F494174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1466 | 668 | 2932 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0711160|Ga0453684_0711160_571_987 |
| Length | 138 |
| Sequence | MSVNDPIADMLTRVRNAILAGQAVAAMPASKVKAEIARILKEEGYIESFDVVSEELMPTHSVLRVRIKYVGERRERRPVITGIVRISRPGRRIYTRKQDIPWVLSGLGISIISTPKGIMTGQRARQLGVGGEILCKVW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002864 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003288 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003291 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003379 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM | Metagenome | Rhizosphere |
| 31 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 41 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 42 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 43 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 62 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 67 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 123 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 124 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 136 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 140 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 141 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 160 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 165 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 247 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 248 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 250 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 251 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 252 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 253 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 254 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 255 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 256 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 264 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 265 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 266 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 267 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 268 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 269 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 273 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 276 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 287 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 296 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 297 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 298 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 299 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 300 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 301 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 302 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 303 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 306 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 308 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 309 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 310 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 311 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 312 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 313 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 314 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 315 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 316 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 317 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 318 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 319 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 320 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 321 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 322 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 323 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 324 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 325 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 326 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 327 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 328 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 329 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 330 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 331 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 332 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 333 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 334 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 335 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 336 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 337 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 338 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 339 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 340 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 341 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 342 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 345 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 346 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 347 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 439 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 442 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 443 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 444 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 445 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 446 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 447 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 448 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 449 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 450 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 451 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 452 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 453 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 454 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 455 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 469 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 470 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 471 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 512 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 513 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 514 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 515 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 516 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 517 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 518 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 519 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 521 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 522 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 523 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 524 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 527 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 528 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 529 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 532 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 533 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 534 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 535 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 536 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 591 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 592 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 593 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 594 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 595 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 596 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 597 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 598 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 599 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 600 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 601 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 602 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 603 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 604 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 605 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 606 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 607 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 608 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 609 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 610 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 611 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 612 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 613 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 614 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 615 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 616 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 617 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 618 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 619 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 620 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 621 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 622 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 623 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 624 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 625 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 626 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 627 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 628 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 629 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 630 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 631 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 632 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 633 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 634 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 635 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 636 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 637 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 638 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 639 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 640 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 641 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 642 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 643 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 644 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 645 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 646 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 647 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 648 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 649 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 650 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 651 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 652 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 653 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 654 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 655 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 656 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 657 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 658 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 659 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 660 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 661 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 662 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 663 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 664 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 665 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 666 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 667 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 668 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.89 |
| Metatranscriptomes | 25.72 |
| Isolates | 5.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.66 |
| Nodule | 0.75 |
| Rhizoplane | 2.73 |
| Rhizosphere | 80.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0711160 | 3300044712 | Bacteria | 1091 |
| 2 | JGI24740J21852_10001487 | 3300001979 | Bacteria | 10770 |
| 3 | JGI24740J21852_10106123 | 3300001979 | Bacteria | 711 |
| 4 | JGI24737J22298_10004492 | 3300001990 | Bacteria | 4859 |
| 5 | JGI24738J21930_10088537 | 3300002075 | Bacteria | 653 |
| 6 | JGI25156J39149_1016366 | 3300002705 | Bacteria | 1443 |
| 7 | JGI25156J39149_1017873 | 3300002705 | Bacteria | 1330 |
| 8 | JGI25162J39368_1000154 | 3300002737 | Bacteria | 75240 |
| 9 | JGI25154J39366_1001042 | 3300002738 | Bacteria | 11063 |
| 10 | JGI25157J39369_1011385 | 3300002741 | Bacteria | 1152 |
| 11 | JGI25164J39214_1003736 | 3300002772 | Bacteria | 1860 |
| 12 | JGI25150J39212_1001923 | 3300002774 | Bacteria | 5456 |
| 13 | JGI25150J39212_1003501 | 3300002774 | Bacteria | 3664 |
| 14 | Ga0006764J43180_105416 | 3300002864 | Bacteria | 2303 |
| 15 | Ga0006767J43181_105098 | 3300002868 | Bacteria | 2522 |
| 16 | Ga0006763J43179_104166 | 3300002870 | Bacteria | 5040 |
| 17 | Ga0006762J43184_106210 | 3300002872 | Bacteria | 1019 |
| 18 | JGI25159J45721_1059041 | 3300002987 | Bacteria | 506 |
| 19 | Ga0006760J45825_101715 | 3300003158 | Bacteria | 2437 |
| 20 | Ga0006760J45825_103029 | 3300003158 | Bacteria | 14292 |
| 21 | Ga0006779J45831_104820 | 3300003160 | Bacteria | 2487 |
| 22 | Ga0006765J45826_105454 | 3300003161 | Bacteria | 4839 |
| 23 | Ga0006778J45830_1013714 | 3300003162 | Bacteria | 8778 |
| 24 | Ga0006759J45824_1007037 | 3300003163 | Bacteria | 1508 |
| 25 | Ga0006759J45824_1011122 | 3300003163 | Bacteria | 15613 |
| 26 | Ga0006759J45824_1018706 | 3300003163 | Bacteria | 1553 |
| 27 | Ga0006759J45824_1019946 | 3300003163 | Bacteria | 12757 |
| 28 | Ga0006759J45824_1028038 | 3300003163 | Bacteria | 4414 |
| 29 | Ga0006759J45824_1059282 | 3300003163 | Bacteria | 1344 |
| 30 | Ga0006759J45824_1078589 | 3300003163 | Bacteria | 918 |
| 31 | JGI25165J46597_1000239 | 3300003214 | Bacteria | 75240 |
| 32 | JGI25153J46596_10002258 | 3300003215 | Bacteria | 11225 |
| 33 | JGI25153J46596_10024994 | 3300003215 | Bacteria | 2143 |
| 34 | Ga0007428J48920_101526 | 3300003288 | Bacteria | 3934 |
| 35 | Ga0007421J48921_104512 | 3300003291 | Bacteria | 6358 |
| 36 | Ga0006758J48902_1003545 | 3300003300 | Bacteria | 8441 |
| 37 | Ga0006758J48902_1003546 | 3300003300 | Bacteria | 6400 |
| 38 | Ga0006758J48902_1008804 | 3300003300 | Bacteria | 15348 |
| 39 | Ga0006758J48902_1008911 | 3300003300 | Bacteria | 7674 |
| 40 | Ga0006758J48902_1015405 | 3300003300 | Bacteria | 1839 |
| 41 | Ga0006758J48902_1024042 | 3300003300 | Bacteria | 1099 |
| 42 | Ga0006770J48903_1019658 | 3300003305 | Bacteria | 2060 |
| 43 | Ga0006770J48903_1026191 | 3300003305 | Bacteria | 3112 |
| 44 | Ga0006770J48903_1040316 | 3300003305 | Bacteria | 4936 |
| 45 | Ga0006777J48905_1009816 | 3300003308 | Bacteria | 3090 |
| 46 | Ga0006777J48905_1091218 | 3300003308 | Bacteria | 1296 |
| 47 | rootH2_10116477 | 3300003320 | Bacteria | 1101 |
| 48 | JGI25160J50197_1001051 | 3300003354 | Bacteria | 14224 |
| 49 | JGI26142J50222_101156 | 3300003379 | Bacteria | 793 |
| 50 | Ga0007417J51691_1002612 | 3300003544 | Bacteria | 14201 |
| 51 | Ga0007417J51691_1007850 | 3300003544 | Bacteria | 19719 |
| 52 | Ga0007417J51691_1010268 | 3300003544 | Bacteria | 1565 |
| 53 | Ga0007417J51691_1011781 | 3300003544 | Bacteria | 8032 |
| 54 | Ga0007417J51691_1048714 | 3300003544 | Bacteria | 1042 |
| 55 | Ga0007427J51700_104411 | 3300003559 | Bacteria | 3323 |
| 56 | Ga0007427J51700_113492 | 3300003559 | Bacteria | 2911 |
| 57 | Ga0006781J51513_1010997 | 3300003568 | Bacteria | 3463 |
| 58 | Ga0007410J51695_1002373 | 3300003574 | Bacteria | 2540 |
| 59 | Ga0007410J51695_1004597 | 3300003574 | Bacteria | 14339 |
| 60 | Ga0007410J51695_1005374 | 3300003574 | Bacteria | 15855 |
| 61 | Ga0007410J51695_1012689 | 3300003574 | Bacteria | 12724 |
| 62 | Ga0007410J51695_1025455 | 3300003574 | Bacteria | 2936 |
| 63 | Ga0007410J51695_1041210 | 3300003574 | Bacteria | 3148 |
| 64 | Ga0007410J51695_1041265 | 3300003574 | Bacteria | 753 |
| 65 | Ga0007410J51695_1058196 | 3300003574 | Bacteria | 1167 |
| 66 | Ga0007409J51694_1000685 | 3300003575 | Bacteria | 1950 |
| 67 | Ga0007409J51694_1002576 | 3300003575 | Bacteria | 16363 |
| 68 | Ga0007409J51694_1029110 | 3300003575 | Bacteria | 1244 |
| 69 | Ga0007409J51694_1063905 | 3300003575 | Bacteria | 568 |
| 70 | Ga0007409J51694_1070581 | 3300003575 | Bacteria | 1247 |
| 71 | Ga0007416J51690_1004870 | 3300003577 | Bacteria | 16169 |
| 72 | Ga0007416J51690_1005292 | 3300003577 | Bacteria | 1546 |
| 73 | Ga0007416J51690_1050288 | 3300003577 | Bacteria | 661 |
| 74 | Ga0007416J51690_1051380 | 3300003577 | Bacteria | 1428 |
| 75 | Ga0007429J51699_1014434 | 3300003579 | Bacteria | 928 |
| 76 | Ga0007429J51699_1081817 | 3300003579 | Bacteria | 2946 |
| 77 | Ga0007411J51799_103551 | 3300003611 | Bacteria | 13349 |
| 78 | Ga0007411J51799_103780 | 3300003611 | Bacteria | 16516 |
| 79 | Ga0007411J51799_109076 | 3300003611 | Bacteria | 2033 |
| 80 | Ga0007415J51800_102854 | 3300003613 | Bacteria | 5009 |
| 81 | Ga0007415J51800_105493 | 3300003613 | Bacteria | 2566 |
| 82 | Ga0007415J51800_106957 | 3300003613 | Bacteria | 14800 |
| 83 | Ga0007415J51800_109761 | 3300003613 | Bacteria | 1239 |
| 84 | Ga0032354_1003171 | 3300003693 | Bacteria | 2717 |
| 85 | Ga0032354_1010694 | 3300003693 | Bacteria | 15995 |
| 86 | Ga0032354_1020687 | 3300003693 | Bacteria | 6503 |
| 87 | Ga0032354_1038818 | 3300003693 | Bacteria | 1084 |
| 88 | Ga0032354_1045145 | 3300003693 | Bacteria | 2372 |
| 89 | Ga0032354_1054804 | 3300003693 | Bacteria | 1134 |
| 90 | Ga0006766_111745 | 3300003717 | Bacteria | 2278 |
| 91 | Ga0006780_1003428 | 3300003735 | Bacteria | 4512 |
| 92 | Ga0006780_1036212 | 3300003735 | Bacteria | 701 |
| 93 | Ga0055538_1000094 | 3300003751 | Bacteria | 75240 |
| 94 | Ga0055538_1000138 | 3300003751 | Bacteria | 51369 |
| 95 | Ga0055539_1000136 | 3300003752 | Bacteria | 76284 |
| 96 | Ga0055539_1000187 | 3300003752 | Bacteria | 51369 |
| 97 | Ga0055533_1000143 | 3300003756 | Bacteria | 75240 |
| 98 | Ga0055533_1000189 | 3300003756 | Bacteria | 51369 |
| 99 | Ga0055532_1000184 | 3300003758 | Bacteria | 52595 |
| 100 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 101 | Ga0055525_1000188 | 3300003759 | Bacteria | 75240 |
| 102 | Ga0055525_1000254 | 3300003759 | Bacteria | 51369 |
| 103 | Ga0055535_1004814 | 3300003761 | Bacteria | 3154 |
| 104 | Ga0055542_1007983 | 3300003762 | Bacteria | 2102 |
| 105 | Ga0055529_1000079 | 3300003763 | Bacteria | 149370 |
| 106 | Ga0055526_1006085 | 3300003771 | Bacteria | 6666 |
| 107 | Ga0055526_1008246 | 3300003771 | Bacteria | 5232 |
| 108 | Ga0055526_1008253 | 3300003771 | Bacteria | 5230 |
| 109 | Ga0055526_1037912 | 3300003771 | Bacteria | 1251 |
| 110 | Ga0055537_1008487 | 3300003773 | Bacteria | 2366 |
| 111 | Ga0055537_1016447 | 3300003773 | Bacteria | 1251 |
| 112 | Ga0055524_1000024 | 3300003775 | Bacteria | 217953 |
| 113 | Ga0055524_1000140 | 3300003775 | Bacteria | 85990 |
| 114 | Ga0055524_1003212 | 3300003775 | Bacteria | 8017 |
| 115 | Ga0055524_1048599 | 3300003775 | Bacteria | 988 |
| 116 | Ga0055534_1017762 | 3300003784 | Bacteria | 1251 |
| 117 | Ga0055528_1018874 | 3300003790 | Bacteria | 2316 |
| 118 | Ga0055528_1034347 | 3300003790 | Bacteria | 1251 |
| 119 | Ga0055530_10006458 | 3300003791 | Bacteria | 5230 |
| 120 | Ga0055530_10013385 | 3300003791 | Bacteria | 2803 |
| 121 | Ga0055540_1000133 | 3300003792 | Bacteria | 75104 |
| 122 | Ga0055540_1005791 | 3300003792 | Bacteria | 5078 |
| 123 | Ga0055540_1025018 | 3300003792 | Bacteria | 1470 |
| 124 | Ga0055540_1037600 | 3300003792 | Bacteria | 1066 |
| 125 | Ga0055531_10002079 | 3300003794 | Bacteria | 13764 |
| 126 | Ga0055531_10006076 | 3300003794 | Bacteria | 6916 |
| 127 | Ga0055541_1000092 | 3300003841 | Bacteria | 75240 |
| 128 | Ga0055541_1000122 | 3300003841 | Bacteria | 51369 |
| 129 | Ga0055543_1075013 | 3300004625 | Bacteria | 526 |
| 130 | Ga0058859_11666848 | 3300004798 | Bacteria | 6681 |
| 131 | Ga0058863_10085600 | 3300004799 | Bacteria | 3459 |
| 132 | Ga0058861_10170907 | 3300004800 | Bacteria | 1513 |
| 133 | Ga0058861_11590956 | 3300004800 | Bacteria | 516 |
| 134 | Ga0058860_12074819 | 3300004801 | Bacteria | 657 |
| 135 | Ga0058862_10086046 | 3300004803 | Bacteria | 2163 |
| 136 | Ga0058862_12189764 | 3300004803 | Bacteria | 565 |
| 137 | Ga0065165_1006561 | 3300005262 | Bacteria | 6061 |
| 138 | Ga0065165_1075084 | 3300005262 | Bacteria | 889 |
| 139 | Ga0065165_1139912 | 3300005262 | Bacteria | 572 |
| 140 | Ga0065165_1161401 | 3300005262 | Bacteria | 517 |
| 141 | Ga0065714_10003225 | 3300005288 | Bacteria | 8263 |
| 142 | Ga0065714_10022125 | 3300005288 | Bacteria | 1710 |
| 143 | Ga0065714_10025602 | 3300005288 | Bacteria | 1737 |
| 144 | Ga0065704_10109441 | 3300005289 | Bacteria | 1994 |
| 145 | Ga0065704_10314924 | 3300005289 | Bacteria | 862 |
| 146 | Ga0065715_10030875 | 3300005293 | Bacteria | 1888 |
| 147 | Ga0065715_10471438 | 3300005293 | Bacteria | 806 |
| 148 | Ga0065707_10413103 | 3300005295 | Bacteria | 839 |
| 149 | Ga0070658_10018142 | 3300005327 | Bacteria | 5631 |
| 150 | Ga0070658_10130450 | 3300005327 | Bacteria | 2094 |
| 151 | Ga0070658_10651962 | 3300005327 | Bacteria | 913 |
| 152 | Ga0070676_10039416 | 3300005328 | Bacteria | 2732 |
| 153 | Ga0070683_100088965 | 3300005329 | Bacteria | 2897 |
| 154 | Ga0070670_100033911 | 3300005331 | Bacteria | 4395 |
| 155 | Ga0068869_101478616 | 3300005334 | Bacteria | 603 |
| 156 | Ga0068869_101497089 | 3300005334 | Bacteria | 599 |
| 157 | Ga0070666_10340547 | 3300005335 | Bacteria | 1072 |
| 158 | Ga0070682_100098928 | 3300005337 | Bacteria | 1922 |
| 159 | Ga0068868_100185626 | 3300005338 | Bacteria | 1727 |
| 160 | Ga0070660_100001978 | 3300005339 | Bacteria | 14153 |
| 161 | Ga0070661_100008785 | 3300005344 | Bacteria | 6991 |
| 162 | Ga0070669_101914429 | 3300005353 | Bacteria | 518 |
| 163 | Ga0070671_100170542 | 3300005355 | Bacteria | 1840 |
| 164 | Ga0070688_100531111 | 3300005365 | Bacteria | 892 |
| 165 | Ga0070659_100004652 | 3300005366 | Bacteria | 9804 |
| 166 | Ga0070659_100341638 | 3300005366 | Bacteria | 1254 |
| 167 | Ga0070667_100001546 | 3300005367 | Bacteria | 20614 |
| 168 | Ga0070667_100013556 | 3300005367 | Bacteria | 6734 |
| 169 | Ga0070667_101644246 | 3300005367 | Bacteria | 604 |
| 170 | Ga0070713_100850446 | 3300005436 | Bacteria | 876 |
| 171 | Ga0070711_100954273 | 3300005439 | Bacteria | 734 |
| 172 | Ga0070705_101010293 | 3300005440 | Bacteria | 676 |
| 173 | Ga0070663_100255852 | 3300005455 | Bacteria | 1387 |
| 174 | Ga0070663_100389895 | 3300005455 | Bacteria | 1136 |
| 175 | Ga0070678_100297921 | 3300005456 | Bacteria | 1369 |
| 176 | Ga0070662_100119099 | 3300005457 | Bacteria | 2021 |
| 177 | Ga0068867_100076663 | 3300005459 | Bacteria | 2511 |
| 178 | Ga0070706_100446918 | 3300005467 | Bacteria | 1203 |
| 179 | Ga0070679_100237339 | 3300005530 | Bacteria | 1782 |
| 180 | Ga0070684_100098831 | 3300005535 | Bacteria | 2604 |
| 181 | Ga0068853_100029320 | 3300005539 | Bacteria | 4637 |
| 182 | Ga0068853_100679372 | 3300005539 | Bacteria | 981 |
| 183 | Ga0070665_100113328 | 3300005548 | Bacteria | 2714 |
| 184 | Ga0068855_100217302 | 3300005563 | Bacteria | 2145 |
| 185 | Ga0068855_100301252 | 3300005563 | Bacteria | 1775 |
| 186 | Ga0068855_100592398 | 3300005563 | Bacteria | 1196 |
| 187 | Ga0068855_101964641 | 3300005563 | Bacteria | 591 |
| 188 | Ga0070664_100027769 | 3300005564 | Bacteria | 4705 |
| 189 | Ga0070664_100575074 | 3300005564 | Bacteria | 1043 |
| 190 | Ga0068857_100009923 | 3300005577 | Bacteria | 8264 |
| 191 | Ga0068857_100129652 | 3300005577 | Bacteria | 2274 |
| 192 | Ga0068857_100148498 | 3300005577 | Bacteria | 2122 |
| 193 | Ga0068857_100196425 | 3300005577 | Bacteria | 1838 |
| 194 | Ga0068854_100016031 | 3300005578 | Bacteria | 4985 |
| 195 | Ga0068854_100069183 | 3300005578 | Bacteria | 2576 |
| 196 | Ga0068856_100049792 | 3300005614 | Bacteria | 4130 |
| 197 | Ga0068856_100784861 | 3300005614 | Bacteria | 972 |
| 198 | Ga0070702_100090534 | 3300005615 | Bacteria | 1854 |
| 199 | Ga0068852_100004987 | 3300005616 | Bacteria | 9445 |
| 200 | Ga0068852_100141024 | 3300005616 | Bacteria | 2230 |
| 201 | Ga0068852_101287319 | 3300005616 | Bacteria | 753 |
| 202 | Ga0068859_100364845 | 3300005617 | Bacteria | 1539 |
| 203 | Ga0068864_100060451 | 3300005618 | Bacteria | 3280 |
| 204 | Ga0068851_10001517 | 3300005834 | Bacteria | 10195 |
| 205 | Ga0068851_10026076 | 3300005834 | Bacteria | 2870 |
| 206 | Ga0068851_10034122 | 3300005834 | Bacteria | 2539 |
| 207 | Ga0068863_100167300 | 3300005841 | Bacteria | 2108 |
| 208 | Ga0068863_100362205 | 3300005841 | Bacteria | 1414 |
| 209 | Ga0068858_100249510 | 3300005842 | Bacteria | 1685 |
| 210 | Ga0068860_100125619 | 3300005843 | Bacteria | 2458 |
| 211 | Ga0068860_100439747 | 3300005843 | Bacteria | 1295 |
| 212 | Ga0070717_11201204 | 3300006028 | Unclassified | 690 |
| 213 | Ga0075363_100057573 | 3300006048 | Bacteria | 2086 |
| 214 | Ga0075364_10402497 | 3300006051 | Bacteria | 934 |
| 215 | Ga0075432_10050036 | 3300006058 | Bacteria | 1473 |
| 216 | Ga0075362_10000565 | 3300006177 | Bacteria | 10784 |
| 217 | Ga0075362_10248447 | 3300006177 | Bacteria | 875 |
| 218 | Ga0075366_10054228 | 3300006195 | Bacteria | 2381 |
| 219 | Ga0075366_10055751 | 3300006195 | Bacteria | 2347 |
| 220 | Ga0075366_10207954 | 3300006195 | Bacteria | 1191 |
| 221 | Ga0097621_100254993 | 3300006237 | Bacteria | 1537 |
| 222 | Ga0097621_101518870 | 3300006237 | Bacteria | 636 |
| 223 | Ga0075370_10036206 | 3300006353 | Bacteria | 2772 |
| 224 | Ga0075370_10212361 | 3300006353 | Bacteria | 1143 |
| 225 | Ga0075370_10281646 | 3300006353 | Bacteria | 987 |
| 226 | Ga0068871_100015656 | 3300006358 | Bacteria | 5684 |
| 227 | Ga0068865_100140074 | 3300006881 | Bacteria | 1823 |
| 228 | Ga0097620_100364841 | 3300006931 | Bacteria | 1539 |
| 229 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 230 | Ga0079104_1002693 | 3300006946 | Bacteria | 9148 |
| 231 | Ga0079104_1004078 | 3300006946 | Bacteria | 6424 |
| 232 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 233 | Ga0099794_10024211 | 3300007265 | Bacteria | 2785 |
| 234 | Ga0105244_10023517 | 3300009036 | Bacteria | 3377 |
| 235 | Ga0105244_10028871 | 3300009036 | Bacteria | 2972 |
| 236 | Ga0105244_10034566 | 3300009036 | Bacteria | 2660 |
| 237 | Ga0105250_10074461 | 3300009092 | Bacteria | 1373 |
| 238 | Ga0105240_10009383 | 3300009093 | Bacteria | 13863 |
| 239 | Ga0105240_10108670 | 3300009093 | Bacteria | 3360 |
| 240 | Ga0105240_10740893 | 3300009093 | Bacteria | 1069 |
| 241 | Ga0105245_10023078 | 3300009098 | Bacteria | 5460 |
| 242 | Ga0105243_10006860 | 3300009148 | Bacteria | 8779 |
| 243 | Ga0105243_10231805 | 3300009148 | Bacteria | 1638 |
| 244 | Ga0105243_11009752 | 3300009148 | Bacteria | 835 |
| 245 | Ga0105243_11855132 | 3300009148 | Bacteria | 635 |
| 246 | Ga0105241_10057980 | 3300009174 | Bacteria | 2972 |
| 247 | Ga0105241_11279784 | 3300009174 | Bacteria | 698 |
| 248 | Ga0105242_10007953 | 3300009176 | Bacteria | 8168 |
| 249 | Ga0105242_11775528 | 3300009176 | Bacteria | 655 |
| 250 | Ga0105248_10243333 | 3300009177 | Bacteria | 2025 |
| 251 | Ga0105248_10673758 | 3300009177 | Bacteria | 1167 |
| 252 | Ga0105237_10056847 | 3300009545 | Bacteria | 3915 |
| 253 | Ga0105237_10360625 | 3300009545 | Bacteria | 1458 |
| 254 | Ga0105238_10000255 | 3300009551 | Bacteria | 59531 |
| 255 | Ga0105238_10006249 | 3300009551 | Bacteria | 11834 |
| 256 | Ga0105238_10181832 | 3300009551 | Bacteria | 2079 |
| 257 | Ga0130086_1083152 | 3300009829 | Bacteria | 503 |
| 258 | Ga0130085_1065905 | 3300009850 | Bacteria | 503 |
| 259 | Ga0105239_10001561 | 3300010375 | Bacteria | 30314 |
| 260 | Ga0105239_10159405 | 3300010375 | Bacteria | 2520 |
| 261 | Ga0105239_10168833 | 3300010375 | Bacteria | 2446 |
| 262 | Ga0105239_11818894 | 3300010375 | Bacteria | 706 |
| 263 | Ga0105246_10722820 | 3300011119 | Bacteria | 875 |
| 264 | Ga0105246_10964055 | 3300011119 | Bacteria | 769 |
| 265 | Ga0157323_1039635 | 3300012495 | Bacteria | 535 |
| 266 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 267 | Ga0157327_1037212 | 3300012512 | Bacteria | 638 |
| 268 | Ga0157373_10015732 | 3300013100 | Bacteria | 5524 |
| 269 | Ga0157373_10076108 | 3300013100 | Bacteria | 2368 |
| 270 | Ga0157371_10061649 | 3300013102 | Bacteria | 2659 |
| 271 | Ga0157370_10062522 | 3300013104 | Bacteria | 3530 |
| 272 | Ga0157370_11169816 | 3300013104 | Bacteria | 694 |
| 273 | Ga0157369_10093282 | 3300013105 | Bacteria | 3214 |
| 274 | Ga0157374_10143777 | 3300013296 | Bacteria | 2316 |
| 275 | Ga0157378_10027087 | 3300013297 | Bacteria | 5057 |
| 276 | Ga0157378_10058938 | 3300013297 | Bacteria | 3425 |
| 277 | Ga0163162_10060438 | 3300013306 | Bacteria | 3825 |
| 278 | Ga0163162_10475400 | 3300013306 | Bacteria | 1381 |
| 279 | Ga0157372_10466393 | 3300013307 | Bacteria | 1472 |
| 280 | Ga0157372_10545256 | 3300013307 | Bacteria | 1352 |
| 281 | Ga0157372_12890446 | 3300013307 | Bacteria | 550 |
| 282 | Ga0182008_10001808 | 3300014497 | Bacteria | 13967 |
| 283 | Ga0182008_10089080 | 3300014497 | Bacteria | 1521 |
| 284 | Ga0157377_10643684 | 3300014745 | Bacteria | 762 |
| 285 | Ga0157376_10741967 | 3300014969 | Bacteria | 990 |
| 286 | Ga0182006_1000240 | 3300015261 | Bacteria | 51334 |
| 287 | Ga0182006_1000274 | 3300015261 | Bacteria | 46140 |
| 288 | Ga0182006_1002682 | 3300015261 | Bacteria | 9566 |
| 289 | Ga0182006_1048484 | 3300015261 | Bacteria | 1643 |
| 290 | Ga0182007_10000196 | 3300015262 | Bacteria | 40434 |
| 291 | Ga0182007_10014439 | 3300015262 | Bacteria | 2977 |
| 292 | Ga0182007_10054753 | 3300015262 | Bacteria | 1312 |
| 293 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 294 | Ga0182005_1000163 | 3300015265 | Bacteria | 46142 |
| 295 | Ga0182005_1000370 | 3300015265 | Bacteria | 24872 |
| 296 | Ga0163161_10007196 | 3300017792 | Bacteria | 7692 |
| 297 | Ga0163161_10136578 | 3300017792 | Bacteria | 1854 |
| 298 | Ga0163161_10252609 | 3300017792 | Bacteria | 1375 |
| 299 | Ga0163161_10253434 | 3300017792 | Bacteria | 1372 |
| 300 | Ga0197907_11499114 | 3300020069 | Bacteria | 1409 |
| 301 | Ga0206349_1212656 | 3300020075 | Bacteria | 703 |
| 302 | Ga0206355_1623195 | 3300020076 | Bacteria | 1223 |
| 303 | Ga0206355_1637204 | 3300020076 | Bacteria | 604 |
| 304 | Ga0206351_10065238 | 3300020077 | Bacteria | 1639 |
| 305 | Ga0206352_10851379 | 3300020078 | Bacteria | 1458 |
| 306 | Ga0206352_11092684 | 3300020078 | Bacteria | 931 |
| 307 | Ga0206350_10425581 | 3300020080 | Bacteria | 3340 |
| 308 | Ga0206354_10609314 | 3300020081 | Bacteria | 1073 |
| 309 | Ga0213872_10010693 | 3300021361 | Bacteria | 4359 |
| 310 | Ga0213872_10079633 | 3300021361 | Bacteria | 1472 |
| 311 | Ga0213872_10171118 | 3300021361 | Bacteria | 941 |
| 312 | Ga0209435_100079 | 3300025206 | Bacteria | 51612 |
| 313 | Ga0209435_100343 | 3300025206 | Bacteria | 10794 |
| 314 | Ga0209436_100401 | 3300025208 | Bacteria | 19545 |
| 315 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 316 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 317 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 318 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 319 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 320 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 321 | Ga0209672_107144 | 3300025228 | Bacteria | 1747 |
| 322 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 323 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 324 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 325 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 326 | Ga0207427_100342 | 3300025231 | Bacteria | 30270 |
| 327 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 328 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 329 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 330 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 331 | Ga0207425_1000845 | 3300025245 | Bacteria | 15112 |
| 332 | Ga0207425_1000932 | 3300025245 | Bacteria | 13905 |
| 333 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 334 | Ga0209646_1000265 | 3300025246 | Bacteria | 50897 |
| 335 | Ga0209026_1000330 | 3300025250 | Bacteria | 47453 |
| 336 | Ga0209026_1003315 | 3300025250 | Bacteria | 5361 |
| 337 | Ga0209026_1020065 | 3300025250 | Bacteria | 1042 |
| 338 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 339 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 340 | Ga0209677_102227 | 3300025253 | Bacteria | 7521 |
| 341 | Ga0209148_1000444 | 3300025254 | Bacteria | 45400 |
| 342 | Ga0209759_1000473 | 3300025256 | Bacteria | 44908 |
| 343 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 344 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 345 | Ga0209565_1001042 | 3300025263 | Bacteria | 14043 |
| 346 | Ga0209565_1003095 | 3300025263 | Bacteria | 5581 |
| 347 | Ga0209565_1022600 | 3300025263 | Bacteria | 1301 |
| 348 | Ga0209565_1026953 | 3300025263 | Bacteria | 1147 |
| 349 | Ga0209565_1063764 | 3300025263 | Bacteria | 634 |
| 350 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 351 | Ga0209673_1000730 | 3300025273 | Bacteria | 45590 |
| 352 | Ga0209673_1010299 | 3300025273 | Bacteria | 3948 |
| 353 | Ga0209673_1057800 | 3300025273 | Bacteria | 986 |
| 354 | Ga0209130_1010313 | 3300025284 | Bacteria | 2584 |
| 355 | Ga0209675_1012428 | 3300025291 | Bacteria | 2743 |
| 356 | Ga0209675_1038432 | 3300025291 | Bacteria | 1066 |
| 357 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 358 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 359 | Ga0209564_1002740 | 3300025295 | Bacteria | 13260 |
| 360 | Ga0209564_1079189 | 3300025295 | Bacteria | 648 |
| 361 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 362 | Ga0209758_1000322 | 3300025297 | Bacteria | 92458 |
| 363 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 364 | Ga0209050_1001097 | 3300025298 | Bacteria | 32856 |
| 365 | Ga0209050_1002922 | 3300025298 | Bacteria | 13390 |
| 366 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 367 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 368 | Ga0209256_1002719 | 3300025299 | Bacteria | 13723 |
| 369 | Ga0209256_1004416 | 3300025299 | Bacteria | 8844 |
| 370 | Ga0207426_1000802 | 3300025302 | Bacteria | 34010 |
| 371 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 372 | Ga0209051_1073300 | 3300025303 | Bacteria | 1020 |
| 373 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 374 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 375 | Ga0207697_10084711 | 3300025315 | Bacteria | 1338 |
| 376 | Ga0207656_10040557 | 3300025321 | Bacteria | 1974 |
| 377 | Ga0207656_10313374 | 3300025321 | Bacteria | 778 |
| 378 | Ga0207656_10481553 | 3300025321 | Bacteria | 629 |
| 379 | Ga0207696_1038621 | 3300025711 | Bacteria | 1408 |
| 380 | Ga0207655_1000499 | 3300025728 | Bacteria | 50341 |
| 381 | Ga0207655_1028515 | 3300025728 | Bacteria | 2632 |
| 382 | Ga0207655_1031488 | 3300025728 | Bacteria | 2443 |
| 383 | Ga0207647_10029480 | 3300025904 | Bacteria | 3551 |
| 384 | Ga0207645_10052858 | 3300025907 | Bacteria | 2596 |
| 385 | Ga0207705_10016800 | 3300025909 | Bacteria | 5240 |
| 386 | Ga0207684_10409189 | 3300025910 | Bacteria | 1166 |
| 387 | Ga0207654_10002111 | 3300025911 | Bacteria | 10175 |
| 388 | Ga0207695_10001345 | 3300025913 | Bacteria | 41663 |
| 389 | Ga0207695_10522141 | 3300025913 | Bacteria | 1069 |
| 390 | Ga0207671_10007790 | 3300025914 | Bacteria | 9221 |
| 391 | Ga0207671_10322971 | 3300025914 | Bacteria | 1222 |
| 392 | Ga0207663_10739341 | 3300025916 | Bacteria | 781 |
| 393 | Ga0207660_10096089 | 3300025917 | Bacteria | 2205 |
| 394 | Ga0207662_10605482 | 3300025918 | Bacteria | 763 |
| 395 | Ga0207657_10001495 | 3300025919 | Bacteria | 25015 |
| 396 | Ga0207657_10030110 | 3300025919 | Bacteria | 4931 |
| 397 | Ga0207649_10125160 | 3300025920 | Bacteria | 1738 |
| 398 | Ga0207652_10959634 | 3300025921 | Bacteria | 753 |
| 399 | Ga0207694_10000193 | 3300025924 | Bacteria | 61887 |
| 400 | Ga0207694_10049485 | 3300025924 | Bacteria | 3254 |
| 401 | Ga0207694_10051172 | 3300025924 | Bacteria | 3201 |
| 402 | Ga0207650_10013708 | 3300025925 | Bacteria | 5620 |
| 403 | Ga0207659_10170020 | 3300025926 | Bacteria | 1719 |
| 404 | Ga0207687_10038586 | 3300025927 | Bacteria | 3265 |
| 405 | Ga0207687_10042371 | 3300025927 | Bacteria | 3131 |
| 406 | Ga0207644_10023313 | 3300025931 | Bacteria | 4238 |
| 407 | Ga0207644_10288580 | 3300025931 | Bacteria | 1319 |
| 408 | Ga0207690_10000959 | 3300025932 | Bacteria | 18469 |
| 409 | Ga0207690_10175406 | 3300025932 | Bacteria | 1609 |
| 410 | Ga0207706_10008025 | 3300025933 | Bacteria | 9741 |
| 411 | Ga0207709_10019899 | 3300025935 | Bacteria | 3780 |
| 412 | Ga0207709_10164903 | 3300025935 | Bacteria | 1549 |
| 413 | Ga0207669_10254786 | 3300025937 | Bacteria | 1309 |
| 414 | Ga0207704_10041905 | 3300025938 | Bacteria | 2689 |
| 415 | Ga0207711_10109982 | 3300025941 | Bacteria | 2450 |
| 416 | Ga0207711_10162953 | 3300025941 | Bacteria | 2020 |
| 417 | Ga0207661_10747536 | 3300025944 | Bacteria | 900 |
| 418 | Ga0207679_10002718 | 3300025945 | Bacteria | 10935 |
| 419 | Ga0207667_10006290 | 3300025949 | Bacteria | 14403 |
| 420 | Ga0207667_10042169 | 3300025949 | Bacteria | 4852 |
| 421 | Ga0207667_10234580 | 3300025949 | Bacteria | 1878 |
| 422 | Ga0207712_11021662 | 3300025961 | Bacteria | 734 |
| 423 | Ga0207640_10004199 | 3300025981 | Bacteria | 7793 |
| 424 | Ga0207640_10022226 | 3300025981 | Bacteria | 3792 |
| 425 | Ga0207640_10135802 | 3300025981 | Bacteria | 1785 |
| 426 | Ga0207658_10005603 | 3300025986 | Bacteria | 8589 |
| 427 | Ga0207658_10041534 | 3300025986 | Bacteria | 3331 |
| 428 | Ga0207658_11367942 | 3300025986 | Bacteria | 648 |
| 429 | Ga0207677_10150765 | 3300026023 | Bacteria | 1793 |
| 430 | Ga0207703_10067259 | 3300026035 | Bacteria | 2949 |
| 431 | Ga0207639_11462473 | 3300026041 | Bacteria | 641 |
| 432 | Ga0207678_10003236 | 3300026067 | Bacteria | 14714 |
| 433 | Ga0207678_10721484 | 3300026067 | Bacteria | 878 |
| 434 | Ga0207678_10932652 | 3300026067 | Bacteria | 768 |
| 435 | Ga0207702_10134488 | 3300026078 | Bacteria | 2229 |
| 436 | Ga0207702_10347747 | 3300026078 | Bacteria | 1418 |
| 437 | Ga0207641_10131093 | 3300026088 | Bacteria | 2251 |
| 438 | Ga0207641_10157362 | 3300026088 | Bacteria | 2063 |
| 439 | Ga0207648_10088414 | 3300026089 | Bacteria | 2705 |
| 440 | Ga0207648_10567080 | 3300026089 | Bacteria | 1044 |
| 441 | Ga0207674_10005520 | 3300026116 | Bacteria | 15020 |
| 442 | Ga0207674_10033169 | 3300026116 | Bacteria | 5406 |
| 443 | Ga0207674_10040092 | 3300026116 | Bacteria | 4854 |
| 444 | Ga0207683_10172753 | 3300026121 | Bacteria | 1958 |
| 445 | Ga0207698_10000840 | 3300026142 | Bacteria | 17813 |
| 446 | Ga0207698_10059102 | 3300026142 | Bacteria | 2975 |
| 447 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 448 | Ga0209281_1002282 | 3300027111 | Bacteria | 8082 |
| 449 | Ga0209282_1000072 | 3300027666 | Bacteria | 81137 |
| 450 | Ga0207428_10182412 | 3300027907 | Bacteria | 1585 |
| 451 | Ga0268265_10143780 | 3300028380 | Bacteria | 2001 |
| 452 | Ga0268264_10261615 | 3300028381 | Bacteria | 1612 |
| 453 | Ga0265326_10017442 | 3300028558 | Bacteria | 2071 |
| 454 | Ga0307517_10185945 | 3300028786 | Bacteria | 1330 |
| 455 | Ga0307515_10301373 | 3300028794 | Bacteria | 1287 |
| 456 | Ga0265338_10165948 | 3300028800 | Bacteria | 1700 |
| 457 | Ga0316177_1129821 | 3300030731 | Bacteria | 1104 |
| 458 | Ga0316177_1154066 | 3300030731 | Bacteria | 637 |
| 459 | Ga0316176_1058761 | 3300030732 | Bacteria | 831 |
| 460 | Ga0316176_1058827 | 3300030732 | Bacteria | 560 |
| 461 | Ga0314311_1057607 | 3300030733 | Bacteria | 627 |
| 462 | Ga0316179_1096110 | 3300030734 | Bacteria | 2738 |
| 463 | Ga0316180_1056555 | 3300030736 | Bacteria | 3840 |
| 464 | Ga0316180_1167379 | 3300030736 | Bacteria | 730 |
| 465 | Ga0316183_1076598 | 3300030742 | Bacteria | 1906 |
| 466 | Ga0316181_1197761 | 3300030744 | Bacteria | 2465 |
| 467 | Ga0265767_100713 | 3300030836 | Bacteria | 1474 |
| 468 | Ga0265766_1002773 | 3300030863 | Bacteria | 988 |
| 469 | Ga0265766_1008174 | 3300030863 | Bacteria | 715 |
| 470 | Ga0265764_102142 | 3300030882 | Bacteria | 944 |
| 471 | Ga0265769_102926 | 3300030888 | Bacteria | 923 |
| 472 | Ga0265768_102697 | 3300030963 | Bacteria | 922 |
| 473 | Ga0265774_101097 | 3300031011 | Bacteria | 904 |
| 474 | Ga0265331_10403822 | 3300031250 | Bacteria | 613 |
| 475 | Ga0265327_10054273 | 3300031251 | Bacteria | 2075 |
| 476 | Ga0307513_10124367 | 3300031456 | Bacteria | 2539 |
| 477 | Ga0307513_10721554 | 3300031456 | Bacteria | 702 |
| 478 | Ga0307408_100067624 | 3300031548 | Bacteria | 2628 |
| 479 | Ga0307408_100141727 | 3300031548 | Bacteria | 1887 |
| 480 | Ga0307408_101681340 | 3300031548 | Bacteria | 604 |
| 481 | Ga0316575_10343388 | 3300031665 | Bacteria | 635 |
| 482 | Ga0316578_10049623 | 3300031728 | Bacteria | 2453 |
| 483 | Ga0307516_10433708 | 3300031730 | Bacteria | 971 |
| 484 | Ga0307518_10004256 | 3300031838 | Bacteria | 10276 |
| 485 | Ga0307406_11108511 | 3300031901 | Bacteria | 684 |
| 486 | Ga0307412_10153493 | 3300031911 | Bacteria | 1702 |
| 487 | Ga0307412_11948157 | 3300031911 | Bacteria | 543 |
| 488 | Ga0307416_100002061 | 3300032002 | Bacteria | 11324 |
| 489 | Ga0307416_101253949 | 3300032002 | Bacteria | 847 |
| 490 | Ga0307416_102562250 | 3300032002 | Bacteria | 608 |
| 491 | Ga0307414_10043339 | 3300032004 | Bacteria | 3064 |
| 492 | Ga0307414_10232447 | 3300032004 | Bacteria | 1521 |
| 493 | Ga0307411_10154296 | 3300032005 | Bacteria | 1711 |
| 494 | Ga0316585_10022471 | 3300032137 | Bacteria | 1941 |
| 495 | Ga0316593_10000292 | 3300032168 | Bacteria | 8493 |
| 496 | Ga0316592_1001180 | 3300033524 | Bacteria | 4123 |
| 497 | Ga0316588_1003102 | 3300033528 | Bacteria | 2985 |
| 498 | Ga0373936_0011451 | 3300035113 | Bacteria | 3357 |
| 499 | Ga0316574_0168024 | 3300035398 | Bacteria | 1412 |
| 500 | Ga0373935_0167776 | 3300035692 | Bacteria | 1500 |
| 501 | Ga0373927_0042076 | 3300035695 | Bacteria | 2962 |
| 502 | Ga0373933_0035625 | 3300035724 | Bacteria | 2908 |
| 503 | Ga0373937_0072024 | 3300036401 | Bacteria | 3187 |
| 504 | Ga0265778_035225 | 3300036457 | Bacteria | 657 |
| 505 | Ga0316582_0006061 | 3300036647 | Bacteria | 6303 |
| 506 | Ga0316584_0025317 | 3300036712 | Bacteria | 4351 |
| 507 | Ga0316584_0176768 | 3300036712 | Bacteria | 1581 |
| 508 | Ga0373925_1493664 | 3300037068 | Bacteria | 553 |
| 509 | Ga0395899_0000218 | 3300037312 | Bacteria | 79718 |
| 510 | Ga0395899_0003628 | 3300037312 | Bacteria | 12217 |
| 511 | Ga0395899_0010178 | 3300037312 | Bacteria | 7207 |
| 512 | Ga0395899_0028029 | 3300037312 | Bacteria | 4241 |
| 513 | Ga0395899_0082040 | 3300037312 | Bacteria | 2345 |
| 514 | Ga0395899_0087203 | 3300037312 | Bacteria | 2266 |
| 515 | Ga0395899_0091713 | 3300037312 | Bacteria | 2201 |
| 516 | Ga0395899_0354989 | 3300037312 | Bacteria | 979 |
| 517 | Ga0395900_0019646 | 3300037418 | Bacteria | 6888 |
| 518 | Ga0395900_0065201 | 3300037418 | Bacteria | 3741 |
| 519 | Ga0395900_0330458 | 3300037418 | Bacteria | 1502 |
| 520 | Ga0395900_0571242 | 3300037418 | Bacteria | 1073 |
| 521 | Ga0395898_0004013 | 3300037466 | Bacteria | 16185 |
| 522 | Ga0395898_0275232 | 3300037466 | Bacteria | 1605 |
| 523 | Ga0395898_0747121 | 3300037466 | Bacteria | 919 |
| 524 | Ga0395898_1310052 | 3300037466 | Bacteria | 653 |
| 525 | Ga0395898_1691808 | 3300037466 | Bacteria | 555 |
| 526 | Ga0395905_0000549 | 3300037471 | Bacteria | 51321 |
| 527 | Ga0395905_0008603 | 3300037471 | Bacteria | 10059 |
| 528 | Ga0395905_0012898 | 3300037471 | Bacteria | 8034 |
| 529 | Ga0395905_0085545 | 3300037471 | Bacteria | 2954 |
| 530 | Ga0395905_0255533 | 3300037471 | Bacteria | 1636 |
| 531 | Ga0395905_0387422 | 3300037471 | Bacteria | 1292 |
| 532 | Ga0395905_0686264 | 3300037471 | Bacteria | 926 |
| 533 | Ga0395905_1076116 | 3300037471 | Bacteria | 707 |
| 534 | Ga0395901_0014473 | 3300038443 | Bacteria | 8024 |
| 535 | Ga0395901_0036377 | 3300038443 | Bacteria | 5089 |
| 536 | Ga0395901_0065153 | 3300038443 | Bacteria | 3793 |
| 537 | Ga0395901_0176537 | 3300038443 | Bacteria | 2240 |
| 538 | Ga0395901_0261380 | 3300038443 | Bacteria | 1801 |
| 539 | Ga0395901_0727674 | 3300038443 | Bacteria | 987 |
| 540 | Ga0395901_1557051 | 3300038443 | Bacteria | 615 |
| 541 | Ga0436361_0097588 | 3300039447 | Bacteria | 1419 |
| 542 | Ga0436361_0378504 | 3300039447 | Bacteria | 3034 |
| 543 | Ga0436361_0391791 | 3300039447 | Bacteria | 42494 |
| 544 | Ga0436361_0394538 | 3300039447 | Bacteria | 1896 |
| 545 | Ga0436361_0568601 | 3300039447 | Bacteria | 1301 |
| 546 | Ga0436361_1041947 | 3300039447 | Bacteria | 6318 |
| 547 | Ga0436362_0392850 | 3300039453 | Bacteria | 872 |
| 548 | Ga0436362_0937853 | 3300039453 | Bacteria | 503 |
| 549 | Ga0439436_0040359 | 3300041404 | Bacteria | 1338 |
| 550 | Ga0439439_0017685 | 3300041406 | Bacteria | 1756 |
| 551 | Ga0439453_0001276 | 3300041408 | Bacteria | 3191 |
| 552 | Ga0439453_0017786 | 3300041408 | Bacteria | 1251 |
| 553 | Ga0439453_0022821 | 3300041408 | Bacteria | 1138 |
| 554 | Ga0439465_0035548 | 3300041413 | Bacteria | 1598 |
| 555 | Ga0439465_0061840 | 3300041413 | Bacteria | 1242 |
| 556 | Ga0451788_18078 | 3300041442 | Bacteria | 1225 |
| 557 | Ga0451790_18219 | 3300041444 | Bacteria | 776 |
| 558 | Ga0451794_47388 | 3300041446 | Bacteria | 1425 |
| 559 | Ga0451793_1577584 | 3300041452 | Bacteria | 587 |
| 560 | Ga0451802_1810119 | 3300041460 | Bacteria | 1370 |
| 561 | Ga0451805_045368 | 3300041461 | Bacteria | 950 |
| 562 | Ga0451807_0965944 | 3300041486 | Unclassified | 504 |
| 563 | Ga0451833_1345593 | 3300041491 | Bacteria | 1238 |
| 564 | Ga0451848_13097 | 3300041504 | Bacteria | 504 |
| 565 | Ga0451843_0537494 | 3300041509 | Bacteria | 1380 |
| 566 | Ga0451853_2717427 | 3300041512 | Bacteria | 789 |
| 567 | Ga0439431_0016768 | 3300041997 | Bacteria | 1717 |
| 568 | Ga0439433_0025440 | 3300041999 | Bacteria | 1337 |
| 569 | Ga0439448_0036322 | 3300042005 | Bacteria | 1580 |
| 570 | Ga0439449_0003878 | 3300042007 | Bacteria | 5800 |
| 571 | Ga0439449_0036247 | 3300042007 | Bacteria | 1835 |
| 572 | Ga0439452_117351 | 3300042010 | Bacteria | 567 |
| 573 | Ga0439454_015455 | 3300042011 | Bacteria | 1069 |
| 574 | Ga0439454_084734 | 3300042011 | Bacteria | 579 |
| 575 | Ga0439455_0000425 | 3300042012 | Bacteria | 5666 |
| 576 | Ga0439455_0028934 | 3300042012 | Bacteria | 1367 |
| 577 | Ga0439457_056273 | 3300042014 | Bacteria | 887 |
| 578 | Ga0439462_0050140 | 3300042015 | Bacteria | 1121 |
| 579 | Ga0450888_007845 | 3300042126 | Bacteria | 1191 |
| 580 | Ga0450890_001085 | 3300042127 | Bacteria | 3967 |
| 581 | Ga0450890_005814 | 3300042127 | Bacteria | 1585 |
| 582 | Ga0450895_001799 | 3300042132 | Bacteria | 1535 |
| 583 | Ga0450896_006823 | 3300042133 | Bacteria | 1570 |
| 584 | Ga0450896_010644 | 3300042133 | Bacteria | 1291 |
| 585 | Ga0450896_080762 | 3300042133 | Bacteria | 547 |
| 586 | Ga0450898_014524 | 3300042134 | Bacteria | 1324 |
| 587 | Ga0450899_002878 | 3300042135 | Bacteria | 1862 |
| 588 | Ga0450904_000961 | 3300042139 | Bacteria | 4531 |
| 589 | Ga0450906_012608 | 3300042145 | Bacteria | 1566 |
| 590 | Ga0439446_0026982 | 3300042156 | Bacteria | 1648 |
| 591 | Ga0439458_0053937 | 3300042157 | Bacteria | 995 |
| 592 | Ga0439458_0120833 | 3300042157 | Bacteria | 689 |
| 593 | Ga0450909_031207 | 3300042185 | Bacteria | 809 |
| 594 | Ga0439434_0041575 | 3300042435 | Bacteria | 1412 |
| 595 | Ga0439435_0004015 | 3300042436 | Bacteria | 3130 |
| 596 | Ga0439464_0071151 | 3300042439 | Bacteria | 1029 |
| 597 | Ga0439464_0181204 | 3300042439 | Bacteria | 667 |
| 598 | Ga0450893_0051404 | 3300042532 | Bacteria | 773 |
| 599 | Ga0451577_0121175 | 3300042876 | Bacteria | 2343 |
| 600 | Ga0451577_0187466 | 3300042876 | Bacteria | 1865 |
| 601 | Ga0451577_0256923 | 3300042876 | Bacteria | 1582 |
| 602 | Ga0451577_0627501 | 3300042876 | Bacteria | 975 |
| 603 | Ga0451577_1192501 | 3300042876 | Unclassified | 679 |
| 604 | Ga0439440_0021857 | 3300042993 | Bacteria | 1446 |
| 605 | Ga0453683_0003998 | 3300044673 | Bacteria | 10656 |
| 606 | Ga0453683_0117933 | 3300044673 | Bacteria | 1670 |
| 607 | Ga0453683_1015021 | 3300044673 | Bacteria | 551 |
| 608 | Ga0466965_0214040 | 3300044683 | Bacteria | 1025 |
| 609 | Ga0466965_0472369 | 3300044683 | Bacteria | 700 |
| 610 | Ga0453684_0016436 | 3300044712 | Bacteria | 11569 |
| 611 | Ga0453684_0026453 | 3300044712 | Bacteria | 8377 |
| 612 | Ga0453684_0039050 | 3300044712 | Bacteria | 6474 |
| 613 | Ga0453684_0055720 | 3300044712 | Bacteria | 5137 |
| 614 | Ga0453684_0106268 | 3300044712 | Bacteria | 3421 |
| 615 | Ga0453684_0167534 | 3300044712 | Bacteria | 2592 |
| 616 | Ga0453684_0273428 | 3300044712 | Bacteria | 1929 |
| 617 | Ga0453684_0422657 | 3300044712 | Bacteria | 1488 |
| 618 | Ga0453684_1459834 | 3300044712 | Unclassified | 707 |
| 619 | Ga0453684_2005111 | 3300044712 | Unclassified | 583 |
| 620 | Ga0453684_2111979 | 3300044712 | Unclassified | 565 |
| 621 | Ga0453684_2230229 | 3300044712 | Bacteria | 546 |
| 622 | Ga0466968_0244610 | 3300044735 | Bacteria | 850 |
| 623 | Ga0466970_0225020 | 3300044765 | Bacteria | 1048 |
| 624 | Ga0466957_0385424 | 3300044842 | Bacteria | 956 |
| 625 | Ga0466960_0701171 | 3300044901 | Bacteria | 607 |
| 626 | Ga0466959_0047090 | 3300045049 | Bacteria | 3172 |
| 627 | Ga0451576_0000454 | 3300045051 | Bacteria | 93047 |
| 628 | Ga0451576_0057306 | 3300045051 | Bacteria | 4073 |
| 629 | Ga0451576_0077585 | 3300045051 | Bacteria | 3457 |
| 630 | Ga0451576_0121490 | 3300045051 | Bacteria | 2720 |
| 631 | Ga0451576_0122787 | 3300045051 | Bacteria | 2704 |
| 632 | Ga0451576_2161912 | 3300045051 | Unclassified | 572 |
| 633 | Ga0466958_0378508 | 3300045836 | Bacteria | 913 |
| 634 | Ga0466967_0538588 | 3300045976 | Bacteria | 1148 |
| 635 | Ga0495617_000397 | 3300046452 | Bacteria | 24142 |
| 636 | Ga0495617_000636 | 3300046452 | Bacteria | 17611 |
| 637 | Ga0495617_000830 | 3300046452 | Bacteria | 14706 |
| 638 | Ga0495617_007088 | 3300046452 | Bacteria | 3909 |
| 639 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 640 | Ga0495627_008059 | 3300046453 | Bacteria | 3972 |
| 641 | Ga0495603_0001612 | 3300046455 | Bacteria | 13252 |
| 642 | Ga0495603_0009392 | 3300046455 | Bacteria | 5909 |
| 643 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 644 | Ga0495590_0000632 | 3300046457 | Bacteria | 16341 |
| 645 | Ga0495590_0006208 | 3300046457 | Bacteria | 4677 |
| 646 | Ga0495590_0190191 | 3300046457 | Bacteria | 752 |
| 647 | Ga0495591_029494 | 3300046458 | Bacteria | 1665 |
| 648 | Ga0495629_0007936 | 3300046459 | Bacteria | 7808 |
| 649 | Ga0495629_0021816 | 3300046459 | Bacteria | 4570 |
| 650 | Ga0495638_0000235 | 3300046460 | Bacteria | 75760 |
| 651 | Ga0495638_0016045 | 3300046460 | Bacteria | 5020 |
| 652 | Ga0495638_0077642 | 3300046460 | Bacteria | 2021 |
| 653 | Ga0495638_0426272 | 3300046460 | Bacteria | 683 |
| 654 | Ga0495651_0138175 | 3300046462 | Bacteria | 1770 |
| 655 | Ga0495653_0000067 | 3300046463 | Bacteria | 90116 |
| 656 | Ga0495653_0004702 | 3300046463 | Bacteria | 11053 |
| 657 | Ga0495653_0009522 | 3300046463 | Bacteria | 7946 |
| 658 | Ga0495650_0000200 | 3300046471 | Bacteria | 130223 |
| 659 | Ga0495650_0001809 | 3300046471 | Bacteria | 19254 |
| 660 | Ga0495650_0002469 | 3300046471 | Bacteria | 14877 |
| 661 | Ga0495650_0017593 | 3300046471 | Bacteria | 3580 |
| 662 | Ga0495650_0023728 | 3300046471 | Bacteria | 2914 |
| 663 | Ga0495580_0299480 | 3300046472 | Bacteria | 1095 |
| 664 | Ga0495582_0005108 | 3300046473 | Bacteria | 7350 |
| 665 | Ga0495582_0063422 | 3300046473 | Bacteria | 2041 |
| 666 | Ga0495605_0001735 | 3300046474 | Bacteria | 13971 |
| 667 | Ga0495605_0005449 | 3300046474 | Bacteria | 7411 |
| 668 | Ga0495605_0010393 | 3300046474 | Bacteria | 5209 |
| 669 | Ga0495605_0013819 | 3300046474 | Bacteria | 4436 |
| 670 | Ga0495605_0044149 | 3300046474 | Bacteria | 2205 |
| 671 | Ga0495605_0070705 | 3300046474 | Bacteria | 1649 |
| 672 | Ga0495605_0191971 | 3300046474 | Bacteria | 893 |
| 673 | Ga0495605_0200282 | 3300046474 | Bacteria | 870 |
| 674 | Ga0495584_0000636 | 3300046491 | Bacteria | 23364 |
| 675 | Ga0495584_0002002 | 3300046491 | Bacteria | 11717 |
| 676 | Ga0495584_0023314 | 3300046491 | Bacteria | 3138 |
| 677 | Ga0495584_0036677 | 3300046491 | Bacteria | 2476 |
| 678 | Ga0495584_0046813 | 3300046491 | Bacteria | 2181 |
| 679 | Ga0495584_0070356 | 3300046491 | Bacteria | 1758 |
| 680 | Ga0495584_0248975 | 3300046491 | Bacteria | 903 |
| 681 | Ga0495584_0302486 | 3300046491 | Bacteria | 812 |
| 682 | Ga0495585_0006666 | 3300046492 | Bacteria | 7134 |
| 683 | Ga0495585_0022456 | 3300046492 | Bacteria | 3621 |
| 684 | Ga0495585_0025799 | 3300046492 | Bacteria | 3361 |
| 685 | Ga0495585_0068953 | 3300046492 | Bacteria | 1930 |
| 686 | Ga0495585_0113007 | 3300046492 | Bacteria | 1442 |
| 687 | Ga0495585_0295478 | 3300046492 | Bacteria | 797 |
| 688 | Ga0495594_0050249 | 3300046499 | Bacteria | 2292 |
| 689 | Ga0495594_0050658 | 3300046499 | Bacteria | 2284 |
| 690 | Ga0495594_0158381 | 3300046499 | Bacteria | 1286 |
| 691 | Ga0495594_0197851 | 3300046499 | Bacteria | 1145 |
| 692 | Ga0495596_0001745 | 3300046500 | Bacteria | 12192 |
| 693 | Ga0495596_0001963 | 3300046500 | Bacteria | 11349 |
| 694 | Ga0495596_0070273 | 3300046500 | Bacteria | 1360 |
| 695 | Ga0495596_0269906 | 3300046500 | Bacteria | 660 |
| 696 | Ga0495607_0019187 | 3300046501 | Bacteria | 4347 |
| 697 | Ga0495607_0042980 | 3300046501 | Bacteria | 2675 |
| 698 | Ga0495607_0070470 | 3300046501 | Bacteria | 1953 |
| 699 | Ga0495607_0099229 | 3300046501 | Bacteria | 1562 |
| 700 | Ga0495607_0339027 | 3300046501 | Bacteria | 696 |
| 701 | Ga0495583_0000317 | 3300046506 | Bacteria | 76193 |
| 702 | Ga0495583_0002046 | 3300046506 | Bacteria | 18350 |
| 703 | Ga0495583_0003152 | 3300046506 | Bacteria | 13002 |
| 704 | Ga0495583_0004594 | 3300046506 | Bacteria | 9786 |
| 705 | Ga0495583_0024275 | 3300046506 | Bacteria | 3049 |
| 706 | Ga0495583_0063582 | 3300046506 | Bacteria | 1639 |
| 707 | Ga0495583_0072580 | 3300046506 | Bacteria | 1510 |
| 708 | Ga0495606_0000433 | 3300046507 | Bacteria | 69506 |
| 709 | Ga0495606_0004241 | 3300046507 | Bacteria | 14500 |
| 710 | Ga0495606_0013080 | 3300046507 | Bacteria | 6592 |
| 711 | Ga0495606_0032750 | 3300046507 | Bacteria | 3595 |
| 712 | Ga0495606_0035311 | 3300046507 | Bacteria | 3418 |
| 713 | Ga0495606_0035831 | 3300046507 | Bacteria | 3387 |
| 714 | Ga0495606_0073479 | 3300046507 | Bacteria | 2145 |
| 715 | Ga0495606_0163349 | 3300046507 | Bacteria | 1297 |
| 716 | Ga0495606_0189549 | 3300046507 | Bacteria | 1179 |
| 717 | Ga0495608_0037678 | 3300046511 | Bacteria | 3251 |
| 718 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 719 | Ga0495610_0004520 | 3300046512 | Bacteria | 10242 |
| 720 | Ga0495610_0035533 | 3300046512 | Bacteria | 2557 |
| 721 | Ga0495610_0048651 | 3300046512 | Bacteria | 2080 |
| 722 | Ga0495610_0159667 | 3300046512 | Bacteria | 954 |
| 723 | Ga0495616_0003800 | 3300046513 | Bacteria | 9623 |
| 724 | Ga0495616_0018110 | 3300046513 | Bacteria | 3874 |
| 725 | Ga0495616_0028095 | 3300046513 | Bacteria | 2980 |
| 726 | Ga0495616_0040567 | 3300046513 | Bacteria | 2377 |
| 727 | Ga0495616_0042318 | 3300046513 | Bacteria | 2319 |
| 728 | Ga0495616_0091183 | 3300046513 | Bacteria | 1442 |
| 729 | Ga0495616_0152195 | 3300046513 | Bacteria | 1045 |
| 730 | Ga0495616_0226651 | 3300046513 | Bacteria | 811 |
| 731 | Ga0495616_0268671 | 3300046513 | Bacteria | 727 |
| 732 | Ga0495620_0001543 | 3300046515 | Bacteria | 13683 |
| 733 | Ga0495628_0107716 | 3300046516 | Bacteria | 2145 |
| 734 | Ga0495631_0019480 | 3300046518 | Bacteria | 3181 |
| 735 | Ga0495631_0026488 | 3300046518 | Bacteria | 2661 |
| 736 | Ga0495631_0040478 | 3300046518 | Bacteria | 2064 |
| 737 | Ga0495631_0059518 | 3300046518 | Bacteria | 1659 |
| 738 | Ga0495631_0124850 | 3300046518 | Bacteria | 1106 |
| 739 | Ga0495631_0173872 | 3300046518 | Bacteria | 923 |
| 740 | Ga0495631_0292289 | 3300046518 | Bacteria | 693 |
| 741 | Ga0495632_0083186 | 3300046519 | Bacteria | 1524 |
| 742 | Ga0495632_0114594 | 3300046519 | Bacteria | 1263 |
| 743 | Ga0495632_0119983 | 3300046519 | Bacteria | 1229 |
| 744 | Ga0495637_0001780 | 3300046520 | Bacteria | 12324 |
| 745 | Ga0495637_0002190 | 3300046520 | Bacteria | 10923 |
| 746 | Ga0495637_0094170 | 3300046520 | Bacteria | 1177 |
| 747 | Ga0495637_0109372 | 3300046520 | Bacteria | 1072 |
| 748 | Ga0495643_0002891 | 3300046522 | Bacteria | 13023 |
| 749 | Ga0495643_0014375 | 3300046522 | Bacteria | 4711 |
| 750 | Ga0495643_0016892 | 3300046522 | Bacteria | 4279 |
| 751 | Ga0495643_0026159 | 3300046522 | Bacteria | 3295 |
| 752 | Ga0495643_0040909 | 3300046522 | Bacteria | 2529 |
| 753 | Ga0495643_0055349 | 3300046522 | Bacteria | 2120 |
| 754 | Ga0495643_0173422 | 3300046522 | Bacteria | 1053 |
| 755 | Ga0495644_0003110 | 3300046523 | Bacteria | 6566 |
| 756 | Ga0495644_0047750 | 3300046523 | Bacteria | 1607 |
| 757 | Ga0495644_0056888 | 3300046523 | Bacteria | 1469 |
| 758 | Ga0495644_0070446 | 3300046523 | Bacteria | 1313 |
| 759 | Ga0495644_0108082 | 3300046523 | Bacteria | 1054 |
| 760 | Ga0495644_0187660 | 3300046523 | Bacteria | 795 |
| 761 | Ga0495648_0003167 | 3300046524 | Bacteria | 14648 |
| 762 | Ga0495648_0072602 | 3300046524 | Bacteria | 1990 |
| 763 | Ga0495663_0015755 | 3300046525 | Bacteria | 2132 |
| 764 | Ga0495663_0032552 | 3300046525 | Bacteria | 1553 |
| 765 | Ga0495663_0062920 | 3300046525 | Bacteria | 1169 |
| 766 | Ga0495666_0202770 | 3300046526 | Bacteria | 911 |
| 767 | Ga0495642_0004003 | 3300046528 | Bacteria | 5759 |
| 768 | Ga0495642_0005824 | 3300046528 | Bacteria | 4726 |
| 769 | Ga0495642_0008349 | 3300046528 | Bacteria | 3963 |
| 770 | Ga0495642_0010689 | 3300046528 | Bacteria | 3515 |
| 771 | Ga0495642_0033338 | 3300046528 | Bacteria | 2070 |
| 772 | Ga0495642_0037203 | 3300046528 | Bacteria | 1968 |
| 773 | Ga0495642_0091690 | 3300046528 | Bacteria | 1286 |
| 774 | Ga0495642_0192405 | 3300046528 | Bacteria | 888 |
| 775 | Ga0495642_0425179 | 3300046528 | Bacteria | 586 |
| 776 | Ga0495652_0019185 | 3300046529 | Bacteria | 6091 |
| 777 | Ga0495654_0000060 | 3300046530 | Bacteria | 134307 |
| 778 | Ga0495654_0018887 | 3300046530 | Bacteria | 3607 |
| 779 | Ga0495654_0214561 | 3300046530 | Bacteria | 817 |
| 780 | Ga0495665_0099716 | 3300046531 | Bacteria | 1524 |
| 781 | Ga0495586_0070286 | 3300046535 | Bacteria | 1912 |
| 782 | Ga0495598_0076132 | 3300046537 | Bacteria | 1067 |
| 783 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 784 | Ga0495609_0005522 | 3300046538 | Bacteria | 6610 |
| 785 | Ga0495609_0018793 | 3300046538 | Bacteria | 3201 |
| 786 | Ga0495609_0019006 | 3300046538 | Bacteria | 3181 |
| 787 | Ga0495609_0021767 | 3300046538 | Bacteria | 2957 |
| 788 | Ga0495609_0026889 | 3300046538 | Bacteria | 2631 |
| 789 | Ga0495609_0046136 | 3300046538 | Bacteria | 1951 |
| 790 | Ga0495609_0122049 | 3300046538 | Bacteria | 1119 |
| 791 | Ga0495597_0004273 | 3300046542 | Bacteria | 7899 |
| 792 | Ga0495597_0007533 | 3300046542 | Bacteria | 5520 |
| 793 | Ga0495597_0007961 | 3300046542 | Bacteria | 5336 |
| 794 | Ga0495597_0022360 | 3300046542 | Bacteria | 2933 |
| 795 | Ga0495597_0025313 | 3300046542 | Bacteria | 2732 |
| 796 | Ga0495597_0050127 | 3300046542 | Bacteria | 1843 |
| 797 | Ga0495597_0059514 | 3300046542 | Bacteria | 1668 |
| 798 | Ga0495597_0072919 | 3300046542 | Bacteria | 1476 |
| 799 | Ga0495597_0200339 | 3300046542 | Bacteria | 800 |
| 800 | Ga0495645_0153398 | 3300046543 | Bacteria | 1598 |
| 801 | Ga0495622_0002906 | 3300046557 | Bacteria | 8173 |
| 802 | Ga0495622_0012942 | 3300046557 | Bacteria | 3869 |
| 803 | Ga0495622_0041061 | 3300046557 | Bacteria | 2151 |
| 804 | Ga0495622_0086811 | 3300046557 | Bacteria | 1438 |
| 805 | Ga0495622_0132327 | 3300046557 | Bacteria | 1135 |
| 806 | Ga0495633_0006566 | 3300046558 | Bacteria | 6874 |
| 807 | Ga0495633_0010195 | 3300046558 | Bacteria | 5140 |
| 808 | Ga0495633_0017696 | 3300046558 | Bacteria | 3636 |
| 809 | Ga0495633_0095570 | 3300046558 | Bacteria | 1380 |
| 810 | Ga0495633_0102739 | 3300046558 | Bacteria | 1326 |
| 811 | Ga0495633_0103686 | 3300046558 | Bacteria | 1319 |
| 812 | Ga0495633_0232640 | 3300046558 | Bacteria | 842 |
| 813 | Ga0495656_0036295 | 3300046615 | Bacteria | 2029 |
| 814 | Ga0495656_0077654 | 3300046615 | Bacteria | 1490 |
| 815 | Ga0495656_0121688 | 3300046615 | Bacteria | 1232 |
| 816 | Ga0495656_0266698 | 3300046615 | Bacteria | 869 |
| 817 | Ga0495656_0443350 | 3300046615 | Bacteria | 683 |
| 818 | Ga0495656_0509799 | 3300046615 | Bacteria | 638 |
| 819 | Ga0495668_0002640 | 3300046616 | Bacteria | 14406 |
| 820 | Ga0495668_0005163 | 3300046616 | Bacteria | 8962 |
| 821 | Ga0495668_0008733 | 3300046616 | Bacteria | 6291 |
| 822 | Ga0495668_0011342 | 3300046616 | Bacteria | 5343 |
| 823 | Ga0495668_0018916 | 3300046616 | Bacteria | 3978 |
| 824 | Ga0495668_0034324 | 3300046616 | Bacteria | 2846 |
| 825 | Ga0495668_0134102 | 3300046616 | Bacteria | 1355 |
| 826 | Ga0495668_0151367 | 3300046616 | Bacteria | 1270 |
| 827 | Ga0495668_0230437 | 3300046616 | Bacteria | 1014 |
| 828 | Ga0495668_0581424 | 3300046616 | Bacteria | 618 |
| 829 | Ga0495611_0001662 | 3300046648 | Bacteria | 10778 |
| 830 | Ga0495611_0002069 | 3300046648 | Bacteria | 9442 |
| 831 | Ga0495611_0005909 | 3300046648 | Bacteria | 5219 |
| 832 | Ga0495611_0007454 | 3300046648 | Bacteria | 4643 |
| 833 | Ga0495611_0011467 | 3300046648 | Bacteria | 3757 |
| 834 | Ga0495611_0020577 | 3300046648 | Bacteria | 2841 |
| 835 | Ga0495611_0031470 | 3300046648 | Bacteria | 2335 |
| 836 | Ga0495611_0115559 | 3300046648 | Bacteria | 1250 |
| 837 | Ga0495625_0011213 | 3300046660 | Bacteria | 7328 |
| 838 | Ga0495625_0016652 | 3300046660 | Bacteria | 5775 |
| 839 | Ga0495625_0042626 | 3300046660 | Bacteria | 3296 |
| 840 | Ga0495625_0125775 | 3300046660 | Bacteria | 1740 |
| 841 | Ga0495625_0176951 | 3300046660 | Bacteria | 1421 |
| 842 | Ga0495625_0288542 | 3300046660 | Bacteria | 1053 |
| 843 | Ga0495625_0311060 | 3300046660 | Bacteria | 1005 |
| 844 | Ga0495635_0008977 | 3300046663 | Bacteria | 6978 |
| 845 | Ga0495635_0074819 | 3300046663 | Bacteria | 2320 |
| 846 | Ga0495659_0118099 | 3300046664 | Bacteria | 1041 |
| 847 | Ga0495661_0022142 | 3300046665 | Bacteria | 4136 |
| 848 | Ga0495661_0048413 | 3300046665 | Bacteria | 2582 |
| 849 | Ga0495661_0152056 | 3300046665 | Bacteria | 1249 |
| 850 | Ga0495661_0178330 | 3300046665 | Bacteria | 1127 |
| 851 | Ga0495661_0196882 | 3300046665 | Bacteria | 1057 |
| 852 | Ga0495661_0203066 | 3300046665 | Bacteria | 1036 |
| 853 | Ga0495661_0222381 | 3300046665 | Bacteria | 977 |
| 854 | Ga0495661_0297574 | 3300046665 | Bacteria | 808 |
| 855 | Ga0495661_0455057 | 3300046665 | Bacteria | 615 |
| 856 | Ga0495588_0009027 | 3300046674 | Bacteria | 4594 |
| 857 | Ga0495588_0022754 | 3300046674 | Bacteria | 3099 |
| 858 | Ga0495588_0038295 | 3300046674 | Bacteria | 2438 |
| 859 | Ga0495588_0067691 | 3300046674 | Bacteria | 1853 |
| 860 | Ga0495588_0094469 | 3300046674 | Bacteria | 1567 |
| 861 | Ga0495588_0143878 | 3300046674 | Bacteria | 1259 |
| 862 | Ga0495588_0178690 | 3300046674 | Bacteria | 1121 |
| 863 | Ga0495588_0496985 | 3300046674 | Bacteria | 639 |
| 864 | Ga0495599_0001590 | 3300046678 | Bacteria | 13082 |
| 865 | Ga0495623_0182525 | 3300046679 | Bacteria | 1218 |
| 866 | Ga0495623_0460627 | 3300046679 | Bacteria | 676 |
| 867 | Ga0495646_0168697 | 3300046680 | Bacteria | 1207 |
| 868 | Ga0495658_0568452 | 3300046683 | Bacteria | 726 |
| 869 | Ga0495669_0001596 | 3300046684 | Bacteria | 9305 |
| 870 | Ga0495669_0002717 | 3300046684 | Bacteria | 7249 |
| 871 | Ga0495669_0099817 | 3300046684 | Bacteria | 1347 |
| 872 | Ga0495669_0183569 | 3300046684 | Bacteria | 997 |
| 873 | Ga0495669_0345104 | 3300046684 | Bacteria | 719 |
| 874 | Ga0495624_0133574 | 3300046690 | Bacteria | 1521 |
| 875 | Ga0495670_0004991 | 3300046691 | Bacteria | 6522 |
| 876 | Ga0495670_0031340 | 3300046691 | Bacteria | 2641 |
| 877 | Ga0495670_0055789 | 3300046691 | Bacteria | 1981 |
| 878 | Ga0495670_0226206 | 3300046691 | Bacteria | 994 |
| 879 | Ga0495670_0252952 | 3300046691 | Bacteria | 939 |
| 880 | Ga0495670_0344114 | 3300046691 | Bacteria | 802 |
| 881 | Ga0495670_0658991 | 3300046691 | Bacteria | 570 |
| 882 | Ga0495671_0000037 | 3300046692 | Bacteria | 177605 |
| 883 | Ga0495671_0005005 | 3300046692 | Bacteria | 7807 |
| 884 | Ga0495649_0007567 | 3300046694 | Bacteria | 6610 |
| 885 | Ga0495649_0066300 | 3300046694 | Bacteria | 1937 |
| 886 | Ga0495649_0141389 | 3300046694 | Bacteria | 1267 |
| 887 | Ga0495649_0186833 | 3300046694 | Bacteria | 1079 |
| 888 | Ga0495649_0622906 | 3300046694 | Bacteria | 531 |
| 889 | Ga0495589_0030733 | 3300046794 | Bacteria | 2704 |
| 890 | Ga0495589_0037560 | 3300046794 | Bacteria | 2426 |
| 891 | Ga0495589_0053829 | 3300046794 | Bacteria | 1985 |
| 892 | Ga0495589_0147423 | 3300046794 | Bacteria | 1124 |
| 893 | Ga0495589_0156814 | 3300046794 | Bacteria | 1085 |
| 894 | Ga0495589_0177111 | 3300046794 | Bacteria | 1012 |
| 895 | Ga0495600_0112057 | 3300046809 | Bacteria | 1776 |
| 896 | Ga0495660_0007547 | 3300046810 | Bacteria | 6384 |
| 897 | Ga0495660_0010186 | 3300046810 | Bacteria | 5468 |
| 898 | Ga0495660_0011018 | 3300046810 | Bacteria | 5250 |
| 899 | Ga0495660_0015683 | 3300046810 | Bacteria | 4375 |
| 900 | Ga0495660_0030532 | 3300046810 | Bacteria | 3035 |
| 901 | Ga0495660_0034825 | 3300046810 | Bacteria | 2815 |
| 902 | Ga0495660_0116918 | 3300046810 | Bacteria | 1353 |
| 903 | Ga0495660_0153779 | 3300046810 | Bacteria | 1133 |
| 904 | Ga0495660_0231960 | 3300046810 | Bacteria | 864 |
| 905 | Ga0495660_0363178 | 3300046810 | Bacteria | 641 |
| 906 | Ga0495660_0444407 | 3300046810 | Bacteria | 561 |
| 907 | Ga0495581_0101745 | 3300047315 | Bacteria | 1669 |
| 908 | Ga0495604_0010101 | 3300047317 | Bacteria | 7477 |
| 909 | Ga0495604_0063319 | 3300047317 | Bacteria | 2821 |
| 910 | Ga0495636_0001434 | 3300047318 | Bacteria | 9014 |
| 911 | Ga0495636_0003890 | 3300047318 | Bacteria | 5826 |
| 912 | Ga0495636_0178191 | 3300047318 | Bacteria | 963 |
| 913 | Ga0495636_0207313 | 3300047318 | Bacteria | 896 |
| 914 | Ga0495674_0009303 | 3300047319 | Bacteria | 9338 |
| 915 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 916 | Ga0495672_0000157 | 3300047320 | Bacteria | 98544 |
| 917 | Ga0495672_0007686 | 3300047320 | Bacteria | 8079 |
| 918 | Ga0495672_0016220 | 3300047320 | Bacteria | 5030 |
| 919 | Ga0495672_0021784 | 3300047320 | Bacteria | 4174 |
| 920 | Ga0495672_0449087 | 3300047320 | Bacteria | 581 |
| 921 | Ga0495676_0004545 | 3300047321 | Bacteria | 12688 |
| 922 | Ga0495676_0024323 | 3300047321 | Bacteria | 5246 |
| 923 | Ga0495676_0303356 | 3300047321 | Bacteria | 1076 |
| 924 | Ga0495680_0387251 | 3300047322 | Bacteria | 967 |
| 925 | Ga0495683_0003225 | 3300047323 | Bacteria | 9532 |
| 926 | Ga0495683_0014031 | 3300047323 | Bacteria | 4174 |
| 927 | Ga0495683_0057199 | 3300047323 | Bacteria | 1938 |
| 928 | Ga0495683_0070987 | 3300047323 | Bacteria | 1709 |
| 929 | Ga0495683_0074576 | 3300047323 | Bacteria | 1662 |
| 930 | Ga0495683_0141996 | 3300047323 | Bacteria | 1124 |
| 931 | Ga0495683_0363683 | 3300047323 | Bacteria | 608 |
| 932 | Ga0495687_000342 | 3300047443 | Bacteria | 59692 |
| 933 | Ga0495687_001562 | 3300047443 | Bacteria | 20787 |
| 934 | Ga0495687_002781 | 3300047443 | Bacteria | 13521 |
| 935 | Ga0495687_002921 | 3300047443 | Bacteria | 12995 |
| 936 | Ga0495687_007470 | 3300047443 | Bacteria | 6428 |
| 937 | Ga0495675_0072153 | 3300047444 | Bacteria | 2178 |
| 938 | Ga0495675_0622080 | 3300047444 | Bacteria | 610 |
| 939 | Ga0495677_0001866 | 3300047445 | Bacteria | 8421 |
| 940 | Ga0495677_0016634 | 3300047445 | Bacteria | 2669 |
| 941 | Ga0495677_0032598 | 3300047445 | Bacteria | 1897 |
| 942 | Ga0495677_0035931 | 3300047445 | Bacteria | 1808 |
| 943 | Ga0495677_0037415 | 3300047445 | Bacteria | 1772 |
| 944 | Ga0495677_0037798 | 3300047445 | Bacteria | 1763 |
| 945 | Ga0495677_0114905 | 3300047445 | Bacteria | 1024 |
| 946 | Ga0495679_006474 | 3300047446 | Bacteria | 5030 |
| 947 | Ga0495679_008349 | 3300047446 | Bacteria | 4218 |
| 948 | Ga0495679_034795 | 3300047446 | Bacteria | 1601 |
| 949 | Ga0495685_000291 | 3300047447 | Bacteria | 16719 |
| 950 | Ga0495685_001965 | 3300047447 | Bacteria | 6380 |
| 951 | Ga0495685_014389 | 3300047447 | Bacteria | 2688 |
| 952 | Ga0495685_036127 | 3300047447 | Bacteria | 1696 |
| 953 | Ga0495685_063448 | 3300047447 | Bacteria | 1243 |
| 954 | Ga0495685_082500 | 3300047447 | Bacteria | 1070 |
| 955 | Ga0495673_0000248 | 3300047469 | Bacteria | 75224 |
| 956 | Ga0495673_0017349 | 3300047469 | Bacteria | 3660 |
| 957 | Ga0495673_0038455 | 3300047469 | Bacteria | 2176 |
| 958 | Ga0495681_0011744 | 3300047470 | Bacteria | 5189 |
| 959 | Ga0495681_0012224 | 3300047470 | Bacteria | 5057 |
| 960 | Ga0495681_0124392 | 3300047470 | Bacteria | 1103 |
| 961 | Ga0495686_0007683 | 3300047472 | Bacteria | 8051 |
| 962 | Ga0495686_0010875 | 3300047472 | Bacteria | 6444 |
| 963 | Ga0495686_0012785 | 3300047472 | Bacteria | 5856 |
| 964 | Ga0495686_0018441 | 3300047472 | Bacteria | 4684 |
| 965 | Ga0495686_0021073 | 3300047472 | Bacteria | 4336 |
| 966 | Ga0495686_0061812 | 3300047472 | Bacteria | 2325 |
| 967 | Ga0495686_0062817 | 3300047472 | Bacteria | 2302 |
| 968 | Ga0495686_0088035 | 3300047472 | Bacteria | 1888 |
| 969 | Ga0495593_0002955 | 3300047673 | Bacteria | 10225 |
| 970 | Ga0495593_0073060 | 3300047673 | Bacteria | 1779 |
| 971 | Ga0495602_0044651 | 3300048088 | Bacteria | 4017 |
| 972 | Ga0495614_0054920 | 3300048089 | Bacteria | 1708 |
| 973 | Ga0495614_0111517 | 3300048089 | Bacteria | 1201 |
| 974 | Ga0495615_0009239 | 3300048090 | Bacteria | 1932 |
| 975 | Ga0495615_0009700 | 3300048090 | Bacteria | 1903 |
| 976 | Ga0495615_0170160 | 3300048090 | Bacteria | 659 |
| 977 | Ga0495626_0000227 | 3300048091 | Bacteria | 66048 |
| 978 | Ga0495626_0002147 | 3300048091 | Bacteria | 14252 |
| 979 | Ga0495626_0014493 | 3300048091 | Bacteria | 4062 |
| 980 | Ga0495626_0037979 | 3300048091 | Bacteria | 2285 |
| 981 | Ga0495626_0081138 | 3300048091 | Bacteria | 1440 |
| 982 | Ga0495626_0095315 | 3300048091 | Bacteria | 1303 |
| 983 | Ga0495626_0107363 | 3300048091 | Bacteria | 1212 |
| 984 | Ga0496100_0014114 | 3300048903 | Bacteria | 4630 |
| 985 | Ga0496100_0246173 | 3300048903 | Bacteria | 1321 |
| 986 | Ga0496101_0160023 | 3300048904 | Bacteria | 1726 |
| 987 | Ga0496102_0219122 | 3300048905 | Bacteria | 1793 |
| 988 | Ga0496102_0222236 | 3300048905 | Bacteria | 1780 |
| 989 | Ga0496102_0240111 | 3300048905 | Bacteria | 1708 |
| 990 | Ga0496103_0020711 | 3300048906 | Bacteria | 3953 |
| 991 | Ga0496103_0061076 | 3300048906 | Bacteria | 2343 |
| 992 | Ga0496103_0116859 | 3300048906 | Bacteria | 1697 |
| 993 | Ga0496103_0135193 | 3300048906 | Bacteria | 1575 |
| 994 | Ga0496103_0365428 | 3300048906 | Bacteria | 927 |
| 995 | Ga0496104_0278667 | 3300048907 | Bacteria | 1585 |
| 996 | Ga0496105_0266761 | 3300048908 | Bacteria | 1383 |
| 997 | Ga0496105_0809280 | 3300048908 | Bacteria | 712 |
| 998 | Ga0496107_0210280 | 3300048910 | Bacteria | 1446 |
| 999 | Ga0496107_0273009 | 3300048910 | Bacteria | 1258 |
| 1000 | Ga0496108_0443772 | 3300048911 | Bacteria | 1133 |
| 1001 | Ga0496108_0847322 | 3300048911 | Bacteria | 787 |
| 1002 | Ga0496109_0344021 | 3300048912 | Bacteria | 1408 |
| 1003 | Ga0496109_0855448 | 3300048912 | Bacteria | 847 |
| 1004 | Ga0496109_0885436 | 3300048912 | Bacteria | 831 |
| 1005 | Ga0496109_0912647 | 3300048912 | Bacteria | 816 |
| 1006 | Ga0496110_0458359 | 3300048913 | Bacteria | 1162 |
| 1007 | Ga0496110_0508332 | 3300048913 | Bacteria | 1096 |
| 1008 | Ga0496110_0900611 | 3300048913 | Bacteria | 791 |
| 1009 | Ga0496112_0288436 | 3300048915 | Bacteria | 1587 |
| 1010 | Ga0496113_0180677 | 3300048916 | Bacteria | 1672 |
| 1011 | Ga0496113_0503465 | 3300048916 | Bacteria | 972 |
| 1012 | Ga0496114_0010053 | 3300048917 | Bacteria | 7523 |
| 1013 | Ga0496114_0041004 | 3300048917 | Bacteria | 3836 |
| 1014 | Ga0496115_0050480 | 3300048918 | Bacteria | 3332 |
| 1015 | Ga0496115_0864800 | 3300048918 | Bacteria | 699 |
| 1016 | Ga0496116_0020766 | 3300048919 | Bacteria | 4975 |
| 1017 | Ga0496116_0030638 | 3300048919 | Bacteria | 3861 |
| 1018 | Ga0496116_0325888 | 3300048919 | Bacteria | 716 |
| 1019 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 1020 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 1021 | Ga0496121_0004491 | 3300048924 | Bacteria | 18710 |
| 1022 | Ga0496121_0079639 | 3300048924 | Bacteria | 2600 |
| 1023 | Ga0496121_0157732 | 3300048924 | Bacteria | 1663 |
| 1024 | Ga0496121_0274189 | 3300048924 | Bacteria | 1158 |
| 1025 | Ga0496121_0369833 | 3300048924 | Bacteria | 949 |
| 1026 | Ga0496121_0446598 | 3300048924 | Bacteria | 834 |
| 1027 | Ga0496122_0000968 | 3300048925 | Bacteria | 51537 |
| 1028 | Ga0496122_0005873 | 3300048925 | Bacteria | 14382 |
| 1029 | Ga0496122_0111660 | 3300048925 | Bacteria | 1792 |
| 1030 | Ga0496122_0158956 | 3300048925 | Bacteria | 1381 |
| 1031 | Ga0496122_0239113 | 3300048925 | Bacteria | 1025 |
| 1032 | Ga0496123_0004825 | 3300048926 | Bacteria | 13907 |
| 1033 | Ga0496123_0005104 | 3300048926 | Bacteria | 13404 |
| 1034 | Ga0496123_0076261 | 3300048926 | Bacteria | 2064 |
| 1035 | Ga0496123_0194868 | 3300048926 | Bacteria | 1044 |
| 1036 | Ga0496123_0364699 | 3300048926 | Bacteria | 667 |
| 1037 | Ga0496124_0009077 | 3300048927 | Bacteria | 10283 |
| 1038 | Ga0496124_0232737 | 3300048927 | Bacteria | 1376 |
| 1039 | Ga0496124_0706698 | 3300048927 | Bacteria | 638 |
| 1040 | Ga0496125_0009685 | 3300048928 | Bacteria | 9840 |
| 1041 | Ga0496125_0040571 | 3300048928 | Bacteria | 3990 |
| 1042 | Ga0496125_0128609 | 3300048928 | Bacteria | 1788 |
| 1043 | Ga0496126_0004622 | 3300048929 | Bacteria | 16312 |
| 1044 | Ga0496126_0804974 | 3300048929 | Bacteria | 721 |
| 1045 | Ga0496126_1154987 | 3300048929 | Bacteria | 572 |
| 1046 | Ga0496126_1182482 | 3300048929 | Bacteria | 563 |
| 1047 | Ga0501306_000005 | 3300049127 | Bacteria | 11576 |
| 1048 | Ga0501306_000907 | 3300049127 | Bacteria | 2551 |
| 1049 | Ga0501306_000979 | 3300049127 | Bacteria | 2501 |
| 1050 | Ga0501306_001799 | 3300049127 | Bacteria | 2089 |
| 1051 | Ga0501306_064535 | 3300049127 | Bacteria | 608 |
| 1052 | Ga0501308_000002 | 3300049128 | Bacteria | 13277 |
| 1053 | Ga0501308_000177 | 3300049128 | Bacteria | 3494 |
| 1054 | Ga0501308_004281 | 3300049128 | Bacteria | 1369 |
| 1055 | Ga0501308_019194 | 3300049128 | Bacteria | 842 |
| 1056 | Ga0501308_053997 | 3300049128 | Bacteria | 594 |
| 1057 | Ga0501308_068015 | 3300049128 | Bacteria | 549 |
| 1058 | Ga0501309_000053 | 3300049129 | Bacteria | 5860 |
| 1059 | Ga0501309_011451 | 3300049129 | Bacteria | 1156 |
| 1060 | Ga0501309_043262 | 3300049129 | Bacteria | 693 |
| 1061 | Ga0501309_045031 | 3300049129 | Bacteria | 682 |
| 1062 | Ga0501309_078610 | 3300049129 | Bacteria | 551 |
| 1063 | Ga0501310_000065 | 3300049130 | Bacteria | 9861 |
| 1064 | Ga0501310_001577 | 3300049130 | Bacteria | 2081 |
| 1065 | Ga0501310_003240 | 3300049130 | Bacteria | 1584 |
| 1066 | Ga0501310_012046 | 3300049130 | Bacteria | 986 |
| 1067 | Ga0501310_045131 | 3300049130 | Bacteria | 624 |
| 1068 | Ga0501341_01880 | 3300049131 | Bacteria | 1094 |
| 1069 | Ga0501341_06842 | 3300049131 | Bacteria | 706 |
| 1070 | Ga0501343_000946 | 3300049132 | Bacteria | 1870 |
| 1071 | Ga0501343_008820 | 3300049132 | Bacteria | 809 |
| 1072 | Ga0501344_08525 | 3300049133 | Bacteria | 612 |
| 1073 | Ga0501304_000001 | 3300049160 | Bacteria | 14569 |
| 1074 | Ga0501304_000110 | 3300049160 | Bacteria | 3123 |
| 1075 | Ga0501304_001659 | 3300049160 | Bacteria | 1462 |
| 1076 | Ga0501305_000399 | 3300049161 | Bacteria | 3488 |
| 1077 | Ga0501305_002400 | 3300049161 | Bacteria | 2014 |
| 1078 | Ga0501305_009251 | 3300049161 | Bacteria | 1291 |
| 1079 | Ga0501305_009815 | 3300049161 | Bacteria | 1266 |
| 1080 | Ga0501305_018025 | 3300049161 | Bacteria | 1019 |
| 1081 | Ga0501305_115993 | 3300049161 | Bacteria | 510 |
| 1082 | Ga0501307_000583 | 3300049162 | Bacteria | 2593 |
| 1083 | Ga0501307_001509 | 3300049162 | Bacteria | 1982 |
| 1084 | Ga0501307_002501 | 3300049162 | Bacteria | 1720 |
| 1085 | Ga0501307_004640 | 3300049162 | Bacteria | 1415 |
| 1086 | Ga0501307_007975 | 3300049162 | Bacteria | 1180 |
| 1087 | Ga0501307_017346 | 3300049162 | Bacteria | 906 |
| 1088 | Ga0501307_050237 | 3300049162 | Bacteria | 626 |
| 1089 | Ga0501307_083358 | 3300049162 | Bacteria | 525 |
| 1090 | Ga0501342_01262 | 3300049163 | Bacteria | 786 |
| 1091 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 1092 | Ga0495678_006449 | 3300049459 | Bacteria | 6240 |
| 1093 | Ga0495678_006909 | 3300049459 | Bacteria | 5955 |
| 1094 | Ga0495678_063342 | 3300049459 | Bacteria | 1381 |
| 1095 | Ga0495682_0003087 | 3300049460 | Bacteria | 7552 |
| 1096 | Ga0495682_0035772 | 3300049460 | Bacteria | 1828 |
| 1097 | Ga0495682_0049156 | 3300049460 | Bacteria | 1536 |
| 1098 | Ga0501298_029220 | 3300049521 | Bacteria | 1073 |
| 1099 | Ga0501298_100889 | 3300049521 | Bacteria | 658 |
| 1100 | Ga0501300_024434 | 3300049523 | Bacteria | 885 |
| 1101 | Ga0501303_006645 | 3300049526 | Bacteria | 1013 |
| 1102 | Ga0501311_000002 | 3300049527 | Bacteria | 12093 |
| 1103 | Ga0501311_006367 | 3300049527 | Bacteria | 1328 |
| 1104 | Ga0501311_034960 | 3300049527 | Bacteria | 742 |
| 1105 | Ga0501311_036217 | 3300049527 | Bacteria | 733 |
| 1106 | Ga0501312_001195 | 3300049528 | Bacteria | 2468 |
| 1107 | Ga0501312_002982 | 3300049528 | Bacteria | 1879 |
| 1108 | Ga0501312_005276 | 3300049528 | Bacteria | 1563 |
| 1109 | Ga0501312_006751 | 3300049528 | Bacteria | 1444 |
| 1110 | Ga0501312_031628 | 3300049528 | Bacteria | 832 |
| 1111 | Ga0501312_039196 | 3300049528 | Bacteria | 769 |
| 1112 | Ga0501312_076553 | 3300049528 | Bacteria | 600 |
| 1113 | Ga0501312_092049 | 3300049528 | Bacteria | 560 |
| 1114 | Ga0501313_000012 | 3300049529 | Bacteria | 8507 |
| 1115 | Ga0501313_000495 | 3300049529 | Bacteria | 2736 |
| 1116 | Ga0501314_009484 | 3300049530 | Bacteria | 894 |
| 1117 | Ga0501314_039418 | 3300049530 | Bacteria | 547 |
| 1118 | Ga0501314_045646 | 3300049530 | Bacteria | 520 |
| 1119 | Ga0501315_000004 | 3300049531 | Bacteria | 11326 |
| 1120 | Ga0501315_000082 | 3300049531 | Bacteria | 4574 |
| 1121 | Ga0501315_003410 | 3300049531 | Bacteria | 1589 |
| 1122 | Ga0501315_009644 | 3300049531 | Bacteria | 1145 |
| 1123 | Ga0501315_014533 | 3300049531 | Bacteria | 998 |
| 1124 | Ga0501315_052771 | 3300049531 | Bacteria | 642 |
| 1125 | Ga0501315_070240 | 3300049531 | Bacteria | 580 |
| 1126 | Ga0501316_000002 | 3300049532 | Bacteria | 13278 |
| 1127 | Ga0501316_000608 | 3300049532 | Bacteria | 2595 |
| 1128 | Ga0501316_003898 | 3300049532 | Bacteria | 1476 |
| 1129 | Ga0501317_031813 | 3300049533 | Bacteria | 769 |
| 1130 | Ga0501318_000040 | 3300049534 | Bacteria | 5307 |
| 1131 | Ga0501318_000292 | 3300049534 | Bacteria | 2919 |
| 1132 | Ga0501318_011949 | 3300049534 | Bacteria | 988 |
| 1133 | Ga0501319_000218 | 3300049535 | Bacteria | 2405 |
| 1134 | Ga0501320_000368 | 3300049536 | Bacteria | 2523 |
| 1135 | Ga0501320_000545 | 3300049536 | Bacteria | 2266 |
| 1136 | Ga0501320_003268 | 3300049536 | Bacteria | 1362 |
| 1137 | Ga0501320_005185 | 3300049536 | Bacteria | 1178 |
| 1138 | Ga0501320_006733 | 3300049536 | Bacteria | 1086 |
| 1139 | Ga0501320_011519 | 3300049536 | Bacteria | 917 |
| 1140 | Ga0501320_012652 | 3300049536 | Bacteria | 891 |
| 1141 | Ga0501320_022714 | 3300049536 | Bacteria | 737 |
| 1142 | Ga0501320_025409 | 3300049536 | Bacteria | 710 |
| 1143 | Ga0501320_029270 | 3300049536 | Bacteria | 678 |
| 1144 | Ga0501320_046014 | 3300049536 | Bacteria | 584 |
| 1145 | Ga0501321_006362 | 3300049537 | Bacteria | 1198 |
| 1146 | Ga0501321_039989 | 3300049537 | Bacteria | 656 |
| 1147 | Ga0501322_000643 | 3300049538 | Bacteria | 1716 |
| 1148 | Ga0501322_015523 | 3300049538 | Bacteria | 630 |
| 1149 | Ga0501322_022367 | 3300049538 | Bacteria | 562 |
| 1150 | Ga0501323_000789 | 3300049539 | Bacteria | 2528 |
| 1151 | Ga0501323_002509 | 3300049539 | Bacteria | 1787 |
| 1152 | Ga0501323_006202 | 3300049539 | Bacteria | 1332 |
| 1153 | Ga0501323_009479 | 3300049539 | Bacteria | 1148 |
| 1154 | Ga0501323_028666 | 3300049539 | Bacteria | 772 |
| 1155 | Ga0501323_038612 | 3300049539 | Bacteria | 694 |
| 1156 | Ga0501324_002702 | 3300049540 | Bacteria | 1306 |
| 1157 | Ga0501324_006256 | 3300049540 | Bacteria | 999 |
| 1158 | Ga0501324_010219 | 3300049540 | Bacteria | 852 |
| 1159 | Ga0501324_012262 | 3300049540 | Bacteria | 800 |
| 1160 | Ga0501324_014045 | 3300049540 | Bacteria | 764 |
| 1161 | Ga0501324_018192 | 3300049540 | Bacteria | 702 |
| 1162 | Ga0501325_012167 | 3300049541 | Bacteria | 806 |
| 1163 | Ga0501327_07127 | 3300049543 | Bacteria | 691 |
| 1164 | Ga0501327_09548 | 3300049543 | Bacteria | 630 |
| 1165 | Ga0501328_02722 | 3300049544 | Bacteria | 789 |
| 1166 | Ga0501329_00384 | 3300049545 | Bacteria | 1510 |
| 1167 | Ga0501329_09108 | 3300049545 | Bacteria | 605 |
| 1168 | Ga0501330_008961 | 3300049546 | Bacteria | 693 |
| 1169 | Ga0501334_01100 | 3300049550 | Bacteria | 1430 |
| 1170 | Ga0501334_01285 | 3300049550 | Bacteria | 1363 |
| 1171 | Ga0501335_000610 | 3300049551 | Bacteria | 2385 |
| 1172 | Ga0501335_004710 | 3300049551 | Bacteria | 1202 |
| 1173 | Ga0501335_029831 | 3300049551 | Bacteria | 613 |
| 1174 | Ga0501335_040321 | 3300049551 | Bacteria | 549 |
| 1175 | Ga0501336_000167 | 3300049552 | Bacteria | 2751 |
| 1176 | Ga0501336_004393 | 3300049552 | Bacteria | 988 |
| 1177 | Ga0501336_015269 | 3300049552 | Bacteria | 657 |
| 1178 | Ga0501337_001443 | 3300049553 | Bacteria | 1361 |
| 1179 | Ga0501337_003490 | 3300049553 | Bacteria | 1000 |
| 1180 | Ga0501337_003553 | 3300049553 | Bacteria | 994 |
| 1181 | Ga0501338_00312 | 3300049554 | Bacteria | 2096 |
| 1182 | Ga0501338_02956 | 3300049554 | Bacteria | 987 |
| 1183 | Ga0501338_05013 | 3300049554 | Bacteria | 814 |
| 1184 | Ga0501340_011180 | 3300049556 | Bacteria | 666 |
| 1185 | Ga0501340_027943 | 3300049556 | Bacteria | 501 |
| 1186 | Ga0501031_0093307 | 3300049568 | Bacteria | 1964 |
| 1187 | Ga0501031_0199569 | 3300049568 | Bacteria | 1305 |
| 1188 | Ga0501032_0005689 | 3300049569 | Bacteria | 9231 |
| 1189 | Ga0501032_0483829 | 3300049569 | Bacteria | 792 |
| 1190 | Ga0501033_0001803 | 3300049570 | Bacteria | 18695 |
| 1191 | Ga0501033_0020233 | 3300049570 | Bacteria | 5031 |
| 1192 | Ga0501034_0029030 | 3300049571 | Bacteria | 5623 |
| 1193 | Ga0501034_0080413 | 3300049571 | Bacteria | 3262 |
| 1194 | Ga0501034_0150364 | 3300049571 | Bacteria | 2304 |
| 1195 | Ga0501036_0085603 | 3300049572 | Bacteria | 2664 |
| 1196 | Ga0501036_1644218 | 3300049572 | Bacteria | 518 |
| 1197 | Ga0501037_0029069 | 3300049573 | Bacteria | 4082 |
| 1198 | Ga0501037_0087529 | 3300049573 | Bacteria | 2254 |
| 1199 | Ga0501037_0421680 | 3300049573 | Bacteria | 913 |
| 1200 | Ga0501038_0004562 | 3300049574 | Bacteria | 12890 |
| 1201 | Ga0501038_0476077 | 3300049574 | Bacteria | 957 |
| 1202 | Ga0501039_0576058 | 3300049575 | Bacteria | 883 |
| 1203 | Ga0501043_0044507 | 3300049579 | Bacteria | 3490 |
| 1204 | Ga0501043_0093617 | 3300049579 | Bacteria | 2362 |
| 1205 | Ga0501046_0047608 | 3300049580 | Bacteria | 3399 |
| 1206 | Ga0501067_0533348 | 3300049583 | Bacteria | 657 |
| 1207 | Ga0501072_0008088 | 3300049588 | Bacteria | 7980 |
| 1208 | Ga0501073_0203968 | 3300049589 | Bacteria | 1367 |
| 1209 | Ga0501073_0562883 | 3300049589 | Bacteria | 787 |
| 1210 | Ga0501076_0818064 | 3300049592 | Bacteria | 769 |
| 1211 | Ga0501077_0209868 | 3300049593 | Bacteria | 1237 |
| 1212 | Ga0501222_031301 | 3300049662 | Bacteria | 732 |
| 1213 | Ga0501227_014322 | 3300049665 | Bacteria | 1759 |
| 1214 | Ga0501233_080366 | 3300049668 | Bacteria | 838 |
| 1215 | Ga0501235_045772 | 3300049669 | Bacteria | 1007 |
| 1216 | Ga0501238_000213 | 3300049671 | Bacteria | 8393 |
| 1217 | Ga0501238_008550 | 3300049671 | Bacteria | 1348 |
| 1218 | Ga0501249_010943 | 3300049679 | Bacteria | 1901 |
| 1219 | Ga0501253_098313 | 3300049683 | Bacteria | 683 |
| 1220 | Ga0501229_003004 | 3300049706 | Bacteria | 2006 |
| 1221 | Ga0501079_0160362 | 3300049741 | Bacteria | 1754 |
| 1222 | Ga0501241_041689 | 3300049758 | Bacteria | 891 |
| 1223 | Ga0501263_084735 | 3300049760 | Bacteria | 528 |
| 1224 | Ga0501269_000003 | 3300049766 | Bacteria | 111299 |
| 1225 | Ga0501279_002045 | 3300049775 | Bacteria | 2668 |
| 1226 | Ga0501279_007866 | 3300049775 | Bacteria | 1417 |
| 1227 | Ga0501035_0010452 | 3300049822 | Bacteria | 8602 |
| 1228 | Ga0501035_0136330 | 3300049822 | Bacteria | 2136 |
| 1229 | Ga0501044_0007653 | 3300049823 | Bacteria | 11876 |
| 1230 | nmdc:mga03683_14381_c1 | 3300050489 | Bacteria | 2927 |
| 1231 | nmdc:mga0k408_17134_c1 | 3300050493 | Bacteria | 4032 |
| 1232 | nmdc:mga0k408_255163_c1 | 3300050493 | Bacteria | 1047 |
| 1233 | nmdc:mga07m45_166976_c1 | 3300050496 | Bacteria | 1278 |
| 1234 | nmdc:mga07m45_398_c1 | 3300050496 | Bacteria | 17925 |
| 1235 | nmdc:mga07m45_87196_c1 | 3300050496 | Bacteria | 1786 |
| 1236 | nmdc:mga05p37_217522_c1 | 3300050507 | Bacteria | 2307 |
| 1237 | Ga0495601_0585866 | 3300053077 | Bacteria | 716 |
| 1238 | Ga0500594_0101680 | 3300053118 | Bacteria | 885 |
| 1239 | Ga0500618_002645 | 3300053125 | Bacteria | 6592 |
| 1240 | Ga0500618_040633 | 3300053125 | Bacteria | 1068 |
| 1241 | Ga0500574_000403 | 3300053141 | Bacteria | 5436 |
| 1242 | Ga0500586_012856 | 3300053145 | Bacteria | 2448 |
| 1243 | Ga0500616_0013527 | 3300053153 | Bacteria | 4735 |
| 1244 | Ga0501084_0089581 | 3300054114 | Bacteria | 2582 |
| 1245 | Ga0587084_000213 | 3300059477 | Bacteria | 3885 |
| 1246 | Ga0587084_000401 | 3300059477 | Bacteria | 3315 |
| 1247 | Ga0587084_003559 | 3300059477 | Bacteria | 1720 |
| 1248 | Ga0587084_026492 | 3300059477 | Bacteria | 906 |
| 1249 | Ga0587084_047284 | 3300059477 | Bacteria | 751 |
| 1250 | Ga0587084_091296 | 3300059477 | Bacteria | 605 |
| 1251 | Ga0587084_117374 | 3300059477 | Bacteria | 556 |
| 1252 | Ga0587093_000380 | 3300059478 | Bacteria | 2980 |
| 1253 | Ga0587093_001062 | 3300059478 | Bacteria | 2196 |
| 1254 | Ga0587093_006615 | 3300059478 | Bacteria | 1269 |
| 1255 | Ga0587093_006649 | 3300059478 | Bacteria | 1267 |
| 1256 | Ga0587093_033107 | 3300059478 | Bacteria | 753 |
| 1257 | Ga0587066_064419 | 3300059490 | Bacteria | 756 |
| 1258 | Ga0587066_064420 | 3300059490 | Bacteria | 756 |
| 1259 | Ga0587070_064009 | 3300059491 | Bacteria | 768 |
| 1260 | Ga0587070_068596 | 3300059491 | Bacteria | 751 |
| 1261 | Ga0587073_0000035 | 3300059492 | Bacteria | 7203 |
| 1262 | Ga0587077_001525 | 3300059493 | Bacteria | 2512 |
| 1263 | Ga0587077_009258 | 3300059493 | Bacteria | 1490 |
| 1264 | Ga0587077_014029 | 3300059493 | Bacteria | 1312 |
| 1265 | Ga0587077_034721 | 3300059493 | Bacteria | 981 |
| 1266 | Ga0587077_223544 | 3300059493 | Bacteria | 532 |
| 1267 | Ga0587080_022409 | 3300059503 | Bacteria | 1046 |
| 1268 | Ga0587080_056073 | 3300059503 | Bacteria | 756 |
| 1269 | Ga0587080_056074 | 3300059503 | Bacteria | 756 |
| 1270 | Ga0587082_004457 | 3300059504 | Bacteria | 1758 |
| 1271 | Ga0587082_008271 | 3300059504 | Bacteria | 1446 |
| 1272 | Ga0587082_024618 | 3300059504 | Bacteria | 1006 |
| 1273 | Ga0587082_065628 | 3300059504 | Bacteria | 726 |
| 1274 | Ga0587083_0007825 | 3300059505 | Bacteria | 1650 |
| 1275 | Ga0587083_0011898 | 3300059505 | Bacteria | 1448 |
| 1276 | Ga0587083_0088084 | 3300059505 | Bacteria | 752 |
| 1277 | Ga0587083_0193213 | 3300059505 | Bacteria | 577 |
| 1278 | Ga0587085_012368 | 3300059506 | Bacteria | 1169 |
| 1279 | Ga0587085_048607 | 3300059506 | Bacteria | 765 |
| 1280 | Ga0587086_000753 | 3300059507 | Bacteria | 2555 |
| 1281 | Ga0587086_048491 | 3300059507 | Bacteria | 678 |
| 1282 | Ga0587086_082925 | 3300059507 | Bacteria | 568 |
| 1283 | Ga0587088_001117 | 3300059508 | Bacteria | 2664 |
| 1284 | Ga0587088_041644 | 3300059508 | Bacteria | 867 |
| 1285 | Ga0587088_063898 | 3300059508 | Bacteria | 752 |
| 1286 | Ga0587089_000565 | 3300059509 | Bacteria | 2935 |
| 1287 | Ga0587089_009810 | 3300059509 | Bacteria | 1182 |
| 1288 | Ga0587089_023489 | 3300059509 | Bacteria | 868 |
| 1289 | Ga0587089_075285 | 3300059509 | Bacteria | 580 |
| 1290 | Ga0587090_001908 | 3300059510 | Bacteria | 2200 |
| 1291 | Ga0587090_051986 | 3300059510 | Bacteria | 753 |
| 1292 | Ga0587090_052046 | 3300059510 | Bacteria | 753 |
| 1293 | Ga0587090_108649 | 3300059510 | Bacteria | 589 |
| 1294 | Ga0587091_002949 | 3300059511 | Bacteria | 2086 |
| 1295 | Ga0587091_073030 | 3300059511 | Bacteria | 755 |
| 1296 | Ga0587091_073148 | 3300059511 | Bacteria | 754 |
| 1297 | Ga0587091_101709 | 3300059511 | Bacteria | 675 |
| 1298 | Ga0587092_000969 | 3300059512 | Bacteria | 2624 |
| 1299 | Ga0587092_008630 | 3300059512 | Bacteria | 1350 |
| 1300 | Ga0587092_042166 | 3300059512 | Bacteria | 798 |
| 1301 | Ga0587092_050322 | 3300059512 | Bacteria | 752 |
| 1302 | Ga0587094_015441 | 3300059513 | Bacteria | 1054 |
| 1303 | Ga0587094_016778 | 3300059513 | Bacteria | 1023 |
| 1304 | Ga0587094_097379 | 3300059513 | Bacteria | 564 |
| 1305 | Ga0587097_00549 | 3300059603 | Bacteria | 1121 |
| 1306 | Ga0587098_004256 | 3300059604 | Bacteria | 1340 |
| 1307 | Ga0587106_001550 | 3300059605 | Bacteria | 2066 |
| 1308 | Ga0587125_002919 | 3300059607 | Bacteria | 1413 |
| 1309 | Ga0587099_000239 | 3300059622 | Bacteria | 2770 |
| 1310 | Ga0587101_002644 | 3300059623 | Bacteria | 1735 |
| 1311 | Ga0587101_023534 | 3300059623 | Bacteria | 907 |
| 1312 | Ga0587101_042527 | 3300059623 | Bacteria | 755 |
| 1313 | Ga0587109_003197 | 3300059624 | Bacteria | 2163 |
| 1314 | Ga0587113_000311 | 3300059625 | Bacteria | 2411 |
| 1315 | Ga0587115_010663 | 3300059626 | Bacteria | 1148 |
| 1316 | Ga0587115_096841 | 3300059626 | Bacteria | 542 |
| 1317 | Ga0587117_011034 | 3300059627 | Bacteria | 1113 |
| 1318 | Ga0587117_038563 | 3300059627 | Bacteria | 752 |
| 1319 | Ga0587127_004393 | 3300059629 | Bacteria | 933 |
| 1320 | Ga0587128_011641 | 3300059630 | Bacteria | 1206 |
| 1321 | Ga0587062_000153 | 3300059639 | Bacteria | 3794 |
| 1322 | Ga0587062_000195 | 3300059639 | Bacteria | 3564 |
| 1323 | Ga0587062_002195 | 3300059639 | Bacteria | 1823 |
| 1324 | Ga0587062_032496 | 3300059639 | Bacteria | 807 |
| 1325 | Ga0587062_040726 | 3300059639 | Bacteria | 752 |
| 1326 | Ga0587067_026739 | 3300059640 | Bacteria | 1036 |
| 1327 | Ga0587068_000350 | 3300059641 | Bacteria | 3976 |
| 1328 | Ga0587068_001305 | 3300059641 | Bacteria | 2742 |
| 1329 | Ga0587068_002203 | 3300059641 | Bacteria | 2337 |
| 1330 | Ga0587068_080234 | 3300059641 | Bacteria | 658 |
| 1331 | Ga0587068_100300 | 3300059641 | Bacteria | 607 |
| 1332 | Ga0587068_125316 | 3300059641 | Bacteria | 561 |
| 1333 | Ga0587069_063455 | 3300059642 | Bacteria | 686 |
| 1334 | Ga0587072_000243 | 3300059643 | Bacteria | 4970 |
| 1335 | Ga0587072_005559 | 3300059643 | Bacteria | 1887 |
| 1336 | Ga0587072_066500 | 3300059643 | Bacteria | 753 |
| 1337 | Ga0587072_066501 | 3300059643 | Bacteria | 753 |
| 1338 | Ga0587072_072842 | 3300059643 | Bacteria | 729 |
| 1339 | Ga0587075_044338 | 3300059644 | Bacteria | 756 |
| 1340 | Ga0587076_002988 | 3300059645 | Bacteria | 1964 |
| 1341 | Ga0587076_012405 | 3300059645 | Bacteria | 1273 |
| 1342 | Ga0587076_012406 | 3300059645 | Bacteria | 1273 |
| 1343 | Ga0587076_013020 | 3300059645 | Bacteria | 1254 |
| 1344 | Ga0587076_047966 | 3300059645 | Bacteria | 823 |
| 1345 | Ga0587076_138571 | 3300059645 | Bacteria | 580 |
| 1346 | Ga0587076_154746 | 3300059645 | Bacteria | 559 |
| 1347 | Ga0587078_016824 | 3300059646 | Bacteria | 894 |
| 1348 | Ga0587078_051400 | 3300059646 | Bacteria | 605 |
| 1349 | Ga0587079_000584 | 3300059647 | Bacteria | 3398 |
| 1350 | Ga0587079_006516 | 3300059647 | Bacteria | 1705 |
| 1351 | Ga0587079_011451 | 3300059647 | Bacteria | 1429 |
| 1352 | Ga0587079_037243 | 3300059647 | Bacteria | 966 |
| 1353 | Ga0587100_001488 | 3300059648 | Bacteria | 1381 |
| 1354 | Ga0587100_003223 | 3300059648 | Bacteria | 1105 |
| 1355 | Ga0587100_007445 | 3300059648 | Bacteria | 865 |
| 1356 | Ga0587102_000132 | 3300059649 | Bacteria | 3370 |
| 1357 | Ga0587104_000049 | 3300059650 | Bacteria | 3143 |
| 1358 | Ga0587107_001789 | 3300059652 | Bacteria | 1818 |
| 1359 | Ga0587107_006131 | 3300059652 | Bacteria | 1303 |
| 1360 | Ga0587107_043660 | 3300059652 | Bacteria | 734 |
| 1361 | Ga0587107_098143 | 3300059652 | Bacteria | 576 |
| 1362 | Ga0587108_000210 | 3300059653 | Bacteria | 2694 |
| 1363 | Ga0587114_007269 | 3300059655 | Bacteria | 1266 |
| 1364 | Ga0587116_02402 | 3300059656 | Bacteria | 987 |
| 1365 | Ga0587118_01521 | 3300059657 | Bacteria | 1414 |
| 1366 | Ga0587118_11699 | 3300059657 | Bacteria | 678 |
| 1367 | Ga0587119_023436 | 3300059658 | Bacteria | 803 |
| 1368 | Ga0587120_002973 | 3300059659 | Bacteria | 1193 |
| 1369 | Ga0587124_001813 | 3300059660 | Bacteria | 1438 |
| 1370 | Ga0587124_014179 | 3300059660 | Bacteria | 755 |
| 1371 | Ga0587124_029558 | 3300059660 | Bacteria | 600 |
| 1372 | Ga0587060_000715 | 3300060243 | Bacteria | 1955 |
| 1373 | Ga0587060_006105 | 3300060243 | Bacteria | 954 |
| 1374 | Ga0587096_00279 | 3300060247 | Bacteria | 1279 |
| 1375 | Ga0587071_001373 | 3300060344 | Bacteria | 3016 |
| 1376 | Ga0587071_043674 | 3300060344 | Bacteria | 906 |
| 1377 | Ga0587071_071506 | 3300060344 | Bacteria | 756 |
| 1378 | Ga0587071_071662 | 3300060344 | Bacteria | 756 |
| 1379 | Ga0587111_0000229 | 3300060346 | Bacteria | 4601 |
| 1380 | Ga0587111_0000781 | 3300060346 | Bacteria | 3362 |
| 1381 | Ga0587111_0007805 | 3300060346 | Bacteria | 1752 |
| 1382 | Ga0587111_0008023 | 3300060346 | Bacteria | 1736 |
| 1383 | Ga0587111_0020048 | 3300060346 | Bacteria | 1275 |
| 1384 | Ga0587111_0096385 | 3300060346 | Bacteria | 730 |
| 1385 | Ga0587111_0157547 | 3300060346 | Bacteria | 615 |
| 1386 | Ga0587111_0180594 | 3300060346 | Bacteria | 586 |
| 1387 | Ga0587111_0189494 | 3300060346 | Bacteria | 577 |
| 1388 | 2511247454 | 2511231003 | Bacteria | 5606035 |
| 1389 | 2511384335 | 2511231026 | Bacteria | 5225445 |
| 1390 | 2521560874 | 2521172590 | Bacteria | 5047645 |
| 1391 | 2548501398 | 2547132374 | Bacteria | 5530232 |
| 1392 | 2550696684 | 2548876994 | Bacteria | 4904866 |
| 1393 | 2553007583 | 2551306416 | Bacteria | 6152985 |
| 1394 | 2601667016 | 2600255292 | Bacteria | 6300551 |
| 1395 | 2643792081 | 2643221554 | Bacteria | 6603920 |
| 1396 | 2643799424 | 2643221556 | Bacteria | 7251154 |
| 1397 | 2643868380 | 2643221570 | Bacteria | 5103772 |
| 1398 | 2643994491 | 2643221596 | Bacteria | 5006805 |
| 1399 | 2644026938 | 2643221603 | Bacteria | 6147767 |
| 1400 | 2644061505 | 2643221609 | Bacteria | 6756331 |
| 1401 | 2644075037 | 2643221611 | Bacteria | 6820941 |
| 1402 | 2644163760 | 2643221628 | Bacteria | 5745828 |
| 1403 | 2644216438 | 2643221638 | Bacteria | 6579467 |
| 1404 | 2644247750 | 2643221644 | Bacteria | 6865017 |
| 1405 | 2644254812 | 2643221645 | Bacteria | 7207331 |
| 1406 | 2644295316 | 2643221652 | Bacteria | 5140275 |
| 1407 | 2644360373 | 2643221664 | Bacteria | 7272945 |
| 1408 | 2644471517 | 2643221684 | Bacteria | 7145183 |
| 1409 | 2644649057 | 2643221717 | Bacteria | 5676132 |
| 1410 | 2722886127 | 2721755523 | Bacteria | 6430384 |
| 1411 | 2738738121 | 2738541280 | Bacteria | 6630198 |
| 1412 | 2738826784 | 2738541297 | Bacteria | 6549566 |
| 1413 | 2738843081 | 2738541300 | Bacteria | 6675882 |
| 1414 | 2739150581 | 2738541357 | Bacteria | 6549408 |
| 1415 | 2739192500 | 2738543003 | Bacteria | 6549560 |
| 1416 | 2739243206 | 2738543012 | Bacteria | 7115078 |
| 1417 | 2739273832 | 2738543018 | Bacteria | 6718814 |
| 1418 | 2739318977 | 2738543026 | Bacteria | 6549408 |
| 1419 | 2739337218 | 2738543029 | Bacteria | 6549249 |
| 1420 | 2739342876 | 2738543030 | Bacteria | 6719714 |
| 1421 | 2765567308 | 2765235838 | Bacteria | 5445269 |
| 1422 | 2808984219 | 2808606386 | Bacteria | 4471946 |
| 1423 | 2809132023 | 2808606415 | Bacteria | 4576710 |
| 1424 | 2809145897 | 2808606418 | Bacteria | 6724496 |
| 1425 | 2809151646 | 2808606419 | Bacteria | 4576925 |
| 1426 | 2816473781 | 2816332133 | Bacteria | 7249298 |
| 1427 | 2819543890 | 2818991436 | Bacteria | 5376622 |
| 1428 | 2819594350 | 2818991445 | Bacteria | 4955017 |
| 1429 | 2819618745 | 2818991449 | Bacteria | 5518009 |
| 1430 | 2821135880 | 2821131069 | Bacteria | 6108407 |
| 1431 | 2839095393 | 2839094727 | Bacteria | 5534556 |
| 1432 | 2839144215 | 2839138175 | Bacteria | 6549354 |
| 1433 | 2842712342 | 2842711865 | Bacteria | 7155354 |
| 1434 | 2842722289 | 2842718218 | Bacteria | 4560148 |
| 1435 | 2852622894 | 2852618963 | Bacteria | 4577824 |
| 1436 | 2857549061 | 2857547612 | Bacteria | 6179999 |
| 1437 | 2857556286 | 2857553236 | Bacteria | 6166726 |
| 1438 | 2857560797 | 2857558681 | Bacteria | 6617694 |
| 1439 | 2857567996 | 2857564685 | Bacteria | 6290584 |
| 1440 | 2881104313 | 2881101125 | Bacteria | 4590519 |
| 1441 | 2884811930 | 2884811622 | Bacteria | 5552861 |
| 1442 | 2884840748 | 2884836552 | Bacteria | 5219991 |
| 1443 | 2884857656 | 2884852848 | Bacteria | 5221161 |
| 1444 | 2885084375 | 2885080285 | Bacteria | 6355622 |
| 1445 | 2885197770 | 2885192300 | Bacteria | 5882526 |
| 1446 | 2891635731 | 2891633521 | Bacteria | 4602265 |
| 1447 | 2894023740 | 2894023352 | Bacteria | 5167372 |
| 1448 | 2896158596 | 2896154374 | Bacteria | 5221518 |
| 1449 | 2904428888 | 2904424332 | Bacteria | 7633521 |
| 1450 | 2904442511 | 2904439833 | Bacteria | 5931679 |
| 1451 | 2904533769 | 2904530477 | Bacteria | 5876334 |
| 1452 | 2904589394 | 2904584206 | Bacteria | 6028872 |
| 1453 | 2904595097 | 2904589729 | Bacteria | 6113573 |
| 1454 | 2904602401 | 2904601388 | Bacteria | 5884906 |
| 1455 | 2919050749 | 2919046199 | Bacteria | 5567169 |
| 1456 | 2919084944 | 2919079590 | Bacteria | 5946433 |
| 1457 | 2919476952 | 2919476304 | Bacteria | 5888696 |
| 1458 | 2923514715 | 2923510766 | Bacteria | 5926163 |
| 1459 | 2928135683 | 2928130867 | Bacteria | 5467269 |
| 1460 | 2932416111 | 2932410948 | Bacteria | 6312192 |
| 1461 | 2932422213 | 2932416698 | Bacteria | 6315112 |
| 1462 | 2954769598 | 2954767861 | Bacteria | 5535784 |
| 1463 | 2974320958 | 2974320154 | Bacteria | 4571377 |
| 1464 | 2990715407 | 2990710928 | Bacteria | 5002431 |
| 1465 | 639788565 | 639633007 | Bacteria | 4376040 |
| 1466 | 8047676082 | 8047673197 | Bacteria | 7395230 |
| 1467 | Ga0453684_0711160 | |||
| 1468 | JGI24740J21852_10001487 | |||
| 1469 | JGI24740J21852_10106123 | |||
| 1470 | JGI24737J22298_10004492 | |||
| 1471 | JGI24738J21930_10088537 | |||
| 1472 | JGI25156J39149_1016366 | |||
| 1473 | JGI25156J39149_1017873 | |||
| 1474 | JGI25162J39368_1000154 | |||
| 1475 | JGI25154J39366_1001042 | |||
| 1476 | JGI25157J39369_1011385 | |||
| 1477 | JGI25164J39214_1003736 | |||
| 1478 | JGI25150J39212_1001923 | |||
| 1479 | JGI25150J39212_1003501 | |||
| 1480 | Ga0006764J43180_105416 | |||
| 1481 | Ga0006767J43181_105098 | |||
| 1482 | Ga0006763J43179_104166 | |||
| 1483 | Ga0006762J43184_106210 | |||
| 1484 | JGI25159J45721_1059041 | |||
| 1485 | Ga0006760J45825_101715 | |||
| 1486 | Ga0006760J45825_103029 | |||
| 1487 | Ga0006779J45831_104820 | |||
| 1488 | Ga0006765J45826_105454 | |||
| 1489 | Ga0006778J45830_1013714 | |||
| 1490 | Ga0006759J45824_1007037 | |||
| 1491 | Ga0006759J45824_1011122 | |||
| 1492 | Ga0006759J45824_1018706 | |||
| 1493 | Ga0006759J45824_1019946 | |||
| 1494 | Ga0006759J45824_1028038 | |||
| 1495 | Ga0006759J45824_1059282 | |||
| 1496 | Ga0006759J45824_1078589 | |||
| 1497 | JGI25165J46597_1000239 | |||
| 1498 | JGI25153J46596_10002258 | |||
| 1499 | JGI25153J46596_10024994 | |||
| 1500 | Ga0007428J48920_101526 | |||
| 1501 | Ga0007421J48921_104512 | |||
| 1502 | Ga0006758J48902_1003545 | |||
| 1503 | Ga0006758J48902_1003546 | |||
| 1504 | Ga0006758J48902_1008804 | |||
| 1505 | Ga0006758J48902_1008911 | |||
| 1506 | Ga0006758J48902_1015405 | |||
| 1507 | Ga0006758J48902_1024042 | |||
| 1508 | Ga0006770J48903_1019658 | |||
| 1509 | Ga0006770J48903_1026191 | |||
| 1510 | Ga0006770J48903_1040316 | |||
| 1511 | Ga0006777J48905_1009816 | |||
| 1512 | Ga0006777J48905_1091218 | |||
| 1513 | rootH2_10116477 | |||
| 1514 | JGI25160J50197_1001051 | |||
| 1515 | JGI26142J50222_101156 | |||
| 1516 | Ga0007417J51691_1002612 | |||
| 1517 | Ga0007417J51691_1007850 | |||
| 1518 | Ga0007417J51691_1010268 | |||
| 1519 | Ga0007417J51691_1011781 | |||
| 1520 | Ga0007417J51691_1048714 | |||
| 1521 | Ga0007427J51700_104411 | |||
| 1522 | Ga0007427J51700_113492 | |||
| 1523 | Ga0006781J51513_1010997 | |||
| 1524 | Ga0007410J51695_1002373 | |||
| 1525 | Ga0007410J51695_1004597 | |||
| 1526 | Ga0007410J51695_1005374 | |||
| 1527 | Ga0007410J51695_1012689 | |||
| 1528 | Ga0007410J51695_1025455 | |||
| 1529 | Ga0007410J51695_1041210 | |||
| 1530 | Ga0007410J51695_1041265 | |||
| 1531 | Ga0007410J51695_1058196 | |||
| 1532 | Ga0007409J51694_1000685 | |||
| 1533 | Ga0007409J51694_1002576 | |||
| 1534 | Ga0007409J51694_1029110 | |||
| 1535 | Ga0007409J51694_1063905 | |||
| 1536 | Ga0007409J51694_1070581 | |||
| 1537 | Ga0007416J51690_1004870 | |||
| 1538 | Ga0007416J51690_1005292 | |||
| 1539 | Ga0007416J51690_1050288 | |||
| 1540 | Ga0007416J51690_1051380 | |||
| 1541 | Ga0007429J51699_1014434 | |||
| 1542 | Ga0007429J51699_1081817 | |||
| 1543 | Ga0007411J51799_103551 | |||
| 1544 | Ga0007411J51799_103780 | |||
| 1545 | Ga0007411J51799_109076 | |||
| 1546 | Ga0007415J51800_102854 | |||
| 1547 | Ga0007415J51800_105493 | |||
| 1548 | Ga0007415J51800_106957 | |||
| 1549 | Ga0007415J51800_109761 | |||
| 1550 | Ga0032354_1003171 | |||
| 1551 | Ga0032354_1010694 | |||
| 1552 | Ga0032354_1020687 | |||
| 1553 | Ga0032354_1038818 | |||
| 1554 | Ga0032354_1045145 | |||
| 1555 | Ga0032354_1054804 | |||
| 1556 | Ga0006766_111745 | |||
| 1557 | Ga0006780_1003428 | |||
| 1558 | Ga0006780_1036212 | |||
| 1559 | Ga0055538_1000094 | |||
| 1560 | Ga0055538_1000138 | |||
| 1561 | Ga0055539_1000136 | |||
| 1562 | Ga0055539_1000187 | |||
| 1563 | Ga0055533_1000143 | |||
| 1564 | Ga0055533_1000189 | |||
| 1565 | Ga0055532_1000184 | |||
| 1566 | Ga0055525_1000018 | |||
| 1567 | Ga0055525_1000188 | |||
| 1568 | Ga0055525_1000254 | |||
| 1569 | Ga0055535_1004814 | |||
| 1570 | Ga0055542_1007983 | |||
| 1571 | Ga0055529_1000079 | |||
| 1572 | Ga0055526_1006085 | |||
| 1573 | Ga0055526_1008246 | |||
| 1574 | Ga0055526_1008253 | |||
| 1575 | Ga0055526_1037912 | |||
| 1576 | Ga0055537_1008487 | |||
| 1577 | Ga0055537_1016447 | |||
| 1578 | Ga0055524_1000024 | |||
| 1579 | Ga0055524_1000140 | |||
| 1580 | Ga0055524_1003212 | |||
| 1581 | Ga0055524_1048599 | |||
| 1582 | Ga0055534_1017762 | |||
| 1583 | Ga0055528_1018874 | |||
| 1584 | Ga0055528_1034347 | |||
| 1585 | Ga0055530_10006458 | |||
| 1586 | Ga0055530_10013385 | |||
| 1587 | Ga0055540_1000133 | |||
| 1588 | Ga0055540_1005791 | |||
| 1589 | Ga0055540_1025018 | |||
| 1590 | Ga0055540_1037600 | |||
| 1591 | Ga0055531_10002079 | |||
| 1592 | Ga0055531_10006076 | |||
| 1593 | Ga0055541_1000092 | |||
| 1594 | Ga0055541_1000122 | |||
| 1595 | Ga0055543_1075013 | |||
| 1596 | Ga0058859_11666848 | |||
| 1597 | Ga0058863_10085600 | |||
| 1598 | Ga0058861_10170907 | |||
| 1599 | Ga0058861_11590956 | |||
| 1600 | Ga0058860_12074819 | |||
| 1601 | Ga0058862_10086046 | |||
| 1602 | Ga0058862_12189764 | |||
| 1603 | Ga0065165_1006561 | |||
| 1604 | Ga0065165_1075084 | |||
| 1605 | Ga0065165_1139912 | |||
| 1606 | Ga0065165_1161401 | |||
| 1607 | Ga0065714_10003225 | |||
| 1608 | Ga0065714_10022125 | |||
| 1609 | Ga0065714_10025602 | |||
| 1610 | Ga0065704_10109441 | |||
| 1611 | Ga0065704_10314924 | |||
| 1612 | Ga0065715_10030875 | |||
| 1613 | Ga0065715_10471438 | |||
| 1614 | Ga0065707_10413103 | |||
| 1615 | Ga0070658_10018142 | |||
| 1616 | Ga0070658_10130450 | |||
| 1617 | Ga0070658_10651962 | |||
| 1618 | Ga0070676_10039416 | |||
| 1619 | Ga0070683_100088965 | |||
| 1620 | Ga0070670_100033911 | |||
| 1621 | Ga0068869_101478616 | |||
| 1622 | Ga0068869_101497089 | |||
| 1623 | Ga0070666_10340547 | |||
| 1624 | Ga0070682_100098928 | |||
| 1625 | Ga0068868_100185626 | |||
| 1626 | Ga0070660_100001978 | |||
| 1627 | Ga0070661_100008785 | |||
| 1628 | Ga0070669_101914429 | |||
| 1629 | Ga0070671_100170542 | |||
| 1630 | Ga0070688_100531111 | |||
| 1631 | Ga0070659_100004652 | |||
| 1632 | Ga0070659_100341638 | |||
| 1633 | Ga0070667_100001546 | |||
| 1634 | Ga0070667_100013556 | |||
| 1635 | Ga0070667_101644246 | |||
| 1636 | Ga0070713_100850446 | |||
| 1637 | Ga0070711_100954273 | |||
| 1638 | Ga0070705_101010293 | |||
| 1639 | Ga0070663_100255852 | |||
| 1640 | Ga0070663_100389895 | |||
| 1641 | Ga0070678_100297921 | |||
| 1642 | Ga0070662_100119099 | |||
| 1643 | Ga0068867_100076663 | |||
| 1644 | Ga0070706_100446918 | |||
| 1645 | Ga0070679_100237339 | |||
| 1646 | Ga0070684_100098831 | |||
| 1647 | Ga0068853_100029320 | |||
| 1648 | Ga0068853_100679372 | |||
| 1649 | Ga0070665_100113328 | |||
| 1650 | Ga0068855_100217302 | |||
| 1651 | Ga0068855_100301252 | |||
| 1652 | Ga0068855_100592398 | |||
| 1653 | Ga0068855_101964641 | |||
| 1654 | Ga0070664_100027769 | |||
| 1655 | Ga0070664_100575074 | |||
| 1656 | Ga0068857_100009923 | |||
| 1657 | Ga0068857_100129652 | |||
| 1658 | Ga0068857_100148498 | |||
| 1659 | Ga0068857_100196425 | |||
| 1660 | Ga0068854_100016031 | |||
| 1661 | Ga0068854_100069183 | |||
| 1662 | Ga0068856_100049792 | |||
| 1663 | Ga0068856_100784861 | |||
| 1664 | Ga0070702_100090534 | |||
| 1665 | Ga0068852_100004987 | |||
| 1666 | Ga0068852_100141024 | |||
| 1667 | Ga0068852_101287319 | |||
| 1668 | Ga0068859_100364845 | |||
| 1669 | Ga0068864_100060451 | |||
| 1670 | Ga0068851_10001517 | |||
| 1671 | Ga0068851_10026076 | |||
| 1672 | Ga0068851_10034122 | |||
| 1673 | Ga0068863_100167300 | |||
| 1674 | Ga0068863_100362205 | |||
| 1675 | Ga0068858_100249510 | |||
| 1676 | Ga0068860_100125619 | |||
| 1677 | Ga0068860_100439747 | |||
| 1678 | Ga0070717_11201204 | |||
| 1679 | Ga0075363_100057573 | |||
| 1680 | Ga0075364_10402497 | |||
| 1681 | Ga0075432_10050036 | |||
| 1682 | Ga0075362_10000565 | |||
| 1683 | Ga0075362_10248447 | |||
| 1684 | Ga0075366_10054228 | |||
| 1685 | Ga0075366_10055751 | |||
| 1686 | Ga0075366_10207954 | |||
| 1687 | Ga0097621_100254993 | |||
| 1688 | Ga0097621_101518870 | |||
| 1689 | Ga0075370_10036206 | |||
| 1690 | Ga0075370_10212361 | |||
| 1691 | Ga0075370_10281646 | |||
| 1692 | Ga0068871_100015656 | |||
| 1693 | Ga0068865_100140074 | |||
| 1694 | Ga0097620_100364841 | |||
| 1695 | Ga0079104_1000053 | |||
| 1696 | Ga0079104_1002693 | |||
| 1697 | Ga0079104_1004078 | |||
| 1698 | Ga0099826_10000010 | |||
| 1699 | Ga0099794_10024211 | |||
| 1700 | Ga0105244_10023517 | |||
| 1701 | Ga0105244_10028871 | |||
| 1702 | Ga0105244_10034566 | |||
| 1703 | Ga0105250_10074461 | |||
| 1704 | Ga0105240_10009383 | |||
| 1705 | Ga0105240_10108670 | |||
| 1706 | Ga0105240_10740893 | |||
| 1707 | Ga0105245_10023078 | |||
| 1708 | Ga0105243_10006860 | |||
| 1709 | Ga0105243_10231805 | |||
| 1710 | Ga0105243_11009752 | |||
| 1711 | Ga0105243_11855132 | |||
| 1712 | Ga0105241_10057980 | |||
| 1713 | Ga0105241_11279784 | |||
| 1714 | Ga0105242_10007953 | |||
| 1715 | Ga0105242_11775528 | |||
| 1716 | Ga0105248_10243333 | |||
| 1717 | Ga0105248_10673758 | |||
| 1718 | Ga0105237_10056847 | |||
| 1719 | Ga0105237_10360625 | |||
| 1720 | Ga0105238_10000255 | |||
| 1721 | Ga0105238_10006249 | |||
| 1722 | Ga0105238_10181832 | |||
| 1723 | Ga0130086_1083152 | |||
| 1724 | Ga0130085_1065905 | |||
| 1725 | Ga0105239_10001561 | |||
| 1726 | Ga0105239_10159405 | |||
| 1727 | Ga0105239_10168833 | |||
| 1728 | Ga0105239_11818894 | |||
| 1729 | Ga0105246_10722820 | |||
| 1730 | Ga0105246_10964055 | |||
| 1731 | Ga0157323_1039635 | |||
| 1732 | Ga0157319_1000005 | |||
| 1733 | Ga0157327_1037212 | |||
| 1734 | Ga0157373_10015732 | |||
| 1735 | Ga0157373_10076108 | |||
| 1736 | Ga0157371_10061649 | |||
| 1737 | Ga0157370_10062522 | |||
| 1738 | Ga0157370_11169816 | |||
| 1739 | Ga0157369_10093282 | |||
| 1740 | Ga0157374_10143777 | |||
| 1741 | Ga0157378_10027087 | |||
| 1742 | Ga0157378_10058938 | |||
| 1743 | Ga0163162_10060438 | |||
| 1744 | Ga0163162_10475400 | |||
| 1745 | Ga0157372_10466393 | |||
| 1746 | Ga0157372_10545256 | |||
| 1747 | Ga0157372_12890446 | |||
| 1748 | Ga0182008_10001808 | |||
| 1749 | Ga0182008_10089080 | |||
| 1750 | Ga0157377_10643684 | |||
| 1751 | Ga0157376_10741967 | |||
| 1752 | Ga0182006_1000240 | |||
| 1753 | Ga0182006_1000274 | |||
| 1754 | Ga0182006_1002682 | |||
| 1755 | Ga0182006_1048484 | |||
| 1756 | Ga0182007_10000196 | |||
| 1757 | Ga0182007_10014439 | |||
| 1758 | Ga0182007_10054753 | |||
| 1759 | Ga0182005_1000016 | |||
| 1760 | Ga0182005_1000163 | |||
| 1761 | Ga0182005_1000370 | |||
| 1762 | Ga0163161_10007196 | |||
| 1763 | Ga0163161_10136578 | |||
| 1764 | Ga0163161_10252609 | |||
| 1765 | Ga0163161_10253434 | |||
| 1766 | Ga0197907_11499114 | |||
| 1767 | Ga0206349_1212656 | |||
| 1768 | Ga0206355_1623195 | |||
| 1769 | Ga0206355_1637204 | |||
| 1770 | Ga0206351_10065238 | |||
| 1771 | Ga0206352_10851379 | |||
| 1772 | Ga0206352_11092684 | |||
| 1773 | Ga0206350_10425581 | |||
| 1774 | Ga0206354_10609314 | |||
| 1775 | Ga0213872_10010693 | |||
| 1776 | Ga0213872_10079633 | |||
| 1777 | Ga0213872_10171118 | |||
| 1778 | Ga0209435_100079 | |||
| 1779 | Ga0209435_100343 | |||
| 1780 | Ga0209436_100401 | |||
| 1781 | Ga0209784_100010 | |||
| 1782 | Ga0209784_100035 | |||
| 1783 | Ga0209566_100008 | |||
| 1784 | Ga0209566_100040 | |||
| 1785 | Ga0209674_100019 | |||
| 1786 | Ga0209674_100057 | |||
| 1787 | Ga0209672_107144 | |||
| 1788 | Ga0209147_100060 | |||
| 1789 | Ga0209563_100011 | |||
| 1790 | Ga0209563_100021 | |||
| 1791 | Ga0209563_100059 | |||
| 1792 | Ga0207427_100342 | |||
| 1793 | Ga0209437_100019 | |||
| 1794 | Ga0209437_100081 | |||
| 1795 | Ga0209258_100141 | |||
| 1796 | Ga0207425_1000021 | |||
| 1797 | Ga0207425_1000845 | |||
| 1798 | Ga0207425_1000932 | |||
| 1799 | Ga0209646_1000068 | |||
| 1800 | Ga0209646_1000265 | |||
| 1801 | Ga0209026_1000330 | |||
| 1802 | Ga0209026_1003315 | |||
| 1803 | Ga0209026_1020065 | |||
| 1804 | Ga0209677_100011 | |||
| 1805 | Ga0209677_100036 | |||
| 1806 | Ga0209677_102227 | |||
| 1807 | Ga0209148_1000444 | |||
| 1808 | Ga0209759_1000473 | |||
| 1809 | Ga0209129_1000020 | |||
| 1810 | Ga0209233_1000025 | |||
| 1811 | Ga0209565_1001042 | |||
| 1812 | Ga0209565_1003095 | |||
| 1813 | Ga0209565_1022600 | |||
| 1814 | Ga0209565_1026953 | |||
| 1815 | Ga0209565_1063764 | |||
| 1816 | Ga0209455_1000070 | |||
| 1817 | Ga0209673_1000730 | |||
| 1818 | Ga0209673_1010299 | |||
| 1819 | Ga0209673_1057800 | |||
| 1820 | Ga0209130_1010313 | |||
| 1821 | Ga0209675_1012428 | |||
| 1822 | Ga0209675_1038432 | |||
| 1823 | Ga0209564_1000027 | |||
| 1824 | Ga0209564_1000047 | |||
| 1825 | Ga0209564_1002740 | |||
| 1826 | Ga0209564_1079189 | |||
| 1827 | Ga0209758_1000077 | |||
| 1828 | Ga0209758_1000322 | |||
| 1829 | Ga0209050_1000050 | |||
| 1830 | Ga0209050_1001097 | |||
| 1831 | Ga0209050_1002922 | |||
| 1832 | Ga0209256_1000045 | |||
| 1833 | Ga0209256_1000054 | |||
| 1834 | Ga0209256_1002719 | |||
| 1835 | Ga0209256_1004416 | |||
| 1836 | Ga0207426_1000802 | |||
| 1837 | Ga0209051_1000004 | |||
| 1838 | Ga0209051_1073300 | |||
| 1839 | Ga0209257_1000075 | |||
| 1840 | Ga0209257_1000315 | |||
| 1841 | Ga0207697_10084711 | |||
| 1842 | Ga0207656_10040557 | |||
| 1843 | Ga0207656_10313374 | |||
| 1844 | Ga0207656_10481553 | |||
| 1845 | Ga0207696_1038621 | |||
| 1846 | Ga0207655_1000499 | |||
| 1847 | Ga0207655_1028515 | |||
| 1848 | Ga0207655_1031488 | |||
| 1849 | Ga0207647_10029480 | |||
| 1850 | Ga0207645_10052858 | |||
| 1851 | Ga0207705_10016800 | |||
| 1852 | Ga0207684_10409189 | |||
| 1853 | Ga0207654_10002111 | |||
| 1854 | Ga0207695_10001345 | |||
| 1855 | Ga0207695_10522141 | |||
| 1856 | Ga0207671_10007790 | |||
| 1857 | Ga0207671_10322971 | |||
| 1858 | Ga0207663_10739341 | |||
| 1859 | Ga0207660_10096089 | |||
| 1860 | Ga0207662_10605482 | |||
| 1861 | Ga0207657_10001495 | |||
| 1862 | Ga0207657_10030110 | |||
| 1863 | Ga0207649_10125160 | |||
| 1864 | Ga0207652_10959634 | |||
| 1865 | Ga0207694_10000193 | |||
| 1866 | Ga0207694_10049485 | |||
| 1867 | Ga0207694_10051172 | |||
| 1868 | Ga0207650_10013708 | |||
| 1869 | Ga0207659_10170020 | |||
| 1870 | Ga0207687_10038586 | |||
| 1871 | Ga0207687_10042371 | |||
| 1872 | Ga0207644_10023313 | |||
| 1873 | Ga0207644_10288580 | |||
| 1874 | Ga0207690_10000959 | |||
| 1875 | Ga0207690_10175406 | |||
| 1876 | Ga0207706_10008025 | |||
| 1877 | Ga0207709_10019899 | |||
| 1878 | Ga0207709_10164903 | |||
| 1879 | Ga0207669_10254786 | |||
| 1880 | Ga0207704_10041905 | |||
| 1881 | Ga0207711_10109982 | |||
| 1882 | Ga0207711_10162953 | |||
| 1883 | Ga0207661_10747536 | |||
| 1884 | Ga0207679_10002718 | |||
| 1885 | Ga0207667_10006290 | |||
| 1886 | Ga0207667_10042169 | |||
| 1887 | Ga0207667_10234580 | |||
| 1888 | Ga0207712_11021662 | |||
| 1889 | Ga0207640_10004199 | |||
| 1890 | Ga0207640_10022226 | |||
| 1891 | Ga0207640_10135802 | |||
| 1892 | Ga0207658_10005603 | |||
| 1893 | Ga0207658_10041534 | |||
| 1894 | Ga0207658_11367942 | |||
| 1895 | Ga0207677_10150765 | |||
| 1896 | Ga0207703_10067259 | |||
| 1897 | Ga0207639_11462473 | |||
| 1898 | Ga0207678_10003236 | |||
| 1899 | Ga0207678_10721484 | |||
| 1900 | Ga0207678_10932652 | |||
| 1901 | Ga0207702_10134488 | |||
| 1902 | Ga0207702_10347747 | |||
| 1903 | Ga0207641_10131093 | |||
| 1904 | Ga0207641_10157362 | |||
| 1905 | Ga0207648_10088414 | |||
| 1906 | Ga0207648_10567080 | |||
| 1907 | Ga0207674_10005520 | |||
| 1908 | Ga0207674_10033169 | |||
| 1909 | Ga0207674_10040092 | |||
| 1910 | Ga0207683_10172753 | |||
| 1911 | Ga0207698_10000840 | |||
| 1912 | Ga0207698_10059102 | |||
| 1913 | Ga0209281_1000147 | |||
| 1914 | Ga0209281_1002282 | |||
| 1915 | Ga0209282_1000072 | |||
| 1916 | Ga0207428_10182412 | |||
| 1917 | Ga0268265_10143780 | |||
| 1918 | Ga0268264_10261615 | |||
| 1919 | Ga0265326_10017442 | |||
| 1920 | Ga0307517_10185945 | |||
| 1921 | Ga0307515_10301373 | |||
| 1922 | Ga0265338_10165948 | |||
| 1923 | Ga0316177_1129821 | |||
| 1924 | Ga0316177_1154066 | |||
| 1925 | Ga0316176_1058761 | |||
| 1926 | Ga0316176_1058827 | |||
| 1927 | Ga0314311_1057607 | |||
| 1928 | Ga0316179_1096110 | |||
| 1929 | Ga0316180_1056555 | |||
| 1930 | Ga0316180_1167379 | |||
| 1931 | Ga0316183_1076598 | |||
| 1932 | Ga0316181_1197761 | |||
| 1933 | Ga0265767_100713 | |||
| 1934 | Ga0265766_1002773 | |||
| 1935 | Ga0265766_1008174 | |||
| 1936 | Ga0265764_102142 | |||
| 1937 | Ga0265769_102926 | |||
| 1938 | Ga0265768_102697 | |||
| 1939 | Ga0265774_101097 | |||
| 1940 | Ga0265331_10403822 | |||
| 1941 | Ga0265327_10054273 | |||
| 1942 | Ga0307513_10124367 | |||
| 1943 | Ga0307513_10721554 | |||
| 1944 | Ga0307408_100067624 | |||
| 1945 | Ga0307408_100141727 | |||
| 1946 | Ga0307408_101681340 | |||
| 1947 | Ga0316575_10343388 | |||
| 1948 | Ga0316578_10049623 | |||
| 1949 | Ga0307516_10433708 | |||
| 1950 | Ga0307518_10004256 | |||
| 1951 | Ga0307406_11108511 | |||
| 1952 | Ga0307412_10153493 | |||
| 1953 | Ga0307412_11948157 | |||
| 1954 | Ga0307416_100002061 | |||
| 1955 | Ga0307416_101253949 | |||
| 1956 | Ga0307416_102562250 | |||
| 1957 | Ga0307414_10043339 | |||
| 1958 | Ga0307414_10232447 | |||
| 1959 | Ga0307411_10154296 | |||
| 1960 | Ga0316585_10022471 | |||
| 1961 | Ga0316593_10000292 | |||
| 1962 | Ga0316592_1001180 | |||
| 1963 | Ga0316588_1003102 | |||
| 1964 | Ga0373936_0011451 | |||
| 1965 | Ga0316574_0168024 | |||
| 1966 | Ga0373935_0167776 | |||
| 1967 | Ga0373927_0042076 | |||
| 1968 | Ga0373933_0035625 | |||
| 1969 | Ga0373937_0072024 | |||
| 1970 | Ga0265778_035225 | |||
| 1971 | Ga0316582_0006061 | |||
| 1972 | Ga0316584_0025317 | |||
| 1973 | Ga0316584_0176768 | |||
| 1974 | Ga0373925_1493664 | |||
| 1975 | Ga0395899_0000218 | |||
| 1976 | Ga0395899_0003628 | |||
| 1977 | Ga0395899_0010178 | |||
| 1978 | Ga0395899_0028029 | |||
| 1979 | Ga0395899_0082040 | |||
| 1980 | Ga0395899_0087203 | |||
| 1981 | Ga0395899_0091713 | |||
| 1982 | Ga0395899_0354989 | |||
| 1983 | Ga0395900_0019646 | |||
| 1984 | Ga0395900_0065201 | |||
| 1985 | Ga0395900_0330458 | |||
| 1986 | Ga0395900_0571242 | |||
| 1987 | Ga0395898_0004013 | |||
| 1988 | Ga0395898_0275232 | |||
| 1989 | Ga0395898_0747121 | |||
| 1990 | Ga0395898_1310052 | |||
| 1991 | Ga0395898_1691808 | |||
| 1992 | Ga0395905_0000549 | |||
| 1993 | Ga0395905_0008603 | |||
| 1994 | Ga0395905_0012898 | |||
| 1995 | Ga0395905_0085545 | |||
| 1996 | Ga0395905_0255533 | |||
| 1997 | Ga0395905_0387422 | |||
| 1998 | Ga0395905_0686264 | |||
| 1999 | Ga0395905_1076116 | |||
| 2000 | Ga0395901_0014473 | |||
| 2001 | Ga0395901_0036377 | |||
| 2002 | Ga0395901_0065153 | |||
| 2003 | Ga0395901_0176537 | |||
| 2004 | Ga0395901_0261380 | |||
| 2005 | Ga0395901_0727674 | |||
| 2006 | Ga0395901_1557051 | |||
| 2007 | Ga0436361_0097588 | |||
| 2008 | Ga0436361_0378504 | |||
| 2009 | Ga0436361_0391791 | |||
| 2010 | Ga0436361_0394538 | |||
| 2011 | Ga0436361_0568601 | |||
| 2012 | Ga0436361_1041947 | |||
| 2013 | Ga0436362_0392850 | |||
| 2014 | Ga0436362_0937853 | |||
| 2015 | Ga0439436_0040359 | |||
| 2016 | Ga0439439_0017685 | |||
| 2017 | Ga0439453_0001276 | |||
| 2018 | Ga0439453_0017786 | |||
| 2019 | Ga0439453_0022821 | |||
| 2020 | Ga0439465_0035548 | |||
| 2021 | Ga0439465_0061840 | |||
| 2022 | Ga0451788_18078 | |||
| 2023 | Ga0451790_18219 | |||
| 2024 | Ga0451794_47388 | |||
| 2025 | Ga0451793_1577584 | |||
| 2026 | Ga0451802_1810119 | |||
| 2027 | Ga0451805_045368 | |||
| 2028 | Ga0451807_0965944 | |||
| 2029 | Ga0451833_1345593 | |||
| 2030 | Ga0451848_13097 | |||
| 2031 | Ga0451843_0537494 | |||
| 2032 | Ga0451853_2717427 | |||
| 2033 | Ga0439431_0016768 | |||
| 2034 | Ga0439433_0025440 | |||
| 2035 | Ga0439448_0036322 | |||
| 2036 | Ga0439449_0003878 | |||
| 2037 | Ga0439449_0036247 | |||
| 2038 | Ga0439452_117351 | |||
| 2039 | Ga0439454_015455 | |||
| 2040 | Ga0439454_084734 | |||
| 2041 | Ga0439455_0000425 | |||
| 2042 | Ga0439455_0028934 | |||
| 2043 | Ga0439457_056273 | |||
| 2044 | Ga0439462_0050140 | |||
| 2045 | Ga0450888_007845 | |||
| 2046 | Ga0450890_001085 | |||
| 2047 | Ga0450890_005814 | |||
| 2048 | Ga0450895_001799 | |||
| 2049 | Ga0450896_006823 | |||
| 2050 | Ga0450896_010644 | |||
| 2051 | Ga0450896_080762 | |||
| 2052 | Ga0450898_014524 | |||
| 2053 | Ga0450899_002878 | |||
| 2054 | Ga0450904_000961 | |||
| 2055 | Ga0450906_012608 | |||
| 2056 | Ga0439446_0026982 | |||
| 2057 | Ga0439458_0053937 | |||
| 2058 | Ga0439458_0120833 | |||
| 2059 | Ga0450909_031207 | |||
| 2060 | Ga0439434_0041575 | |||
| 2061 | Ga0439435_0004015 | |||
| 2062 | Ga0439464_0071151 | |||
| 2063 | Ga0439464_0181204 | |||
| 2064 | Ga0450893_0051404 | |||
| 2065 | Ga0451577_0121175 | |||
| 2066 | Ga0451577_0187466 | |||
| 2067 | Ga0451577_0256923 | |||
| 2068 | Ga0451577_0627501 | |||
| 2069 | Ga0451577_1192501 | |||
| 2070 | Ga0439440_0021857 | |||
| 2071 | Ga0453683_0003998 | |||
| 2072 | Ga0453683_0117933 | |||
| 2073 | Ga0453683_1015021 | |||
| 2074 | Ga0466965_0214040 | |||
| 2075 | Ga0466965_0472369 | |||
| 2076 | Ga0453684_0016436 | |||
| 2077 | Ga0453684_0026453 | |||
| 2078 | Ga0453684_0039050 | |||
| 2079 | Ga0453684_0055720 | |||
| 2080 | Ga0453684_0106268 | |||
| 2081 | Ga0453684_0167534 | |||
| 2082 | Ga0453684_0273428 | |||
| 2083 | Ga0453684_0422657 | |||
| 2084 | Ga0453684_1459834 | |||
| 2085 | Ga0453684_2005111 | |||
| 2086 | Ga0453684_2111979 | |||
| 2087 | Ga0453684_2230229 | |||
| 2088 | Ga0466968_0244610 | |||
| 2089 | Ga0466970_0225020 | |||
| 2090 | Ga0466957_0385424 | |||
| 2091 | Ga0466960_0701171 | |||
| 2092 | Ga0466959_0047090 | |||
| 2093 | Ga0451576_0000454 | |||
| 2094 | Ga0451576_0057306 | |||
| 2095 | Ga0451576_0077585 | |||
| 2096 | Ga0451576_0121490 | |||
| 2097 | Ga0451576_0122787 | |||
| 2098 | Ga0451576_2161912 | |||
| 2099 | Ga0466958_0378508 | |||
| 2100 | Ga0466967_0538588 | |||
| 2101 | Ga0495617_000397 | |||
| 2102 | Ga0495617_000636 | |||
| 2103 | Ga0495617_000830 | |||
| 2104 | Ga0495617_007088 | |||
| 2105 | Ga0495627_000011 | |||
| 2106 | Ga0495627_008059 | |||
| 2107 | Ga0495603_0001612 | |||
| 2108 | Ga0495603_0009392 | |||
| 2109 | Ga0495590_0000020 | |||
| 2110 | Ga0495590_0000632 | |||
| 2111 | Ga0495590_0006208 | |||
| 2112 | Ga0495590_0190191 | |||
| 2113 | Ga0495591_029494 | |||
| 2114 | Ga0495629_0007936 | |||
| 2115 | Ga0495629_0021816 | |||
| 2116 | Ga0495638_0000235 | |||
| 2117 | Ga0495638_0016045 | |||
| 2118 | Ga0495638_0077642 | |||
| 2119 | Ga0495638_0426272 | |||
| 2120 | Ga0495651_0138175 | |||
| 2121 | Ga0495653_0000067 | |||
| 2122 | Ga0495653_0004702 | |||
| 2123 | Ga0495653_0009522 | |||
| 2124 | Ga0495650_0000200 | |||
| 2125 | Ga0495650_0001809 | |||
| 2126 | Ga0495650_0002469 | |||
| 2127 | Ga0495650_0017593 | |||
| 2128 | Ga0495650_0023728 | |||
| 2129 | Ga0495580_0299480 | |||
| 2130 | Ga0495582_0005108 | |||
| 2131 | Ga0495582_0063422 | |||
| 2132 | Ga0495605_0001735 | |||
| 2133 | Ga0495605_0005449 | |||
| 2134 | Ga0495605_0010393 | |||
| 2135 | Ga0495605_0013819 | |||
| 2136 | Ga0495605_0044149 | |||
| 2137 | Ga0495605_0070705 | |||
| 2138 | Ga0495605_0191971 | |||
| 2139 | Ga0495605_0200282 | |||
| 2140 | Ga0495584_0000636 | |||
| 2141 | Ga0495584_0002002 | |||
| 2142 | Ga0495584_0023314 | |||
| 2143 | Ga0495584_0036677 | |||
| 2144 | Ga0495584_0046813 | |||
| 2145 | Ga0495584_0070356 | |||
| 2146 | Ga0495584_0248975 | |||
| 2147 | Ga0495584_0302486 | |||
| 2148 | Ga0495585_0006666 | |||
| 2149 | Ga0495585_0022456 | |||
| 2150 | Ga0495585_0025799 | |||
| 2151 | Ga0495585_0068953 | |||
| 2152 | Ga0495585_0113007 | |||
| 2153 | Ga0495585_0295478 | |||
| 2154 | Ga0495594_0050249 | |||
| 2155 | Ga0495594_0050658 | |||
| 2156 | Ga0495594_0158381 | |||
| 2157 | Ga0495594_0197851 | |||
| 2158 | Ga0495596_0001745 | |||
| 2159 | Ga0495596_0001963 | |||
| 2160 | Ga0495596_0070273 | |||
| 2161 | Ga0495596_0269906 | |||
| 2162 | Ga0495607_0019187 | |||
| 2163 | Ga0495607_0042980 | |||
| 2164 | Ga0495607_0070470 | |||
| 2165 | Ga0495607_0099229 | |||
| 2166 | Ga0495607_0339027 | |||
| 2167 | Ga0495583_0000317 | |||
| 2168 | Ga0495583_0002046 | |||
| 2169 | Ga0495583_0003152 | |||
| 2170 | Ga0495583_0004594 | |||
| 2171 | Ga0495583_0024275 | |||
| 2172 | Ga0495583_0063582 | |||
| 2173 | Ga0495583_0072580 | |||
| 2174 | Ga0495606_0000433 | |||
| 2175 | Ga0495606_0004241 | |||
| 2176 | Ga0495606_0013080 | |||
| 2177 | Ga0495606_0032750 | |||
| 2178 | Ga0495606_0035311 | |||
| 2179 | Ga0495606_0035831 | |||
| 2180 | Ga0495606_0073479 | |||
| 2181 | Ga0495606_0163349 | |||
| 2182 | Ga0495606_0189549 | |||
| 2183 | Ga0495608_0037678 | |||
| 2184 | Ga0495610_0000017 | |||
| 2185 | Ga0495610_0004520 | |||
| 2186 | Ga0495610_0035533 | |||
| 2187 | Ga0495610_0048651 | |||
| 2188 | Ga0495610_0159667 | |||
| 2189 | Ga0495616_0003800 | |||
| 2190 | Ga0495616_0018110 | |||
| 2191 | Ga0495616_0028095 | |||
| 2192 | Ga0495616_0040567 | |||
| 2193 | Ga0495616_0042318 | |||
| 2194 | Ga0495616_0091183 | |||
| 2195 | Ga0495616_0152195 | |||
| 2196 | Ga0495616_0226651 | |||
| 2197 | Ga0495616_0268671 | |||
| 2198 | Ga0495620_0001543 | |||
| 2199 | Ga0495628_0107716 | |||
| 2200 | Ga0495631_0019480 | |||
| 2201 | Ga0495631_0026488 | |||
| 2202 | Ga0495631_0040478 | |||
| 2203 | Ga0495631_0059518 | |||
| 2204 | Ga0495631_0124850 | |||
| 2205 | Ga0495631_0173872 | |||
| 2206 | Ga0495631_0292289 | |||
| 2207 | Ga0495632_0083186 | |||
| 2208 | Ga0495632_0114594 | |||
| 2209 | Ga0495632_0119983 | |||
| 2210 | Ga0495637_0001780 | |||
| 2211 | Ga0495637_0002190 | |||
| 2212 | Ga0495637_0094170 | |||
| 2213 | Ga0495637_0109372 | |||
| 2214 | Ga0495643_0002891 | |||
| 2215 | Ga0495643_0014375 | |||
| 2216 | Ga0495643_0016892 | |||
| 2217 | Ga0495643_0026159 | |||
| 2218 | Ga0495643_0040909 | |||
| 2219 | Ga0495643_0055349 | |||
| 2220 | Ga0495643_0173422 | |||
| 2221 | Ga0495644_0003110 | |||
| 2222 | Ga0495644_0047750 | |||
| 2223 | Ga0495644_0056888 | |||
| 2224 | Ga0495644_0070446 | |||
| 2225 | Ga0495644_0108082 | |||
| 2226 | Ga0495644_0187660 | |||
| 2227 | Ga0495648_0003167 | |||
| 2228 | Ga0495648_0072602 | |||
| 2229 | Ga0495663_0015755 | |||
| 2230 | Ga0495663_0032552 | |||
| 2231 | Ga0495663_0062920 | |||
| 2232 | Ga0495666_0202770 | |||
| 2233 | Ga0495642_0004003 | |||
| 2234 | Ga0495642_0005824 | |||
| 2235 | Ga0495642_0008349 | |||
| 2236 | Ga0495642_0010689 | |||
| 2237 | Ga0495642_0033338 | |||
| 2238 | Ga0495642_0037203 | |||
| 2239 | Ga0495642_0091690 | |||
| 2240 | Ga0495642_0192405 | |||
| 2241 | Ga0495642_0425179 | |||
| 2242 | Ga0495652_0019185 | |||
| 2243 | Ga0495654_0000060 | |||
| 2244 | Ga0495654_0018887 | |||
| 2245 | Ga0495654_0214561 | |||
| 2246 | Ga0495665_0099716 | |||
| 2247 | Ga0495586_0070286 | |||
| 2248 | Ga0495598_0076132 | |||
| 2249 | Ga0495609_0000007 | |||
| 2250 | Ga0495609_0005522 | |||
| 2251 | Ga0495609_0018793 | |||
| 2252 | Ga0495609_0019006 | |||
| 2253 | Ga0495609_0021767 | |||
| 2254 | Ga0495609_0026889 | |||
| 2255 | Ga0495609_0046136 | |||
| 2256 | Ga0495609_0122049 | |||
| 2257 | Ga0495597_0004273 | |||
| 2258 | Ga0495597_0007533 | |||
| 2259 | Ga0495597_0007961 | |||
| 2260 | Ga0495597_0022360 | |||
| 2261 | Ga0495597_0025313 | |||
| 2262 | Ga0495597_0050127 | |||
| 2263 | Ga0495597_0059514 | |||
| 2264 | Ga0495597_0072919 | |||
| 2265 | Ga0495597_0200339 | |||
| 2266 | Ga0495645_0153398 | |||
| 2267 | Ga0495622_0002906 | |||
| 2268 | Ga0495622_0012942 | |||
| 2269 | Ga0495622_0041061 | |||
| 2270 | Ga0495622_0086811 | |||
| 2271 | Ga0495622_0132327 | |||
| 2272 | Ga0495633_0006566 | |||
| 2273 | Ga0495633_0010195 | |||
| 2274 | Ga0495633_0017696 | |||
| 2275 | Ga0495633_0095570 | |||
| 2276 | Ga0495633_0102739 | |||
| 2277 | Ga0495633_0103686 | |||
| 2278 | Ga0495633_0232640 | |||
| 2279 | Ga0495656_0036295 | |||
| 2280 | Ga0495656_0077654 | |||
| 2281 | Ga0495656_0121688 | |||
| 2282 | Ga0495656_0266698 | |||
| 2283 | Ga0495656_0443350 | |||
| 2284 | Ga0495656_0509799 | |||
| 2285 | Ga0495668_0002640 | |||
| 2286 | Ga0495668_0005163 | |||
| 2287 | Ga0495668_0008733 | |||
| 2288 | Ga0495668_0011342 | |||
| 2289 | Ga0495668_0018916 | |||
| 2290 | Ga0495668_0034324 | |||
| 2291 | Ga0495668_0134102 | |||
| 2292 | Ga0495668_0151367 | |||
| 2293 | Ga0495668_0230437 | |||
| 2294 | Ga0495668_0581424 | |||
| 2295 | Ga0495611_0001662 | |||
| 2296 | Ga0495611_0002069 | |||
| 2297 | Ga0495611_0005909 | |||
| 2298 | Ga0495611_0007454 | |||
| 2299 | Ga0495611_0011467 | |||
| 2300 | Ga0495611_0020577 | |||
| 2301 | Ga0495611_0031470 | |||
| 2302 | Ga0495611_0115559 | |||
| 2303 | Ga0495625_0011213 | |||
| 2304 | Ga0495625_0016652 | |||
| 2305 | Ga0495625_0042626 | |||
| 2306 | Ga0495625_0125775 | |||
| 2307 | Ga0495625_0176951 | |||
| 2308 | Ga0495625_0288542 | |||
| 2309 | Ga0495625_0311060 | |||
| 2310 | Ga0495635_0008977 | |||
| 2311 | Ga0495635_0074819 | |||
| 2312 | Ga0495659_0118099 | |||
| 2313 | Ga0495661_0022142 | |||
| 2314 | Ga0495661_0048413 | |||
| 2315 | Ga0495661_0152056 | |||
| 2316 | Ga0495661_0178330 | |||
| 2317 | Ga0495661_0196882 | |||
| 2318 | Ga0495661_0203066 | |||
| 2319 | Ga0495661_0222381 | |||
| 2320 | Ga0495661_0297574 | |||
| 2321 | Ga0495661_0455057 | |||
| 2322 | Ga0495588_0009027 | |||
| 2323 | Ga0495588_0022754 | |||
| 2324 | Ga0495588_0038295 | |||
| 2325 | Ga0495588_0067691 | |||
| 2326 | Ga0495588_0094469 | |||
| 2327 | Ga0495588_0143878 | |||
| 2328 | Ga0495588_0178690 | |||
| 2329 | Ga0495588_0496985 | |||
| 2330 | Ga0495599_0001590 | |||
| 2331 | Ga0495623_0182525 | |||
| 2332 | Ga0495623_0460627 | |||
| 2333 | Ga0495646_0168697 | |||
| 2334 | Ga0495658_0568452 | |||
| 2335 | Ga0495669_0001596 | |||
| 2336 | Ga0495669_0002717 | |||
| 2337 | Ga0495669_0099817 | |||
| 2338 | Ga0495669_0183569 | |||
| 2339 | Ga0495669_0345104 | |||
| 2340 | Ga0495624_0133574 | |||
| 2341 | Ga0495670_0004991 | |||
| 2342 | Ga0495670_0031340 | |||
| 2343 | Ga0495670_0055789 | |||
| 2344 | Ga0495670_0226206 | |||
| 2345 | Ga0495670_0252952 | |||
| 2346 | Ga0495670_0344114 | |||
| 2347 | Ga0495670_0658991 | |||
| 2348 | Ga0495671_0000037 | |||
| 2349 | Ga0495671_0005005 | |||
| 2350 | Ga0495649_0007567 | |||
| 2351 | Ga0495649_0066300 | |||
| 2352 | Ga0495649_0141389 | |||
| 2353 | Ga0495649_0186833 | |||
| 2354 | Ga0495649_0622906 | |||
| 2355 | Ga0495589_0030733 | |||
| 2356 | Ga0495589_0037560 | |||
| 2357 | Ga0495589_0053829 | |||
| 2358 | Ga0495589_0147423 | |||
| 2359 | Ga0495589_0156814 | |||
| 2360 | Ga0495589_0177111 | |||
| 2361 | Ga0495600_0112057 | |||
| 2362 | Ga0495660_0007547 | |||
| 2363 | Ga0495660_0010186 | |||
| 2364 | Ga0495660_0011018 | |||
| 2365 | Ga0495660_0015683 | |||
| 2366 | Ga0495660_0030532 | |||
| 2367 | Ga0495660_0034825 | |||
| 2368 | Ga0495660_0116918 | |||
| 2369 | Ga0495660_0153779 | |||
| 2370 | Ga0495660_0231960 | |||
| 2371 | Ga0495660_0363178 | |||
| 2372 | Ga0495660_0444407 | |||
| 2373 | Ga0495581_0101745 | |||
| 2374 | Ga0495604_0010101 | |||
| 2375 | Ga0495604_0063319 | |||
| 2376 | Ga0495636_0001434 | |||
| 2377 | Ga0495636_0003890 | |||
| 2378 | Ga0495636_0178191 | |||
| 2379 | Ga0495636_0207313 | |||
| 2380 | Ga0495674_0009303 | |||
| 2381 | Ga0495672_0000013 | |||
| 2382 | Ga0495672_0000157 | |||
| 2383 | Ga0495672_0007686 | |||
| 2384 | Ga0495672_0016220 | |||
| 2385 | Ga0495672_0021784 | |||
| 2386 | Ga0495672_0449087 | |||
| 2387 | Ga0495676_0004545 | |||
| 2388 | Ga0495676_0024323 | |||
| 2389 | Ga0495676_0303356 | |||
| 2390 | Ga0495680_0387251 | |||
| 2391 | Ga0495683_0003225 | |||
| 2392 | Ga0495683_0014031 | |||
| 2393 | Ga0495683_0057199 | |||
| 2394 | Ga0495683_0070987 | |||
| 2395 | Ga0495683_0074576 | |||
| 2396 | Ga0495683_0141996 | |||
| 2397 | Ga0495683_0363683 | |||
| 2398 | Ga0495687_000342 | |||
| 2399 | Ga0495687_001562 | |||
| 2400 | Ga0495687_002781 | |||
| 2401 | Ga0495687_002921 | |||
| 2402 | Ga0495687_007470 | |||
| 2403 | Ga0495675_0072153 | |||
| 2404 | Ga0495675_0622080 | |||
| 2405 | Ga0495677_0001866 | |||
| 2406 | Ga0495677_0016634 | |||
| 2407 | Ga0495677_0032598 | |||
| 2408 | Ga0495677_0035931 | |||
| 2409 | Ga0495677_0037415 | |||
| 2410 | Ga0495677_0037798 | |||
| 2411 | Ga0495677_0114905 | |||
| 2412 | Ga0495679_006474 | |||
| 2413 | Ga0495679_008349 | |||
| 2414 | Ga0495679_034795 | |||
| 2415 | Ga0495685_000291 | |||
| 2416 | Ga0495685_001965 | |||
| 2417 | Ga0495685_014389 | |||
| 2418 | Ga0495685_036127 | |||
| 2419 | Ga0495685_063448 | |||
| 2420 | Ga0495685_082500 | |||
| 2421 | Ga0495673_0000248 | |||
| 2422 | Ga0495673_0017349 | |||
| 2423 | Ga0495673_0038455 | |||
| 2424 | Ga0495681_0011744 | |||
| 2425 | Ga0495681_0012224 | |||
| 2426 | Ga0495681_0124392 | |||
| 2427 | Ga0495686_0007683 | |||
| 2428 | Ga0495686_0010875 | |||
| 2429 | Ga0495686_0012785 | |||
| 2430 | Ga0495686_0018441 | |||
| 2431 | Ga0495686_0021073 | |||
| 2432 | Ga0495686_0061812 | |||
| 2433 | Ga0495686_0062817 | |||
| 2434 | Ga0495686_0088035 | |||
| 2435 | Ga0495593_0002955 | |||
| 2436 | Ga0495593_0073060 | |||
| 2437 | Ga0495602_0044651 | |||
| 2438 | Ga0495614_0054920 | |||
| 2439 | Ga0495614_0111517 | |||
| 2440 | Ga0495615_0009239 | |||
| 2441 | Ga0495615_0009700 | |||
| 2442 | Ga0495615_0170160 | |||
| 2443 | Ga0495626_0000227 | |||
| 2444 | Ga0495626_0002147 | |||
| 2445 | Ga0495626_0014493 | |||
| 2446 | Ga0495626_0037979 | |||
| 2447 | Ga0495626_0081138 | |||
| 2448 | Ga0495626_0095315 | |||
| 2449 | Ga0495626_0107363 | |||
| 2450 | Ga0496100_0014114 | |||
| 2451 | Ga0496100_0246173 | |||
| 2452 | Ga0496101_0160023 | |||
| 2453 | Ga0496102_0219122 | |||
| 2454 | Ga0496102_0222236 | |||
| 2455 | Ga0496102_0240111 | |||
| 2456 | Ga0496103_0020711 | |||
| 2457 | Ga0496103_0061076 | |||
| 2458 | Ga0496103_0116859 | |||
| 2459 | Ga0496103_0135193 | |||
| 2460 | Ga0496103_0365428 | |||
| 2461 | Ga0496104_0278667 | |||
| 2462 | Ga0496105_0266761 | |||
| 2463 | Ga0496105_0809280 | |||
| 2464 | Ga0496107_0210280 | |||
| 2465 | Ga0496107_0273009 | |||
| 2466 | Ga0496108_0443772 | |||
| 2467 | Ga0496108_0847322 | |||
| 2468 | Ga0496109_0344021 | |||
| 2469 | Ga0496109_0855448 | |||
| 2470 | Ga0496109_0885436 | |||
| 2471 | Ga0496109_0912647 | |||
| 2472 | Ga0496110_0458359 | |||
| 2473 | Ga0496110_0508332 | |||
| 2474 | Ga0496110_0900611 | |||
| 2475 | Ga0496112_0288436 | |||
| 2476 | Ga0496113_0180677 | |||
| 2477 | Ga0496113_0503465 | |||
| 2478 | Ga0496114_0010053 | |||
| 2479 | Ga0496114_0041004 | |||
| 2480 | Ga0496115_0050480 | |||
| 2481 | Ga0496115_0864800 | |||
| 2482 | Ga0496116_0020766 | |||
| 2483 | Ga0496116_0030638 | |||
| 2484 | Ga0496116_0325888 | |||
| 2485 | Ga0496117_0000005 | |||
| 2486 | Ga0496118_0000031 | |||
| 2487 | Ga0496121_0004491 | |||
| 2488 | Ga0496121_0079639 | |||
| 2489 | Ga0496121_0157732 | |||
| 2490 | Ga0496121_0274189 | |||
| 2491 | Ga0496121_0369833 | |||
| 2492 | Ga0496121_0446598 | |||
| 2493 | Ga0496122_0000968 | |||
| 2494 | Ga0496122_0005873 | |||
| 2495 | Ga0496122_0111660 | |||
| 2496 | Ga0496122_0158956 | |||
| 2497 | Ga0496122_0239113 | |||
| 2498 | Ga0496123_0004825 | |||
| 2499 | Ga0496123_0005104 | |||
| 2500 | Ga0496123_0076261 | |||
| 2501 | Ga0496123_0194868 | |||
| 2502 | Ga0496123_0364699 | |||
| 2503 | Ga0496124_0009077 | |||
| 2504 | Ga0496124_0232737 | |||
| 2505 | Ga0496124_0706698 | |||
| 2506 | Ga0496125_0009685 | |||
| 2507 | Ga0496125_0040571 | |||
| 2508 | Ga0496125_0128609 | |||
| 2509 | Ga0496126_0004622 | |||
| 2510 | Ga0496126_0804974 | |||
| 2511 | Ga0496126_1154987 | |||
| 2512 | Ga0496126_1182482 | |||
| 2513 | Ga0501306_000005 | |||
| 2514 | Ga0501306_000907 | |||
| 2515 | Ga0501306_000979 | |||
| 2516 | Ga0501306_001799 | |||
| 2517 | Ga0501306_064535 | |||
| 2518 | Ga0501308_000002 | |||
| 2519 | Ga0501308_000177 | |||
| 2520 | Ga0501308_004281 | |||
| 2521 | Ga0501308_019194 | |||
| 2522 | Ga0501308_053997 | |||
| 2523 | Ga0501308_068015 | |||
| 2524 | Ga0501309_000053 | |||
| 2525 | Ga0501309_011451 | |||
| 2526 | Ga0501309_043262 | |||
| 2527 | Ga0501309_045031 | |||
| 2528 | Ga0501309_078610 | |||
| 2529 | Ga0501310_000065 | |||
| 2530 | Ga0501310_001577 | |||
| 2531 | Ga0501310_003240 | |||
| 2532 | Ga0501310_012046 | |||
| 2533 | Ga0501310_045131 | |||
| 2534 | Ga0501341_01880 | |||
| 2535 | Ga0501341_06842 | |||
| 2536 | Ga0501343_000946 | |||
| 2537 | Ga0501343_008820 | |||
| 2538 | Ga0501344_08525 | |||
| 2539 | Ga0501304_000001 | |||
| 2540 | Ga0501304_000110 | |||
| 2541 | Ga0501304_001659 | |||
| 2542 | Ga0501305_000399 | |||
| 2543 | Ga0501305_002400 | |||
| 2544 | Ga0501305_009251 | |||
| 2545 | Ga0501305_009815 | |||
| 2546 | Ga0501305_018025 | |||
| 2547 | Ga0501305_115993 | |||
| 2548 | Ga0501307_000583 | |||
| 2549 | Ga0501307_001509 | |||
| 2550 | Ga0501307_002501 | |||
| 2551 | Ga0501307_004640 | |||
| 2552 | Ga0501307_007975 | |||
| 2553 | Ga0501307_017346 | |||
| 2554 | Ga0501307_050237 | |||
| 2555 | Ga0501307_083358 | |||
| 2556 | Ga0501342_01262 | |||
| 2557 | Ga0495678_000010 | |||
| 2558 | Ga0495678_006449 | |||
| 2559 | Ga0495678_006909 | |||
| 2560 | Ga0495678_063342 | |||
| 2561 | Ga0495682_0003087 | |||
| 2562 | Ga0495682_0035772 | |||
| 2563 | Ga0495682_0049156 | |||
| 2564 | Ga0501298_029220 | |||
| 2565 | Ga0501298_100889 | |||
| 2566 | Ga0501300_024434 | |||
| 2567 | Ga0501303_006645 | |||
| 2568 | Ga0501311_000002 | |||
| 2569 | Ga0501311_006367 | |||
| 2570 | Ga0501311_034960 | |||
| 2571 | Ga0501311_036217 | |||
| 2572 | Ga0501312_001195 | |||
| 2573 | Ga0501312_002982 | |||
| 2574 | Ga0501312_005276 | |||
| 2575 | Ga0501312_006751 | |||
| 2576 | Ga0501312_031628 | |||
| 2577 | Ga0501312_039196 | |||
| 2578 | Ga0501312_076553 | |||
| 2579 | Ga0501312_092049 | |||
| 2580 | Ga0501313_000012 | |||
| 2581 | Ga0501313_000495 | |||
| 2582 | Ga0501314_009484 | |||
| 2583 | Ga0501314_039418 | |||
| 2584 | Ga0501314_045646 | |||
| 2585 | Ga0501315_000004 | |||
| 2586 | Ga0501315_000082 | |||
| 2587 | Ga0501315_003410 | |||
| 2588 | Ga0501315_009644 | |||
| 2589 | Ga0501315_014533 | |||
| 2590 | Ga0501315_052771 | |||
| 2591 | Ga0501315_070240 | |||
| 2592 | Ga0501316_000002 | |||
| 2593 | Ga0501316_000608 | |||
| 2594 | Ga0501316_003898 | |||
| 2595 | Ga0501317_031813 | |||
| 2596 | Ga0501318_000040 | |||
| 2597 | Ga0501318_000292 | |||
| 2598 | Ga0501318_011949 | |||
| 2599 | Ga0501319_000218 | |||
| 2600 | Ga0501320_000368 | |||
| 2601 | Ga0501320_000545 | |||
| 2602 | Ga0501320_003268 | |||
| 2603 | Ga0501320_005185 | |||
| 2604 | Ga0501320_006733 | |||
| 2605 | Ga0501320_011519 | |||
| 2606 | Ga0501320_012652 | |||
| 2607 | Ga0501320_022714 | |||
| 2608 | Ga0501320_025409 | |||
| 2609 | Ga0501320_029270 | |||
| 2610 | Ga0501320_046014 | |||
| 2611 | Ga0501321_006362 | |||
| 2612 | Ga0501321_039989 | |||
| 2613 | Ga0501322_000643 | |||
| 2614 | Ga0501322_015523 | |||
| 2615 | Ga0501322_022367 | |||
| 2616 | Ga0501323_000789 | |||
| 2617 | Ga0501323_002509 | |||
| 2618 | Ga0501323_006202 | |||
| 2619 | Ga0501323_009479 | |||
| 2620 | Ga0501323_028666 | |||
| 2621 | Ga0501323_038612 | |||
| 2622 | Ga0501324_002702 | |||
| 2623 | Ga0501324_006256 | |||
| 2624 | Ga0501324_010219 | |||
| 2625 | Ga0501324_012262 | |||
| 2626 | Ga0501324_014045 | |||
| 2627 | Ga0501324_018192 | |||
| 2628 | Ga0501325_012167 | |||
| 2629 | Ga0501327_07127 | |||
| 2630 | Ga0501327_09548 | |||
| 2631 | Ga0501328_02722 | |||
| 2632 | Ga0501329_00384 | |||
| 2633 | Ga0501329_09108 | |||
| 2634 | Ga0501330_008961 | |||
| 2635 | Ga0501334_01100 | |||
| 2636 | Ga0501334_01285 | |||
| 2637 | Ga0501335_000610 | |||
| 2638 | Ga0501335_004710 | |||
| 2639 | Ga0501335_029831 | |||
| 2640 | Ga0501335_040321 | |||
| 2641 | Ga0501336_000167 | |||
| 2642 | Ga0501336_004393 | |||
| 2643 | Ga0501336_015269 | |||
| 2644 | Ga0501337_001443 | |||
| 2645 | Ga0501337_003490 | |||
| 2646 | Ga0501337_003553 | |||
| 2647 | Ga0501338_00312 | |||
| 2648 | Ga0501338_02956 | |||
| 2649 | Ga0501338_05013 | |||
| 2650 | Ga0501340_011180 | |||
| 2651 | Ga0501340_027943 | |||
| 2652 | Ga0501031_0093307 | |||
| 2653 | Ga0501031_0199569 | |||
| 2654 | Ga0501032_0005689 | |||
| 2655 | Ga0501032_0483829 | |||
| 2656 | Ga0501033_0001803 | |||
| 2657 | Ga0501033_0020233 | |||
| 2658 | Ga0501034_0029030 | |||
| 2659 | Ga0501034_0080413 | |||
| 2660 | Ga0501034_0150364 | |||
| 2661 | Ga0501036_0085603 | |||
| 2662 | Ga0501036_1644218 | |||
| 2663 | Ga0501037_0029069 | |||
| 2664 | Ga0501037_0087529 | |||
| 2665 | Ga0501037_0421680 | |||
| 2666 | Ga0501038_0004562 | |||
| 2667 | Ga0501038_0476077 | |||
| 2668 | Ga0501039_0576058 | |||
| 2669 | Ga0501043_0044507 | |||
| 2670 | Ga0501043_0093617 | |||
| 2671 | Ga0501046_0047608 | |||
| 2672 | Ga0501067_0533348 | |||
| 2673 | Ga0501072_0008088 | |||
| 2674 | Ga0501073_0203968 | |||
| 2675 | Ga0501073_0562883 | |||
| 2676 | Ga0501076_0818064 | |||
| 2677 | Ga0501077_0209868 | |||
| 2678 | Ga0501222_031301 | |||
| 2679 | Ga0501227_014322 | |||
| 2680 | Ga0501233_080366 | |||
| 2681 | Ga0501235_045772 | |||
| 2682 | Ga0501238_000213 | |||
| 2683 | Ga0501238_008550 | |||
| 2684 | Ga0501249_010943 | |||
| 2685 | Ga0501253_098313 | |||
| 2686 | Ga0501229_003004 | |||
| 2687 | Ga0501079_0160362 | |||
| 2688 | Ga0501241_041689 | |||
| 2689 | Ga0501263_084735 | |||
| 2690 | Ga0501269_000003 | |||
| 2691 | Ga0501279_002045 | |||
| 2692 | Ga0501279_007866 | |||
| 2693 | Ga0501035_0010452 | |||
| 2694 | Ga0501035_0136330 | |||
| 2695 | Ga0501044_0007653 | |||
| 2696 | nmdc:mga03683_14381_c1 | |||
| 2697 | nmdc:mga0k408_17134_c1 | |||
| 2698 | nmdc:mga0k408_255163_c1 | |||
| 2699 | nmdc:mga07m45_166976_c1 | |||
| 2700 | nmdc:mga07m45_398_c1 | |||
| 2701 | nmdc:mga07m45_87196_c1 | |||
| 2702 | nmdc:mga05p37_217522_c1 | |||
| 2703 | Ga0495601_0585866 | |||
| 2704 | Ga0500594_0101680 | |||
| 2705 | Ga0500618_002645 | |||
| 2706 | Ga0500618_040633 | |||
| 2707 | Ga0500574_000403 | |||
| 2708 | Ga0500586_012856 | |||
| 2709 | Ga0500616_0013527 | |||
| 2710 | Ga0501084_0089581 | |||
| 2711 | Ga0587084_000213 | |||
| 2712 | Ga0587084_000401 | |||
| 2713 | Ga0587084_003559 | |||
| 2714 | Ga0587084_026492 | |||
| 2715 | Ga0587084_047284 | |||
| 2716 | Ga0587084_091296 | |||
| 2717 | Ga0587084_117374 | |||
| 2718 | Ga0587093_000380 | |||
| 2719 | Ga0587093_001062 | |||
| 2720 | Ga0587093_006615 | |||
| 2721 | Ga0587093_006649 | |||
| 2722 | Ga0587093_033107 | |||
| 2723 | Ga0587066_064419 | |||
| 2724 | Ga0587066_064420 | |||
| 2725 | Ga0587070_064009 | |||
| 2726 | Ga0587070_068596 | |||
| 2727 | Ga0587073_0000035 | |||
| 2728 | Ga0587077_001525 | |||
| 2729 | Ga0587077_009258 | |||
| 2730 | Ga0587077_014029 | |||
| 2731 | Ga0587077_034721 | |||
| 2732 | Ga0587077_223544 | |||
| 2733 | Ga0587080_022409 | |||
| 2734 | Ga0587080_056073 | |||
| 2735 | Ga0587080_056074 | |||
| 2736 | Ga0587082_004457 | |||
| 2737 | Ga0587082_008271 | |||
| 2738 | Ga0587082_024618 | |||
| 2739 | Ga0587082_065628 | |||
| 2740 | Ga0587083_0007825 | |||
| 2741 | Ga0587083_0011898 | |||
| 2742 | Ga0587083_0088084 | |||
| 2743 | Ga0587083_0193213 | |||
| 2744 | Ga0587085_012368 | |||
| 2745 | Ga0587085_048607 | |||
| 2746 | Ga0587086_000753 | |||
| 2747 | Ga0587086_048491 | |||
| 2748 | Ga0587086_082925 | |||
| 2749 | Ga0587088_001117 | |||
| 2750 | Ga0587088_041644 | |||
| 2751 | Ga0587088_063898 | |||
| 2752 | Ga0587089_000565 | |||
| 2753 | Ga0587089_009810 | |||
| 2754 | Ga0587089_023489 | |||
| 2755 | Ga0587089_075285 | |||
| 2756 | Ga0587090_001908 | |||
| 2757 | Ga0587090_051986 | |||
| 2758 | Ga0587090_052046 | |||
| 2759 | Ga0587090_108649 | |||
| 2760 | Ga0587091_002949 | |||
| 2761 | Ga0587091_073030 | |||
| 2762 | Ga0587091_073148 | |||
| 2763 | Ga0587091_101709 | |||
| 2764 | Ga0587092_000969 | |||
| 2765 | Ga0587092_008630 | |||
| 2766 | Ga0587092_042166 | |||
| 2767 | Ga0587092_050322 | |||
| 2768 | Ga0587094_015441 | |||
| 2769 | Ga0587094_016778 | |||
| 2770 | Ga0587094_097379 | |||
| 2771 | Ga0587097_00549 | |||
| 2772 | Ga0587098_004256 | |||
| 2773 | Ga0587106_001550 | |||
| 2774 | Ga0587125_002919 | |||
| 2775 | Ga0587099_000239 | |||
| 2776 | Ga0587101_002644 | |||
| 2777 | Ga0587101_023534 | |||
| 2778 | Ga0587101_042527 | |||
| 2779 | Ga0587109_003197 | |||
| 2780 | Ga0587113_000311 | |||
| 2781 | Ga0587115_010663 | |||
| 2782 | Ga0587115_096841 | |||
| 2783 | Ga0587117_011034 | |||
| 2784 | Ga0587117_038563 | |||
| 2785 | Ga0587127_004393 | |||
| 2786 | Ga0587128_011641 | |||
| 2787 | Ga0587062_000153 | |||
| 2788 | Ga0587062_000195 | |||
| 2789 | Ga0587062_002195 | |||
| 2790 | Ga0587062_032496 | |||
| 2791 | Ga0587062_040726 | |||
| 2792 | Ga0587067_026739 | |||
| 2793 | Ga0587068_000350 | |||
| 2794 | Ga0587068_001305 | |||
| 2795 | Ga0587068_002203 | |||
| 2796 | Ga0587068_080234 | |||
| 2797 | Ga0587068_100300 | |||
| 2798 | Ga0587068_125316 | |||
| 2799 | Ga0587069_063455 | |||
| 2800 | Ga0587072_000243 | |||
| 2801 | Ga0587072_005559 | |||
| 2802 | Ga0587072_066500 | |||
| 2803 | Ga0587072_066501 | |||
| 2804 | Ga0587072_072842 | |||
| 2805 | Ga0587075_044338 | |||
| 2806 | Ga0587076_002988 | |||
| 2807 | Ga0587076_012405 | |||
| 2808 | Ga0587076_012406 | |||
| 2809 | Ga0587076_013020 | |||
| 2810 | Ga0587076_047966 | |||
| 2811 | Ga0587076_138571 | |||
| 2812 | Ga0587076_154746 | |||
| 2813 | Ga0587078_016824 | |||
| 2814 | Ga0587078_051400 | |||
| 2815 | Ga0587079_000584 | |||
| 2816 | Ga0587079_006516 | |||
| 2817 | Ga0587079_011451 | |||
| 2818 | Ga0587079_037243 | |||
| 2819 | Ga0587100_001488 | |||
| 2820 | Ga0587100_003223 | |||
| 2821 | Ga0587100_007445 | |||
| 2822 | Ga0587102_000132 | |||
| 2823 | Ga0587104_000049 | |||
| 2824 | Ga0587107_001789 | |||
| 2825 | Ga0587107_006131 | |||
| 2826 | Ga0587107_043660 | |||
| 2827 | Ga0587107_098143 | |||
| 2828 | Ga0587108_000210 | |||
| 2829 | Ga0587114_007269 | |||
| 2830 | Ga0587116_02402 | |||
| 2831 | Ga0587118_01521 | |||
| 2832 | Ga0587118_11699 | |||
| 2833 | Ga0587119_023436 | |||
| 2834 | Ga0587120_002973 | |||
| 2835 | Ga0587124_001813 | |||
| 2836 | Ga0587124_014179 | |||
| 2837 | Ga0587124_029558 | |||
| 2838 | Ga0587060_000715 | |||
| 2839 | Ga0587060_006105 | |||
| 2840 | Ga0587096_00279 | |||
| 2841 | Ga0587071_001373 | |||
| 2842 | Ga0587071_043674 | |||
| 2843 | Ga0587071_071506 | |||
| 2844 | Ga0587071_071662 | |||
| 2845 | Ga0587111_0000229 | |||
| 2846 | Ga0587111_0000781 | |||
| 2847 | Ga0587111_0007805 | |||
| 2848 | Ga0587111_0008023 | |||
| 2849 | Ga0587111_0020048 | |||
| 2850 | Ga0587111_0096385 | |||
| 2851 | Ga0587111_0157547 | |||
| 2852 | Ga0587111_0180594 | |||
| 2853 | Ga0587111_0189494 | |||
| 2854 | 2511247454 | |||
| 2855 | 2511384335 | |||
| 2856 | 2521560874 | |||
| 2857 | 2548501398 | |||
| 2858 | 2550696684 | |||
| 2859 | 2553007583 | |||
| 2860 | 2601667016 | |||
| 2861 | 2643792081 | |||
| 2862 | 2643799424 | |||
| 2863 | 2643868380 | |||
| 2864 | 2643994491 | |||
| 2865 | 2644026938 | |||
| 2866 | 2644061505 | |||
| 2867 | 2644075037 | |||
| 2868 | 2644163760 | |||
| 2869 | 2644216438 | |||
| 2870 | 2644247750 | |||
| 2871 | 2644254812 | |||
| 2872 | 2644295316 | |||
| 2873 | 2644360373 | |||
| 2874 | 2644471517 | |||
| 2875 | 2644649057 | |||
| 2876 | 2722886127 | |||
| 2877 | 2738738121 | |||
| 2878 | 2738826784 | |||
| 2879 | 2738843081 | |||
| 2880 | 2739150581 | |||
| 2881 | 2739192500 | |||
| 2882 | 2739243206 | |||
| 2883 | 2739273832 | |||
| 2884 | 2739318977 | |||
| 2885 | 2739337218 | |||
| 2886 | 2739342876 | |||
| 2887 | 2765567308 | |||
| 2888 | 2808984219 | |||
| 2889 | 2809132023 | |||
| 2890 | 2809145897 | |||
| 2891 | 2809151646 | |||
| 2892 | 2816473781 | |||
| 2893 | 2819543890 | |||
| 2894 | 2819594350 | |||
| 2895 | 2819618745 | |||
| 2896 | 2821135880 | |||
| 2897 | 2839095393 | |||
| 2898 | 2839144215 | |||
| 2899 | 2842712342 | |||
| 2900 | 2842722289 | |||
| 2901 | 2852622894 | |||
| 2902 | 2857549061 | |||
| 2903 | 2857556286 | |||
| 2904 | 2857560797 | |||
| 2905 | 2857567996 | |||
| 2906 | 2881104313 | |||
| 2907 | 2884811930 | |||
| 2908 | 2884840748 | |||
| 2909 | 2884857656 | |||
| 2910 | 2885084375 | |||
| 2911 | 2885197770 | |||
| 2912 | 2891635731 | |||
| 2913 | 2894023740 | |||
| 2914 | 2896158596 | |||
| 2915 | 2904428888 | |||
| 2916 | 2904442511 | |||
| 2917 | 2904533769 | |||
| 2918 | 2904589394 | |||
| 2919 | 2904595097 | |||
| 2920 | 2904602401 | |||
| 2921 | 2919050749 | |||
| 2922 | 2919084944 | |||
| 2923 | 2919476952 | |||
| 2924 | 2923514715 | |||
| 2925 | 2928135683 | |||
| 2926 | 2932416111 | |||
| 2927 | 2932422213 | |||
| 2928 | 2954769598 | |||
| 2929 | 2974320958 | |||
| 2930 | 2990715407 | |||
| 2931 | 639788565 | |||
| 2932 | 8047676082 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pdb-assembly1.cif.gz_A | crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer | 0.9813 | 4 | 131 |
| 7m4u-assembly1.cif.gz_h | a. baumannii ribosome-eravacycline complex: 30s | 0.9756 | 2 | 131 |
| 3j9y-assembly1.cif.gz_h | cryo-em structure of tetracycline resistance protein tetm bound to a translating e.coli ribosome | 0.9743 | 2 | 131 |
| 7unu-assembly1.cif.gz_h | pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) | 0.9736 | 2 | 131 |
| 5uyl-assembly1.cif.gz_H | 70s ribosome bound with cognate ternary complex base-paired to a site codon (structure ii) | 0.9688 | 2 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9789 | 74 | 131 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9761 | 74 | 131 | 3.30.1490.10 |
| 4pdbA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.9648 | 4 | 73 | 3.30.1370.30 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9627 | 74 | 131 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.96 | 74 | 131 | 3.30.1490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2TVS9-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.999 | 15 | 131 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A352KI84-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9933 | 63 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A435JWK2-F1-model_v4 | deleted | 0.9933 | 63 | 131 |
|
| AF-A0A351BDG7-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9926 | 63 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-E4Z9Z8-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9922 | 27 | 131 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |