bacteria 2450
416 Ga0207711_10162953 3300025941 Bacteria 2020
417 Ga0207661_10747536 3300025944 Bacteria 900
418 Ga0207679_10002718 3300025945 Bacteria 10935
419 Ga0207667_10006290 3300025949 Bacteria 14403
420 Ga0207667_10042169 3300025949 Bacteria 4852
421 Ga0207667_10234580 3300025949 Bacteria 1878
422 Ga0207712_11021662 3300025961 Bacteria 734
423 Ga0207640_10004199 3300025981 Bacteria 7793
424 Ga0207640_10022226 3300025981 Bacteria 3792
425 Ga0207640_10135802 3300025981 Bacteria 1785
426 Ga0207658_10005603 3300025986 Bacteria 8589
427 Ga0207658_10041534 3300025986 Bacteria 3331
428 Ga0207658_11367942 3300025986 Bacteria 648
429 Ga0207677_10150765 3300026023 Bacteria 1793
430 Ga0207703_10067259 3300026035 Bacteria 2949
431 Ga0207639_11462473 3300026041 Bacteria 641
432 Ga0207678_10003236 3300026067 Bacteria 14714
433 Ga0207678_10721484 3300026067 Bacteria 878
434 Ga0207678_10932652 3300026067 Bacteria 768
435 Ga0207702_10134488 3300026078 Bacteria 2229
436 Ga0207702_10347747 3300026078 Bacteria 1418
437 Ga0207641_10131093 3300026088 Bacteria 2251
438 Ga0207641_10157362 3300026088 Bacteria 2063
439 Ga0207648_10088414 3300026089 Bacteria 2705
440 Ga0207648_10567080 3300026089 Bacteria 1044
441 Ga0207674_10005520 3300026116 Bacteria 15020
442 Ga0207674_10033169 3300026116 Bacteria 5406
443 Ga0207674_10040092 3300026116 Bacteria 4854
444 Ga0207683_10172753 3300026121 Bacteria 1958
445 Ga0207698_10000840 3300026142 Bacteria 17813
446 Ga0207698_10059102 3300026142 Bacteria 2975
447 Ga0209281_1000147 3300027111 Bacteria 168586
448 Ga0209281_1002282 3300027111 Bacteria 8082
449 Ga0209282_1000072 3300027666 Bacteria 81137
450 Ga0207428_10182412 3300027907 Bacteria 1585
451 Ga0268265_10143780 3300028380 Bacteria 2001
452 Ga0268264_10261615 3300028381 Bacteria 1612
453 Ga0265326_10017442 3300028558 Bacteria 2071
454 Ga0307517_10185945 3300028786 Bacteria 1330
455 Ga0307515_10301373 3300028794 Bacteria 1287
456 Ga0265338_10165948 3300028800 Bacteria 1700
457 Ga0316177_1129821 3300030731 Bacteria 1104
458 Ga0316177_1154066 3300030731 Bacteria 637
459 Ga0316176_1058761 3300030732 Bacteria 831
460 Ga0316176_1058827 3300030732 Bacteria 560
461 Ga0314311_1057607 3300030733 Bacteria 627
462 Ga0316179_1096110 3300030734 Bacteria 2738
463 Ga0316180_1056555 3300030736 Bacteria 3840
464 Ga0316180_1167379 3300030736 Bacteria 730
465 Ga0316183_1076598 3300030742 Bacteria 1906
466 Ga0316181_1197761 3300030744 Bacteria 2465
467 Ga0265767_100713 3300030836 Bacteria 1474
468 Ga0265766_1002773 3300030863 Bacteria 988
469 Ga0265766_1008174 3300030863 Bacteria 715
470 Ga0265764_102142 3300030882 Bacteria 944
471 Ga0265769_102926 3300030888 Bacteria 923
472 Ga0265768_102697 3300030963 Bacteria 922
473 Ga0265774_101097 3300031011 Bacteria 904
474 Ga0265331_10403822 3300031250 Bacteria 613
475 Ga0265327_10054273 3300031251 Bacteria 2075
476 Ga0307513_10124367 3300031456 Bacteria 2539
477 Ga0307513_10721554 3300031456 Bacteria 702
478 Ga0307408_100067624 3300031548 Bacteria 2628
479 Ga0307408_100141727 3300031548 Bacteria 1887
480 Ga0307408_101681340 3300031548 Bacteria 604
481 Ga0316575_10343388 3300031665 Bacteria 635
482 Ga0316578_10049623 3300031728 Bacteria 2453
483 Ga0307516_10433708 3300031730 Bacteria 971
484 Ga0307518_10004256 3300031838 Bacteria 10276
485 Ga0307406_11108511 3300031901 Bacteria 684
486 Ga0307412_10153493 3300031911 Bacteria 1702
487 Ga0307412_11948157 3300031911 Bacteria 543
488 Ga0307416_100002061 3300032002 Bacteria 11324
489 Ga0307416_101253949 3300032002 Bacteria 847
490 Ga0307416_102562250 3300032002 Bacteria 608
491 Ga0307414_10043339 3300032004 Bacteria 3064
492 Ga0307414_10232447 3300032004 Bacteria 1521
493 Ga0307411_10154296 3300032005 Bacteria 1711
494 Ga0316585_10022471 3300032137 Bacteria 1941
495 Ga0316593_10000292 3300032168 Bacteria 8493
496 Ga0316592_1001180 3300033524 Bacteria 4123
497 Ga0316588_1003102 3300033528 Bacteria 2985
498 Ga0373936_0011451 3300035113 Bacteria 3357
499 Ga0316574_0168024 3300035398 Bacteria 1412
500 Ga0373935_0167776 3300035692 Bacteria 1500
501 Ga0373927_0042076 3300035695 Bacteria 2962
502 Ga0373933_0035625 3300035724 Bacteria 2908
503 Ga0373937_0072024 3300036401 Bacteria 3187
504 Ga0265778_035225 3300036457 Bacteria 657
505 Ga0316582_0006061 3300036647 Bacteria 6303
506 Ga0316584_0025317 3300036712 Bacteria 4351
507 Ga0316584_0176768 3300036712 Bacteria 1581
508 Ga0373925_1493664 3300037068 Bacteria 553
509 Ga0395899_0000218 3300037312 Bacteria 79718
510 Ga0395899_0003628 3300037312 Bacteria 12217
511 Ga0395899_0010178 3300037312 Bacteria 7207
512 Ga0395899_0028029 3300037312 Bacteria 4241
513 Ga0395899_0082040 3300037312 Bacteria 2345
514 Ga0395899_0087203 3300037312 Bacteria 2266
515 Ga0395899_0091713 3300037312 Bacteria 2201
516 Ga0395899_0354989 3300037312 Bacteria 979
517 Ga0395900_0019646 3300037418 Bacteria 6888
518 Ga0395900_0065201 3300037418 Bacteria 3741
519 Ga0395900_0330458 3300037418 Bacteria 1502
520 Ga0395900_0571242 3300037418 Bacteria 1073
521 Ga0395898_0004013 3300037466 Bacteria 16185
522 Ga0395898_0275232 3300037466 Bacteria 1605
523 Ga0395898_0747121 3300037466 Bacteria 919
524 Ga0395898_1310052 3300037466 Bacteria 653
525 Ga0395898_1691808 3300037466 Bacteria 555
526 Ga0395905_0000549 3300037471 Bacteria 51321
527 Ga0395905_0008603 3300037471 Bacteria 10059
528 Ga0395905_0012898 3300037471 Bacteria 8034
529 Ga0395905_0085545 3300037471 Bacteria 2954
530 Ga0395905_0255533 3300037471 Bacteria 1636
531 Ga0395905_0387422 3300037471 Bacteria 1292
532 Ga0395905_0686264 3300037471 Bacteria 926
533 Ga0395905_1076116 3300037471 Bacteria 707
534 Ga0395901_0014473 3300038443 Bacteria 8024
535 Ga0395901_0036377 3300038443 Bacteria 5089
536 Ga0395901_0065153 3300038443 Bacteria 3793
537 Ga0395901_0176537 3300038443 Bacteria 2240
538 Ga0395901_0261380 3300038443 Bacteria 1801
539 Ga0395901_0727674 3300038443 Bacteria 987
540 Ga0395901_1557051 3300038443 Bacteria 615
541 Ga0436361_0097588 3300039447 Bacteria 1419
542 Ga0436361_0378504 3300039447 Bacteria 3034
543 Ga0436361_0391791 3300039447 Bacteria 42494
544 Ga0436361_0394538 3300039447 Bacteria 1896
545 Ga0436361_0568601 3300039447 Bacteria 1301
546 Ga0436361_1041947 3300039447 Bacteria 6318
547 Ga0436362_0392850 3300039453 Bacteria 872
548 Ga0436362_0937853 3300039453 Bacteria 503
549 Ga0439436_0040359 3300041404 Bacteria 1338
550 Ga0439439_0017685 3300041406 Bacteria 1756
551 Ga0439453_0001276 3300041408 Bacteria 3191
552 Ga0439453_0017786 3300041408 Bacteria 1251
553 Ga0439453_0022821 3300041408 Bacteria 1138
554 Ga0439465_0035548 3300041413 Bacteria 1598
555 Ga0439465_0061840 3300041413 Bacteria 1242
556 Ga0451788_18078 3300041442 Bacteria 1225
557 Ga0451790_18219 3300041444 Bacteria 776
558 Ga0451794_47388 3300041446 Bacteria 1425
559 Ga0451793_1577584 3300041452 Bacteria 587
560 Ga0451802_1810119 3300041460 Bacteria 1370
561 Ga0451805_045368 3300041461 Bacteria 950
562 Ga0451807_0965944 3300041486 Unclassified 504
563 Ga0451833_1345593 3300041491 Bacteria 1238
564 Ga0451848_13097 3300041504 Bacteria 504
565 Ga0451843_0537494 3300041509 Bacteria 1380
566 Ga0451853_2717427 3300041512 Bacteria 789
567 Ga0439431_0016768 3300041997 Bacteria 1717
568 Ga0439433_0025440 3300041999 Bacteria 1337
569 Ga0439448_0036322 3300042005 Bacteria 1580
570 Ga0439449_0003878 3300042007 Bacteria 5800
571 Ga0439449_0036247 3300042007 Bacteria 1835
572 Ga0439452_117351 3300042010 Bacteria 567
573 Ga0439454_015455 3300042011 Bacteria 1069
574 Ga0439454_084734 3300042011 Bacteria 579
575 Ga0439455_0000425 3300042012 Bacteria 5666
576 Ga0439455_0028934 3300042012 Bacteria 1367
577 Ga0439457_056273 3300042014 Bacteria 887
578 Ga0439462_0050140 3300042015 Bacteria 1121
579 Ga0450888_007845 3300042126 Bacteria 1191
580 Ga0450890_001085 3300042127 Bacteria 3967
581 Ga0450890_005814 3300042127 Bacteria 1585
582 Ga0450895_001799 3300042132 Bacteria 1535
583 Ga0450896_006823 3300042133 Bacteria 1570
584 Ga0450896_010644 3300042133 Bacteria 1291
585 Ga0450896_080762 3300042133 Bacteria 547
586 Ga0450898_014524 3300042134 Bacteria 1324
587 Ga0450899_002878 3300042135 Bacteria 1862
588 Ga0450904_000961 3300042139 Bacteria 4531
589 Ga0450906_012608 3300042145 Bacteria 1566
590 Ga0439446_0026982 3300042156 Bacteria 1648
591 Ga0439458_0053937 3300042157 Bacteria 995
592 Ga0439458_0120833 3300042157 Bacteria 689
593 Ga0450909_031207 3300042185 Bacteria 809
594 Ga0439434_0041575 3300042435 Bacteria 1412
595 Ga0439435_0004015 3300042436 Bacteria 3130
596 Ga0439464_0071151 3300042439 Bacteria 1029
597 Ga0439464_0181204 3300042439 Bacteria 667
598 Ga0450893_0051404 3300042532 Bacteria 773
599 Ga0451577_0121175 3300042876 Bacteria 2343
600 Ga0451577_0187466 3300042876 Bacteria 1865
601 Ga0451577_0256923 3300042876 Bacteria 1582
602 Ga0451577_0627501 3300042876 Bacteria 975
603 Ga0451577_1192501 3300042876 Unclassified 679
604 Ga0439440_0021857 3300042993 Bacteria 1446
605 Ga0453683_0003998 3300044673 Bacteria 10656
606 Ga0453683_0117933 3300044673 Bacteria 1670
607 Ga0453683_1015021 3300044673 Bacteria 551
608 Ga0466965_0214040 3300044683 Bacteria 1025
609 Ga0466965_0472369 3300044683 Bacteria 700
610 Ga0453684_0016436 3300044712 Bacteria 11569
611 Ga0453684_0026453 3300044712 Bacteria 8377
612 Ga0453684_0039050 3300044712 Bacteria 6474
613 Ga0453684_0055720 3300044712 Bacteria 5137
614 Ga0453684_0106268 3300044712 Bacteria 3421
615 Ga0453684_0167534 3300044712 Bacteria 2592
616 Ga0453684_0273428 3300044712 Bacteria 1929
617 Ga0453684_0422657 3300044712 Bacteria 1488
618 Ga0453684_1459834 3300044712 Unclassified 707
619 Ga0453684_2005111 3300044712 Unclassified 583
620 Ga0453684_2111979 3300044712 Unclassified 565
621 Ga0453684_2230229 3300044712 Bacteria 546
622 Ga0466968_0244610 3300044735 Bacteria 850
623 Ga0466970_0225020 3300044765 Bacteria 1048
624 Ga0466957_0385424 3300044842 Bacteria 956
625 Ga0466960_0701171 3300044901 Bacteria 607
626 Ga0466959_0047090 3300045049 Bacteria 3172
627 Ga0451576_0000454 3300045051 Bacteria 93047
628 Ga0451576_0057306 3300045051 Bacteria 4073
629 Ga0451576_0077585 3300045051 Bacteria 3457
630 Ga0451576_0121490 3300045051 Bacteria 2720
631 Ga0451576_0122787 3300045051 Bacteria 2704
632 Ga0451576_2161912 3300045051 Unclassified 572
633 Ga0466958_0378508 3300045836 Bacteria 913
634 Ga0466967_0538588 3300045976 Bacteria 1148
635 Ga0495617_000397 3300046452 Bacteria 24142
636 Ga0495617_000636 3300046452 Bacteria 17611
637 Ga0495617_000830 3300046452 Bacteria 14706
638 Ga0495617_007088 3300046452 Bacteria 3909
639 Ga0495627_000011 3300046453 Bacteria 354522
640 Ga0495627_008059 3300046453 Bacteria 3972
641 Ga0495603_0001612 3300046455 Bacteria 13252
642 Ga0495603_0009392 3300046455 Bacteria 5909
643 Ga0495590_0000020 3300046457 Bacteria 212352
644 Ga0495590_0000632 3300046457 Bacteria 16341
645 Ga0495590_0006208 3300046457 Bacteria 4677
646 Ga0495590_0190191 3300046457 Bacteria 752
647 Ga0495591_029494 3300046458 Bacteria 1665
648 Ga0495629_0007936 3300046459 Bacteria 7808
649 Ga0495629_0021816 3300046459 Bacteria 4570
650 Ga0495638_0000235 3300046460 Bacteria 75760
651 Ga0495638_0016045 3300046460 Bacteria 5020
652 Ga0495638_0077642 3300046460 Bacteria 2021
653 Ga0495638_0426272 3300046460 Bacteria 683
654 Ga0495651_0138175 3300046462 Bacteria 1770
655 Ga0495653_0000067 3300046463 Bacteria 90116
656 Ga0495653_0004702 3300046463 Bacteria 11053
657 Ga0495653_0009522 3300046463 Bacteria 7946
658 Ga0495650_0000200 3300046471 Bacteria 130223
659 Ga0495650_0001809 3300046471 Bacteria 19254
660 Ga0495650_0002469 3300046471 Bacteria 14877
661 Ga0495650_0017593 3300046471 Bacteria 3580
662 Ga0495650_0023728 3300046471 Bacteria 2914
663 Ga0495580_0299480 3300046472 Bacteria 1095
664 Ga0495582_0005108 3300046473 Bacteria 7350
665 Ga0495582_0063422 3300046473 Bacteria 2041
666 Ga0495605_0001735 3300046474 Bacteria 13971
667 Ga0495605_0005449 3300046474 Bacteria 7411
668 Ga0495605_0010393 3300046474 Bacteria 5209
669 Ga0495605_0013819 3300046474 Bacteria 4436
670 Ga0495605_0044149 3300046474 Bacteria 2205
671 Ga0495605_0070705 3300046474 Bacteria 1649
672 Ga0495605_0191971 3300046474 Bacteria 893
673 Ga0495605_0200282 3300046474 Bacteria 870
674 Ga0495584_0000636 3300046491 Bacteria 23364
675 Ga0495584_0002002 3300046491 Bacteria 11717
676 Ga0495584_0023314 3300046491 Bacteria 3138
677 Ga0495584_0036677 3300046491 Bacteria 2476
678 Ga0495584_0046813 3300046491 Bacteria 2181
679 Ga0495584_0070356 3300046491 Bacteria 1758
680 Ga0495584_0248975 3300046491 Bacteria 903
681 Ga0495584_0302486 3300046491 Bacteria 812
682 Ga0495585_0006666 3300046492 Bacteria 7134
683 Ga0495585_0022456 3300046492 Bacteria 3621
684 Ga0495585_0025799 3300046492 Bacteria 3361
685 Ga0495585_0068953 3300046492 Bacteria 1930
686 Ga0495585_0113007 3300046492 Bacteria 1442
687 Ga0495585_0295478 3300046492 Bacteria 797
688 Ga0495594_0050249 3300046499 Bacteria 2292
689 Ga0495594_0050658 3300046499 Bacteria 2284
690 Ga0495594_0158381 3300046499 Bacteria 1286
691 Ga0495594_0197851 3300046499 Bacteria 1145
692 Ga0495596_0001745 3300046500 Bacteria 12192
693 Ga0495596_0001963 3300046500 Bacteria 11349
694 Ga0495596_0070273 3300046500 Bacteria 1360
695 Ga0495596_0269906 3300046500 Bacteria 660
696 Ga0495607_0019187 3300046501 Bacteria 4347
697 Ga0495607_0042980 3300046501 Bacteria 2675
698 Ga0495607_0070470 3300046501 Bacteria 1953
699 Ga0495607_0099229 3300046501 Bacteria 1562
700 Ga0495607_0339027 3300046501 Bacteria 696
701 Ga0495583_0000317 3300046506 Bacteria 76193
702 Ga0495583_0002046 3300046506 Bacteria 18350
703 Ga0495583_0003152 3300046506 Bacteria 13002
704 Ga0495583_0004594 3300046506 Bacteria 9786
705 Ga0495583_0024275 3300046506 Bacteria 3049
706 Ga0495583_0063582 3300046506 Bacteria 1639
707 Ga0495583_0072580 3300046506 Bacteria 1510
708 Ga0495606_0000433 3300046507 Bacteria 69506
709 Ga0495606_0004241 3300046507 Bacteria 14500
710 Ga0495606_0013080 3300046507 Bacteria 6592
711 Ga0495606_0032750 3300046507 Bacteria 3595
712 Ga0495606_0035311 3300046507 Bacteria 3418
713 Ga0495606_0035831 3300046507 Bacteria 3387
714 Ga0495606_0073479 3300046507 Bacteria 2145
715 Ga0495606_0163349 3300046507 Bacteria 1297
716 Ga0495606_0189549 3300046507 Bacteria 1179
717 Ga0495608_0037678 3300046511 Bacteria 3251
718 Ga0495610_0000017 3300046512 Bacteria 365675
719 Ga0495610_0004520 3300046512 Bacteria 10242
720 Ga0495610_0035533 3300046512 Bacteria 2557
721 Ga0495610_0048651 3300046512 Bacteria 2080
722 Ga0495610_0159667 3300046512 Bacteria 954
723 Ga0495616_0003800 3300046513 Bacteria 9623
724 Ga0495616_0018110 3300046513 Bacteria 3874
725 Ga0495616_0028095 3300046513 Bacteria 2980
726 Ga0495616_0040567 3300046513 Bacteria 2377
727 Ga0495616_0042318 3300046513 Bacteria 2319
728 Ga0495616_0091183 3300046513 Bacteria 1442
729 Ga0495616_0152195 3300046513 Bacteria 1045
730 Ga0495616_0226651 3300046513 Bacteria 811
731 Ga0495616_0268671 3300046513 Bacteria 727
732 Ga0495620_0001543 3300046515 Bacteria 13683
733 Ga0495628_0107716 3300046516 Bacteria 2145
734 Ga0495631_0019480 3300046518 Bacteria 3181
735 Ga0495631_0026488 3300046518 Bacteria 2661
736 Ga0495631_0040478 3300046518 Bacteria 2064
737 Ga0495631_0059518 3300046518 Bacteria 1659
738 Ga0495631_0124850 3300046518 Bacteria 1106
739 Ga0495631_0173872 3300046518 Bacteria 923
740 Ga0495631_0292289 3300046518 Bacteria 693
741 Ga0495632_0083186 3300046519 Bacteria 1524
742 Ga0495632_0114594 3300046519 Bacteria 1263
743 Ga0495632_0119983 3300046519 Bacteria 1229
744 Ga0495637_0001780 3300046520 Bacteria 12324
745 Ga0495637_0002190 3300046520 Bacteria 10923
746 Ga0495637_0094170 3300046520 Bacteria 1177
747 Ga0495637_0109372 3300046520 Bacteria 1072
748 Ga0495643_0002891 3300046522 Bacteria 13023
749 Ga0495643_0014375 3300046522 Bacteria 4711
750 Ga0495643_0016892 3300046522 Bacteria 4279
751 Ga0495643_0026159 3300046522 Bacteria 3295
752 Ga0495643_0040909 3300046522 Bacteria 2529
753 Ga0495643_0055349 3300046522 Bacteria 2120
754 Ga0495643_0173422 3300046522 Bacteria 1053
755 Ga0495644_0003110 3300046523 Bacteria 6566
756 Ga0495644_0047750 3300046523 Bacteria 1607
757 Ga0495644_0056888 3300046523 Bacteria 1469
758 Ga0495644_0070446 3300046523 Bacteria 1313
759 Ga0495644_0108082 3300046523 Bacteria 1054
760 Ga0495644_0187660 3300046523 Bacteria 795
761 Ga0495648_0003167 3300046524 Bacteria 14648
762 Ga0495648_0072602 3300046524 Bacteria 1990
763 Ga0495663_0015755 3300046525 Bacteria 2132
764 Ga0495663_0032552 3300046525 Bacteria 1553
765 Ga0495663_0062920 3300046525 Bacteria 1169
766 Ga0495666_0202770 3300046526 Bacteria 911
767 Ga0495642_0004003 3300046528 Bacteria 5759
768 Ga0495642_0005824 3300046528 Bacteria 4726
769 Ga0495642_0008349 3300046528 Bacteria 3963
770 Ga0495642_0010689 3300046528 Bacteria 3515
771 Ga0495642_0033338 3300046528 Bacteria 2070
772 Ga0495642_0037203 3300046528 Bacteria 1968
773 Ga0495642_0091690 3300046528 Bacteria 1286
774 Ga0495642_0192405 3300046528 Bacteria 888
775 Ga0495642_0425179 3300046528 Bacteria 586
776 Ga0495652_0019185 3300046529 Bacteria 6091
777 Ga0495654_0000060 3300046530 Bacteria 134307
778 Ga0495654_0018887 3300046530 Bacteria 3607
779 Ga0495654_0214561 3300046530 Bacteria 817
780 Ga0495665_0099716 3300046531 Bacteria 1524
781 Ga0495586_0070286 3300046535 Bacteria 1912
782 Ga0495598_0076132 3300046537 Bacteria 1067
783 Ga0495609_0000007 3300046538 Bacteria 398812
784 Ga0495609_0005522 3300046538 Bacteria 6610
785 Ga0495609_0018793 3300046538 Bacteria 3201
786 Ga0495609_0019006 3300046538 Bacteria 3181
787 Ga0495609_0021767 3300046538 Bacteria 2957
788 Ga0495609_0026889 3300046538 Bacteria 2631
789 Ga0495609_0046136 3300046538 Bacteria 1951
790 Ga0495609_0122049 3300046538 Bacteria 1119
791 Ga0495597_0004273 3300046542 Bacteria 7899
792 Ga0495597_0007533 3300046542 Bacteria 5520
793 Ga0495597_0007961 3300046542 Bacteria 5336
794 Ga0495597_0022360 3300046542 Bacteria 2933
795 Ga0495597_0025313 3300046542 Bacteria 2732
796 Ga0495597_0050127 3300046542 Bacteria 1843
797 Ga0495597_0059514 3300046542 Bacteria 1668
798 Ga0495597_0072919 3300046542 Bacteria 1476
799 Ga0495597_0200339 3300046542 Bacteria 800
800 Ga0495645_0153398 3300046543 Bacteria 1598
801 Ga0495622_0002906 3300046557 Bacteria 8173
802 Ga0495622_0012942 3300046557 Bacteria 3869
803 Ga0495622_0041061 3300046557 Bacteria 2151
804 Ga0495622_0086811 3300046557 Bacteria 1438
805 Ga0495622_0132327 3300046557 Bacteria 1135
806 Ga0495633_0006566 3300046558 Bacteria 6874
807 Ga0495633_0010195 3300046558 Bacteria 5140
808 Ga0495633_0017696 3300046558 Bacteria 3636
809 Ga0495633_0095570 3300046558 Bacteria 1380
810 Ga0495633_0102739 3300046558 Bacteria 1326
811 Ga0495633_0103686 3300046558 Bacteria 1319
812 Ga0495633_0232640 3300046558 Bacteria 842
813 Ga0495656_0036295 3300046615 Bacteria 2029
814 Ga0495656_0077654 3300046615 Bacteria 1490
815 Ga0495656_0121688 3300046615 Bacteria 1232
816 Ga0495656_0266698 3300046615 Bacteria 869
817 Ga0495656_0443350 3300046615 Bacteria 683
818 Ga0495656_0509799 3300046615 Bacteria 638
819 Ga0495668_0002640 3300046616 Bacteria 14406
820 Ga0495668_0005163 3300046616 Bacteria 8962
821 Ga0495668_0008733 3300046616 Bacteria 6291
822 Ga0495668_0011342 3300046616 Bacteria 5343
823 Ga0495668_0018916 3300046616 Bacteria 3978
824 Ga0495668_0034324 3300046616 Bacteria 2846
825 Ga0495668_0134102 3300046616 Bacteria 1355
826 Ga0495668_0151367 3300046616 Bacteria 1270
827 Ga0495668_0230437 3300046616 Bacteria 1014
828 Ga0495668_0581424 3300046616 Bacteria 618
829 Ga0495611_0001662 3300046648 Bacteria 10778
830 Ga0495611_0002069 3300046648 Bacteria 9442
831 Ga0495611_0005909 3300046648 Bacteria 5219
832 Ga0495611_0007454 3300046648 Bacteria 4643
833 Ga0495611_0011467 3300046648 Bacteria 3757
834 Ga0495611_0020577 3300046648 Bacteria 2841
835 Ga0495611_0031470 3300046648 Bacteria 2335
836 Ga0495611_0115559 3300046648 Bacteria 1250
837 Ga0495625_0011213 3300046660 Bacteria 7328
838 Ga0495625_0016652 3300046660 Bacteria 5775
839 Ga0495625_0042626 3300046660 Bacteria 3296
840 Ga0495625_0125775 3300046660 Bacteria 1740
841 Ga0495625_0176951 3300046660 Bacteria 1421
842 Ga0495625_0288542 3300046660 Bacteria 1053
843 Ga0495625_0311060 3300046660 Bacteria 1005
844 Ga0495635_0008977 3300046663 Bacteria 6978
845 Ga0495635_0074819 3300046663 Bacteria 2320
846 Ga0495659_0118099 3300046664 Bacteria 1041
847 Ga0495661_0022142 3300046665 Bacteria 4136
848 Ga0495661_0048413 3300046665 Bacteria 2582
849 Ga0495661_0152056 3300046665 Bacteria 1249
850 Ga0495661_0178330 3300046665 Bacteria 1127
851 Ga0495661_0196882 3300046665 Bacteria 1057
852 Ga0495661_0203066 3300046665 Bacteria 1036
853 Ga0495661_0222381 3300046665 Bacteria 977
854 Ga0495661_0297574 3300046665 Bacteria 808
855 Ga0495661_0455057 3300046665 Bacteria 615
856 Ga0495588_0009027 3300046674 Bacteria 4594
857 Ga0495588_0022754 3300046674 Bacteria 3099
858 Ga0495588_0038295 3300046674 Bacteria 2438
859 Ga0495588_0067691 3300046674 Bacteria 1853
860 Ga0495588_0094469 3300046674 Bacteria 1567
861 Ga0495588_0143878 3300046674 Bacteria 1259
862 Ga0495588_0178690 3300046674 Bacteria 1121
863 Ga0495588_0496985 3300046674 Bacteria 639
864 Ga0495599_0001590 3300046678 Bacteria 13082
865 Ga0495623_0182525 3300046679 Bacteria 1218
866 Ga0495623_0460627 3300046679 Bacteria 676
867 Ga0495646_0168697 3300046680 Bacteria 1207
868 Ga0495658_0568452 3300046683 Bacteria 726
869 Ga0495669_0001596 3300046684 Bacteria 9305
870 Ga0495669_0002717 3300046684 Bacteria 7249
871 Ga0495669_0099817 3300046684 Bacteria 1347
872 Ga0495669_0183569 3300046684 Bacteria 997
873 Ga0495669_0345104 3300046684 Bacteria 719
874 Ga0495624_0133574 3300046690 Bacteria 1521
875 Ga0495670_0004991 3300046691 Bacteria 6522
876 Ga0495670_0031340 3300046691 Bacteria 2641
877 Ga0495670_0055789 3300046691 Bacteria 1981
878 Ga0495670_0226206 3300046691 Bacteria 994
879 Ga0495670_0252952 3300046691 Bacteria 939
880 Ga0495670_0344114 3300046691 Bacteria 802
881 Ga0495670_0658991 3300046691 Bacteria 570
882 Ga0495671_0000037 3300046692 Bacteria 177605
883 Ga0495671_0005005 3300046692 Bacteria 7807
884 Ga0495649_0007567 3300046694 Bacteria 6610
885 Ga0495649_0066300 3300046694 Bacteria 1937
886 Ga0495649_0141389 3300046694 Bacteria 1267
887 Ga0495649_0186833 3300046694 Bacteria 1079
888 Ga0495649_0622906 3300046694 Bacteria 531
889 Ga0495589_0030733 3300046794 Bacteria 2704
890 Ga0495589_0037560 3300046794 Bacteria 2426
891 Ga0495589_0053829 3300046794 Bacteria 1985
892 Ga0495589_0147423 3300046794 Bacteria 1124
893 Ga0495589_0156814 3300046794 Bacteria 1085
894 Ga0495589_0177111 3300046794 Bacteria 1012
895 Ga0495600_0112057 3300046809 Bacteria 1776
896 Ga0495660_0007547 3300046810 Bacteria 6384
897 Ga0495660_0010186 3300046810 Bacteria 5468
898 Ga0495660_0011018 3300046810 Bacteria 5250
899 Ga0495660_0015683 3300046810 Bacteria 4375
900 Ga0495660_0030532 3300046810 Bacteria 3035
901 Ga0495660_0034825 3300046810 Bacteria 2815
902 Ga0495660_0116918 3300046810 Bacteria 1353
903 Ga0495660_0153779 3300046810 Bacteria 1133
904 Ga0495660_0231960 3300046810 Bacteria 864
905 Ga0495660_0363178 3300046810 Bacteria 641
906 Ga0495660_0444407 3300046810 Bacteria 561
907 Ga0495581_0101745 3300047315 Bacteria 1669
908 Ga0495604_0010101 3300047317 Bacteria 7477
909 Ga0495604_0063319 3300047317 Bacteria 2821
910 Ga0495636_0001434 3300047318 Bacteria 9014
911 Ga0495636_0003890 3300047318 Bacteria 5826
912 Ga0495636_0178191 3300047318 Bacteria 963
913 Ga0495636_0207313 3300047318 Bacteria 896
914 Ga0495674_0009303 3300047319 Bacteria 9338
915 Ga0495672_0000013 3300047320 Bacteria 511827
916 Ga0495672_0000157 3300047320 Bacteria 98544
917 Ga0495672_0007686 3300047320 Bacteria 8079
918 Ga0495672_0016220 3300047320 Bacteria 5030
919 Ga0495672_0021784 3300047320 Bacteria 4174
920 Ga0495672_0449087 3300047320 Bacteria 581
921 Ga0495676_0004545 3300047321 Bacteria 12688
922 Ga0495676_0024323 3300047321 Bacteria 5246
923 Ga0495676_0303356 3300047321 Bacteria 1076
924 Ga0495680_0387251 3300047322 Bacteria 967
925 Ga0495683_0003225 3300047323 Bacteria 9532
926 Ga0495683_0014031 3300047323 Bacteria 4174
927 Ga0495683_0057199 3300047323 Bacteria 1938
928 Ga0495683_0070987 3300047323 Bacteria 1709
929 Ga0495683_0074576 3300047323 Bacteria 1662
930 Ga0495683_0141996 3300047323 Bacteria 1124
931 Ga0495683_0363683 3300047323 Bacteria 608
932 Ga0495687_000342 3300047443 Bacteria 59692
933 Ga0495687_001562 3300047443 Bacteria 20787
934 Ga0495687_002781 3300047443 Bacteria 13521
935 Ga0495687_002921 3300047443 Bacteria 12995
936 Ga0495687_007470 3300047443 Bacteria 6428
937 Ga0495675_0072153 3300047444 Bacteria 2178
938 Ga0495675_0622080 3300047444 Bacteria 610
939 Ga0495677_0001866 3300047445 Bacteria 8421
940 Ga0495677_0016634 3300047445 Bacteria 2669
941 Ga0495677_0032598 3300047445 Bacteria 1897
942 Ga0495677_0035931 3300047445 Bacteria 1808
943 Ga0495677_0037415 3300047445 Bacteria 1772
944 Ga0495677_0037798 3300047445 Bacteria 1763
945 Ga0495677_0114905 3300047445 Bacteria 1024
946 Ga0495679_006474 3300047446 Bacteria 5030
947 Ga0495679_008349 3300047446 Bacteria 4218
948 Ga0495679_034795 3300047446 Bacteria 1601
949 Ga0495685_000291 3300047447 Bacteria 16719
950 Ga0495685_001965 3300047447 Bacteria 6380
951 Ga0495685_014389 3300047447 Bacteria 2688
952 Ga0495685_036127 3300047447 Bacteria 1696
953 Ga0495685_063448 3300047447 Bacteria 1243
954 Ga0495685_082500 3300047447 Bacteria 1070
955 Ga0495673_0000248 3300047469 Bacteria 75224
956 Ga0495673_0017349 3300047469 Bacteria 3660
957 Ga0495673_0038455 3300047469 Bacteria 2176
958 Ga0495681_0011744 3300047470 Bacteria 5189
959 Ga0495681_0012224 3300047470 Bacteria 5057
960 Ga0495681_0124392 3300047470 Bacteria 1103
961 Ga0495686_0007683 3300047472 Bacteria 8051
962 Ga0495686_0010875 3300047472 Bacteria 6444
963 Ga0495686_0012785 3300047472 Bacteria 5856
964 Ga0495686_0018441 3300047472 Bacteria 4684
965 Ga0495686_0021073 3300047472 Bacteria 4336
966 Ga0495686_0061812 3300047472 Bacteria 2325
967 Ga0495686_0062817 3300047472 Bacteria 2302
968 Ga0495686_0088035 3300047472 Bacteria 1888
969 Ga0495593_0002955 3300047673 Bacteria 10225
970 Ga0495593_0073060 3300047673 Bacteria 1779
971 Ga0495602_0044651 3300048088 Bacteria 4017
972 Ga0495614_0054920 3300048089 Bacteria 1708
973 Ga0495614_0111517 3300048089 Bacteria 1201
974 Ga0495615_0009239 3300048090 Bacteria 1932
975 Ga0495615_0009700 3300048090 Bacteria 1903
976 Ga0495615_0170160 3300048090 Bacteria 659
977 Ga0495626_0000227 3300048091 Bacteria 66048
978 Ga0495626_0002147 3300048091 Bacteria 14252
979 Ga0495626_0014493 3300048091 Bacteria 4062
980 Ga0495626_0037979 3300048091 Bacteria 2285
981 Ga0495626_0081138 3300048091 Bacteria 1440
982 Ga0495626_0095315 3300048091 Bacteria 1303
983 Ga0495626_0107363 3300048091 Bacteria 1212
984 Ga0496100_0014114 3300048903 Bacteria 4630
985 Ga0496100_0246173 3300048903 Bacteria 1321
986 Ga0496101_0160023 3300048904 Bacteria 1726
987 Ga0496102_0219122 3300048905 Bacteria 1793
988 Ga0496102_0222236 3300048905 Bacteria 1780
989 Ga0496102_0240111 3300048905 Bacteria 1708
990 Ga0496103_0020711 3300048906 Bacteria 3953
991 Ga0496103_0061076 3300048906 Bacteria 2343
992 Ga0496103_0116859 3300048906 Bacteria 1697
993 Ga0496103_0135193 3300048906 Bacteria 1575
994 Ga0496103_0365428 3300048906 Bacteria 927
995 Ga0496104_0278667 3300048907 Bacteria 1585
996 Ga0496105_0266761 3300048908 Bacteria 1383
997 Ga0496105_0809280 3300048908 Bacteria 712
998 Ga0496107_0210280 3300048910 Bacteria 1446
999 Ga0496107_0273009 3300048910 Bacteria 1258
1000 Ga0496108_0443772 3300048911 Bacteria 1133
1001 Ga0496108_0847322 3300048911 Bacteria 787
1002 Ga0496109_0344021 3300048912 Bacteria 1408
1003 Ga0496109_0855448 3300048912 Bacteria 847
1004 Ga0496109_0885436 3300048912 Bacteria 831
1005 Ga0496109_0912647 3300048912 Bacteria 816
1006 Ga0496110_0458359 3300048913 Bacteria 1162
1007 Ga0496110_0508332 3300048913 Bacteria 1096
1008 Ga0496110_0900611 3300048913 Bacteria 791
1009 Ga0496112_0288436 3300048915 Bacteria 1587
1010 Ga0496113_0180677 3300048916 Bacteria 1672
1011 Ga0496113_0503465 3300048916 Bacteria 972
1012 Ga0496114_0010053 3300048917 Bacteria 7523
1013 Ga0496114_0041004 3300048917 Bacteria 3836
1014 Ga0496115_0050480 3300048918 Bacteria 3332
1015 Ga0496115_0864800 3300048918 Bacteria 699
1016 Ga0496116_0020766 3300048919 Bacteria 4975
1017 Ga0496116_0030638 3300048919 Bacteria 3861
1018 Ga0496116_0325888 3300048919 Bacteria 716
1019 Ga0496117_0000005 3300048920 Bacteria 777468
1020 Ga0496118_0000031 3300048921 Bacteria 339329
1021 Ga0496121_0004491 3300048924 Bacteria 18710
1022 Ga0496121_0079639 3300048924 Bacteria 2600
1023 Ga0496121_0157732 3300048924 Bacteria 1663
1024 Ga0496121_0274189 3300048924 Bacteria 1158
1025 Ga0496121_0369833 3300048924 Bacteria 949
1026 Ga0496121_0446598 3300048924 Bacteria 834
1027 Ga0496122_0000968 3300048925 Bacteria 51537
1028 Ga0496122_0005873 3300048925 Bacteria 14382
1029 Ga0496122_0111660 3300048925 Bacteria 1792
1030 Ga0496122_0158956 3300048925 Bacteria 1381
1031 Ga0496122_0239113 3300048925 Bacteria 1025
1032 Ga0496123_0004825 3300048926 Bacteria 13907
1033 Ga0496123_0005104 3300048926 Bacteria 13404
1034 Ga0496123_0076261 3300048926 Bacteria 2064
1035 Ga0496123_0194868 3300048926 Bacteria 1044
1036 Ga0496123_0364699 3300048926 Bacteria 667
1037 Ga0496124_0009077 3300048927 Bacteria 10283
1038 Ga0496124_0232737 3300048927 Bacteria 1376
1039 Ga0496124_0706698 3300048927 Bacteria 638
1040 Ga0496125_0009685 3300048928 Bacteria 9840
1041 Ga0496125_0040571 3300048928 Bacteria 3990
1042 Ga0496125_0128609 3300048928 Bacteria 1788
1043 Ga0496126_0004622 3300048929 Bacteria 16312
1044 Ga0496126_0804974 3300048929 Bacteria 721
1045 Ga0496126_1154987 3300048929 Bacteria 572
1046 Ga0496126_1182482 3300048929 Bacteria 563
1047 Ga0501306_000005 3300049127 Bacteria 11576
1048 Ga0501306_000907 3300049127 Bacteria 2551
1049 Ga0501306_000979 3300049127 Bacteria 2501
1050 Ga0501306_001799 3300049127 Bacteria 2089
1051 Ga0501306_064535 3300049127 Bacteria 608
1052 Ga0501308_000002 3300049128 Bacteria 13277
1053 Ga0501308_000177 3300049128 Bacteria 3494
1054 Ga0501308_004281 3300049128 Bacteria 1369
1055 Ga0501308_019194 3300049128 Bacteria 842
1056 Ga0501308_053997 3300049128 Bacteria 594
1057 Ga0501308_068015 3300049128 Bacteria 549
1058 Ga0501309_000053 3300049129 Bacteria 5860
1059 Ga0501309_011451 3300049129 Bacteria 1156
1060 Ga0501309_043262 3300049129 Bacteria 693
1061 Ga0501309_045031 3300049129 Bacteria 682
1062 Ga0501309_078610 3300049129 Bacteria 551
1063 Ga0501310_000065 3300049130 Bacteria 9861
1064 Ga0501310_001577 3300049130 Bacteria 2081
1065 Ga0501310_003240 3300049130 Bacteria 1584
1066 Ga0501310_012046 3300049130 Bacteria 986
1067 Ga0501310_045131 3300049130 Bacteria 624
1068 Ga0501341_01880 3300049131 Bacteria 1094
1069 Ga0501341_06842 3300049131 Bacteria 706
1070 Ga0501343_000946 3300049132 Bacteria 1870
1071 Ga0501343_008820 3300049132 Bacteria 809
1072 Ga0501344_08525 3300049133 Bacteria 612
1073 Ga0501304_000001 3300049160 Bacteria 14569
1074 Ga0501304_000110 3300049160 Bacteria 3123
1075 Ga0501304_001659 3300049160 Bacteria 1462
1076 Ga0501305_000399 3300049161 Bacteria 3488
1077 Ga0501305_002400 3300049161 Bacteria 2014
1078 Ga0501305_009251 3300049161 Bacteria 1291
1079 Ga0501305_009815 3300049161 Bacteria 1266
1080 Ga0501305_018025 3300049161 Bacteria 1019
1081 Ga0501305_115993 3300049161 Bacteria 510
1082 Ga0501307_000583 3300049162 Bacteria 2593
1083 Ga0501307_001509 3300049162 Bacteria 1982
1084 Ga0501307_002501 3300049162 Bacteria 1720
1085 Ga0501307_004640 3300049162 Bacteria 1415
1086 Ga0501307_007975 3300049162 Bacteria 1180
1087 Ga0501307_017346 3300049162 Bacteria 906
1088 Ga0501307_050237 3300049162 Bacteria 626
1089 Ga0501307_083358 3300049162 Bacteria 525
1090 Ga0501342_01262 3300049163 Bacteria 786
1091 Ga0495678_000010 3300049459 Bacteria 357896
1092 Ga0495678_006449 3300049459 Bacteria 6240
1093 Ga0495678_006909 3300049459 Bacteria 5955
1094 Ga0495678_063342 3300049459 Bacteria 1381
1095 Ga0495682_0003087 3300049460 Bacteria 7552
1096 Ga0495682_0035772 3300049460 Bacteria 1828
1097 Ga0495682_0049156 3300049460 Bacteria 1536
1098 Ga0501298_029220 3300049521 Bacteria 1073
1099 Ga0501298_100889 3300049521 Bacteria 658
1100 Ga0501300_024434 3300049523 Bacteria 885
1101 Ga0501303_006645 3300049526 Bacteria 1013
1102 Ga0501311_000002 3300049527 Bacteria 12093
1103 Ga0501311_006367 3300049527 Bacteria 1328
1104 Ga0501311_034960 3300049527 Bacteria 742
1105 Ga0501311_036217 3300049527 Bacteria 733
1106 Ga0501312_001195 3300049528 Bacteria 2468
1107 Ga0501312_002982 3300049528 Bacteria 1879
1108 Ga0501312_005276 3300049528 Bacteria 1563
1109 Ga0501312_006751 3300049528 Bacteria 1444
1110 Ga0501312_031628 3300049528 Bacteria 832
1111 Ga0501312_039196 3300049528 Bacteria 769
1112 Ga0501312_076553 3300049528 Bacteria 600
1113 Ga0501312_092049 3300049528 Bacteria 560
1114 Ga0501313_000012 3300049529 Bacteria 8507
1115 Ga0501313_000495 3300049529 Bacteria 2736
1116 Ga0501314_009484 3300049530 Bacteria 894
1117 Ga0501314_039418 3300049530 Bacteria 547
1118 Ga0501314_045646 3300049530 Bacteria 520
1119 Ga0501315_000004 3300049531 Bacteria 11326
1120 Ga0501315_000082 3300049531 Bacteria 4574
1121 Ga0501315_003410 3300049531 Bacteria 1589
1122 Ga0501315_009644 3300049531 Bacteria 1145
1123 Ga0501315_014533 3300049531 Bacteria 998
1124 Ga0501315_052771 3300049531 Bacteria 642
1125 Ga0501315_070240 3300049531 Bacteria 580
1126 Ga0501316_000002 3300049532 Bacteria 13278
1127 Ga0501316_000608 3300049532 Bacteria 2595
1128 Ga0501316_003898 3300049532 Bacteria 1476
1129 Ga0501317_031813 3300049533 Bacteria 769
1130 Ga0501318_000040 3300049534 Bacteria 5307
1131 Ga0501318_000292 3300049534 Bacteria 2919
1132 Ga0501318_011949 3300049534 Bacteria 988
1133 Ga0501319_000218 3300049535 Bacteria 2405
1134 Ga0501320_000368 3300049536 Bacteria 2523
1135 Ga0501320_000545 3300049536 Bacteria 2266
1136 Ga0501320_003268 3300049536 Bacteria 1362
1137 Ga0501320_005185 3300049536 Bacteria 1178
1138 Ga0501320_006733 3300049536 Bacteria 1086
1139 Ga0501320_011519 3300049536 Bacteria 917
1140 Ga0501320_012652 3300049536 Bacteria 891
1141 Ga0501320_022714 3300049536 Bacteria 737
1142 Ga0501320_025409 3300049536 Bacteria 710
1143 Ga0501320_029270 3300049536 Bacteria 678
1144 Ga0501320_046014 3300049536 Bacteria 584
1145 Ga0501321_006362 3300049537 Bacteria 1198
1146 Ga0501321_039989 3300049537 Bacteria 656
1147 Ga0501322_000643 3300049538 Bacteria 1716
1148 Ga0501322_015523 3300049538 Bacteria 630
1149 Ga0501322_022367 3300049538 Bacteria 562
1150 Ga0501323_000789 3300049539 Bacteria 2528
1151 Ga0501323_002509 3300049539 Bacteria 1787
1152 Ga0501323_006202 3300049539 Bacteria 1332
1153 Ga0501323_009479 3300049539 Bacteria 1148
1154 Ga0501323_028666 3300049539 Bacteria 772
1155 Ga0501323_038612 3300049539 Bacteria 694
1156 Ga0501324_002702 3300049540 Bacteria 1306
1157 Ga0501324_006256 3300049540 Bacteria 999
1158 Ga0501324_010219 3300049540 Bacteria 852
1159 Ga0501324_012262 3300049540 Bacteria 800
1160 Ga0501324_014045 3300049540 Bacteria 764
1161 Ga0501324_018192 3300049540 Bacteria 702
1162 Ga0501325_012167 3300049541 Bacteria 806
1163 Ga0501327_07127 3300049543 Bacteria 691
1164 Ga0501327_09548 3300049543 Bacteria 630
1165 Ga0501328_02722 3300049544 Bacteria 789
1166 Ga0501329_00384 3300049545 Bacteria 1510
1167 Ga0501329_09108 3300049545 Bacteria 605
1168 Ga0501330_008961 3300049546 Bacteria 693
1169 Ga0501334_01100 3300049550 Bacteria 1430
1170 Ga0501334_01285 3300049550 Bacteria 1363
1171 Ga0501335_000610 3300049551 Bacteria 2385
1172 Ga0501335_004710 3300049551 Bacteria 1202
1173 Ga0501335_029831 3300049551 Bacteria 613
1174 Ga0501335_040321 3300049551 Bacteria 549
1175 Ga0501336_000167 3300049552 Bacteria 2751
1176 Ga0501336_004393 3300049552 Bacteria 988
1177 Ga0501336_015269 3300049552 Bacteria 657
1178 Ga0501337_001443 3300049553 Bacteria 1361
1179 Ga0501337_003490 3300049553 Bacteria 1000
1180 Ga0501337_003553 3300049553 Bacteria 994
1181 Ga0501338_00312 3300049554 Bacteria 2096
1182 Ga0501338_02956 3300049554 Bacteria 987
1183 Ga0501338_05013 3300049554 Bacteria 814
1184 Ga0501340_011180 3300049556 Bacteria 666
1185 Ga0501340_027943 3300049556 Bacteria 501
1186 Ga0501031_0093307 3300049568 Bacteria 1964
1187 Ga0501031_0199569 3300049568 Bacteria 1305
1188 Ga0501032_0005689 3300049569 Bacteria 9231
1189 Ga0501032_0483829 3300049569 Bacteria 792
1190 Ga0501033_0001803 3300049570 Bacteria 18695
1191 Ga0501033_0020233 3300049570 Bacteria 5031
1192 Ga0501034_0029030 3300049571 Bacteria 5623
1193 Ga0501034_0080413 3300049571 Bacteria 3262
1194 Ga0501034_0150364 3300049571 Bacteria 2304
1195 Ga0501036_0085603 3300049572 Bacteria 2664
1196 Ga0501036_1644218 3300049572 Bacteria 518
1197 Ga0501037_0029069 3300049573 Bacteria 4082
1198 Ga0501037_0087529 3300049573 Bacteria 2254
1199 Ga0501037_0421680 3300049573 Bacteria 913
1200 Ga0501038_0004562 3300049574 Bacteria 12890
1201 Ga0501038_0476077 3300049574 Bacteria 957
1202 Ga0501039_0576058 3300049575 Bacteria 883
1203 Ga0501043_0044507 3300049579 Bacteria 3490
1204 Ga0501043_0093617 3300049579 Bacteria 2362
1205 Ga0501046_0047608 3300049580 Bacteria 3399
1206 Ga0501067_0533348 3300049583 Bacteria 657
1207 Ga0501072_0008088 3300049588 Bacteria 7980
1208 Ga0501073_0203968 3300049589 Bacteria 1367
1209 Ga0501073_0562883 3300049589 Bacteria 787
1210 Ga0501076_0818064 3300049592 Bacteria 769
1211 Ga0501077_0209868 3300049593 Bacteria 1237
1212 Ga0501222_031301 3300049662 Bacteria 732
1213 Ga0501227_014322 3300049665 Bacteria 1759
1214 Ga0501233_080366 3300049668 Bacteria 838
1215 Ga0501235_045772 3300049669 Bacteria 1007
1216 Ga0501238_000213 3300049671 Bacteria 8393
1217 Ga0501238_008550 3300049671 Bacteria 1348
1218 Ga0501249_010943 3300049679 Bacteria 1901
1219 Ga0501253_098313 3300049683 Bacteria 683
1220 Ga0501229_003004 3300049706 Bacteria 2006
1221 Ga0501079_0160362 3300049741 Bacteria 1754
1222 Ga0501241_041689 3300049758 Bacteria 891
1223 Ga0501263_084735 3300049760 Bacteria 528
1224 Ga0501269_000003 3300049766 Bacteria 111299
1225 Ga0501279_002045 3300049775 Bacteria 2668
1226 Ga0501279_007866 3300049775 Bacteria 1417
1227 Ga0501035_0010452 3300049822 Bacteria 8602
1228 Ga0501035_0136330 3300049822 Bacteria 2136
1229 Ga0501044_0007653 3300049823 Bacteria 11876
1230 nmdc:mga03683_14381_c1 3300050489 Bacteria 2927
1231 nmdc:mga0k408_17134_c1 3300050493 Bacteria 4032
1232 nmdc:mga0k408_255163_c1 3300050493 Bacteria 1047
1233 nmdc:mga07m45_166976_c1 3300050496 Bacteria 1278
1234 nmdc:mga07m45_398_c1 3300050496 Bacteria 17925
1235 nmdc:mga07m45_87196_c1 3300050496 Bacteria 1786
1236 nmdc:mga05p37_217522_c1 3300050507 Bacteria 2307
1237 Ga0495601_0585866 3300053077 Bacteria 716
1238 Ga0500594_0101680 3300053118 Bacteria 885
1239 Ga0500618_002645 3300053125 Bacteria 6592
1240 Ga0500618_040633 3300053125 Bacteria 1068
1241 Ga0500574_000403 3300053141 Bacteria 5436
1242 Ga0500586_012856 3300053145 Bacteria 2448
1243 Ga0500616_0013527 3300053153 Bacteria 4735
1244 Ga0501084_0089581 3300054114 Bacteria 2582
1245 Ga0587084_000213 3300059477 Bacteria 3885
1246 Ga0587084_000401 3300059477 Bacteria 3315
1247 Ga0587084_003559 3300059477 Bacteria 1720
1248 Ga0587084_026492 3300059477 Bacteria 906
1249 Ga0587084_047284 3300059477 Bacteria 751
1250 Ga0587084_091296 3300059477 Bacteria 605
1251 Ga0587084_117374 3300059477 Bacteria 556
1252 Ga0587093_000380 3300059478 Bacteria 2980
1253 Ga0587093_001062 3300059478 Bacteria 2196
1254 Ga0587093_006615 3300059478 Bacteria 1269
1255 Ga0587093_006649 3300059478 Bacteria 1267
1256 Ga0587093_033107 3300059478 Bacteria 753
1257 Ga0587066_064419 3300059490 Bacteria 756
1258 Ga0587066_064420 3300059490 Bacteria 756
1259 Ga0587070_064009 3300059491 Bacteria 768
1260 Ga0587070_068596 3300059491 Bacteria 751
1261 Ga0587073_0000035 3300059492 Bacteria 7203
1262 Ga0587077_001525 3300059493 Bacteria 2512
1263 Ga0587077_009258 3300059493 Bacteria 1490
1264 Ga0587077_014029 3300059493 Bacteria 1312
1265 Ga0587077_034721 3300059493 Bacteria 981
1266 Ga0587077_223544 3300059493 Bacteria 532
1267 Ga0587080_022409 3300059503 Bacteria 1046
1268 Ga0587080_056073 3300059503 Bacteria 756
1269 Ga0587080_056074 3300059503 Bacteria 756
1270 Ga0587082_004457 3300059504 Bacteria 1758
1271 Ga0587082_008271 3300059504 Bacteria 1446
1272 Ga0587082_024618 3300059504 Bacteria 1006
1273 Ga0587082_065628 3300059504 Bacteria 726
1274 Ga0587083_0007825 3300059505 Bacteria 1650
1275 Ga0587083_0011898 3300059505 Bacteria 1448
1276 Ga0587083_0088084 3300059505 Bacteria 752
1277 Ga0587083_0193213 3300059505 Bacteria 577
1278 Ga0587085_012368 3300059506 Bacteria 1169
1279 Ga0587085_048607 3300059506 Bacteria 765
1280 Ga0587086_000753 3300059507 Bacteria 2555
1281 Ga0587086_048491 3300059507 Bacteria 678
1282 Ga0587086_082925 3300059507 Bacteria 568
1283 Ga0587088_001117 3300059508 Bacteria 2664
1284 Ga0587088_041644 3300059508 Bacteria 867
1285 Ga0587088_063898 3300059508 Bacteria 752
1286 Ga0587089_000565 3300059509 Bacteria 2935
1287 Ga0587089_009810 3300059509 Bacteria 1182
1288 Ga0587089_023489 3300059509 Bacteria 868
1289 Ga0587089_075285 3300059509 Bacteria 580
1290 Ga0587090_001908 3300059510 Bacteria 2200
1291 Ga0587090_051986 3300059510 Bacteria 753
1292 Ga0587090_052046 3300059510 Bacteria 753
1293 Ga0587090_108649 3300059510 Bacteria 589
1294 Ga0587091_002949 3300059511 Bacteria 2086
1295 Ga0587091_073030 3300059511 Bacteria 755
1296 Ga0587091_073148 3300059511 Bacteria 754
1297 Ga0587091_101709 3300059511 Bacteria 675
1298 Ga0587092_000969 3300059512 Bacteria 2624
1299 Ga0587092_008630 3300059512 Bacteria 1350
1300 Ga0587092_042166 3300059512 Bacteria 798
1301 Ga0587092_050322 3300059512 Bacteria 752
1302 Ga0587094_015441 3300059513 Bacteria 1054
1303 Ga0587094_016778 3300059513 Bacteria 1023
1304 Ga0587094_097379 3300059513 Bacteria 564
1305 Ga0587097_00549 3300059603 Bacteria 1121
1306 Ga0587098_004256 3300059604 Bacteria 1340
1307 Ga0587106_001550 3300059605 Bacteria 2066
1308 Ga0587125_002919 3300059607 Bacteria 1413
1309 Ga0587099_000239 3300059622 Bacteria 2770
1310 Ga0587101_002644 3300059623 Bacteria 1735
1311 Ga0587101_023534 3300059623 Bacteria 907
1312 Ga0587101_042527 3300059623 Bacteria 755
1313 Ga0587109_003197 3300059624 Bacteria 2163
1314 Ga0587113_000311 3300059625 Bacteria 2411
1315 Ga0587115_010663 3300059626 Bacteria 1148
1316 Ga0587115_096841 3300059626 Bacteria 542
1317 Ga0587117_011034 3300059627 Bacteria 1113
1318 Ga0587117_038563 3300059627 Bacteria 752
1319 Ga0587127_004393 3300059629 Bacteria 933
1320 Ga0587128_011641 3300059630 Bacteria 1206
1321 Ga0587062_000153 3300059639 Bacteria 3794
1322 Ga0587062_000195 3300059639 Bacteria 3564
1323 Ga0587062_002195 3300059639 Bacteria 1823
1324 Ga0587062_032496 3300059639 Bacteria 807
1325 Ga0587062_040726 3300059639 Bacteria 752
1326 Ga0587067_026739 3300059640 Bacteria 1036
1327 Ga0587068_000350 3300059641 Bacteria 3976
1328 Ga0587068_001305 3300059641 Bacteria 2742
1329 Ga0587068_002203 3300059641 Bacteria 2337
1330 Ga0587068_080234 3300059641 Bacteria 658
1331 Ga0587068_100300 3300059641 Bacteria 607
1332 Ga0587068_125316 3300059641 Bacteria 561
1333 Ga0587069_063455 3300059642 Bacteria 686
1334 Ga0587072_000243 3300059643 Bacteria 4970
1335 Ga0587072_005559 3300059643 Bacteria 1887
1336 Ga0587072_066500 3300059643 Bacteria 753
1337 Ga0587072_066501 3300059643 Bacteria 753
1338 Ga0587072_072842 3300059643 Bacteria 729
1339 Ga0587075_044338 3300059644 Bacteria 756
1340 Ga0587076_002988 3300059645 Bacteria 1964
1341 Ga0587076_012405 3300059645 Bacteria 1273
1342 Ga0587076_012406 3300059645 Bacteria 1273
1343 Ga0587076_013020 3300059645 Bacteria 1254
1344 Ga0587076_047966 3300059645 Bacteria 823
1345 Ga0587076_138571 3300059645 Bacteria 580
1346 Ga0587076_154746 3300059645 Bacteria 559
1347 Ga0587078_016824 3300059646 Bacteria 894
1348 Ga0587078_051400 3300059646 Bacteria 605
1349 Ga0587079_000584 3300059647 Bacteria 3398
1350 Ga0587079_006516 3300059647 Bacteria 1705
1351 Ga0587079_011451 3300059647 Bacteria 1429
1352 Ga0587079_037243 3300059647 Bacteria 966
1353 Ga0587100_001488 3300059648 Bacteria 1381
1354 Ga0587100_003223 3300059648 Bacteria 1105
1355 Ga0587100_007445 3300059648 Bacteria 865
1356 Ga0587102_000132 3300059649 Bacteria 3370
1357 Ga0587104_000049 3300059650 Bacteria 3143
1358 Ga0587107_001789 3300059652 Bacteria 1818
1359 Ga0587107_006131 3300059652 Bacteria 1303
1360 Ga0587107_043660 3300059652 Bacteria 734
1361 Ga0587107_098143 3300059652 Bacteria 576
1362 Ga0587108_000210 3300059653 Bacteria 2694
1363 Ga0587114_007269 3300059655 Bacteria 1266
1364 Ga0587116_02402 3300059656 Bacteria 987
1365 Ga0587118_01521 3300059657 Bacteria 1414
1366 Ga0587118_11699 3300059657 Bacteria 678
1367 Ga0587119_023436 3300059658 Bacteria 803
1368 Ga0587120_002973 3300059659 Bacteria 1193
1369 Ga0587124_001813 3300059660 Bacteria 1438
1370 Ga0587124_014179 3300059660 Bacteria 755
1371 Ga0587124_029558 3300059660 Bacteria 600
1372 Ga0587060_000715 3300060243 Bacteria 1955
1373 Ga0587060_006105 3300060243 Bacteria 954
1374 Ga0587096_00279 3300060247 Bacteria 1279
1375 Ga0587071_001373 3300060344 Bacteria 3016
1376 Ga0587071_043674 3300060344 Bacteria 906
1377 Ga0587071_071506 3300060344 Bacteria 756
1378 Ga0587071_071662 3300060344 Bacteria 756
1379 Ga0587111_0000229 3300060346 Bacteria 4601
1380 Ga0587111_0000781 3300060346 Bacteria 3362
1381 Ga0587111_0007805 3300060346 Bacteria 1752
1382 Ga0587111_0008023 3300060346 Bacteria 1736
1383 Ga0587111_0020048 3300060346 Bacteria 1275
1384 Ga0587111_0096385 3300060346 Bacteria 730
1385 Ga0587111_0157547 3300060346 Bacteria 615
1386 Ga0587111_0180594 3300060346 Bacteria 586
1387 Ga0587111_0189494 3300060346 Bacteria 577
1388 2511247454 2511231003 Bacteria 5606035
1389 2511384335 2511231026 Bacteria 5225445
1390 2521560874 2521172590 Bacteria 5047645
1391 2548501398 2547132374 Bacteria 5530232
1392 2550696684 2548876994 Bacteria 4904866
1393 2553007583 2551306416 Bacteria 6152985
1394 2601667016 2600255292 Bacteria 6300551
1395 2643792081 2643221554 Bacteria 6603920
1396 2643799424 2643221556 Bacteria 7251154
1397 2643868380 2643221570 Bacteria 5103772
1398 2643994491 2643221596 Bacteria 5006805
1399 2644026938 2643221603 Bacteria 6147767
1400 2644061505 2643221609 Bacteria 6756331
1401 2644075037 2643221611 Bacteria 6820941
1402 2644163760 2643221628 Bacteria 5745828
1403 2644216438 2643221638 Bacteria 6579467
1404 2644247750 2643221644 Bacteria 6865017
1405 2644254812 2643221645 Bacteria 7207331
1406 2644295316 2643221652 Bacteria 5140275
1407 2644360373 2643221664 Bacteria 7272945
1408 2644471517 2643221684 Bacteria 7145183
1409 2644649057 2643221717 Bacteria 5676132
1410 2722886127 2721755523 Bacteria 6430384
1411 2738738121 2738541280 Bacteria 6630198
1412 2738826784 2738541297 Bacteria 6549566
1413 2738843081 2738541300 Bacteria 6675882
1414 2739150581 2738541357 Bacteria 6549408
1415 2739192500 2738543003 Bacteria 6549560
1416 2739243206 2738543012 Bacteria 7115078
1417 2739273832 2738543018 Bacteria 6718814
1418 2739318977 2738543026 Bacteria 6549408
1419 2739337218 2738543029 Bacteria 6549249
1420 2739342876 2738543030 Bacteria 6719714
1421 2765567308 2765235838 Bacteria 5445269
1422 2808984219 2808606386 Bacteria 4471946
1423 2809132023 2808606415 Bacteria 4576710
1424 2809145897 2808606418 Bacteria 6724496
1425 2809151646 2808606419 Bacteria 4576925
1426 2816473781 2816332133 Bacteria 7249298
1427 2819543890 2818991436 Bacteria 5376622
1428 2819594350 2818991445 Bacteria 4955017
1429 2819618745 2818991449 Bacteria 5518009
1430 2821135880 2821131069 Bacteria 6108407
1431 2839095393 2839094727 Bacteria 5534556
1432 2839144215 2839138175 Bacteria 6549354
1433 2842712342 2842711865 Bacteria 7155354
1434 2842722289 2842718218 Bacteria 4560148
1435 2852622894 2852618963 Bacteria 4577824
1436 2857549061 2857547612 Bacteria 6179999
1437 2857556286 2857553236 Bacteria 6166726
1438 2857560797 2857558681 Bacteria 6617694
1439 2857567996 2857564685 Bacteria 6290584
1440 2881104313 2881101125 Bacteria 4590519
1441 2884811930 2884811622 Bacteria 5552861
1442 2884840748 2884836552 Bacteria 5219991
1443 2884857656 2884852848 Bacteria 5221161
1444 2885084375 2885080285 Bacteria 6355622
1445 2885197770 2885192300 Bacteria 5882526
1446 2891635731 2891633521 Bacteria 4602265
1447 2894023740 2894023352 Bacteria 5167372
1448 2896158596 2896154374 Bacteria 5221518
1449 2904428888 2904424332 Bacteria 7633521
1450 2904442511 2904439833 Bacteria 5931679
1451 2904533769 2904530477 Bacteria 5876334
1452 2904589394 2904584206 Bacteria 6028872
1453 2904595097 2904589729 Bacteria 6113573
1454 2904602401 2904601388 Bacteria 5884906
1455 2919050749 2919046199 Bacteria 5567169
1456 2919084944 2919079590 Bacteria 5946433
1457 2919476952 2919476304 Bacteria 5888696
1458 2923514715 2923510766 Bacteria 5926163
1459 2928135683 2928130867 Bacteria 5467269
1460 2932416111 2932410948 Bacteria 6312192
1461 2932422213 2932416698 Bacteria 6315112
1462 2954769598 2954767861 Bacteria 5535784
1463 2974320958 2974320154 Bacteria 4571377
1464 2990715407 2990710928 Bacteria 5002431
1465 639788565 639633007 Bacteria 4376040
1466 8047676082 8047673197 Bacteria 7395230
1467 Ga0453684_0711160
1468 JGI24740J21852_10001487
1469 JGI24740J21852_10106123
1470 JGI24737J22298_10004492
1471 JGI24738J21930_10088537
1472 JGI25156J39149_1016366
1473 JGI25156J39149_1017873
1474 JGI25162J39368_1000154
1475 JGI25154J39366_1001042
1476 JGI25157J39369_1011385
1477 JGI25164J39214_1003736
1478 JGI25150J39212_1001923
1479 JGI25150J39212_1003501
1480 Ga0006764J43180_105416
1481 Ga0006767J43181_105098
1482 Ga0006763J43179_104166
1483 Ga0006762J43184_106210
1484 JGI25159J45721_1059041
1485 Ga0006760J45825_101715
1486 Ga0006760J45825_103029
1487 Ga0006779J45831_104820
1488 Ga0006765J45826_105454
1489 Ga0006778J45830_1013714
1490 Ga0006759J45824_1007037
1491 Ga0006759J45824_1011122
1492 Ga0006759J45824_1018706
1493 Ga0006759J45824_1019946
1494 Ga0006759J45824_1028038
1495 Ga0006759J45824_1059282
1496 Ga0006759J45824_1078589
1497 JGI25165J46597_1000239
1498 JGI25153J46596_10002258
1499 JGI25153J46596_10024994
1500 Ga0007428J48920_101526
1501 Ga0007421J48921_104512
1502 Ga0006758J48902_1003545
1503 Ga0006758J48902_1003546
1504 Ga0006758J48902_1008804
1505 Ga0006758J48902_1008911
1506 Ga0006758J48902_1015405
1507 Ga0006758J48902_1024042
1508 Ga0006770J48903_1019658
1509 Ga0006770J48903_1026191
1510 Ga0006770J48903_1040316
1511 Ga0006777J48905_1009816
1512 Ga0006777J48905_1091218
1513 rootH2_10116477
1514 JGI25160J50197_1001051
1515 JGI26142J50222_101156
1516 Ga0007417J51691_1002612
1517 Ga0007417J51691_1007850
1518 Ga0007417J51691_1010268
1519 Ga0007417J51691_1011781
1520 Ga0007417J51691_1048714
1521 Ga0007427J51700_104411
1522 Ga0007427J51700_113492
1523 Ga0006781J51513_1010997
1524 Ga0007410J51695_1002373
1525 Ga0007410J51695_1004597
1526 Ga0007410J51695_1005374
1527 Ga0007410J51695_1012689
1528 Ga0007410J51695_1025455
1529 Ga0007410J51695_1041210
1530 Ga0007410J51695_1041265
1531 Ga0007410J51695_1058196
1532 Ga0007409J51694_1000685
1533 Ga0007409J51694_1002576
1534 Ga0007409J51694_1029110
1535 Ga0007409J51694_1063905
1536 Ga0007409J51694_1070581
1537 Ga0007416J51690_1004870
1538 Ga0007416J51690_1005292
1539 Ga0007416J51690_1050288
1540 Ga0007416J51690_1051380
1541 Ga0007429J51699_1014434
1542 Ga0007429J51699_1081817
1543 Ga0007411J51799_103551
1544 Ga0007411J51799_103780
1545 Ga0007411J51799_109076
1546 Ga0007415J51800_102854
1547 Ga0007415J51800_105493
1548 Ga0007415J51800_106957
1549 Ga0007415J51800_109761
1550 Ga0032354_1003171
1551 Ga0032354_1010694
1552 Ga0032354_1020687
1553 Ga0032354_1038818
1554 Ga0032354_1045145
1555 Ga0032354_1054804
1556 Ga0006766_111745
1557 Ga0006780_1003428
1558 Ga0006780_1036212
1559 Ga0055538_1000094
1560 Ga0055538_1000138
1561 Ga0055539_1000136
1562 Ga0055539_1000187
1563 Ga0055533_1000143
1564 Ga0055533_1000189
1565 Ga0055532_1000184
1566 Ga0055525_1000018
1567 Ga0055525_1000188
1568 Ga0055525_1000254
1569 Ga0055535_1004814
1570 Ga0055542_1007983
1571 Ga0055529_1000079
1572 Ga0055526_1006085
1573 Ga0055526_1008246
1574 Ga0055526_1008253
1575 Ga0055526_1037912
1576 Ga0055537_1008487
1577 Ga0055537_1016447
1578 Ga0055524_1000024
1579 Ga0055524_1000140
1580 Ga0055524_1003212
1581 Ga0055524_1048599
1582 Ga0055534_1017762
1583 Ga0055528_1018874
1584 Ga0055528_1034347
1585 Ga0055530_10006458
1586 Ga0055530_10013385
1587 Ga0055540_1000133
1588 Ga0055540_1005791
1589 Ga0055540_1025018
1590 Ga0055540_1037600
1591 Ga0055531_10002079
1592 Ga0055531_10006076
1593 Ga0055541_1000092
1594 Ga0055541_1000122
1595 Ga0055543_1075013
1596 Ga0058859_11666848
1597 Ga0058863_10085600
1598 Ga0058861_10170907
1599 Ga0058861_11590956
1600 Ga0058860_12074819
1601 Ga0058862_10086046
1602 Ga0058862_12189764
1603 Ga0065165_1006561
1604 Ga0065165_1075084
1605 Ga0065165_1139912
1606 Ga0065165_1161401
1607 Ga0065714_10003225
1608 Ga0065714_10022125
1609 Ga0065714_10025602
1610 Ga0065704_10109441
1611 Ga0065704_10314924
1612 Ga0065715_10030875
1613 Ga0065715_10471438
1614 Ga0065707_10413103
1615 Ga0070658_10018142
1616 Ga0070658_10130450
1617 Ga0070658_10651962
1618 Ga0070676_10039416
1619 Ga0070683_100088965
1620 Ga0070670_100033911
1621 Ga0068869_101478616
1622 Ga0068869_101497089
1623 Ga0070666_10340547
1624 Ga0070682_100098928
1625 Ga0068868_100185626
1626 Ga0070660_100001978
1627 Ga0070661_100008785
1628 Ga0070669_101914429
1629 Ga0070671_100170542
1630 Ga0070688_100531111
1631 Ga0070659_100004652
1632 Ga0070659_100341638
1633 Ga0070667_100001546
1634 Ga0070667_100013556
1635 Ga0070667_101644246
1636 Ga0070713_100850446
1637 Ga0070711_100954273
1638 Ga0070705_101010293
1639 Ga0070663_100255852
1640 Ga0070663_100389895
1641 Ga0070678_100297921
1642 Ga0070662_100119099
1643 Ga0068867_100076663
1644 Ga0070706_100446918
1645 Ga0070679_100237339
1646 Ga0070684_100098831
1647 Ga0068853_100029320
1648 Ga0068853_100679372
1649 Ga0070665_100113328
1650 Ga0068855_100217302
1651 Ga0068855_100301252
1652 Ga0068855_100592398
1653 Ga0068855_101964641
1654 Ga0070664_100027769
1655 Ga0070664_100575074
1656 Ga0068857_100009923
1657 Ga0068857_100129652
1658 Ga0068857_100148498
1659 Ga0068857_100196425
1660 Ga0068854_100016031
1661 Ga0068854_100069183
1662 Ga0068856_100049792
1663 Ga0068856_100784861
1664 Ga0070702_100090534
1665 Ga0068852_100004987
1666 Ga0068852_100141024
1667 Ga0068852_101287319
1668 Ga0068859_100364845
1669 Ga0068864_100060451
1670 Ga0068851_10001517
1671 Ga0068851_10026076
1672 Ga0068851_10034122
1673 Ga0068863_100167300
1674 Ga0068863_100362205
1675 Ga0068858_100249510
1676 Ga0068860_100125619
1677 Ga0068860_100439747
1678 Ga0070717_11201204
1679 Ga0075363_100057573
1680 Ga0075364_10402497
1681 Ga0075432_10050036
1682 Ga0075362_10000565
1683 Ga0075362_10248447
1684 Ga0075366_10054228
1685 Ga0075366_10055751
1686 Ga0075366_10207954
1687 Ga0097621_100254993
1688 Ga0097621_101518870
1689 Ga0075370_10036206
1690 Ga0075370_10212361
1691 Ga0075370_10281646
1692 Ga0068871_100015656
1693 Ga0068865_100140074
1694 Ga0097620_100364841
1695 Ga0079104_1000053
1696 Ga0079104_1002693
1697 Ga0079104_1004078
1698 Ga0099826_10000010
1699 Ga0099794_10024211
1700 Ga0105244_10023517
1701 Ga0105244_10028871
1702 Ga0105244_10034566
1703 Ga0105250_10074461
1704 Ga0105240_10009383
1705 Ga0105240_10108670
1706 Ga0105240_10740893
1707 Ga0105245_10023078
1708 Ga0105243_10006860
1709 Ga0105243_10231805
1710 Ga0105243_11009752
1711 Ga0105243_11855132
1712 Ga0105241_10057980
1713 Ga0105241_11279784
1714 Ga0105242_10007953
1715 Ga0105242_11775528
1716 Ga0105248_10243333
1717 Ga0105248_10673758
1718 Ga0105237_10056847
1719 Ga0105237_10360625
1720 Ga0105238_10000255
1721 Ga0105238_10006249
1722 Ga0105238_10181832
1723 Ga0130086_1083152
1724 Ga0130085_1065905
1725 Ga0105239_10001561
1726 Ga0105239_10159405
1727 Ga0105239_10168833
1728 Ga0105239_11818894
1729 Ga0105246_10722820
1730 Ga0105246_10964055
1731 Ga0157323_1039635
1732 Ga0157319_1000005
1733 Ga0157327_1037212
1734 Ga0157373_10015732
1735 Ga0157373_10076108
1736 Ga0157371_10061649
1737 Ga0157370_10062522
1738 Ga0157370_11169816
1739 Ga0157369_10093282
1740 Ga0157374_10143777
1741 Ga0157378_10027087
1742 Ga0157378_10058938
1743 Ga0163162_10060438
1744 Ga0163162_10475400
1745 Ga0157372_10466393
1746 Ga0157372_10545256
1747 Ga0157372_12890446
1748 Ga0182008_10001808
1749 Ga0182008_10089080
1750 Ga0157377_10643684
1751 Ga0157376_10741967
1752 Ga0182006_1000240
1753 Ga0182006_1000274
1754 Ga0182006_1002682
1755 Ga0182006_1048484
1756 Ga0182007_10000196
1757 Ga0182007_10014439
1758 Ga0182007_10054753
1759 Ga0182005_1000016
1760 Ga0182005_1000163
1761 Ga0182005_1000370
1762 Ga0163161_10007196
1763 Ga0163161_10136578
1764 Ga0163161_10252609
1765 Ga0163161_10253434
1766 Ga0197907_11499114
1767 Ga0206349_1212656
1768 Ga0206355_1623195
1769 Ga0206355_1637204
1770 Ga0206351_10065238
1771 Ga0206352_10851379
1772 Ga0206352_11092684
1773 Ga0206350_10425581
1774 Ga0206354_10609314
1775 Ga0213872_10010693
1776 Ga0213872_10079633
1777 Ga0213872_10171118
1778 Ga0209435_100079
1779 Ga0209435_100343
1780 Ga0209436_100401
1781 Ga0209784_100010
1782 Ga0209784_100035
1783 Ga0209566_100008
1784 Ga0209566_100040
1785 Ga0209674_100019
1786 Ga0209674_100057
1787 Ga0209672_107144
1788 Ga0209147_100060
1789 Ga0209563_100011
1790 Ga0209563_100021
1791 Ga0209563_100059
1792 Ga0207427_100342
1793 Ga0209437_100019
1794 Ga0209437_100081
1795 Ga0209258_100141
1796 Ga0207425_1000021
1797 Ga0207425_1000845
1798 Ga0207425_1000932
1799 Ga0209646_1000068
1800 Ga0209646_1000265
1801 Ga0209026_1000330
1802 Ga0209026_1003315
1803 Ga0209026_1020065
1804 Ga0209677_100011
1805 Ga0209677_100036
1806 Ga0209677_102227
1807 Ga0209148_1000444
1808 Ga0209759_1000473
1809 Ga0209129_1000020
1810 Ga0209233_1000025
1811 Ga0209565_1001042
1812 Ga0209565_1003095
1813 Ga0209565_1022600
1814 Ga0209565_1026953
1815 Ga0209565_1063764
1816 Ga0209455_1000070
1817 Ga0209673_1000730
1818 Ga0209673_1010299
1819 Ga0209673_1057800
1820 Ga0209130_1010313
1821 Ga0209675_1012428
1822 Ga0209675_1038432
1823 Ga0209564_1000027
1824 Ga0209564_1000047
1825 Ga0209564_1002740
1826 Ga0209564_1079189
1827 Ga0209758_1000077
1828 Ga0209758_1000322
1829 Ga0209050_1000050
1830 Ga0209050_1001097
1831 Ga0209050_1002922
1832 Ga0209256_1000045
1833 Ga0209256_1000054
1834 Ga0209256_1002719
1835 Ga0209256_1004416
1836 Ga0207426_1000802
1837 Ga0209051_1000004
1838 Ga0209051_1073300
1839 Ga0209257_1000075
1840 Ga0209257_1000315
1841 Ga0207697_10084711
1842 Ga0207656_10040557
1843 Ga0207656_10313374
1844 Ga0207656_10481553
1845 Ga0207696_1038621
1846 Ga0207655_1000499
1847 Ga0207655_1028515
1848 Ga0207655_1031488
1849 Ga0207647_10029480
1850 Ga0207645_10052858
1851 Ga0207705_10016800
1852 Ga0207684_10409189
1853 Ga0207654_10002111
1854 Ga0207695_10001345
1855 Ga0207695_10522141
1856 Ga0207671_10007790
1857 Ga0207671_10322971
1858 Ga0207663_10739341
1859 Ga0207660_10096089
1860 Ga0207662_10605482
1861 Ga0207657_10001495
1862 Ga0207657_10030110
1863 Ga0207649_10125160
1864 Ga0207652_10959634
1865 Ga0207694_10000193
1866 Ga0207694_10049485
1867 Ga0207694_10051172
1868 Ga0207650_10013708
1869 Ga0207659_10170020
1870 Ga0207687_10038586
1871 Ga0207687_10042371
1872 Ga0207644_10023313
1873 Ga0207644_10288580
1874 Ga0207690_10000959
1875 Ga0207690_10175406
1876 Ga0207706_10008025
1877 Ga0207709_10019899
1878 Ga0207709_10164903
1879 Ga0207669_10254786
1880 Ga0207704_10041905
1881 Ga0207711_10109982
1882 Ga0207711_10162953
1883 Ga0207661_10747536
1884 Ga0207679_10002718
1885 Ga0207667_10006290
1886 Ga0207667_10042169
1887 Ga0207667_10234580
1888 Ga0207712_11021662
1889 Ga0207640_10004199
1890 Ga0207640_10022226
1891 Ga0207640_10135802
1892 Ga0207658_10005603
1893 Ga0207658_10041534
1894 Ga0207658_11367942
1895 Ga0207677_10150765
1896 Ga0207703_10067259
1897 Ga0207639_11462473
1898 Ga0207678_10003236
1899 Ga0207678_10721484
1900 Ga0207678_10932652
1901 Ga0207702_10134488
1902 Ga0207702_10347747
1903 Ga0207641_10131093
1904 Ga0207641_10157362
1905 Ga0207648_10088414
1906 Ga0207648_10567080
1907 Ga0207674_10005520
1908 Ga0207674_10033169
1909 Ga0207674_10040092
1910 Ga0207683_10172753
1911 Ga0207698_10000840
1912 Ga0207698_10059102
1913 Ga0209281_1000147
1914 Ga0209281_1002282
1915 Ga0209282_1000072
1916 Ga0207428_10182412
1917 Ga0268265_10143780
1918 Ga0268264_10261615
1919 Ga0265326_10017442
1920 Ga0307517_10185945
1921 Ga0307515_10301373
1922 Ga0265338_10165948
1923 Ga0316177_1129821
1924 Ga0316177_1154066
1925 Ga0316176_1058761
1926 Ga0316176_1058827
1927 Ga0314311_1057607
1928 Ga0316179_1096110
1929 Ga0316180_1056555
1930 Ga0316180_1167379
1931 Ga0316183_1076598
1932 Ga0316181_1197761
1933 Ga0265767_100713
1934 Ga0265766_1002773
1935 Ga0265766_1008174
1936 Ga0265764_102142
1937 Ga0265769_102926
1938 Ga0265768_102697
1939 Ga0265774_101097
1940 Ga0265331_10403822
1941 Ga0265327_10054273
1942 Ga0307513_10124367
1943 Ga0307513_10721554
1944 Ga0307408_100067624
1945 Ga0307408_100141727
1946 Ga0307408_101681340
1947 Ga0316575_10343388
1948 Ga0316578_10049623
1949 Ga0307516_10433708
1950 Ga0307518_10004256
1951 Ga0307406_11108511
1952 Ga0307412_10153493
1953 Ga0307412_11948157
1954 Ga0307416_100002061
1955 Ga0307416_101253949
1956 Ga0307416_102562250
1957 Ga0307414_10043339
1958 Ga0307414_10232447
1959 Ga0307411_10154296
1960 Ga0316585_10022471
1961 Ga0316593_10000292
1962 Ga0316592_1001180
1963 Ga0316588_1003102
1964 Ga0373936_0011451
1965 Ga0316574_0168024
1966 Ga0373935_0167776
1967 Ga0373927_0042076
1968 Ga0373933_0035625
1969 Ga0373937_0072024
1970 Ga0265778_035225
1971 Ga0316582_0006061
1972 Ga0316584_0025317
1973 Ga0316584_0176768
1974 Ga0373925_1493664
1975 Ga0395899_0000218
1976 Ga0395899_0003628
1977 Ga0395899_0010178
1978 Ga0395899_0028029
1979 Ga0395899_0082040
1980 Ga0395899_0087203
1981 Ga0395899_0091713
1982 Ga0395899_0354989
1983 Ga0395900_0019646
1984 Ga0395900_0065201
1985 Ga0395900_0330458
1986 Ga0395900_0571242
1987 Ga0395898_0004013
1988 Ga0395898_0275232
1989 Ga0395898_0747121
1990 Ga0395898_1310052
1991 Ga0395898_1691808
1992 Ga0395905_0000549
1993 Ga0395905_0008603
1994 Ga0395905_0012898
1995 Ga0395905_0085545
1996 Ga0395905_0255533
1997 Ga0395905_0387422
1998 Ga0395905_0686264
1999 Ga0395905_1076116
2000 Ga0395901_0014473
2001 Ga0395901_0036377
2002 Ga0395901_0065153
2003 Ga0395901_0176537
2004 Ga0395901_0261380
2005 Ga0395901_0727674
2006 Ga0395901_1557051
2007 Ga0436361_0097588
2008 Ga0436361_0378504
2009 Ga0436361_0391791
2010 Ga0436361_0394538
2011 Ga0436361_0568601
2012 Ga0436361_1041947
2013 Ga0436362_0392850
2014 Ga0436362_0937853
2015 Ga0439436_0040359
2016 Ga0439439_0017685
2017 Ga0439453_0001276
2018 Ga0439453_0017786
2019 Ga0439453_0022821
2020 Ga0439465_0035548
2021 Ga0439465_0061840
2022 Ga0451788_18078
2023 Ga0451790_18219
2024 Ga0451794_47388
2025 Ga0451793_1577584
2026 Ga0451802_1810119
2027 Ga0451805_045368
2028 Ga0451807_0965944
2029 Ga0451833_1345593
2030 Ga0451848_13097
2031 Ga0451843_0537494
2032 Ga0451853_2717427
2033 Ga0439431_0016768
2034 Ga0439433_0025440
2035 Ga0439448_0036322
2036 Ga0439449_0003878
2037 Ga0439449_0036247
2038 Ga0439452_117351
2039 Ga0439454_015455
2040 Ga0439454_084734
2041 Ga0439455_0000425
2042 Ga0439455_0028934
2043 Ga0439457_056273
2044 Ga0439462_0050140
2045 Ga0450888_007845
2046 Ga0450890_001085
2047 Ga0450890_005814
2048 Ga0450895_001799
2049 Ga0450896_006823
2050 Ga0450896_010644
2051 Ga0450896_080762
2052 Ga0450898_014524
2053 Ga0450899_002878
2054 Ga0450904_000961
2055 Ga0450906_012608
2056 Ga0439446_0026982
2057 Ga0439458_0053937
2058 Ga0439458_0120833
2059 Ga0450909_031207
2060 Ga0439434_0041575
2061 Ga0439435_0004015
2062 Ga0439464_0071151
2063 Ga0439464_0181204
2064 Ga0450893_0051404
2065 Ga0451577_0121175
2066 Ga0451577_0187466
2067 Ga0451577_0256923
2068 Ga0451577_0627501
2069 Ga0451577_1192501
2070 Ga0439440_0021857
2071 Ga0453683_0003998
2072 Ga0453683_0117933
2073 Ga0453683_1015021
2074 Ga0466965_0214040
2075 Ga0466965_0472369
2076 Ga0453684_0016436
2077 Ga0453684_0026453
2078 Ga0453684_0039050
2079 Ga0453684_0055720
2080 Ga0453684_0106268
2081 Ga0453684_0167534
2082 Ga0453684_0273428
2083 Ga0453684_0422657
2084 Ga0453684_1459834
2085 Ga0453684_2005111
2086 Ga0453684_2111979
2087 Ga0453684_2230229
2088 Ga0466968_0244610
2089 Ga0466970_0225020
2090 Ga0466957_0385424
2091 Ga0466960_0701171
2092 Ga0466959_0047090
2093 Ga0451576_0000454
2094 Ga0451576_0057306
2095 Ga0451576_0077585
2096 Ga0451576_0121490
2097 Ga0451576_0122787
2098 Ga0451576_2161912
2099 Ga0466958_0378508
2100 Ga0466967_0538588
2101 Ga0495617_000397
2102 Ga0495617_000636
2103 Ga0495617_000830
2104 Ga0495617_007088
2105 Ga0495627_000011
2106 Ga0495627_008059
2107 Ga0495603_0001612
2108 Ga0495603_0009392
2109 Ga0495590_0000020
2110 Ga0495590_0000632
2111 Ga0495590_0006208
2112 Ga0495590_0190191
2113 Ga0495591_029494
2114 Ga0495629_0007936
2115 Ga0495629_0021816
2116 Ga0495638_0000235
2117 Ga0495638_0016045
2118 Ga0495638_0077642
2119 Ga0495638_0426272
2120 Ga0495651_0138175
2121 Ga0495653_0000067
2122 Ga0495653_0004702
2123 Ga0495653_0009522
2124 Ga0495650_0000200
2125 Ga0495650_0001809
2126 Ga0495650_0002469
2127 Ga0495650_0017593
2128 Ga0495650_0023728
2129 Ga0495580_0299480
2130 Ga0495582_0005108
2131 Ga0495582_0063422
2132 Ga0495605_0001735
2133 Ga0495605_0005449
2134 Ga0495605_0010393
2135 Ga0495605_0013819
2136 Ga0495605_0044149
2137 Ga0495605_0070705
2138 Ga0495605_0191971
2139 Ga0495605_0200282
2140 Ga0495584_0000636
2141 Ga0495584_0002002
2142 Ga0495584_0023314
2143 Ga0495584_0036677
2144 Ga0495584_0046813
2145 Ga0495584_0070356
2146 Ga0495584_0248975
2147 Ga0495584_0302486
2148 Ga0495585_0006666
2149 Ga0495585_0022456
2150 Ga0495585_0025799
2151 Ga0495585_0068953
2152 Ga0495585_0113007
2153 Ga0495585_0295478
2154 Ga0495594_0050249
2155 Ga0495594_0050658
2156 Ga0495594_0158381
2157 Ga0495594_0197851
2158 Ga0495596_0001745
2159 Ga0495596_0001963
2160 Ga0495596_0070273
2161 Ga0495596_0269906
2162 Ga0495607_0019187
2163 Ga0495607_0042980
2164 Ga0495607_0070470
2165 Ga0495607_0099229
2166 Ga0495607_0339027
2167 Ga0495583_0000317
2168 Ga0495583_0002046
2169 Ga0495583_0003152
2170 Ga0495583_0004594
2171 Ga0495583_0024275
2172 Ga0495583_0063582
2173 Ga0495583_0072580
2174 Ga0495606_0000433
2175 Ga0495606_0004241
2176 Ga0495606_0013080
2177 Ga0495606_0032750
2178 Ga0495606_0035311
2179 Ga0495606_0035831
2180 Ga0495606_0073479
2181 Ga0495606_0163349
2182 Ga0495606_0189549
2183 Ga0495608_0037678
2184 Ga0495610_0000017
2185 Ga0495610_0004520
2186 Ga0495610_0035533
2187 Ga0495610_0048651
2188 Ga0495610_0159667
2189 Ga0495616_0003800
2190 Ga0495616_0018110
2191 Ga0495616_0028095
2192 Ga0495616_0040567
2193 Ga0495616_0042318
2194 Ga0495616_0091183
2195 Ga0495616_0152195
2196 Ga0495616_0226651
2197 Ga0495616_0268671
2198 Ga0495620_0001543
2199 Ga0495628_0107716
2200 Ga0495631_0019480
2201 Ga0495631_0026488
2202 Ga0495631_0040478
2203 Ga0495631_0059518
2204 Ga0495631_0124850
2205 Ga0495631_0173872
2206 Ga0495631_0292289
2207 Ga0495632_0083186
2208 Ga0495632_0114594
2209 Ga0495632_0119983
2210 Ga0495637_0001780
2211 Ga0495637_0002190
2212 Ga0495637_0094170
2213 Ga0495637_0109372
2214 Ga0495643_0002891
2215 Ga0495643_0014375
2216 Ga0495643_0016892
2217 Ga0495643_0026159
2218 Ga0495643_0040909
2219 Ga0495643_0055349
2220 Ga0495643_0173422
2221 Ga0495644_0003110
2222 Ga0495644_0047750
2223 Ga0495644_0056888
2224 Ga0495644_0070446
2225 Ga0495644_0108082
2226 Ga0495644_0187660
2227 Ga0495648_0003167
2228 Ga0495648_0072602
2229 Ga0495663_0015755
2230 Ga0495663_0032552
2231 Ga0495663_0062920
2232 Ga0495666_0202770
2233 Ga0495642_0004003
2234 Ga0495642_0005824
2235 Ga0495642_0008349
2236 Ga0495642_0010689
2237 Ga0495642_0033338
2238 Ga0495642_0037203
2239 Ga0495642_0091690
2240 Ga0495642_0192405
2241 Ga0495642_0425179
2242 Ga0495652_0019185
2243 Ga0495654_0000060
2244 Ga0495654_0018887
2245 Ga0495654_0214561
2246 Ga0495665_0099716
2247 Ga0495586_0070286
2248 Ga0495598_0076132
2249 Ga0495609_0000007
2250 Ga0495609_0005522
2251 Ga0495609_0018793
2252 Ga0495609_0019006
2253 Ga0495609_0021767
2254 Ga0495609_0026889
2255 Ga0495609_0046136
2256 Ga0495609_0122049
2257 Ga0495597_0004273
2258 Ga0495597_0007533
2259 Ga0495597_0007961
2260 Ga0495597_0022360
2261 Ga0495597_0025313
2262 Ga0495597_0050127
2263 Ga0495597_0059514
2264 Ga0495597_0072919
2265 Ga0495597_0200339
2266 Ga0495645_0153398
2267 Ga0495622_0002906
2268 Ga0495622_0012942
2269 Ga0495622_0041061
2270 Ga0495622_0086811
2271 Ga0495622_0132327
2272 Ga0495633_0006566
2273 Ga0495633_0010195
2274 Ga0495633_0017696
2275 Ga0495633_0095570
2276 Ga0495633_0102739
2277 Ga0495633_0103686
2278 Ga0495633_0232640
2279 Ga0495656_0036295
2280 Ga0495656_0077654
2281 Ga0495656_0121688
2282 Ga0495656_0266698
2283 Ga0495656_0443350
2284 Ga0495656_0509799
2285 Ga0495668_0002640
2286 Ga0495668_0005163
2287 Ga0495668_0008733
2288 Ga0495668_0011342
2289 Ga0495668_0018916
2290 Ga0495668_0034324
2291 Ga0495668_0134102
2292 Ga0495668_0151367
2293 Ga0495668_0230437
2294 Ga0495668_0581424
2295 Ga0495611_0001662
2296 Ga0495611_0002069
2297 Ga0495611_0005909
2298 Ga0495611_0007454
2299 Ga0495611_0011467
2300 Ga0495611_0020577
2301 Ga0495611_0031470
2302 Ga0495611_0115559
2303 Ga0495625_0011213
2304 Ga0495625_0016652
2305 Ga0495625_0042626
2306 Ga0495625_0125775
2307 Ga0495625_0176951
2308 Ga0495625_0288542
2309 Ga0495625_0311060
2310 Ga0495635_0008977
2311 Ga0495635_0074819
2312 Ga0495659_0118099
2313 Ga0495661_0022142
2314 Ga0495661_0048413
2315 Ga0495661_0152056
2316 Ga0495661_0178330
2317 Ga0495661_0196882
2318 Ga0495661_0203066
2319 Ga0495661_0222381
2320 Ga0495661_0297574
2321 Ga0495661_0455057
2322 Ga0495588_0009027
2323 Ga0495588_0022754
2324 Ga0495588_0038295
2325 Ga0495588_0067691
2326 Ga0495588_0094469
2327 Ga0495588_0143878
2328 Ga0495588_0178690
2329 Ga0495588_0496985
2330 Ga0495599_0001590
2331 Ga0495623_0182525
2332 Ga0495623_0460627
2333 Ga0495646_0168697
2334 Ga0495658_0568452
2335 Ga0495669_0001596
2336 Ga0495669_0002717
2337 Ga0495669_0099817
2338 Ga0495669_0183569
2339 Ga0495669_0345104
2340 Ga0495624_0133574
2341 Ga0495670_0004991
2342 Ga0495670_0031340
2343 Ga0495670_0055789
2344 Ga0495670_0226206
2345 Ga0495670_0252952
2346 Ga0495670_0344114
2347 Ga0495670_0658991
2348 Ga0495671_0000037
2349 Ga0495671_0005005
2350 Ga0495649_0007567
2351 Ga0495649_0066300
2352 Ga0495649_0141389
2353 Ga0495649_0186833
2354 Ga0495649_0622906
2355 Ga0495589_0030733
2356 Ga0495589_0037560
2357 Ga0495589_0053829
2358 Ga0495589_0147423
2359 Ga0495589_0156814
2360 Ga0495589_0177111
2361 Ga0495600_0112057
2362 Ga0495660_0007547
2363 Ga0495660_0010186
2364 Ga0495660_0011018
2365 Ga0495660_0015683
2366 Ga0495660_0030532
2367 Ga0495660_0034825
2368 Ga0495660_0116918
2369 Ga0495660_0153779
2370 Ga0495660_0231960
2371 Ga0495660_0363178
2372 Ga0495660_0444407
2373 Ga0495581_0101745
2374 Ga0495604_0010101
2375 Ga0495604_0063319
2376 Ga0495636_0001434
2377 Ga0495636_0003890
2378 Ga0495636_0178191
2379 Ga0495636_0207313
2380 Ga0495674_0009303
2381 Ga0495672_0000013
2382 Ga0495672_0000157
2383 Ga0495672_0007686
2384 Ga0495672_0016220
2385 Ga0495672_0021784
2386 Ga0495672_0449087
2387 Ga0495676_0004545
2388 Ga0495676_0024323
2389 Ga0495676_0303356
2390 Ga0495680_0387251
2391 Ga0495683_0003225
2392 Ga0495683_0014031
2393 Ga0495683_0057199
2394 Ga0495683_0070987
2395 Ga0495683_0074576
2396 Ga0495683_0141996
2397 Ga0495683_0363683
2398 Ga0495687_000342
2399 Ga0495687_001562
2400 Ga0495687_002781
2401 Ga0495687_002921
2402 Ga0495687_007470
2403 Ga0495675_0072153
2404 Ga0495675_0622080
2405 Ga0495677_0001866
2406 Ga0495677_0016634
2407 Ga0495677_0032598
2408 Ga0495677_0035931
2409 Ga0495677_0037415
2410 Ga0495677_0037798
2411 Ga0495677_0114905
2412 Ga0495679_006474
2413 Ga0495679_008349
2414 Ga0495679_034795
2415 Ga0495685_000291
2416 Ga0495685_001965
2417 Ga0495685_014389
2418 Ga0495685_036127
2419 Ga0495685_063448
2420 Ga0495685_082500
2421 Ga0495673_0000248
2422 Ga0495673_0017349
2423 Ga0495673_0038455
2424 Ga0495681_0011744
2425 Ga0495681_0012224
2426 Ga0495681_0124392
2427 Ga0495686_0007683
2428 Ga0495686_0010875
2429 Ga0495686_0012785
2430 Ga0495686_0018441
2431 Ga0495686_0021073
2432 Ga0495686_0061812
2433 Ga0495686_0062817
2434 Ga0495686_0088035
2435 Ga0495593_0002955
2436 Ga0495593_0073060
2437 Ga0495602_0044651
2438 Ga0495614_0054920
2439 Ga0495614_0111517
2440 Ga0495615_0009239
2441 Ga0495615_0009700
2442 Ga0495615_0170160
2443 Ga0495626_0000227
2444 Ga0495626_0002147
2445 Ga0495626_0014493
2446 Ga0495626_0037979
2447 Ga0495626_0081138
2448 Ga0495626_0095315
2449 Ga0495626_0107363
2450 Ga0496100_0014114
2451 Ga0496100_0246173
2452 Ga0496101_0160023
2453 Ga0496102_0219122
2454 Ga0496102_0222236
2455 Ga0496102_0240111
2456 Ga0496103_0020711
2457 Ga0496103_0061076
2458 Ga0496103_0116859
2459 Ga0496103_0135193
2460 Ga0496103_0365428
2461 Ga0496104_0278667
2462 Ga0496105_0266761
2463 Ga0496105_0809280
2464 Ga0496107_0210280
2465 Ga0496107_0273009
2466 Ga0496108_0443772
2467 Ga0496108_0847322
2468 Ga0496109_0344021
2469 Ga0496109_0855448
2470 Ga0496109_0885436
2471 Ga0496109_0912647
2472 Ga0496110_0458359
2473 Ga0496110_0508332
2474 Ga0496110_0900611
2475 Ga0496112_0288436
2476 Ga0496113_0180677
2477 Ga0496113_0503465
2478 Ga0496114_0010053
2479 Ga0496114_0041004
2480 Ga0496115_0050480
2481 Ga0496115_0864800
2482 Ga0496116_0020766
2483 Ga0496116_0030638
2484 Ga0496116_0325888
2485 Ga0496117_0000005
2486 Ga0496118_0000031
2487 Ga0496121_0004491
2488 Ga0496121_0079639
2489 Ga0496121_0157732
2490 Ga0496121_0274189
2491 Ga0496121_0369833
2492 Ga0496121_0446598
2493 Ga0496122_0000968
2494 Ga0496122_0005873
2495 Ga0496122_0111660
2496 Ga0496122_0158956
2497 Ga0496122_0239113
2498 Ga0496123_0004825
2499 Ga0496123_0005104
2500 Ga0496123_0076261
2501 Ga0496123_0194868
2502 Ga0496123_0364699
2503 Ga0496124_0009077
2504 Ga0496124_0232737
2505 Ga0496124_0706698
2506 Ga0496125_0009685
2507 Ga0496125_0040571
2508 Ga0496125_0128609
2509 Ga0496126_0004622
2510 Ga0496126_0804974
2511 Ga0496126_1154987
2512 Ga0496126_1182482
2513 Ga0501306_000005
2514 Ga0501306_000907
2515 Ga0501306_000979
2516 Ga0501306_001799
2517 Ga0501306_064535
2518 Ga0501308_000002
2519 Ga0501308_000177
2520 Ga0501308_004281
2521 Ga0501308_019194
2522 Ga0501308_053997
2523 Ga0501308_068015
2524 Ga0501309_000053
2525 Ga0501309_011451
2526 Ga0501309_043262
2527 Ga0501309_045031
2528 Ga0501309_078610
2529 Ga0501310_000065
2530 Ga0501310_001577
2531 Ga0501310_003240
2532 Ga0501310_012046
2533 Ga0501310_045131
2534 Ga0501341_01880
2535 Ga0501341_06842
2536 Ga0501343_000946
2537 Ga0501343_008820
2538 Ga0501344_08525
2539 Ga0501304_000001
2540 Ga0501304_000110
2541 Ga0501304_001659
2542 Ga0501305_000399
2543 Ga0501305_002400
2544 Ga0501305_009251
2545 Ga0501305_009815
2546 Ga0501305_018025
2547 Ga0501305_115993
2548 Ga0501307_000583
2549 Ga0501307_001509
2550 Ga0501307_002501
2551 Ga0501307_004640
2552 Ga0501307_007975
2553 Ga0501307_017346
2554 Ga0501307_050237
2555 Ga0501307_083358
2556 Ga0501342_01262
2557 Ga0495678_000010
2558 Ga0495678_006449
2559 Ga0495678_006909
2560 Ga0495678_063342
2561 Ga0495682_0003087
2562 Ga0495682_0035772
2563 Ga0495682_0049156
2564 Ga0501298_029220
2565 Ga0501298_100889
2566 Ga0501300_024434
2567 Ga0501303_006645
2568 Ga0501311_000002
2569 Ga0501311_006367
2570 Ga0501311_034960
2571 Ga0501311_036217
2572 Ga0501312_001195
2573 Ga0501312_002982
2574 Ga0501312_005276
2575 Ga0501312_006751
2576 Ga0501312_031628
2577 Ga0501312_039196
2578 Ga0501312_076553
2579 Ga0501312_092049
2580 Ga0501313_000012
2581 Ga0501313_000495
2582 Ga0501314_009484
2583 Ga0501314_039418
2584 Ga0501314_045646
2585 Ga0501315_000004
2586 Ga0501315_000082
2587 Ga0501315_003410
2588 Ga0501315_009644
2589 Ga0501315_014533
2590 Ga0501315_052771
2591 Ga0501315_070240
2592 Ga0501316_000002
2593 Ga0501316_000608
2594 Ga0501316_003898
2595 Ga0501317_031813
2596 Ga0501318_000040
2597 Ga0501318_000292
2598 Ga0501318_011949
2599 Ga0501319_000218
2600 Ga0501320_000368
2601 Ga0501320_000545
2602 Ga0501320_003268
2603 Ga0501320_005185
2604 Ga0501320_006733
2605 Ga0501320_011519
2606 Ga0501320_012652
2607 Ga0501320_022714
2608 Ga0501320_025409
2609 Ga0501320_029270
2610 Ga0501320_046014
2611 Ga0501321_006362
2612 Ga0501321_039989
2613 Ga0501322_000643
2614 Ga0501322_015523
2615 Ga0501322_022367
2616 Ga0501323_000789
2617 Ga0501323_002509
2618 Ga0501323_006202
2619 Ga0501323_009479
2620 Ga0501323_028666
2621 Ga0501323_038612
2622 Ga0501324_002702
2623 Ga0501324_006256
2624 Ga0501324_010219
2625 Ga0501324_012262
2626 Ga0501324_014045
2627 Ga0501324_018192
2628 Ga0501325_012167
2629 Ga0501327_07127
2630 Ga0501327_09548
2631 Ga0501328_02722
2632 Ga0501329_00384
2633 Ga0501329_09108
2634 Ga0501330_008961
2635 Ga0501334_01100
2636 Ga0501334_01285
2637 Ga0501335_000610
2638 Ga0501335_004710
2639 Ga0501335_029831
2640 Ga0501335_040321
2641 Ga0501336_000167
2642 Ga0501336_004393
2643 Ga0501336_015269
2644 Ga0501337_001443
2645 Ga0501337_003490
2646 Ga0501337_003553
2647 Ga0501338_00312
2648 Ga0501338_02956
2649 Ga0501338_05013
2650 Ga0501340_011180
2651 Ga0501340_027943
2652 Ga0501031_0093307
2653 Ga0501031_0199569
2654 Ga0501032_0005689
2655 Ga0501032_0483829
2656 Ga0501033_0001803
2657 Ga0501033_0020233
2658 Ga0501034_0029030
2659 Ga0501034_0080413
2660 Ga0501034_0150364
2661 Ga0501036_0085603
2662 Ga0501036_1644218
2663 Ga0501037_0029069
2664 Ga0501037_0087529
2665 Ga0501037_0421680
2666 Ga0501038_0004562
2667 Ga0501038_0476077
2668 Ga0501039_0576058
2669 Ga0501043_0044507
2670 Ga0501043_0093617
2671 Ga0501046_0047608
2672 Ga0501067_0533348
2673 Ga0501072_0008088
2674 Ga0501073_0203968
2675 Ga0501073_0562883
2676 Ga0501076_0818064
2677 Ga0501077_0209868
2678 Ga0501222_031301
2679 Ga0501227_014322
2680 Ga0501233_080366
2681 Ga0501235_045772
2682 Ga0501238_000213
2683 Ga0501238_008550
2684 Ga0501249_010943
2685 Ga0501253_098313
2686 Ga0501229_003004
2687 Ga0501079_0160362
2688 Ga0501241_041689
2689 Ga0501263_084735
2690 Ga0501269_000003
2691 Ga0501279_002045
2692 Ga0501279_007866
2693 Ga0501035_0010452
2694 Ga0501035_0136330
2695 Ga0501044_0007653
2696 nmdc:mga03683_14381_c1
2697 nmdc:mga0k408_17134_c1
2698 nmdc:mga0k408_255163_c1
2699 nmdc:mga07m45_166976_c1
2700 nmdc:mga07m45_398_c1
2701 nmdc:mga07m45_87196_c1
2702 nmdc:mga05p37_217522_c1
2703 Ga0495601_0585866
2704 Ga0500594_0101680
2705 Ga0500618_002645
2706 Ga0500618_040633
2707 Ga0500574_000403
2708 Ga0500586_012856
2709 Ga0500616_0013527
2710 Ga0501084_0089581
2711 Ga0587084_000213
2712 Ga0587084_000401
2713 Ga0587084_003559
2714 Ga0587084_026492
2715 Ga0587084_047284
2716 Ga0587084_091296
2717 Ga0587084_117374
2718 Ga0587093_000380
2719 Ga0587093_001062
2720 Ga0587093_006615
2721 Ga0587093_006649
2722 Ga0587093_033107
2723 Ga0587066_064419
2724 Ga0587066_064420
2725 Ga0587070_064009
2726 Ga0587070_068596
2727 Ga0587073_0000035
2728 Ga0587077_001525
2729 Ga0587077_009258
2730 Ga0587077_014029
2731 Ga0587077_034721
2732 Ga0587077_223544
2733 Ga0587080_022409
2734 Ga0587080_056073
2735 Ga0587080_056074
2736 Ga0587082_004457
2737 Ga0587082_008271
2738 Ga0587082_024618
2739 Ga0587082_065628
2740 Ga0587083_0007825
2741 Ga0587083_0011898
2742 Ga0587083_0088084
2743 Ga0587083_0193213
2744 Ga0587085_012368
2745 Ga0587085_048607
2746 Ga0587086_000753
2747 Ga0587086_048491
2748 Ga0587086_082925
2749 Ga0587088_001117
2750 Ga0587088_041644
2751 Ga0587088_063898
2752 Ga0587089_000565
2753 Ga0587089_009810
2754 Ga0587089_023489
2755 Ga0587089_075285
2756 Ga0587090_001908
2757 Ga0587090_051986
2758 Ga0587090_052046
2759 Ga0587090_108649
2760 Ga0587091_002949
2761 Ga0587091_073030
2762 Ga0587091_073148
2763 Ga0587091_101709
2764 Ga0587092_000969
2765 Ga0587092_008630
2766 Ga0587092_042166
2767 Ga0587092_050322
2768 Ga0587094_015441
2769 Ga0587094_016778
2770 Ga0587094_097379
2771 Ga0587097_00549
2772 Ga0587098_004256
2773 Ga0587106_001550
2774 Ga0587125_002919
2775 Ga0587099_000239
2776 Ga0587101_002644
2777 Ga0587101_023534
2778 Ga0587101_042527
2779 Ga0587109_003197
2780 Ga0587113_000311
2781 Ga0587115_010663
2782 Ga0587115_096841
2783 Ga0587117_011034
2784 Ga0587117_038563
2785 Ga0587127_004393
2786 Ga0587128_011641
2787 Ga0587062_000153
2788 Ga0587062_000195
2789 Ga0587062_002195
2790 Ga0587062_032496
2791 Ga0587062_040726
2792 Ga0587067_026739
2793 Ga0587068_000350
2794 Ga0587068_001305
2795 Ga0587068_002203
2796 Ga0587068_080234
2797 Ga0587068_100300
2798 Ga0587068_125316
2799 Ga0587069_063455
2800 Ga0587072_000243
2801 Ga0587072_005559
2802 Ga0587072_066500
2803 Ga0587072_066501
2804 Ga0587072_072842
2805 Ga0587075_044338
2806 Ga0587076_002988
2807 Ga0587076_012405
2808 Ga0587076_012406
2809 Ga0587076_013020
2810 Ga0587076_047966
2811 Ga0587076_138571
2812 Ga0587076_154746
2813 Ga0587078_016824
2814 Ga0587078_051400
2815 Ga0587079_000584
2816 Ga0587079_006516
2817 Ga0587079_011451
2818 Ga0587079_037243
2819 Ga0587100_001488
2820 Ga0587100_003223
2821 Ga0587100_007445
2822 Ga0587102_000132
2823 Ga0587104_000049
2824 Ga0587107_001789
2825 Ga0587107_006131
2826 Ga0587107_043660
2827 Ga0587107_098143
2828 Ga0587108_000210
2829 Ga0587114_007269
2830 Ga0587116_02402
2831 Ga0587118_01521
2832 Ga0587118_11699
2833 Ga0587119_023436
2834 Ga0587120_002973
2835 Ga0587124_001813
2836 Ga0587124_014179
2837 Ga0587124_029558
2838 Ga0587060_000715
2839 Ga0587060_006105
2840 Ga0587096_00279
2841 Ga0587071_001373
2842 Ga0587071_043674
2843 Ga0587071_071506
2844 Ga0587071_071662
2845 Ga0587111_0000229
2846 Ga0587111_0000781
2847 Ga0587111_0007805
2848 Ga0587111_0008023
2849 Ga0587111_0020048
2850 Ga0587111_0096385
2851 Ga0587111_0157547
2852 Ga0587111_0180594
2853 Ga0587111_0189494
2854 2511247454
2855 2511384335
2856 2521560874
2857 2548501398
2858 2550696684
2859 2553007583
2860 2601667016
2861 2643792081
2862 2643799424
2863 2643868380
2864 2643994491
2865 2644026938
2866 2644061505
2867 2644075037
2868 2644163760
2869 2644216438
2870 2644247750
2871 2644254812
2872 2644295316
2873 2644360373
2874 2644471517
2875 2644649057
2876 2722886127
2877 2738738121
2878 2738826784
2879 2738843081
2880 2739150581
2881 2739192500
2882 2739243206
2883 2739273832
2884 2739318977
2885 2739337218
2886 2739342876
2887 2765567308
2888 2808984219
2889 2809132023
2890 2809145897
2891 2809151646
2892 2816473781
2893 2819543890
2894 2819594350
2895 2819618745
2896 2821135880
2897 2839095393
2898 2839144215
2899 2842712342
2900 2842722289
2901 2852622894
2902 2857549061
2903 2857556286
2904 2857560797
2905 2857567996
2906 2881104313
2907 2884811930
2908 2884840748
2909 2884857656
2910 2885084375
2911 2885197770
2912 2891635731
2913 2894023740
2914 2896158596
2915 2904428888
2916 2904442511
2917 2904533769
2918 2904589394
2919 2904595097
2920 2904602401
2921 2919050749
2922 2919084944
2923 2919476952
2924 2923514715
2925 2928135683
2926 2932416111
2927 2932422213
2928 2954769598
2929 2974320958
2930 2990715407
2931 639788565
2932 8047676082

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

5

138

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9813 4 131
7m4u-assembly1.cif.gz_h a. baumannii ribosome-eravacycline complex: 30s 0.9756 2 131
3j9y-assembly1.cif.gz_h cryo-em structure of tetracycline resistance protein tetm bound to a translating e.coli ribosome 0.9743 2 131
7unu-assembly1.cif.gz_h pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9736 2 131
5uyl-assembly1.cif.gz_H 70s ribosome bound with cognate ternary complex base-paired to a site codon (structure ii) 0.9688 2 131
ID Description Score Start End Superfamily
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9789 74 131 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9761 74 131 3.30.1490.10
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9648 4 73 3.30.1370.30
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9627 74 131 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.96 74 131 3.30.1490.10
ID Description Score Start End GO Terms
AF-A0A2N2TVS9-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.999 15 131 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A352KI84-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9933 63 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A435JWK2-F1-model_v4 deleted 0.9933 63 131
AF-A0A351BDG7-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9926 63 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-E4Z9Z8-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9922 27 131 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map