F494145

General Info

Members Datasets Scaffolds Average Seq Length
1463 522 2926 129

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1516371|Ga0451793_1516371_20_499
Length 159
Sequence MAGSDHPQSIVQRQDGDSDLQQFQLSIGTKTMRHQKSGRKFNRTSAHRQAMFSNMAASLFKHELIKTTLPKAKELRRVAEPLITIAKVDGVANRRLAFSRLRDKEAVGKLFVELGPRYQSRPGGYLRILKCGFRAGDNAPMAYVELVDRPTSIAEEVAE

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
25 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
45 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
46 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
168 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
169 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
170 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
185 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
187 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
188 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
259 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
260 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
272 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
280 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
281 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
282 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
283 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
284 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
285 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
286 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
287 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
288 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
289 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
290 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
291 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
293 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
294 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
295 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
296 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
297 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
298 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
299 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
300 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
303 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
306 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
307 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
310 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
311 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
312 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
313 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
314 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
316 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
322 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
323 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
324 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
325 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
326 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
329 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
332 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
333 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
334 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
335 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
336 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
337 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
338 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
339 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
340 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
341 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
342 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
343 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
344 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
345 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
349 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
350 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
351 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
352 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
353 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
354 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
355 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
356 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
357 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
358 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
359 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
360 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
361 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
362 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
363 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
364 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
365 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
366 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
367 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
368 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
369 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
370 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
371 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
372 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
373 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
374 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
375 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
376 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
377 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
378 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
379 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
380 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
381 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
382 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
383 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
384 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
385 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
386 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
387 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
388 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
389 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
390 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
391 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
392 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
393 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
394 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
395 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
396 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
397 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
398 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
399 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
400 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
401 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
402 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
403 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
404 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
405 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
406 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
407 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
408 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
409 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
410 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
411 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
412 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
413 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
414 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
415 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
416 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
417 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
418 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
419 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
420 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
421 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
422 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
423 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
424 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
425 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
426 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
427 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
428 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
429 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
430 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
431 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
434 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
435 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
436 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
437 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
438 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
439 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
440 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
441 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
442 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
443 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
444 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
445 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
446 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
447 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
448 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
449 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
450 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
451 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
452 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
453 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
454 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
455 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
458 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
474 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
475 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
497 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
498 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
499 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
503 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
504 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
505 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
506 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
510 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
511 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
512 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
513 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
514 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
515 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
516 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
517 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
518 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
519 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
520 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.09
Metatranscriptomes 9.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 0.55
Rhizoplane 2.94
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_1516371 3300041452 Bacteria 1076
2 MRS2a_Contig_30 2124908027 Bacteria 50483
3 SwRhRL2b_contig_1764583 2162886007 Bacteria 1193
4 JGI24736J21556_1002338 3300001904 Bacteria 3353
5 JGI24741J21665_1002066 3300001915 Bacteria 5375
6 JGI24740J21852_10005249 3300001979 Bacteria 5499
7 JGI24739J22299_10000118 3300001989 Bacteria 24899
8 JGI24737J22298_10000685 3300001990 Bacteria 11898
9 JGI24737J22298_10004035 3300001990 Bacteria 5132
10 JGI24737J22298_10129025 3300001990 Bacteria 747
11 JGI24735J21928_10007003 3300002067 Bacteria 3685
12 JGI24735J21928_10080256 3300002067 Bacteria 934
13 JGI24744J21845_10044038 3300002077 Bacteria 830
14 JGI25156J39149_1005142 3300002705 Bacteria 3844
15 JGI25162J39368_1001066 3300002737 Bacteria 16772
16 JGI25162J39368_1002454 3300002737 Bacteria 7175
17 JGI25162J39368_1004075 3300002737 Bacteria 3637
18 JGI25154J39366_1007603 3300002738 Bacteria 1465
19 JGI25157J39369_1002937 3300002741 Bacteria 3776
20 JGI25163J39215_1000088 3300002771 Bacteria 38934
21 JGI25164J39214_1000264 3300002772 Bacteria 38934
22 JGI25164J39214_1000535 3300002772 Bacteria 17725
23 JGI25164J39214_1000666 3300002772 Bacteria 14014
24 JGI25152J39213_1000284 3300002773 Bacteria 33794
25 JGI25152J39213_1001094 3300002773 Bacteria 12721
26 JGI25152J39213_1031566 3300002773 Bacteria 812
27 JGI25150J39212_1000359 3300002774 Bacteria 22362
28 JGI25151J46595_10000895 3300003187 Bacteria 23452
29 JGI25165J46597_1001865 3300003214 Bacteria 8677
30 JGI25165J46597_1004381 3300003214 Bacteria 3055
31 JGI25153J46596_10000050 3300003215 Bacteria 140710
32 rootH2_10027207 3300003320 Bacteria 14900
33 rootH1_10017276 3300003323 Bacteria 33770
34 JGI26145J50221_1003575 3300003371 Bacteria 1241
35 Ga0006556J51387_1030839 3300003479 Bacteria 3475
36 Ga0006558J51389_1019524 3300003558 Bacteria 3457
37 Ga0006560J51390_1017170 3300003565 Bacteria 14049
38 Ga0006554J51385_1017088 3300003567 Bacteria 14046
39 Ga0006554J51385_1021904 3300003567 Bacteria 3529
40 Ga0006562J51391_1006869 3300003578 Bacteria 31335
41 Ga0006562J51391_1006870 3300003578 Bacteria 810
42 Ga0006562J51391_1017069 3300003578 Bacteria 3330
43 Ga0006562J51391_1017070 3300003578 Bacteria 650
44 Ga0055538_1000042 3300003751 Bacteria 164754
45 Ga0055538_1000183 3300003751 Bacteria 38934
46 Ga0055539_1000055 3300003752 Bacteria 164754
47 Ga0055539_1000232 3300003752 Bacteria 38934
48 Ga0055533_1000067 3300003756 Bacteria 164754
49 Ga0055533_1000224 3300003756 Bacteria 38934
50 Ga0055533_1010841 3300003756 Bacteria 1015
51 Ga0055532_1000053 3300003758 Bacteria 164751
52 Ga0055525_1000103 3300003759 Bacteria 134778
53 Ga0055525_1000316 3300003759 Bacteria 38934
54 Ga0055542_1000409 3300003762 Bacteria 41890
55 Ga0055542_1014770 3300003762 Bacteria 1272
56 Ga0055526_1002877 3300003771 Bacteria 11337
57 Ga0055537_1000851 3300003773 Bacteria 14843
58 Ga0055524_1049473 3300003775 Bacteria 969
59 Ga0055534_1000766 3300003784 Bacteria 15218
60 Ga0055528_1002206 3300003790 Bacteria 10640
61 Ga0055528_1011134 3300003790 Bacteria 3600
62 Ga0055540_1031521 3300003792 Bacteria 1217
63 Ga0055531_10000125 3300003794 Bacteria 86349
64 Ga0055541_1000042 3300003841 Bacteria 164754
65 Ga0055541_1000139 3300003841 Bacteria 38934
66 Ga0058692_1000064 3300003856 Bacteria 90988
67 Ga0058692_1000156 3300003856 Bacteria 43208
68 Ga0058692_1022013 3300003856 Bacteria 1316
69 Ga0058692_1023058 3300003856 Bacteria 1271
70 Ga0058860_10204723 3300004801 Bacteria 1305
71 Ga0065703_1022151 3300005272 Bacteria 984
72 Ga0065714_10000007 3300005288 Bacteria 22418
73 Ga0065704_10000076 3300005289 Bacteria 33688
74 Ga0065704_10005509 3300005289 Bacteria 3029
75 Ga0065704_10006529 3300005289 Bacteria 3787
76 Ga0065704_10014593 3300005289 Bacteria 2745
77 Ga0065704_10071113 3300005289 Bacteria 13091
78 Ga0065712_10069095 3300005290 Bacteria 8036
79 Ga0070690_100518754 3300005330 Bacteria 894
80 Ga0070670_100000015 3300005331 Bacteria 228819
81 Ga0070670_100167063 3300005331 Bacteria 1908
82 Ga0070677_10311487 3300005333 Bacteria 803
83 Ga0070677_10542653 3300005333 Bacteria 636
84 Ga0068869_100088546 3300005334 Bacteria 2324
85 Ga0068869_100262223 3300005334 Bacteria 1384
86 Ga0068869_100609552 3300005334 Bacteria 923
87 Ga0070666_10000795 3300005335 Bacteria 19131
88 Ga0070666_10013955 3300005335 Bacteria 5107
89 Ga0070666_11159626 3300005335 Bacteria 575
90 Ga0070680_100161000 3300005336 Bacteria 1886
91 Ga0070680_100368235 3300005336 Bacteria 1223
92 Ga0070680_101806956 3300005336 Bacteria 530
93 Ga0070682_100020045 3300005337 Bacteria 3930
94 Ga0070682_100167309 3300005337 Bacteria 1524
95 Ga0070682_100194487 3300005337 Bacteria 1426
96 Ga0070682_100254989 3300005337 Bacteria 1267
97 Ga0070682_100641984 3300005337 Bacteria 844
98 Ga0070682_100783973 3300005337 Bacteria 773
99 Ga0068868_100448304 3300005338 Bacteria 1122
100 Ga0068868_100552881 3300005338 Bacteria 1015
101 Ga0070660_100364606 3300005339 Bacteria 1191
102 Ga0070660_100769714 3300005339 Bacteria 809
103 Ga0070660_101133068 3300005339 Bacteria 662
104 Ga0070689_100962894 3300005340 Bacteria 758
105 Ga0070691_10125754 3300005341 Bacteria 1295
106 Ga0070687_100056000 3300005343 Bacteria 2062
107 Ga0070661_100000652 3300005344 Bacteria 25497
108 Ga0070661_100222492 3300005344 Bacteria 1448
109 Ga0070661_100341807 3300005344 Bacteria 1173
110 Ga0070661_100411411 3300005344 Bacteria 1071
111 Ga0070692_10015871 3300005345 Bacteria 3571
112 Ga0070692_10034401 3300005345 Bacteria 2559
113 Ga0070668_100000954 3300005347 Bacteria 20211
114 Ga0070668_100096692 3300005347 Bacteria 2334
115 Ga0070668_100446646 3300005347 Bacteria 1111
116 Ga0070668_100921658 3300005347 Bacteria 782
117 Ga0070668_100951434 3300005347 Bacteria 770
118 Ga0070669_100004607 3300005353 Bacteria 9957
119 Ga0070675_100695103 3300005354 Bacteria 926
120 Ga0070675_102040857 3300005354 Bacteria 529
121 Ga0070671_100351743 3300005355 Bacteria 1257
122 Ga0070671_100836964 3300005355 Bacteria 802
123 Ga0070674_100412177 3300005356 Bacteria 1107
124 Ga0070673_100317799 3300005364 Bacteria 1375
125 Ga0070688_100001170 3300005365 Bacteria 13058
126 Ga0070688_100546824 3300005365 Bacteria 880
127 Ga0070659_100026058 3300005366 Bacteria 4497
128 Ga0070659_100663248 3300005366 Bacteria 900
129 Ga0070667_100000015 3300005367 Bacteria 238203
130 Ga0070667_100000041 3300005367 Bacteria 170008
131 Ga0070667_100041814 3300005367 Bacteria 3845
132 Ga0070667_100294774 3300005367 Bacteria 1459
133 Ga0070667_100844605 3300005367 Bacteria 851
134 Ga0070667_100999576 3300005367 Bacteria 780
135 Ga0070667_101929219 3300005367 Bacteria 556
136 Ga0070703_10179391 3300005406 Bacteria 817
137 Ga0070709_10157216 3300005434 Bacteria 1577
138 Ga0070709_10809908 3300005434 Bacteria 735
139 Ga0070714_100003062 3300005435 Bacteria 12403
140 Ga0070714_100046919 3300005435 Bacteria 3667
141 Ga0070714_100158171 3300005435 Bacteria 2048
142 Ga0070714_100170555 3300005435 Bacteria 1974
143 Ga0070714_100265067 3300005435 Bacteria 1592
144 Ga0070713_100006537 3300005436 Bacteria 8093
145 Ga0070710_10825403 3300005437 Bacteria 664
146 Ga0070701_10033705 3300005438 Bacteria 2561
147 Ga0070711_100079769 3300005439 Bacteria 2329
148 Ga0070711_101052196 3300005439 Bacteria 700
149 Ga0070705_100200797 3300005440 Bacteria 1367
150 Ga0070705_100676931 3300005440 Bacteria 807
151 Ga0070700_100493287 3300005441 Bacteria 940
152 Ga0070694_100617489 3300005444 Bacteria 874
153 Ga0070663_100001175 3300005455 Bacteria 14405
154 Ga0070663_100033068 3300005455 Bacteria 3570
155 Ga0070663_100221456 3300005455 Bacteria 1486
156 Ga0070663_100224419 3300005455 Bacteria 1476
157 Ga0070663_100301257 3300005455 Bacteria 1283
158 Ga0070663_100405189 3300005455 Bacteria 1116
159 Ga0070663_100411388 3300005455 Bacteria 1108
160 Ga0070663_100498503 3300005455 Bacteria 1011
161 Ga0070663_100773306 3300005455 Bacteria 821
162 Ga0070678_100101533 3300005456 Bacteria 2230
163 Ga0070678_100500660 3300005456 Bacteria 1072
164 Ga0070662_100000042 3300005457 Bacteria 72274
165 Ga0070662_100030703 3300005457 Bacteria 3764
166 Ga0070662_100034778 3300005457 Bacteria 3555
167 Ga0070662_100177367 3300005457 Bacteria 1678
168 Ga0070662_101273412 3300005457 Bacteria 633
169 Ga0070681_10024176 3300005458 Bacteria 6116
170 Ga0070685_10000104 3300005466 Bacteria 53528
171 Ga0070679_100027870 3300005530 Bacteria 5565
172 Ga0070679_100525863 3300005530 Bacteria 1127
173 Ga0070684_101212775 3300005535 Bacteria 710
174 Ga0068853_100003322 3300005539 Bacteria 12309
175 Ga0068853_100006635 3300005539 Bacteria 9218
176 Ga0068853_100017951 3300005539 Bacteria 5847
177 Ga0068853_100056518 3300005539 Bacteria 3384
178 Ga0068853_100056677 3300005539 Bacteria 3380
179 Ga0068853_100171220 3300005539 Bacteria 1964
180 Ga0068853_102455654 3300005539 Bacteria 505
181 Ga0070672_100312180 3300005543 Bacteria 1335
182 Ga0070672_100801777 3300005543 Bacteria 829
183 Ga0070695_100551164 3300005545 Bacteria 899
184 Ga0070695_100714179 3300005545 Bacteria 797
185 Ga0070696_100002929 3300005546 Bacteria 11345
186 Ga0070693_100010756 3300005547 Bacteria 4590
187 Ga0070665_100005720 3300005548 Bacteria 12763
188 Ga0070665_100037817 3300005548 Bacteria 4852
189 Ga0070665_100038905 3300005548 Bacteria 4782
190 Ga0070665_100382972 3300005548 Bacteria 1414
191 Ga0070665_100485369 3300005548 Bacteria 1246
192 Ga0070665_100651265 3300005548 Bacteria 1066
193 Ga0070665_100690977 3300005548 Bacteria 1033
194 Ga0070665_101432677 3300005548 Bacteria 700
195 Ga0070704_100042855 3300005549 Bacteria 3133
196 Ga0068855_100086783 3300005563 Bacteria 3618
197 Ga0068855_100305411 3300005563 Bacteria 1761
198 Ga0068855_100741939 3300005563 Bacteria 1048
199 Ga0068855_100875033 3300005563 Bacteria 950
200 Ga0070664_100000826 3300005564 Bacteria 23859
201 Ga0070664_100043633 3300005564 Bacteria 3784
202 Ga0068857_100000609 3300005577 Bacteria 26325
203 Ga0068857_100000998 3300005577 Bacteria 21742
204 Ga0068857_100183856 3300005577 Bacteria 1902
205 Ga0068857_100316089 3300005577 Bacteria 1441
206 Ga0068857_100625982 3300005577 Bacteria 1018
207 Ga0068857_100773484 3300005577 Bacteria 915
208 Ga0068857_100878841 3300005577 Bacteria 859
209 Ga0068854_100001113 3300005578 Bacteria 16151
210 Ga0068854_100001181 3300005578 Bacteria 15658
211 Ga0068854_100003601 3300005578 Bacteria 9691
212 Ga0068856_100579159 3300005614 Bacteria 1144
213 Ga0070702_100628584 3300005615 Bacteria 809
214 Ga0068852_100040531 3300005616 Bacteria 3930
215 Ga0068852_100062649 3300005616 Bacteria 3235
216 Ga0068852_100229248 3300005616 Bacteria 1770
217 Ga0068852_100306097 3300005616 Bacteria 1540
218 Ga0068852_100797260 3300005616 Bacteria 958
219 Ga0068852_101100538 3300005616 Bacteria 815
220 Ga0068852_101638784 3300005616 Bacteria 666
221 Ga0068859_100105280 3300005617 Bacteria 2880
222 Ga0068859_100182412 3300005617 Bacteria 2182
223 Ga0068859_100213954 3300005617 Bacteria 2014
224 Ga0068864_100000056 3300005618 Bacteria 127891
225 Ga0068864_100015120 3300005618 Bacteria 6417
226 Ga0068864_100656690 3300005618 Bacteria 1022
227 Ga0068851_10000002 3300005834 Bacteria 302756
228 Ga0068851_10002236 3300005834 Bacteria 8512
229 Ga0068851_10002465 3300005834 Bacteria 8131
230 Ga0068851_10022007 3300005834 Bacteria 3100
231 Ga0068851_10305512 3300005834 Bacteria 916
232 Ga0068863_100025318 3300005841 Bacteria 5657
233 Ga0068863_100036314 3300005841 Bacteria 4694
234 Ga0068863_100064837 3300005841 Bacteria 3455
235 Ga0068863_100151591 3300005841 Bacteria 2218
236 Ga0068863_100405176 3300005841 Bacteria 1334
237 Ga0068858_100022095 3300005842 Bacteria 5940
238 Ga0068858_100025123 3300005842 Bacteria 5543
239 Ga0068858_100639128 3300005842 Bacteria 1034
240 Ga0068858_100927888 3300005842 Bacteria 852
241 Ga0068860_100002410 3300005843 Bacteria 19616
242 Ga0068860_100061930 3300005843 Bacteria 3555
243 Ga0068860_100345652 3300005843 Bacteria 1463
244 Ga0068860_100751366 3300005843 Bacteria 987
245 Ga0068862_100014084 3300005844 Bacteria 6633
246 Ga0068862_100394364 3300005844 Bacteria 1294
247 Ga0081455_10012710 3300005937 Bacteria 8376
248 Ga0081455_10473713 3300005937 Bacteria 849
249 Ga0081540_1000720 3300005983 Bacteria 30494
250 Ga0070717_10307945 3300006028 Bacteria 1409
251 Ga0070717_10402945 3300006028 Bacteria 1229
252 Ga0075365_10637641 3300006038 Bacteria 753
253 Ga0075363_100194892 3300006048 Bacteria 1156
254 Ga0075364_10016532 3300006051 Bacteria 4591
255 Ga0075364_10378582 3300006051 Bacteria 965
256 Ga0075364_10539599 3300006051 Bacteria 797
257 Ga0075364_11026187 3300006051 Bacteria 560
258 Ga0070712_100875191 3300006175 Bacteria 774
259 Ga0075362_10658544 3300006177 Bacteria 544
260 Ga0075367_10273634 3300006178 Bacteria 1061
261 Ga0075369_10273354 3300006186 Bacteria 786
262 Ga0075427_10031688 3300006194 Bacteria 869
263 Ga0075366_10002176 3300006195 Bacteria 10001
264 Ga0075366_10105176 3300006195 Bacteria 1696
265 Ga0075366_10136831 3300006195 Bacteria 1479
266 Ga0097621_100110253 3300006237 Bacteria 2325
267 Ga0097621_100129891 3300006237 Bacteria 2143
268 Ga0097621_100187814 3300006237 Bacteria 1788
269 Ga0097621_100904837 3300006237 Bacteria 822
270 Ga0075370_10275459 3300006353 Bacteria 999
271 Ga0075370_10496105 3300006353 Bacteria 737
272 Ga0068871_100186416 3300006358 Bacteria 1785
273 Ga0068871_101101579 3300006358 Bacteria 742
274 Ga0075428_100283735 3300006844 Bacteria 1782
275 Ga0075430_100082800 3300006846 Bacteria 2689
276 Ga0075430_100151817 3300006846 Bacteria 1929
277 Ga0075430_100858636 3300006846 Bacteria 748
278 Ga0075431_100268455 3300006847 Bacteria 1730
279 Ga0075433_11221835 3300006852 Bacteria 652
280 Ga0075429_100025677 3300006880 Bacteria 5115
281 Ga0068865_100005420 3300006881 Bacteria 7733
282 Ga0068865_100664683 3300006881 Bacteria 887
283 Ga0097620_100105293 3300006931 Bacteria 2880
284 Ga0097620_100182418 3300006931 Bacteria 2182
285 Ga0097620_100213944 3300006931 Bacteria 2014
286 Ga0097620_101042712 3300006931 Bacteria 899
287 Ga0099823_1001424 3300006944 Bacteria 19746
288 Ga0079104_1011549 3300006946 Bacteria 2832
289 Ga0099826_10004264 3300006948 Bacteria 9981
290 Ga0105251_10001384 3300009011 Bacteria 20990
291 Ga0105251_10003365 3300009011 Bacteria 11643
292 Ga0105251_10004275 3300009011 Bacteria 9818
293 Ga0105251_10046768 3300009011 Bacteria 2081
294 Ga0105251_10113970 3300009011 Bacteria 1230
295 Ga0105251_10203057 3300009011 Bacteria 893
296 Ga0105244_10003157 3300009036 Bacteria 11968
297 Ga0105244_10003200 3300009036 Bacteria 11868
298 Ga0105244_10003679 3300009036 Bacteria 10831
299 Ga0105244_10022121 3300009036 Bacteria 3503
300 Ga0105244_10039739 3300009036 Bacteria 2447
301 Ga0105244_10092708 3300009036 Bacteria 1484
302 Ga0105244_10334153 3300009036 Bacteria 699
303 Ga0105244_10360844 3300009036 Bacteria 669
304 Ga0105244_10451587 3300009036 Bacteria 591
305 Ga0105250_10001814 3300009092 Bacteria 11183
306 Ga0105250_10001821 3300009092 Bacteria 11158
307 Ga0105250_10001822 3300009092 Bacteria 11155
308 Ga0105250_10102142 3300009092 Bacteria 1170
309 Ga0105250_10169998 3300009092 Bacteria 912
310 Ga0105250_10254294 3300009092 Bacteria 751
311 Ga0105240_10001463 3300009093 Bacteria 40357
312 Ga0105240_10020349 3300009093 Bacteria 8856
313 Ga0105240_10081338 3300009093 Bacteria 3981
314 Ga0105240_10212903 3300009093 Bacteria 2257
315 Ga0105240_10283630 3300009093 Bacteria 1902
316 Ga0105245_10346633 3300009098 Bacteria 1470
317 Ga0105245_10512475 3300009098 Bacteria 1217
318 Ga0105247_10002905 3300009101 Bacteria 11410
319 Ga0105247_10236253 3300009101 Bacteria 1243
320 Ga0105247_10469118 3300009101 Bacteria 911
321 Ga0114129_11327847 3300009147 Bacteria 890
322 Ga0114129_12808648 3300009147 Bacteria 579
323 Ga0105243_10020634 3300009148 Bacteria 4996
324 Ga0105243_10033041 3300009148 Bacteria 3999
325 Ga0105243_10093860 3300009148 Bacteria 2477
326 Ga0105243_10692280 3300009148 Bacteria 992
327 Ga0105243_10699202 3300009148 Bacteria 988
328 Ga0105241_10000672 3300009174 Bacteria 25784
329 Ga0105241_10646888 3300009174 Bacteria 960
330 Ga0105241_10659840 3300009174 Bacteria 951
331 Ga0105241_11246006 3300009174 Bacteria 706
332 Ga0105241_11799766 3300009174 Bacteria 598
333 Ga0105242_10002241 3300009176 Bacteria 15255
334 Ga0105242_10015431 3300009176 Bacteria 5933
335 Ga0105242_10294709 3300009176 Bacteria 1478
336 Ga0105248_10001072 3300009177 Bacteria 30268
337 Ga0105248_10283186 3300009177 Bacteria 1866
338 Ga0105248_10291539 3300009177 Bacteria 1837
339 Ga0105248_10346592 3300009177 Bacteria 1672
340 Ga0105248_10717759 3300009177 Bacteria 1128
341 Ga0105237_10001741 3300009545 Bacteria 28104
342 Ga0105237_10005934 3300009545 Bacteria 13696
343 Ga0105237_10007392 3300009545 Bacteria 12030
344 Ga0105237_10015499 3300009545 Bacteria 7931
345 Ga0105237_10218268 3300009545 Bacteria 1907
346 Ga0105237_10336995 3300009545 Bacteria 1513
347 Ga0105237_10369507 3300009545 Bacteria 1439
348 Ga0105238_10168817 3300009551 Bacteria 2164
349 Ga0105238_10460288 3300009551 Bacteria 1270
350 Ga0105249_10000622 3300009553 Bacteria 32271
351 Ga0105249_10026163 3300009553 Bacteria 5255
352 Ga0105249_10032534 3300009553 Bacteria 4719
353 Ga0105249_10164198 3300009553 Bacteria 2148
354 Ga0105249_12702864 3300009553 Bacteria 568
355 Ga0105239_10003327 3300010375 Bacteria 19782
356 Ga0105239_10004272 3300010375 Bacteria 17140
357 Ga0105239_10004445 3300010375 Bacteria 16760
358 Ga0105239_10017757 3300010375 Bacteria 7870
359 Ga0105239_10048112 3300010375 Bacteria 4676
360 Ga0105239_10141841 3300010375 Bacteria 2678
361 Ga0105239_10311902 3300010375 Bacteria 1773
362 Ga0105239_10456855 3300010375 Bacteria 1449
363 Ga0105239_10847148 3300010375 Bacteria 1048
364 Ga0105246_10019344 3300011119 Bacteria 4350
365 Ga0105246_10052166 3300011119 Bacteria 2810
366 Ga0105246_10198765 3300011119 Bacteria 1557
367 Ga0157314_1000299 3300012500 Bacteria 5145
368 Ga0157373_10004967 3300013100 Bacteria 9994
369 Ga0157373_10018843 3300013100 Bacteria 5022
370 Ga0157373_10032828 3300013100 Bacteria 3736
371 Ga0157373_10038271 3300013100 Bacteria 3438
372 Ga0157373_10322581 3300013100 Bacteria 1099
373 Ga0157373_10348475 3300013100 Bacteria 1056
374 Ga0157373_10378827 3300013100 Bacteria 1012
375 Ga0157371_10004487 3300013102 Bacteria 12175
376 Ga0157371_10004889 3300013102 Bacteria 11512
377 Ga0157371_10005445 3300013102 Bacteria 10730
378 Ga0157371_10020835 3300013102 Bacteria 4822
379 Ga0157371_10043348 3300013102 Bacteria 3205
380 Ga0157371_10061606 3300013102 Bacteria 2660
381 Ga0157371_10094463 3300013102 Bacteria 2119
382 Ga0157371_10101459 3300013102 Bacteria 2041
383 Ga0157371_10161132 3300013102 Bacteria 1602
384 Ga0157371_10250099 3300013102 Bacteria 1276
385 Ga0157371_11077206 3300013102 Bacteria 616
386 Ga0157370_10000422 3300013104 Bacteria 53330
387 Ga0157370_10005510 3300013104 Bacteria 14184
388 Ga0157370_10008351 3300013104 Bacteria 11169
389 Ga0157370_10009847 3300013104 Bacteria 10130
390 Ga0157370_10110234 3300013104 Bacteria 2573
391 Ga0157370_10123222 3300013104 Bacteria 2420
392 Ga0157370_10205003 3300013104 Bacteria 1829
393 Ga0157370_10255789 3300013104 Bacteria 1619
394 Ga0157370_10280480 3300013104 Bacteria 1540
395 Ga0157370_10354802 3300013104 Bacteria 1352
396 Ga0157370_10367438 3300013104 Bacteria 1326
397 Ga0157370_10751193 3300013104 Bacteria 889
398 Ga0157370_10974266 3300013104 Bacteria 768
399 Ga0157369_10004613 3300013105 Bacteria 16198
400 Ga0157369_10005087 3300013105 Bacteria 15394
401 Ga0157369_10008827 3300013105 Bacteria 11547
402 Ga0157369_10375978 3300013105 Bacteria 1475
403 Ga0157369_10570688 3300013105 Bacteria 1169
404 Ga0157369_11228543 3300013105 Bacteria 764
405 Ga0157374_10007275 3300013296 Bacteria 9433
406 Ga0157378_10026963 3300013297 Bacteria 5068
407 Ga0157378_10081560 3300013297 Bacteria 2924
408 Ga0163162_10005583 3300013306 Bacteria 12167
409 Ga0163162_10017452 3300013306 Bacteria 7023
410 Ga0163162_10096005 3300013306 Bacteria 3052
411 Ga0163162_10180551 3300013306 Bacteria 2237
412 Ga0163162_10394279 3300013306 Bacteria 1517
413 Ga0157372_10006843 3300013307 Bacteria 12129
414 Ga0157372_10012562 3300013307 Bacteria 9019
415 Ga0157372_10020902 3300013307 Bacteria 7065
416 Ga0157372_10065095 3300013307 Bacteria 4092
417 Ga0157372_10270571 3300013307 Bacteria 1974
418 Ga0157372_10677983 3300013307 Bacteria 1200
419 Ga0157375_10000319 3300013308 Bacteria 43172
420 Ga0163163_10000199 3300014325 Bacteria 62045
421 Ga0157380_10773522 3300014326 Bacteria 974
422 Ga0182008_10002668 3300014497 Bacteria 11072
423 Ga0182008_10006926 3300014497 Bacteria 6291
424 Ga0182008_10040391 3300014497 Bacteria 2330
425 Ga0182008_10055211 3300014497 Bacteria 1965
426 Ga0157379_10122139 3300014968 Bacteria 2343
427 Ga0157379_10972511 3300014968 Bacteria 808
428 Ga0157376_10007084 3300014969 Bacteria 7962
429 Ga0157376_10380117 3300014969 Bacteria 1360
430 Ga0182006_1001639 3300015261 Bacteria 13219
431 Ga0182006_1004854 3300015261 Bacteria 6525
432 Ga0182006_1010988 3300015261 Bacteria 3999
433 Ga0182006_1019907 3300015261 Bacteria 2818
434 Ga0182006_1034577 3300015261 Bacteria 2020
435 Ga0182006_1049347 3300015261 Bacteria 1625
436 Ga0182006_1099774 3300015261 Bacteria 1032
437 Ga0182007_10005587 3300015262 Bacteria 5501
438 Ga0182007_10014939 3300015262 Bacteria 2911
439 Ga0182007_10078677 3300015262 Bacteria 1081
440 Ga0182007_10127709 3300015262 Bacteria 853
441 Ga0182005_1000261 3300015265 Bacteria 33393
442 Ga0182005_1011381 3300015265 Bacteria 2537
443 Ga0182005_1090894 3300015265 Bacteria 849
444 Ga0183360_10821 3300015689 Bacteria 973
445 Ga0163161_10003205 3300017792 Bacteria 11504
446 Ga0163161_10016624 3300017792 Bacteria 5138
447 Ga0163161_10060757 3300017792 Bacteria 2751
448 Ga0163161_10066219 3300017792 Bacteria 2637
449 Ga0163161_10113215 3300017792 Bacteria 2030
450 Ga0163161_10357291 3300017792 Bacteria 1163
451 Ga0163161_10589633 3300017792 Bacteria 915
452 Ga0206354_10784947 3300020081 Bacteria 638
453 Ga0213872_10227045 3300021361 Bacteria 793
454 Ga0213876_10000608 3300021384 Bacteria 26445
455 Ga0213876_10190768 3300021384 Bacteria 1090
456 Ga0224712_10477116 3300022467 Bacteria 601
457 Ga0224712_10566405 3300022467 Bacteria 553
458 Ga0209435_100298 3300025206 Bacteria 12008
459 Ga0209760_100117 3300025207 Bacteria 57229
460 Ga0209760_100153 3300025207 Bacteria 42023
461 Ga0209760_100166 3300025207 Bacteria 39087
462 Ga0209760_108483 3300025207 Bacteria 741
463 Ga0209784_100060 3300025224 Bacteria 164838
464 Ga0209784_100218 3300025224 Bacteria 39215
465 Ga0209566_100075 3300025225 Bacteria 164838
466 Ga0209566_100353 3300025225 Bacteria 39215
467 Ga0209674_100100 3300025226 Bacteria 164838
468 Ga0209674_100273 3300025226 Bacteria 39215
469 Ga0209674_100632 3300025226 Bacteria 12783
470 Ga0209147_100096 3300025229 Bacteria 164838
471 Ga0209563_100182 3300025230 Bacteria 39215
472 Ga0207427_100063 3300025231 Bacteria 177711
473 Ga0207427_100270 3300025231 Bacteria 39215
474 Ga0209437_100065 3300025233 Bacteria 332417
475 Ga0209437_100133 3300025233 Bacteria 178493
476 Ga0209437_100616 3300025233 Bacteria 21817
477 Ga0209437_100676 3300025233 Bacteria 18470
478 Ga0209258_100387 3300025242 Bacteria 56263
479 Ga0207425_1000117 3300025245 Bacteria 74911
480 Ga0209646_1000276 3300025246 Bacteria 45523
481 Ga0209677_100057 3300025253 Bacteria 164838
482 Ga0209677_100234 3300025253 Bacteria 39215
483 Ga0209148_1002260 3300025254 Bacteria 6975
484 Ga0209759_1007895 3300025256 Bacteria 3367
485 Ga0209129_1000011 3300025258 Bacteria 568657
486 Ga0209129_1000540 3300025258 Bacteria 26365
487 Ga0209233_1000085 3300025261 Bacteria 333078
488 Ga0209233_1000133 3300025261 Bacteria 202716
489 Ga0209233_1003358 3300025261 Bacteria 5661
490 Ga0209565_1000415 3300025263 Bacteria 35224
491 Ga0209673_1000204 3300025273 Bacteria 119618
492 Ga0209130_1005672 3300025284 Bacteria 4265
493 Ga0209130_1014121 3300025284 Bacteria 2017
494 Ga0209675_1000015 3300025291 Bacteria 403517
495 Ga0209676_1000076 3300025292 Bacteria 301393
496 Ga0209676_1000110 3300025292 Bacteria 214083
497 Ga0209676_1001080 3300025292 Bacteria 30784
498 Ga0209025_1000002 3300025294 Bacteria 1393142
499 Ga0209564_1000037 3300025295 Bacteria 414794
500 Ga0209758_1000003 3300025297 Bacteria 1398533
501 Ga0209050_1000063 3300025298 Bacteria 314955
502 Ga0209050_1002971 3300025298 Bacteria 13226
503 Ga0209256_1018864 3300025299 Bacteria 2221
504 Ga0209051_1000045 3300025303 Bacteria 297882
505 Ga0209051_1000283 3300025303 Bacteria 82731
506 Ga0209051_1001513 3300025303 Bacteria 19394
507 Ga0209051_1007989 3300025303 Bacteria 5680
508 Ga0209051_1012543 3300025303 Bacteria 4094
509 Ga0209257_1000129 3300025304 Bacteria 214155
510 Ga0209257_1000185 3300025304 Bacteria 155047
511 Ga0209257_1011177 3300025304 Bacteria 4371
512 Ga0209257_1054444 3300025304 Bacteria 1113
513 Ga0209257_1139166 3300025304 Bacteria 547
514 Ga0207656_10000010 3300025321 Bacteria 192224
515 Ga0207656_10076474 3300025321 Bacteria 1497
516 Ga0207656_10083068 3300025321 Bacteria 1443
517 Ga0207656_10306820 3300025321 Bacteria 786
518 Ga0207696_1000047 3300025711 Bacteria 285005
519 Ga0207696_1000118 3300025711 Bacteria 147902
520 Ga0207696_1000168 3300025711 Bacteria 103496
521 Ga0207696_1000334 3300025711 Bacteria 49107
522 Ga0207696_1001023 3300025711 Bacteria 16688
523 Ga0207696_1001545 3300025711 Bacteria 12291
524 Ga0207696_1001690 3300025711 Bacteria 11473
525 Ga0207696_1001739 3300025711 Bacteria 11291
526 Ga0207696_1001745 3300025711 Bacteria 11263
527 Ga0207696_1001772 3300025711 Bacteria 11134
528 Ga0207696_1004316 3300025711 Bacteria 6152
529 Ga0207655_1000104 3300025728 Bacteria 184765
530 Ga0207655_1000606 3300025728 Bacteria 43412
531 Ga0207655_1001098 3300025728 Bacteria 26525
532 Ga0207655_1001191 3300025728 Bacteria 25163
533 Ga0207655_1001305 3300025728 Bacteria 23562
534 Ga0207655_1002413 3300025728 Bacteria 15194
535 Ga0207655_1003289 3300025728 Bacteria 12121
536 Ga0207655_1003403 3300025728 Bacteria 11876
537 Ga0207655_1003558 3300025728 Bacteria 11538
538 Ga0207655_1003709 3300025728 Bacteria 11246
539 Ga0207655_1006248 3300025728 Bacteria 7922
540 Ga0207655_1023419 3300025728 Bacteria 3064
541 Ga0207655_1028068 3300025728 Bacteria 2663
542 Ga0207655_1030467 3300025728 Bacteria 2508
543 Ga0207655_1186455 3300025728 Bacteria 629
544 Ga0207713_1000049 3300025735 Bacteria 227882
545 Ga0207713_1000073 3300025735 Bacteria 181519
546 Ga0207713_1001458 3300025735 Bacteria 18836
547 Ga0207713_1003194 3300025735 Bacteria 11331
548 Ga0207713_1012383 3300025735 Bacteria 4566
549 Ga0207713_1013301 3300025735 Bacteria 4344
550 Ga0207713_1069892 3300025735 Bacteria 1299
551 Ga0207713_1258604 3300025735 Bacteria 511
552 Ga0207653_10166297 3300025885 Bacteria 819
553 Ga0207692_10953701 3300025898 Bacteria 565
554 Ga0207710_10000468 3300025900 Bacteria 25913
555 Ga0207710_10004791 3300025900 Bacteria 5872
556 Ga0207710_10344820 3300025900 Bacteria 758
557 Ga0207680_10001411 3300025903 Bacteria 11370
558 Ga0207680_10040636 3300025903 Bacteria 2708
559 Ga0207680_10061368 3300025903 Bacteria 2292
560 Ga0207699_10153906 3300025906 Bacteria 1524
561 Ga0207645_10791902 3300025907 Bacteria 645
562 Ga0207705_10486669 3300025909 Bacteria 958
563 Ga0207654_10000379 3300025911 Bacteria 25944
564 Ga0207707_10953191 3300025912 Bacteria 706
565 Ga0207671_10000380 3300025914 Bacteria 62950
566 Ga0207671_10014065 3300025914 Bacteria 6343
567 Ga0207671_10017764 3300025914 Bacteria 5475
568 Ga0207671_10093262 3300025914 Bacteria 2271
569 Ga0207671_10180802 3300025914 Bacteria 1641
570 Ga0207662_10082749 3300025918 Bacteria 1961
571 Ga0207662_10119540 3300025918 Bacteria 1651
572 Ga0207657_10056527 3300025919 Bacteria 3385
573 Ga0207649_10000041 3300025920 Bacteria 117781
574 Ga0207649_10483093 3300025920 Bacteria 940
575 Ga0207649_10892844 3300025920 Bacteria 697
576 Ga0207649_10955084 3300025920 Bacteria 673
577 Ga0207652_10266670 3300025921 Bacteria 1545
578 Ga0207652_10600806 3300025921 Bacteria 987
579 Ga0207681_10001197 3300025923 Bacteria 16670
580 Ga0207681_10021631 3300025923 Bacteria 4091
581 Ga0207681_10042359 3300025923 Bacteria 3041
582 Ga0207681_10535675 3300025923 Bacteria 962
583 Ga0207694_10095814 3300025924 Bacteria 2347
584 Ga0207694_10373777 3300025924 Bacteria 1182
585 Ga0207650_10000013 3300025925 Bacteria 409471
586 Ga0207650_10248506 3300025925 Bacteria 1439
587 Ga0207650_10889905 3300025925 Bacteria 756
588 Ga0207650_11891072 3300025925 Bacteria 504
589 Ga0207687_10063514 3300025927 Bacteria 2615
590 Ga0207687_10653867 3300025927 Bacteria 889
591 Ga0207664_10087884 3300025929 Bacteria 2542
592 Ga0207664_10216074 3300025929 Bacteria 1661
593 Ga0207644_10138725 3300025931 Bacteria 1870
594 Ga0207644_10385958 3300025931 Bacteria 1143
595 Ga0207690_10084403 3300025932 Bacteria 2226
596 Ga0207706_10000128 3300025933 Bacteria 81615
597 Ga0207706_10030526 3300025933 Bacteria 4807
598 Ga0207686_10016851 3300025934 Bacteria 4105
599 Ga0207709_10000030 3300025935 Bacteria 331710
600 Ga0207709_10000343 3300025935 Bacteria 48072
601 Ga0207709_10008703 3300025935 Bacteria 5599
602 Ga0207709_10010135 3300025935 Bacteria 5190
603 Ga0207709_10011110 3300025935 Bacteria 4965
604 Ga0207709_10056312 3300025935 Bacteria 2433
605 Ga0207669_10984965 3300025937 Bacteria 708
606 Ga0207704_10355312 3300025938 Bacteria 1142
607 Ga0207691_10172788 3300025940 Bacteria 1892
608 Ga0207711_10000194 3300025941 Bacteria 65127
609 Ga0207711_10000272 3300025941 Bacteria 55799
610 Ga0207711_10108211 3300025941 Bacteria 2469
611 Ga0207711_10426503 3300025941 Bacteria 1234
612 Ga0207711_10803153 3300025941 Bacteria 876
613 Ga0207711_11527427 3300025941 Bacteria 611
614 Ga0207689_10073424 3300025942 Bacteria 2810
615 Ga0207689_10099611 3300025942 Bacteria 2388
616 Ga0207661_10497578 3300025944 Bacteria 1114
617 Ga0207661_12041632 3300025944 Bacteria 519
618 Ga0207679_10000081 3300025945 Bacteria 84888
619 Ga0207679_11310009 3300025945 Bacteria 665
620 Ga0207667_10482560 3300025949 Bacteria 1258
621 Ga0207667_10569686 3300025949 Bacteria 1144
622 Ga0207667_10839570 3300025949 Bacteria 913
623 Ga0207651_10111114 3300025960 Bacteria 2058
624 Ga0207651_10397877 3300025960 Bacteria 1171
625 Ga0207712_10000839 3300025961 Bacteria 22597
626 Ga0207712_10021372 3300025961 Bacteria 4249
627 Ga0207712_10038480 3300025961 Bacteria 3271
628 Ga0207712_10184842 3300025961 Bacteria 1640
629 Ga0207668_10009496 3300025972 Bacteria 5835
630 Ga0207668_10435299 3300025972 Bacteria 1116
631 Ga0207668_10571449 3300025972 Bacteria 982
632 Ga0207640_10004766 3300025981 Bacteria 7364
633 Ga0207640_10219687 3300025981 Bacteria 1454
634 Ga0207658_10000005 3300025986 Bacteria 408341
635 Ga0207658_10000028 3300025986 Bacteria 174550
636 Ga0207658_10075889 3300025986 Bacteria 2559
637 Ga0207658_10269819 3300025986 Bacteria 1454
638 Ga0207658_10497040 3300025986 Bacteria 1086
639 Ga0207677_10031823 3300026023 Bacteria 3383
640 Ga0207703_10068783 3300026035 Bacteria 2918
641 Ga0207703_10809199 3300026035 Bacteria 895
642 Ga0207639_10000901 3300026041 Bacteria 20110
643 Ga0207639_10003844 3300026041 Bacteria 10119
644 Ga0207639_10012828 3300026041 Bacteria 5846
645 Ga0207639_10086604 3300026041 Bacteria 2495
646 Ga0207639_10295782 3300026041 Bacteria 1429
647 Ga0207639_11035743 3300026041 Bacteria 769
648 Ga0207678_10005433 3300026067 Bacteria 11409
649 Ga0207678_10094890 3300026067 Bacteria 2549
650 Ga0207678_10198092 3300026067 Bacteria 1717
651 Ga0207678_10377640 3300026067 Bacteria 1225
652 Ga0207708_10780472 3300026075 Bacteria 821
653 Ga0207641_10139344 3300026088 Bacteria 2186
654 Ga0207641_10953208 3300026088 Bacteria 853
655 Ga0207641_10975505 3300026088 Bacteria 843
656 Ga0207641_11017580 3300026088 Bacteria 825
657 Ga0207641_11163664 3300026088 Bacteria 770
658 Ga0207641_11833177 3300026088 Bacteria 608
659 Ga0207648_10590976 3300026089 Bacteria 1023
660 Ga0207676_10000010 3300026095 Bacteria 519402
661 Ga0207676_10031174 3300026095 Bacteria 4008
662 Ga0207676_10452668 3300026095 Bacteria 1210
663 Ga0207674_10003713 3300026116 Bacteria 18642
664 Ga0207674_10276418 3300026116 Bacteria 1627
665 Ga0207675_100027444 3300026118 Bacteria 5303
666 Ga0207675_101375141 3300026118 Bacteria 727
667 Ga0207683_10216641 3300026121 Bacteria 1744
668 Ga0207698_10023144 3300026142 Bacteria 4335
669 Ga0207698_10032580 3300026142 Bacteria 3778
670 Ga0209281_1000874 3300027111 Bacteria 26131
671 Ga0209281_1001322 3300027111 Bacteria 15649
672 Ga0209281_1001756 3300027111 Bacteria 11080
673 Ga0209389_1000020 3300027296 Bacteria 172003
674 Ga0209371_1000228 3300027312 Bacteria 72315
675 Ga0209371_1000294 3300027312 Bacteria 56307
676 Ga0209371_1000302 3300027312 Bacteria 55126
677 Ga0209371_1001410 3300027312 Bacteria 16496
678 Ga0209371_1002180 3300027312 Bacteria 11427
679 Ga0209371_1002194 3300027312 Bacteria 11380
680 Ga0209371_1003997 3300027312 Bacteria 6702
681 Ga0209371_1006959 3300027312 Bacteria 4057
682 Ga0209371_1015144 3300027312 Bacteria 2087
683 Ga0209969_1005003 3300027360 Bacteria 1855
684 Ga0209969_1007401 3300027360 Bacteria 1551
685 Ga0209981_1006526 3300027378 Bacteria 1562
686 Ga0209996_1001844 3300027395 Bacteria 2596
687 Ga0209984_1014865 3300027424 Bacteria 1031
688 Ga0209995_1001985 3300027471 Bacteria 3203
689 Ga0209995_1020685 3300027471 Bacteria 1089
690 Ga0209995_1063579 3300027471 Bacteria 629
691 Ga0209968_1001116 3300027526 Bacteria 4100
692 Ga0209999_1000717 3300027543 Bacteria 5377
693 Ga0209999_1012766 3300027543 Bacteria 1522
694 Ga0209982_1000139 3300027552 Bacteria 8091
695 Ga0209982_1001049 3300027552 Bacteria 3688
696 Ga0209970_1039649 3300027614 Bacteria 836
697 Ga0209983_1002894 3300027665 Bacteria 3716
698 Ga0209282_1047549 3300027666 Bacteria 2491
699 Ga0209971_1000288 3300027682 Bacteria 14053
700 Ga0209998_10114225 3300027717 Bacteria 676
701 Ga0209974_10014534 3300027876 Bacteria 2619
702 Ga0209974_10323674 3300027876 Bacteria 594
703 Ga0207428_10416354 3300027907 Bacteria 983
704 Ga0268266_10001891 3300028379 Bacteria 23621
705 Ga0268266_10002538 3300028379 Bacteria 19391
706 Ga0268266_10034750 3300028379 Bacteria 4287
707 Ga0268266_10058354 3300028379 Bacteria 3323
708 Ga0268266_10065647 3300028379 Bacteria 3137
709 Ga0268266_10125644 3300028379 Bacteria 2288
710 Ga0268266_10162981 3300028379 Bacteria 2018
711 Ga0268266_10316450 3300028379 Bacteria 1459
712 Ga0268266_10543976 3300028379 Bacteria 1112
713 Ga0268265_10000383 3300028380 Bacteria 47354
714 Ga0268265_11209183 3300028380 Bacteria 753
715 Ga0268264_10000036 3300028381 Bacteria 392994
716 Ga0268264_10028346 3300028381 Bacteria 4580
717 Ga0265334_10000272 3300028573 Bacteria 29197
718 Ga0307515_10645580 3300028794 Bacteria 671
719 Ga0265338_10011455 3300028800 Bacteria 10239
720 Ga0268256_1000188 3300030500 Bacteria 72315
721 Ga0268256_1000258 3300030500 Bacteria 56249
722 Ga0268256_1000674 3300030500 Bacteria 25864
723 Ga0268256_1001982 3300030500 Bacteria 11140
724 Ga0268256_1003119 3300030500 Bacteria 7723
725 Ga0268256_1003595 3300030500 Bacteria 6902
726 Ga0268256_1003729 3300030500 Bacteria 6702
727 Ga0268256_1017177 3300030500 Bacteria 2046
728 Ga0268256_1031085 3300030500 Bacteria 1285
729 Ga0316177_1166192 3300030731 Bacteria 4394
730 Ga0316176_1207210 3300030732 Bacteria 4074
731 Ga0314311_1030222 3300030733 Bacteria 8365
732 Ga0316178_1033068 3300030735 Bacteria 14472
733 Ga0316178_1127651 3300030735 Bacteria 1214
734 Ga0316180_1043925 3300030736 Bacteria 661
735 Ga0316183_1040327 3300030742 Bacteria 2620
736 Ga0316183_1119066 3300030742 Bacteria 990
737 Ga0316181_1171526 3300030744 Bacteria 7821
738 Ga0316182_1129448 3300030745 Bacteria 5193
739 Ga0316182_1288898 3300030745 Bacteria 1714
740 Ga0265766_1002668 3300030863 Bacteria 1000
741 Ga0265325_10002468 3300031241 Bacteria 12465
742 Ga0265325_10101495 3300031241 Bacteria 1408
743 Ga0265331_10023066 3300031250 Bacteria 3167
744 Ga0265327_10001935 3300031251 Bacteria 23890
745 Ga0307513_10282596 3300031456 Bacteria 1436
746 Ga0307408_100000595 3300031548 Bacteria 31049
747 Ga0307408_100000900 3300031548 Bacteria 23377
748 Ga0307408_100001790 3300031548 Bacteria 15690
749 Ga0307408_100410322 3300031548 Bacteria 1165
750 Ga0307408_100866817 3300031548 Bacteria 824
751 Ga0316575_10006210 3300031665 Bacteria 4287
752 Ga0316575_10018901 3300031665 Bacteria 2630
753 Ga0316575_10028680 3300031665 Bacteria 2171
754 Ga0316575_10043459 3300031665 Bacteria 1781
755 Ga0316575_10059515 3300031665 Bacteria 1525
756 Ga0316575_10300405 3300031665 Bacteria 679
757 Ga0316579_10014436 3300031691 Bacteria 3414
758 Ga0316579_10027879 3300031691 Bacteria 2567
759 Ga0316579_10090094 3300031691 Bacteria 1464
760 Ga0316579_10122014 3300031691 Bacteria 1252
761 Ga0316579_10141294 3300031691 Bacteria 1161
762 Ga0316579_10146412 3300031691 Bacteria 1139
763 Ga0316579_10284115 3300031691 Bacteria 800
764 Ga0316579_10370417 3300031691 Bacteria 692
765 Ga0316579_10418073 3300031691 Bacteria 648
766 Ga0316576_10000365 3300031727 Bacteria 20446
767 Ga0316576_10005233 3300031727 Bacteria 7894
768 Ga0316576_10025746 3300031727 Bacteria 4121
769 Ga0316576_10070262 3300031727 Bacteria 2582
770 Ga0316576_10115217 3300031727 Bacteria 2016
771 Ga0316576_10125769 3300031727 Bacteria 1926
772 Ga0316576_10129454 3300031727 Bacteria 1898
773 Ga0316576_10132290 3300031727 Bacteria 1877
774 Ga0316576_10155933 3300031727 Bacteria 1721
775 Ga0316576_10162064 3300031727 Bacteria 1687
776 Ga0316576_10237148 3300031727 Bacteria 1371
777 Ga0316576_10405174 3300031727 Bacteria 1010
778 Ga0316576_10514197 3300031727 Bacteria 880
779 Ga0316576_10947083 3300031727 Bacteria 615
780 Ga0316576_11143768 3300031727 Bacteria 551
781 Ga0316578_10002390 3300031728 Bacteria 8210
782 Ga0316578_10002871 3300031728 Bacteria 7704
783 Ga0316578_10003816 3300031728 Bacteria 6981
784 Ga0316578_10010349 3300031728 Bacteria 4839
785 Ga0316578_10025441 3300031728 Bacteria 3328
786 Ga0316578_10025755 3300031728 Bacteria 3310
787 Ga0316578_10070604 3300031728 Bacteria 2067
788 Ga0316578_10071160 3300031728 Bacteria 2059
789 Ga0316578_10079834 3300031728 Bacteria 1946
790 Ga0316578_10117559 3300031728 Bacteria 1597
791 Ga0316578_10159106 3300031728 Bacteria 1361
792 Ga0316578_10344108 3300031728 Bacteria 888
793 Ga0316578_10631250 3300031728 Bacteria 626
794 Ga0316578_10830107 3300031728 Bacteria 535
795 Ga0307516_10140749 3300031730 Bacteria 2183
796 Ga0307516_10184359 3300031730 Bacteria 1818
797 Ga0307516_10726710 3300031730 Bacteria 651
798 Ga0307405_10252890 3300031731 Bacteria 1312
799 Ga0316577_10000967 3300031733 Bacteria 12817
800 Ga0316577_10001901 3300031733 Bacteria 10097
801 Ga0316577_10006195 3300031733 Bacteria 6312
802 Ga0316577_10008440 3300031733 Bacteria 5522
803 Ga0316577_10015752 3300031733 Bacteria 4160
804 Ga0316577_10026823 3300031733 Bacteria 3210
805 Ga0316577_10027647 3300031733 Bacteria 3163
806 Ga0316577_10128277 3300031733 Bacteria 1427
807 Ga0316577_10169666 3300031733 Bacteria 1231
808 Ga0316577_10268103 3300031733 Bacteria 966
809 Ga0316577_10457147 3300031733 Bacteria 725
810 Ga0307413_10232804 3300031824 Bacteria 1354
811 Ga0307413_10467415 3300031824 Bacteria 1005
812 Ga0307413_10551424 3300031824 Bacteria 935
813 Ga0307413_11928749 3300031824 Bacteria 531
814 Ga0307410_10585425 3300031852 Bacteria 929
815 Ga0307410_10721614 3300031852 Bacteria 842
816 Ga0307406_10002004 3300031901 Bacteria 11113
817 Ga0307412_10000781 3300031911 Bacteria 18387
818 Ga0307412_10059437 3300031911 Bacteria 2562
819 Ga0307412_10798813 3300031911 Bacteria 819
820 Ga0307412_11834511 3300031911 Bacteria 558
821 Ga0307416_100013048 3300032002 Bacteria 5631
822 Ga0307416_100522706 3300032002 Bacteria 1255
823 Ga0307416_101038308 3300032002 Bacteria 923
824 Ga0307416_101221250 3300032002 Bacteria 857
825 Ga0307414_10010322 3300032004 Bacteria 5412
826 Ga0307414_10174417 3300032004 Bacteria 1722
827 Ga0307414_10179188 3300032004 Bacteria 1702
828 Ga0307414_10356475 3300032004 Bacteria 1257
829 Ga0307414_10410054 3300032004 Bacteria 1179
830 Ga0307414_10608997 3300032004 Bacteria 980
831 Ga0307411_10915952 3300032005 Bacteria 780
832 Ga0316583_10001999 3300032133 Bacteria 6976
833 Ga0316583_10002545 3300032133 Bacteria 6351
834 Ga0316583_10007773 3300032133 Bacteria 3866
835 Ga0316583_10011745 3300032133 Bacteria 3158
836 Ga0316583_10073338 3300032133 Bacteria 1197
837 Ga0316583_10183043 3300032133 Bacteria 728
838 Ga0316585_10029715 3300032137 Bacteria 1712
839 Ga0316585_10050096 3300032137 Bacteria 1340
840 Ga0316585_10073295 3300032137 Bacteria 1112
841 Ga0316585_10161384 3300032137 Bacteria 740
842 Ga0316585_10205620 3300032137 Bacteria 651
843 Ga0316585_10226210 3300032137 Bacteria 619
844 Ga0316585_10306946 3300032137 Bacteria 527
845 Ga0316580_10000629 3300032139 Bacteria 8312
846 Ga0316580_10000991 3300032139 Bacteria 7073
847 Ga0316580_10001942 3300032139 Bacteria 5571
848 Ga0316580_10006714 3300032139 Bacteria 3402
849 Ga0316580_10023405 3300032139 Bacteria 1907
850 Ga0316580_10025521 3300032139 Bacteria 1828
851 Ga0316580_10029179 3300032139 Bacteria 1706
852 Ga0316580_10050738 3300032139 Bacteria 1279
853 Ga0316593_10000037 3300032168 Bacteria 14308
854 Ga0316593_10000090 3300032168 Bacteria 11405
855 Ga0316593_10000105 3300032168 Bacteria 11043
856 Ga0316593_10000170 3300032168 Bacteria 9614
857 Ga0316593_10000239 3300032168 Bacteria 8907
858 Ga0316593_10001113 3300032168 Bacteria 5670
859 Ga0316593_10001316 3300032168 Bacteria 5415
860 Ga0316593_10001765 3300032168 Bacteria 4911
861 Ga0316593_10002310 3300032168 Bacteria 4482
862 Ga0316593_10002877 3300032168 Bacteria 4177
863 Ga0316593_10003511 3300032168 Bacteria 3904
864 Ga0316593_10003674 3300032168 Bacteria 3840
865 Ga0316593_10004626 3300032168 Bacteria 3550
866 Ga0316593_10005492 3300032168 Bacteria 3349
867 Ga0316593_10005752 3300032168 Bacteria 3300
868 Ga0316593_10005754 3300032168 Bacteria 3300
869 Ga0316593_10006095 3300032168 Bacteria 3234
870 Ga0316593_10006651 3300032168 Bacteria 3134
871 Ga0316593_10006666 3300032168 Bacteria 3132
872 Ga0316593_10009160 3300032168 Bacteria 2787
873 Ga0316593_10009462 3300032168 Bacteria 2753
874 Ga0316593_10017013 3300032168 Bacteria 2213
875 Ga0316593_10023909 3300032168 Bacteria 1933
876 Ga0316593_10024309 3300032168 Bacteria 1920
877 Ga0316593_10035643 3300032168 Bacteria 1637
878 Ga0316593_10041816 3300032168 Bacteria 1526
879 Ga0316593_10046536 3300032168 Bacteria 1457
880 Ga0316593_10059026 3300032168 Bacteria 1309
881 Ga0316593_10094491 3300032168 Bacteria 1055
882 Ga0316593_10102570 3300032168 Bacteria 1016
883 Ga0316593_10148823 3300032168 Bacteria 851
884 Ga0316593_10261610 3300032168 Bacteria 649
885 Ga0316593_10324626 3300032168 Bacteria 586
886 Ga0316593_10434371 3300032168 Bacteria 511
887 Ga0307507_10040591 3300033179 Bacteria 4671
888 Ga0316592_1000006 3300033524 Bacteria 14706
889 Ga0316592_1000008 3300033524 Bacteria 14268
890 Ga0316592_1000152 3300033524 Bacteria 7849
891 Ga0316592_1000166 3300033524 Bacteria 7627
892 Ga0316592_1000320 3300033524 Bacteria 6251
893 Ga0316592_1000527 3300033524 Bacteria 5398
894 Ga0316592_1000901 3300033524 Bacteria 4510
895 Ga0316592_1007736 3300033524 Bacteria 2104
896 Ga0316592_1011845 3300033524 Bacteria 1779
897 Ga0316592_1014072 3300033524 Bacteria 1656
898 Ga0316592_1030984 3300033524 Bacteria 1163
899 Ga0316592_1037924 3300033524 Bacteria 1061
900 Ga0316592_1063588 3300033524 Bacteria 830
901 Ga0316592_1083117 3300033524 Bacteria 729
902 Ga0316592_1105302 3300033524 Bacteria 650
903 Ga0316592_1167089 3300033524 Bacteria 523
904 Ga0316586_1000062 3300033527 Bacteria 7865
905 Ga0316586_1000811 3300033527 Bacteria 3263
906 Ga0316586_1001007 3300033527 Bacteria 3030
907 Ga0316586_1001156 3300033527 Bacteria 2906
908 Ga0316586_1003655 3300033527 Bacteria 2042
909 Ga0316586_1005762 3300033527 Bacteria 1755
910 Ga0316586_1008619 3300033527 Bacteria 1514
911 Ga0316586_1009742 3300033527 Bacteria 1444
912 Ga0316586_1010601 3300033527 Bacteria 1399
913 Ga0316586_1010928 3300033527 Bacteria 1383
914 Ga0316586_1024940 3300033527 Bacteria 1005
915 Ga0316586_1036446 3300033527 Bacteria 855
916 Ga0316586_1039744 3300033527 Bacteria 825
917 Ga0316586_1096567 3300033527 Bacteria 562
918 Ga0316588_1000356 3300033528 Bacteria 5927
919 Ga0316588_1000857 3300033528 Bacteria 4618
920 Ga0316588_1001732 3300033528 Bacteria 3663
921 Ga0316588_1002922 3300033528 Bacteria 3045
922 Ga0316588_1010833 3300033528 Bacteria 1932
923 Ga0316588_1050547 3300033528 Bacteria 1007
924 Ga0316588_1122647 3300033528 Bacteria 658
925 Ga0316588_1126439 3300033528 Bacteria 648
926 Ga0316588_1157135 3300033528 Bacteria 585
927 Ga0316587_1000178 3300033529 Bacteria 5352
928 Ga0316587_1000791 3300033529 Bacteria 3505
929 Ga0316587_1001181 3300033529 Bacteria 3119
930 Ga0316587_1003199 3300033529 Bacteria 2273
931 Ga0316587_1005587 3300033529 Bacteria 1892
932 Ga0316587_1008270 3300033529 Bacteria 1632
933 Ga0316587_1010578 3300033529 Bacteria 1477
934 Ga0316587_1011466 3300033529 Bacteria 1431
935 Ga0316587_1026777 3300033529 Bacteria 1006
936 Ga0316587_1045853 3300033529 Bacteria 795
937 Ga0316587_1050351 3300033529 Bacteria 762
938 Ga0316587_1094742 3300033529 Bacteria 571
939 Ga0316596_1000013 3300033541 Bacteria 16477
940 Ga0316596_1000016 3300033541 Bacteria 15149
941 Ga0316596_1000017 3300033541 Bacteria 15063
942 Ga0316596_1000064 3300033541 Bacteria 12159
943 Ga0316596_1000073 3300033541 Bacteria 11690
944 Ga0316596_1000324 3300033541 Bacteria 7741
945 Ga0316596_1000471 3300033541 Bacteria 6810
946 Ga0316596_1000860 3300033541 Bacteria 5693
947 Ga0316596_1000888 3300033541 Bacteria 5638
948 Ga0316596_1001224 3300033541 Bacteria 5067
949 Ga0316596_1001882 3300033541 Bacteria 4383
950 Ga0316596_1003301 3300033541 Bacteria 3519
951 Ga0316596_1009708 3300033541 Bacteria 2312
952 Ga0316596_1010400 3300033541 Bacteria 2250
953 Ga0316596_1019412 3300033541 Bacteria 1725
954 Ga0316596_1024016 3300033541 Bacteria 1564
955 Ga0316596_1039748 3300033541 Bacteria 1234
956 Ga0316596_1040223 3300033541 Bacteria 1228
957 Ga0316596_1048167 3300033541 Bacteria 1126
958 Ga0316596_1050348 3300033541 Bacteria 1102
959 Ga0316596_1094331 3300033541 Bacteria 807
960 Ga0316596_1096969 3300033541 Bacteria 796
961 Ga0316596_1099481 3300033541 Bacteria 786
962 Ga0316596_1114383 3300033541 Bacteria 733
963 Ga0316596_1120386 3300033541 Bacteria 714
964 Ga0316596_1137235 3300033541 Bacteria 669
965 Ga0316596_1178790 3300033541 Bacteria 587
966 Ga0316596_1195447 3300033541 Bacteria 562
967 Ga0373959_0108869 3300034820 Bacteria 667
968 Ga0373951_0127358 3300035091 Bacteria 698
969 Ga0373952_0284129 3300035092 Bacteria 511
970 Ga0316574_0003365 3300035398 Bacteria 8235
971 Ga0316574_0009388 3300035398 Bacteria 5478
972 Ga0316574_0014334 3300035398 Bacteria 4579
973 Ga0316574_0015724 3300035398 Bacteria 4393
974 Ga0316574_0022885 3300035398 Bacteria 3726
975 Ga0316574_0037126 3300035398 Bacteria 2986
976 Ga0316574_0043878 3300035398 Bacteria 2764
977 Ga0316574_0052893 3300035398 Bacteria 2534
978 Ga0316574_0065682 3300035398 Bacteria 2284
979 Ga0316574_0080197 3300035398 Bacteria 2071
980 Ga0316574_0167088 3300035398 Bacteria 1417
981 Ga0316574_0206123 3300035398 Bacteria 1262
982 Ga0316574_0393407 3300035398 Bacteria 873
983 Ga0316574_0432652 3300035398 Bacteria 826
984 Ga0316574_0519034 3300035398 Bacteria 741
985 Ga0316574_0818961 3300035398 Bacteria 566
986 Ga0316582_0000535 3300036647 Bacteria 14503
987 Ga0316582_0007722 3300036647 Bacteria 5743
988 Ga0316582_0009607 3300036647 Bacteria 5255
989 Ga0316582_0009817 3300036647 Bacteria 5211
990 Ga0316582_0045489 3300036647 Bacteria 2764
991 Ga0316582_0069080 3300036647 Bacteria 2283
992 Ga0316582_0116894 3300036647 Bacteria 1781
993 Ga0316582_0142125 3300036647 Bacteria 1618
994 Ga0316582_0195133 3300036647 Bacteria 1380
995 Ga0316582_0253038 3300036647 Bacteria 1207
996 Ga0316582_0327449 3300036647 Bacteria 1053
997 Ga0316582_0874963 3300036647 Bacteria 615
998 Ga0316582_0929862 3300036647 Bacteria 594
999 Ga0316584_0000609 3300036712 Bacteria 19432
1000 Ga0316584_0021743 3300036712 Bacteria 4667
1001 Ga0316584_0038333 3300036712 Bacteria 3565
1002 Ga0316584_0045352 3300036712 Bacteria 3281
1003 Ga0316584_0072361 3300036712 Bacteria 2584
1004 Ga0316584_0123016 3300036712 Bacteria 1938
1005 Ga0316584_0148891 3300036712 Bacteria 1743
1006 Ga0316584_0235482 3300036712 Bacteria 1341
1007 Ga0316584_0269750 3300036712 Bacteria 1239
1008 Ga0316584_0277152 3300036712 Bacteria 1219
1009 Ga0316584_0325327 3300036712 Bacteria 1108
1010 Ga0316584_0627969 3300036712 Bacteria 742
1011 Ga0316584_0727621 3300036712 Bacteria 678
1012 Ga0316584_0949327 3300036712 Bacteria 577
1013 Ga0373925_0560792 3300037068 Bacteria 940
1014 Ga0395899_0040298 3300037312 Bacteria 3493
1015 Ga0395899_0135621 3300037312 Bacteria 1754
1016 Ga0395899_0605066 3300037312 Bacteria 698
1017 Ga0395900_0100423 3300037418 Bacteria 2972
1018 Ga0395900_0851552 3300037418 Bacteria 837
1019 Ga0395898_0131389 3300037466 Bacteria 2398
1020 Ga0395905_0191904 3300037471 Bacteria 1916
1021 Ga0395905_0278731 3300037471 Bacteria 1558
1022 Ga0316581_0028521 3300037588 Bacteria 1673
1023 Ga0316581_0048004 3300037588 Bacteria 1306
1024 Ga0316581_0163692 3300037588 Bacteria 685
1025 Ga0395901_0035575 3300038443 Bacteria 5146
1026 Ga0395901_0105050 3300038443 Bacteria 2964
1027 Ga0395901_0130755 3300038443 Bacteria 2638
1028 Ga0237819_00026 3300038705 Bacteria 50539
1029 Ga0237819_01145 3300038705 Bacteria 7617
1030 Ga0400484_21948 3300038725 Bacteria 1747
1031 Ga0400484_26615 3300038725 Bacteria 15410
1032 Ga0400484_28932 3300038725 Bacteria 10422
1033 Ga0400484_30405 3300038725 Bacteria 18960
1034 Ga0400490_00437 3300038726 Bacteria 17578
1035 Ga0400490_04587 3300038726 Bacteria 5258
1036 Ga0400490_09731 3300038726 Bacteria 5915
1037 Ga0400490_11910 3300038726 Bacteria 15668
1038 Ga0400490_45348 3300038726 Bacteria 8083
1039 Ga0400490_58965 3300038726 Bacteria 11519
1040 Ga0400491_03737 3300038727 Bacteria 1075
1041 Ga0400491_05686 3300038727 Bacteria 2006
1042 Ga0400491_23703 3300038727 Bacteria 3398
1043 Ga0400485_15858 3300038735 Bacteria 1637
1044 Ga0400485_16414 3300038735 Bacteria 1497
1045 Ga0400488_25343 3300038741 Bacteria 4439
1046 Ga0400488_33732 3300038741 Bacteria 1509
1047 Ga0400488_38355 3300038741 Bacteria 4911
1048 Ga0400488_47685 3300038741 Bacteria 2179
1049 Ga0400488_48084 3300038741 Bacteria 3492
1050 Ga0400486_01341 3300038742 Bacteria 7086
1051 Ga0400486_06901 3300038742 Bacteria 5727
1052 Ga0400486_21344 3300038742 Bacteria 12917
1053 Ga0400483_019829 3300039062 Bacteria 1701
1054 Ga0400483_073836 3300039062 Bacteria 21552
1055 Ga0400483_085104 3300039062 Bacteria 8941
1056 Ga0400483_113587 3300039062 Bacteria 1611
1057 Ga0400483_119721 3300039062 Bacteria 1730
1058 Ga0400483_153100 3300039062 Bacteria 13456
1059 Ga0400483_228820 3300039062 Bacteria 9087
1060 Ga0400483_233637 3300039062 Bacteria 29223
1061 Ga0400483_246247 3300039062 Bacteria 3858
1062 Ga0400483_256558 3300039062 Bacteria 4380
1063 Ga0400483_266885 3300039062 Bacteria 1694
1064 Ga0400483_282411 3300039062 Bacteria 6190
1065 Ga0400489_44403 3300039093 Bacteria 9386
1066 Ga0400489_73450 3300039093 Bacteria 1419
1067 Ga0400487_38625 3300039110 Bacteria 13678
1068 Ga0400487_60385 3300039110 Bacteria 6465
1069 Ga0436365_0390798 3300039437 Bacteria 26679
1070 Ga0436365_0804640 3300039437 Bacteria 2249
1071 Ga0436365_0845481 3300039437 Bacteria 957
1072 Ga0436360_0872094 3300039438 Bacteria 933
1073 Ga0436361_0341318 3300039447 Bacteria 778
1074 Ga0436363_0507755 3300039450 Bacteria 606
1075 Ga0439436_0000027 3300041404 Bacteria 53417
1076 Ga0439438_000016 3300041405 Bacteria 128189
1077 Ga0439438_000406 3300041405 Bacteria 19354
1078 Ga0439438_074814 3300041405 Bacteria 835
1079 Ga0439447_002630 3300041407 Bacteria 6514
1080 Ga0439447_023672 3300041407 Bacteria 1597
1081 Ga0439447_108383 3300041407 Bacteria 637
1082 Ga0439466_0000011 3300041411 Bacteria 221134
1083 Ga0439466_0001991 3300041411 Bacteria 8008
1084 Ga0439465_0000141 3300041413 Bacteria 17802
1085 Ga0439465_0164329 3300041413 Bacteria 797
1086 Ga0451789_0621368 3300041443 Bacteria 746
1087 Ga0451789_0864582 3300041443 Bacteria 1288
1088 Ga0451790_50732 3300041444 Bacteria 626
1089 Ga0451792_17887 3300041445 Bacteria 898
1090 Ga0451791_0285136 3300041451 Bacteria 2195
1091 Ga0451791_0398483 3300041451 Bacteria 516
1092 Ga0451791_0591736 3300041451 Bacteria 851
1093 Ga0451791_1092867 3300041451 Bacteria 752
1094 Ga0451793_0147297 3300041452 Bacteria 2774
1095 Ga0451793_1283045 3300041452 Bacteria 565
1096 Ga0451797_0708520 3300041453 Bacteria 1735
1097 Ga0451801_36357 3300041455 Bacteria 935
1098 Ga0451795_0482512 3300041456 Bacteria 1000
1099 Ga0451798_0304695 3300041458 Bacteria 723
1100 Ga0451798_0776824 3300041458 Bacteria 542
1101 Ga0451800_1057945 3300041459 Bacteria 15810
1102 Ga0451802_0320625 3300041460 Bacteria 906
1103 Ga0451802_0850886 3300041460 Bacteria 1194
1104 Ga0451805_070913 3300041461 Bacteria 2877
1105 Ga0451806_234332 3300041462 Bacteria 19745
1106 Ga0451804_0273190 3300041463 Bacteria 1635
1107 Ga0451807_0203642 3300041486 Bacteria 6914
1108 Ga0451833_0641876 3300041491 Bacteria 1012
1109 Ga0451837_0138569 3300041494 Bacteria 3907
1110 Ga0451839_1074144 3300041496 Bacteria 1008
1111 Ga0451841_1135274 3300041498 Bacteria 2550
1112 Ga0451846_29185 3300041502 Bacteria 1131
1113 Ga0451849_0833378 3300041505 Bacteria 1006
1114 Ga0451851_0732648 3300041507 Bacteria 974
1115 Ga0451843_0113374 3300041509 Bacteria 1228
1116 Ga0451843_0415897 3300041509 Bacteria 650
1117 Ga0451854_31420 3300041510 Bacteria 684
1118 Ga0451853_0065199 3300041512 Bacteria 2396
1119 Ga0451853_0286797 3300041512 Bacteria 871
1120 Ga0451853_1411631 3300041512 Bacteria 2164
1121 Ga0451853_3999158 3300041512 Bacteria 1074
1122 Ga0439431_0166628 3300041997 Bacteria 631
1123 Ga0439437_001344 3300042000 Bacteria 2586
1124 Ga0439445_0049863 3300042004 Bacteria 1128
1125 Ga0439445_0081424 3300042004 Bacteria 905
1126 Ga0439445_0092543 3300042004 Bacteria 852
1127 Ga0439432_000824 3300042006 Bacteria 11560
1128 Ga0439432_001037 3300042006 Bacteria 10543
1129 Ga0439432_002401 3300042006 Bacteria 7068
1130 Ga0439432_011571 3300042006 Bacteria 3040
1131 Ga0439432_014624 3300042006 Bacteria 2655
1132 Ga0439432_124463 3300042006 Bacteria 762
1133 Ga0439432_154018 3300042006 Bacteria 674
1134 Ga0439449_0002484 3300042007 Bacteria 7209
1135 Ga0439449_0098257 3300042007 Bacteria 1081
1136 Ga0439452_000010 3300042010 Bacteria 459139
1137 Ga0439452_000384 3300042010 Bacteria 26380
1138 Ga0439452_000388 3300042010 Bacteria 26215
1139 Ga0439452_117984 3300042010 Bacteria 565
1140 Ga0439456_006490 3300042013 Bacteria 2391
1141 Ga0439463_000335 3300042016 Bacteria 13091
1142 Ga0450911_000978 3300042115 Bacteria 7421
1143 Ga0450902_030872 3300042137 Bacteria 902
1144 Ga0450904_000176 3300042139 Bacteria 13995
1145 Ga0450907_001837 3300042146 Bacteria 4361
1146 Ga0439446_0033772 3300042156 Bacteria 1487
1147 Ga0450908_003237 3300042184 Bacteria 3168
1148 Ga0439434_0006646 3300042435 Bacteria 3380
1149 Ga0439459_0010896 3300042438 Bacteria 1593
1150 Ga0439459_0203660 3300042438 Bacteria 541
1151 Ga0439464_0001845 3300042439 Bacteria 5115
1152 Ga0439464_0001931 3300042439 Bacteria 5010
1153 Ga0439464_0004320 3300042439 Bacteria 3632
1154 Ga0450916_063459 3300042530 Bacteria 604
1155 Ga0450893_0001607 3300042532 Bacteria 3464
1156 Ga0451577_0007309 3300042876 Bacteria 10874
1157 Ga0466982_0000210 3300044672 Bacteria 15368
1158 Ga0453683_0029666 3300044673 Bacteria 3458
1159 Ga0453684_0001268 3300044712 Bacteria 75704
1160 Ga0453684_0623450 3300044712 Bacteria 1180
1161 Ga0466968_0654986 3300044735 Bacteria 533
1162 Ga0466957_0089266 3300044842 Bacteria 1929
1163 Ga0451576_1702569 3300045051 Bacteria 653
1164 Ga0466967_0567214 3300045976 Bacteria 1118
1165 Ga0466967_0601757 3300045976 Bacteria 1085
1166 Ga0495617_000213 3300046452 Bacteria 35551
1167 Ga0495617_058347 3300046452 Bacteria 1279
1168 Ga0495627_000696 3300046453 Bacteria 25746
1169 Ga0495591_000658 3300046458 Bacteria 25518
1170 Ga0495591_001371 3300046458 Bacteria 15266
1171 Ga0495638_0001525 3300046460 Bacteria 20852
1172 Ga0495638_0001912 3300046460 Bacteria 17955
1173 Ga0495638_0050575 3300046460 Bacteria 2595
1174 Ga0495650_0000787 3300046471 Bacteria 38830
1175 Ga0495650_0001108 3300046471 Bacteria 29502
1176 Ga0495650_0001677 3300046471 Bacteria 20464
1177 Ga0495650_0011587 3300046471 Bacteria 4817
1178 Ga0495650_0022825 3300046471 Bacteria 2992
1179 Ga0495650_0055509 3300046471 Bacteria 1611
1180 Ga0495605_0011977 3300046474 Bacteria 4821
1181 Ga0495605_0156182 3300046474 Bacteria 1015
1182 Ga0495584_0001537 3300046491 Bacteria 13711
1183 Ga0495584_0011469 3300046491 Bacteria 4539
1184 Ga0495596_0004550 3300046500 Bacteria 6740
1185 Ga0495607_0000012 3300046501 Bacteria 195369
1186 Ga0495607_0018006 3300046501 Bacteria 4515
1187 Ga0495607_0023571 3300046501 Bacteria 3851
1188 Ga0495607_0033957 3300046501 Bacteria 3100
1189 Ga0495606_0001257 3300046507 Bacteria 35388
1190 Ga0495606_0001303 3300046507 Bacteria 34371
1191 Ga0495606_0009659 3300046507 Bacteria 8123
1192 Ga0495606_0070965 3300046507 Bacteria 2194
1193 Ga0495610_0001380 3300046512 Bacteria 21565
1194 Ga0495610_0011725 3300046512 Bacteria 5329
1195 Ga0495610_0074761 3300046512 Bacteria 1571
1196 Ga0495616_0089266 3300046513 Bacteria 1463
1197 Ga0495620_0001298 3300046515 Bacteria 15206
1198 Ga0495620_0007668 3300046515 Bacteria 5837
1199 Ga0495620_0027402 3300046515 Bacteria 2666
1200 Ga0495631_0009976 3300046518 Bacteria 4721
1201 Ga0495631_0021513 3300046518 Bacteria 3003
1202 Ga0495631_0051702 3300046518 Bacteria 1795
1203 Ga0495632_0005953 3300046519 Bacteria 7945
1204 Ga0495632_0025323 3300046519 Bacteria 3140
1205 Ga0495632_0025699 3300046519 Bacteria 3111
1206 Ga0495637_0002718 3300046520 Bacteria 9640
1207 Ga0495637_0076697 3300046520 Bacteria 1339
1208 Ga0495643_0010313 3300046522 Bacteria 5754
1209 Ga0495643_0064611 3300046522 Bacteria 1933
1210 Ga0495643_0232132 3300046522 Bacteria 869
1211 Ga0495644_0000420 3300046523 Bacteria 18895
1212 Ga0495648_0021547 3300046524 Bacteria 4459
1213 Ga0495648_0025079 3300046524 Bacteria 4044
1214 Ga0495648_0326885 3300046524 Bacteria 708
1215 Ga0495654_0000178 3300046530 Bacteria 62611
1216 Ga0495654_0000730 3300046530 Bacteria 25592
1217 Ga0495654_0001501 3300046530 Bacteria 15950
1218 Ga0495654_0012399 3300046530 Bacteria 4580
1219 Ga0495654_0055682 3300046530 Bacteria 1913
1220 Ga0495609_0000089 3300046538 Bacteria 107029
1221 Ga0495609_0001578 3300046538 Bacteria 14896
1222 Ga0495597_0001226 3300046542 Bacteria 19105
1223 Ga0495633_0029543 3300046558 Bacteria 2666
1224 Ga0495656_0074115 3300046615 Bacteria 1519
1225 Ga0495668_0003266 3300046616 Bacteria 12327
1226 Ga0495668_0006136 3300046616 Bacteria 7956
1227 Ga0495668_0020102 3300046616 Bacteria 3841
1228 Ga0495611_0000029 3300046648 Bacteria 115887
1229 Ga0495611_0008135 3300046648 Bacteria 4447
1230 Ga0495625_0001724 3300046660 Bacteria 25395
1231 Ga0495625_0005121 3300046660 Bacteria 12114
1232 Ga0495625_0101380 3300046660 Bacteria 1977
1233 Ga0495625_0159043 3300046660 Bacteria 1514
1234 Ga0495661_0044308 3300046665 Bacteria 2728
1235 Ga0495588_0054483 3300046674 Bacteria 2063
1236 Ga0495588_0186328 3300046674 Bacteria 1096
1237 Ga0495670_0016580 3300046691 Bacteria 3622
1238 Ga0495670_0152107 3300046691 Bacteria 1213
1239 Ga0495670_0206763 3300046691 Bacteria 1040
1240 Ga0495671_0000488 3300046692 Bacteria 30667
1241 Ga0495671_0001281 3300046692 Bacteria 17150
1242 Ga0495649_0025971 3300046694 Bacteria 3259
1243 Ga0495649_0150366 3300046694 Bacteria 1223
1244 Ga0495649_0156349 3300046694 Bacteria 1196
1245 Ga0495589_0000144 3300046794 Bacteria 65654
1246 Ga0495589_0000538 3300046794 Bacteria 26421
1247 Ga0495660_0000286 3300046810 Bacteria 46967
1248 Ga0495660_0000352 3300046810 Bacteria 40624
1249 Ga0495660_0000755 3300046810 Bacteria 24422
1250 Ga0495660_0014492 3300046810 Bacteria 4559
1251 Ga0495636_0009335 3300047318 Bacteria 3861
1252 Ga0495672_0000040 3300047320 Bacteria 268573
1253 Ga0495672_0000057 3300047320 Bacteria 221635
1254 Ga0495672_0004046 3300047320 Bacteria 12251
1255 Ga0495672_0159995 3300047320 Bacteria 1159
1256 Ga0495683_0001368 3300047323 Bacteria 16223
1257 Ga0495683_0019053 3300047323 Bacteria 3541
1258 Ga0495679_000001 3300047446 Bacteria 1607568
1259 Ga0495679_001362 3300047446 Bacteria 14046
1260 Ga0495673_0000072 3300047469 Bacteria 213166
1261 Ga0495673_0000498 3300047469 Bacteria 41800
1262 Ga0495673_0000948 3300047469 Bacteria 26258
1263 Ga0495673_0001941 3300047469 Bacteria 15339
1264 Ga0495673_0015229 3300047469 Bacteria 3968
1265 Ga0495681_0023793 3300047470 Bacteria 3243
1266 Ga0495686_0002623 3300047472 Bacteria 16652
1267 Ga0495686_0033604 3300047472 Bacteria 3309
1268 Ga0495686_0252482 3300047472 Bacteria 990
1269 Ga0495686_0563429 3300047472 Bacteria 593
1270 Ga0496100_0005912 3300048903 Bacteria 6632
1271 Ga0496101_0002023 3300048904 Bacteria 12318
1272 Ga0496101_0108578 3300048904 Bacteria 2086
1273 Ga0496101_1187336 3300048904 Bacteria 598
1274 Ga0496101_1282701 3300048904 Bacteria 573
1275 Ga0496102_0030781 3300048905 Bacteria 4805
1276 Ga0496102_0731287 3300048905 Bacteria 912
1277 Ga0496103_0043084 3300048906 Bacteria 2778
1278 Ga0496104_0001892 3300048907 Bacteria 18133
1279 Ga0496104_0016472 3300048907 Bacteria 6715
1280 Ga0496105_0002695 3300048908 Bacteria 12933
1281 Ga0496105_0412489 3300048908 Bacteria 1070
1282 Ga0496106_0001522 3300048909 Bacteria 17429
1283 Ga0496108_0913793 3300048911 Bacteria 753
1284 Ga0496108_1736935 3300048911 Unclassified 513
1285 Ga0496109_0919104 3300048912 Bacteria 813
1286 Ga0496109_1304448 3300048912 Bacteria 662
1287 Ga0496110_0222429 3300048913 Bacteria 1717
1288 Ga0496113_0035458 3300048916 Bacteria 3648
1289 Ga0496115_0000605 3300048918 Bacteria 27378
1290 Ga0496116_0003201 3300048919 Bacteria 16374
1291 Ga0496116_0005339 3300048919 Bacteria 11970
1292 Ga0496116_0006976 3300048919 Bacteria 10121
1293 Ga0496116_0011021 3300048919 Bacteria 7521
1294 Ga0496116_0243440 3300048919 Bacteria 901
1295 Ga0496117_0005477 3300048920 Bacteria 13301
1296 Ga0496117_0011774 3300048920 Bacteria 7796
1297 Ga0496117_0024547 3300048920 Bacteria 4765
1298 Ga0496117_0034005 3300048920 Bacteria 3847
1299 Ga0496117_0100689 3300048920 Bacteria 1829
1300 Ga0496117_0395597 3300048920 Bacteria 699
1301 Ga0496118_0007739 3300048921 Bacteria 11281
1302 Ga0496118_0021422 3300048921 Bacteria 5688
1303 Ga0496118_0026816 3300048921 Bacteria 4896
1304 Ga0496118_0031572 3300048921 Bacteria 4388
1305 Ga0496118_0094354 3300048921 Bacteria 2046
1306 Ga0496118_0110724 3300048921 Bacteria 1823
1307 Ga0496118_0148897 3300048921 Bacteria 1468
1308 Ga0496118_0172911 3300048921 Bacteria 1317
1309 Ga0496118_0220442 3300048921 Bacteria 1104
1310 Ga0496119_0003409 3300048922 Bacteria 16511
1311 Ga0496119_0005901 3300048922 Bacteria 11555
1312 Ga0496119_0006104 3300048922 Bacteria 11284
1313 Ga0496119_0006306 3300048922 Bacteria 11044
1314 Ga0496119_0029409 3300048922 Bacteria 3726
1315 Ga0496119_0035175 3300048922 Bacteria 3285
1316 Ga0496119_0108174 3300048922 Bacteria 1548
1317 Ga0496119_0136252 3300048922 Bacteria 1331
1318 Ga0496120_0001572 3300048923 Bacteria 26689
1319 Ga0496120_0002769 3300048923 Bacteria 17056
1320 Ga0496120_0010944 3300048923 Bacteria 6275
1321 Ga0496120_0030470 3300048923 Bacteria 3278
1322 Ga0496120_0055780 3300048923 Bacteria 2232
1323 Ga0496120_0126218 3300048923 Bacteria 1316
1324 Ga0496120_0181388 3300048923 Bacteria 1033
1325 Ga0496121_0003768 3300048924 Bacteria 21184
1326 Ga0496121_0004539 3300048924 Bacteria 18566
1327 Ga0496121_0016935 3300048924 Bacteria 7487
1328 Ga0496121_0033577 3300048924 Bacteria 4639
1329 Ga0496121_0158242 3300048924 Bacteria 1659
1330 Ga0496121_0203442 3300048924 Bacteria 1409
1331 Ga0496122_0001230 3300048925 Bacteria 43287
1332 Ga0496122_0001405 3300048925 Bacteria 39030
1333 Ga0496122_0008393 3300048925 Bacteria 11157
1334 Ga0496122_0015755 3300048925 Bacteria 7204
1335 Ga0496122_0017548 3300048925 Bacteria 6685
1336 Ga0496122_0024616 3300048925 Bacteria 5262
1337 Ga0496122_0128946 3300048925 Bacteria 1612
1338 Ga0496122_0603965 3300048925 Bacteria 512
1339 Ga0496123_0001008 3300048926 Bacteria 43023
1340 Ga0496123_0001162 3300048926 Bacteria 39028
1341 Ga0496123_0006244 3300048926 Bacteria 11617
1342 Ga0496123_0006598 3300048926 Bacteria 11206
1343 Ga0496123_0006627 3300048926 Bacteria 11177
1344 Ga0496123_0008749 3300048926 Bacteria 9241
1345 Ga0496123_0032023 3300048926 Bacteria 3815
1346 Ga0496123_0044605 3300048926 Bacteria 3030
1347 Ga0496123_0047515 3300048926 Bacteria 2898
1348 Ga0496123_0056797 3300048926 Bacteria 2554
1349 Ga0496123_0289445 3300048926 Bacteria 787
1350 Ga0496123_0318158 3300048926 Bacteria 735
1351 Ga0496123_0490111 3300048926 Bacteria 539
1352 Ga0496124_0000472 3300048927 Bacteria 69226
1353 Ga0496124_0001250 3300048927 Bacteria 38944
1354 Ga0496124_0001586 3300048927 Bacteria 32782
1355 Ga0496124_0004282 3300048927 Bacteria 16770
1356 Ga0496124_0007859 3300048927 Bacteria 11246
1357 Ga0496124_0016466 3300048927 Bacteria 7024
1358 Ga0496124_0027994 3300048927 Bacteria 5046
1359 Ga0496124_0157468 3300048927 Bacteria 1774
1360 Ga0496124_0268946 3300048927 Bacteria 1249
1361 Ga0496125_0000100 3300048928 Bacteria 202713
1362 Ga0496125_0036970 3300048928 Bacteria 4252
1363 Ga0496125_0040942 3300048928 Bacteria 3966
1364 Ga0496125_0187377 3300048928 Bacteria 1370
1365 Ga0496125_0305756 3300048928 Bacteria 972
1366 Ga0496126_0000033 3300048929 Bacteria 368851
1367 Ga0496126_0003866 3300048929 Bacteria 18480
1368 Ga0496126_0013100 3300048929 Bacteria 8457
1369 Ga0496126_0022691 3300048929 Bacteria 6097
1370 Ga0496126_0033686 3300048929 Bacteria 4818
1371 Ga0496126_0083436 3300048929 Bacteria 2820
1372 Ga0496126_0195964 3300048929 Bacteria 1708
1373 Ga0496126_0300169 3300048929 Bacteria 1325
1374 Ga0496126_0330660 3300048929 Bacteria 1250
1375 Ga0496126_0463736 3300048929 Bacteria 1017
1376 Ga0501306_008659 3300049127 Bacteria 1246
1377 Ga0501308_053469 3300049128 Bacteria 596
1378 Ga0501309_026767 3300049129 Bacteria 834
1379 Ga0501310_013500 3300049130 Bacteria 949
1380 Ga0501307_000588 3300049162 Bacteria 2586
1381 Ga0495678_000882 3300049459 Bacteria 26697
1382 Ga0495678_003548 3300049459 Bacteria 9567
1383 Ga0495682_0000520 3300049460 Bacteria 26623
1384 Ga0501312_000128 3300049528 Bacteria 4717
1385 Ga0501313_038755 3300049529 Bacteria 636
1386 Ga0501316_000026 3300049532 Bacteria 6215
1387 Ga0501320_002144 3300049536 Bacteria 1550
1388 Ga0501321_040733 3300049537 Bacteria 653
1389 Ga0501330_018742 3300049546 Bacteria 545
1390 Ga0501338_04571 3300049554 Bacteria 841
1391 Ga0501031_0003929 3300049568 Bacteria 9569
1392 Ga0501031_0453984 3300049568 Bacteria 828
1393 Ga0501032_0002355 3300049569 Bacteria 14808
1394 Ga0501033_0004184 3300049570 Bacteria 11618
1395 Ga0501033_0029320 3300049570 Bacteria 4135
1396 Ga0501033_0745431 3300049570 Bacteria 664
1397 Ga0501034_0090022 3300049571 Bacteria 3067
1398 Ga0501034_0218862 3300049571 Bacteria 1857
1399 Ga0501036_0006195 3300049572 Bacteria 9705
1400 Ga0501036_0083509 3300049572 Bacteria 2700
1401 Ga0501036_1136989 3300049572 Bacteria 637
1402 Ga0501037_0001372 3300049573 Bacteria 17876
1403 Ga0501037_0065318 3300049573 Bacteria 2651
1404 Ga0501038_0000314 3300049574 Bacteria 41462
1405 Ga0501038_0243106 3300049574 Bacteria 1428
1406 Ga0501039_0003833 3300049575 Bacteria 11292
1407 Ga0501039_0797842 3300049575 Bacteria 737
1408 Ga0501040_0319239 3300049576 Bacteria 1111
1409 Ga0501041_0836094 3300049577 Bacteria 591
1410 Ga0501042_0030954 3300049578 Bacteria 3784
1411 Ga0501043_0001324 3300049579 Bacteria 21677
1412 Ga0501043_0011177 3300049579 Bacteria 7030
1413 Ga0501046_0001012 3300049580 Bacteria 27395
1414 Ga0501046_0450357 3300049580 Bacteria 926
1415 Ga0501047_0017837 3300049581 Bacteria 6799
1416 Ga0501047_0244141 3300049581 Bacteria 1645
1417 Ga0501047_0383636 3300049581 Bacteria 1239
1418 Ga0501047_0387183 3300049581 Bacteria 1232
1419 Ga0501047_0669514 3300049581 Bacteria 856
1420 Ga0501047_0675659 3300049581 Bacteria 851
1421 Ga0501047_0884130 3300049581 Bacteria 707
1422 Ga0501067_0194539 3300049583 Bacteria 1130
1423 Ga0501067_0513761 3300049583 Bacteria 670
1424 Ga0501068_0183409 3300049584 Bacteria 1324
1425 Ga0501068_0207541 3300049584 Bacteria 1243
1426 Ga0501068_0713906 3300049584 Bacteria 656
1427 Ga0501070_0557055 3300049586 Bacteria 917
1428 Ga0501071_0741147 3300049587 Bacteria 757
1429 Ga0501073_0005913 3300049589 Bacteria 9132
1430 Ga0501073_1078068 3300049589 Bacteria 552
1431 Ga0501074_0320358 3300049590 Bacteria 1101
1432 Ga0501227_120792 3300049665 Bacteria 707
1433 Ga0501249_042535 3300049679 Bacteria 1033
1434 Ga0501251_073724 3300049681 Bacteria 587
1435 Ga0501257_047708 3300049686 Bacteria 1063
1436 Ga0501225_0105837 3300049705 Bacteria 825
1437 Ga0501080_0145438 3300049742 Bacteria 2191
1438 Ga0501035_0000666 3300049822 Bacteria 37861
1439 Ga0501035_0049862 3300049822 Bacteria 3752
1440 Ga0501035_0349554 3300049822 Bacteria 1237
1441 Ga0501035_0426462 3300049822 Bacteria 1100
1442 Ga0501044_0004802 3300049823 Bacteria 15112
1443 Ga0501044_0025623 3300049823 Bacteria 6252
1444 Ga0501044_0054246 3300049823 Bacteria 4122
1445 Ga0501044_0230592 3300049823 Bacteria 1799
1446 Ga0501044_1369177 3300049823 Bacteria 573
1447 nmdc:mga00v17_1225_c1 3300050491 Bacteria 13469
1448 nmdc:mga00v17_304144_c1 3300050491 Bacteria 1036
1449 nmdc:mga00v17_83351_c1 3300050491 Bacteria 2000
1450 nmdc:mga0qj67_163083_c1 3300050509 Bacteria 1809
1451 nmdc:mga0qj67_757457_c1 3300050509 Bacteria 770
1452 nmdc:mga0sz30_200195_c1 3300050516 Bacteria 887
1453 nmdc:mga0sz30_91353_c1 3300050516 Bacteria 1325
1454 Ga0500643_000120 3300053087 Bacteria 81701
1455 Ga0500651_0003556 3300053093 Bacteria 8533
1456 Ga0500555_001019 3300053103 Bacteria 9511
1457 Ga0500595_034558 3300053119 Bacteria 1671
1458 Ga0500621_000035 3300053126 Bacteria 26463
1459 Ga0500564_040396 3300053138 Bacteria 2148
1460 Ga0500633_0008712 3300053160 Bacteria 2630
1461 Ga0500634_0000084 3300053161 Bacteria 36722
1462 Ga0500645_002030 3300053730 Bacteria 9458
1463 Ga0500661_041519 3300055283 Bacteria 815
1464 Ga0451793_1516371
1465 MRS2a_Contig_30
1466 SwRhRL2b_contig_1764583
1467 JGI24736J21556_1002338
1468 JGI24741J21665_1002066
1469 JGI24740J21852_10005249
1470 JGI24739J22299_10000118
1471 JGI24737J22298_10000685
1472 JGI24737J22298_10004035
1473 JGI24737J22298_10129025
1474 JGI24735J21928_10007003
1475 JGI24735J21928_10080256
1476 JGI24744J21845_10044038
1477 JGI25156J39149_1005142
1478 JGI25162J39368_1001066
1479 JGI25162J39368_1002454
1480 JGI25162J39368_1004075
1481 JGI25154J39366_1007603
1482 JGI25157J39369_1002937
1483 JGI25163J39215_1000088
1484 JGI25164J39214_1000264
1485 JGI25164J39214_1000535
1486 JGI25164J39214_1000666
1487 JGI25152J39213_1000284
1488 JGI25152J39213_1001094
1489 JGI25152J39213_1031566
1490 JGI25150J39212_1000359
1491 JGI25151J46595_10000895
1492 JGI25165J46597_1001865
1493 JGI25165J46597_1004381
1494 JGI25153J46596_10000050
1495 rootH2_10027207
1496 rootH1_10017276
1497 JGI26145J50221_1003575
1498 Ga0006556J51387_1030839
1499 Ga0006558J51389_1019524
1500 Ga0006560J51390_1017170
1501 Ga0006554J51385_1017088
1502 Ga0006554J51385_1021904
1503 Ga0006562J51391_1006869
1504 Ga0006562J51391_1006870
1505 Ga0006562J51391_1017069
1506 Ga0006562J51391_1017070
1507 Ga0055538_1000042
1508 Ga0055538_1000183
1509 Ga0055539_1000055
1510 Ga0055539_1000232
1511 Ga0055533_1000067
1512 Ga0055533_1000224
1513 Ga0055533_1010841
1514 Ga0055532_1000053
1515 Ga0055525_1000103
1516 Ga0055525_1000316
1517 Ga0055542_1000409
1518 Ga0055542_1014770
1519 Ga0055526_1002877
1520 Ga0055537_1000851
1521 Ga0055524_1049473
1522 Ga0055534_1000766
1523 Ga0055528_1002206
1524 Ga0055528_1011134
1525 Ga0055540_1031521
1526 Ga0055531_10000125
1527 Ga0055541_1000042
1528 Ga0055541_1000139
1529 Ga0058692_1000064
1530 Ga0058692_1000156
1531 Ga0058692_1022013
1532 Ga0058692_1023058
1533 Ga0058860_10204723
1534 Ga0065703_1022151
1535 Ga0065714_10000007
1536 Ga0065704_10000076
1537 Ga0065704_10005509
1538 Ga0065704_10006529
1539 Ga0065704_10014593
1540 Ga0065704_10071113
1541 Ga0065712_10069095
1542 Ga0070690_100518754
1543 Ga0070670_100000015
1544 Ga0070670_100167063
1545 Ga0070677_10311487
1546 Ga0070677_10542653
1547 Ga0068869_100088546
1548 Ga0068869_100262223
1549 Ga0068869_100609552
1550 Ga0070666_10000795
1551 Ga0070666_10013955
1552 Ga0070666_11159626
1553 Ga0070680_100161000
1554 Ga0070680_100368235
1555 Ga0070680_101806956
1556 Ga0070682_100020045
1557 Ga0070682_100167309
1558 Ga0070682_100194487
1559 Ga0070682_100254989
1560 Ga0070682_100641984
1561 Ga0070682_100783973
1562 Ga0068868_100448304
1563 Ga0068868_100552881
1564 Ga0070660_100364606
1565 Ga0070660_100769714
1566 Ga0070660_101133068
1567 Ga0070689_100962894
1568 Ga0070691_10125754
1569 Ga0070687_100056000
1570 Ga0070661_100000652
1571 Ga0070661_100222492
1572 Ga0070661_100341807
1573 Ga0070661_100411411
1574 Ga0070692_10015871
1575 Ga0070692_10034401
1576 Ga0070668_100000954
1577 Ga0070668_100096692
1578 Ga0070668_100446646
1579 Ga0070668_100921658
1580 Ga0070668_100951434
1581 Ga0070669_100004607
1582 Ga0070675_100695103
1583 Ga0070675_102040857
1584 Ga0070671_100351743
1585 Ga0070671_100836964
1586 Ga0070674_100412177
1587 Ga0070673_100317799
1588 Ga0070688_100001170
1589 Ga0070688_100546824
1590 Ga0070659_100026058
1591 Ga0070659_100663248
1592 Ga0070667_100000015
1593 Ga0070667_100000041
1594 Ga0070667_100041814
1595 Ga0070667_100294774
1596 Ga0070667_100844605
1597 Ga0070667_100999576
1598 Ga0070667_101929219
1599 Ga0070703_10179391
1600 Ga0070709_10157216
1601 Ga0070709_10809908
1602 Ga0070714_100003062
1603 Ga0070714_100046919
1604 Ga0070714_100158171
1605 Ga0070714_100170555
1606 Ga0070714_100265067
1607 Ga0070713_100006537
1608 Ga0070710_10825403
1609 Ga0070701_10033705
1610 Ga0070711_100079769
1611 Ga0070711_101052196
1612 Ga0070705_100200797
1613 Ga0070705_100676931
1614 Ga0070700_100493287
1615 Ga0070694_100617489
1616 Ga0070663_100001175
1617 Ga0070663_100033068
1618 Ga0070663_100221456
1619 Ga0070663_100224419
1620 Ga0070663_100301257
1621 Ga0070663_100405189
1622 Ga0070663_100411388
1623 Ga0070663_100498503
1624 Ga0070663_100773306
1625 Ga0070678_100101533
1626 Ga0070678_100500660
1627 Ga0070662_100000042
1628 Ga0070662_100030703
1629 Ga0070662_100034778
1630 Ga0070662_100177367
1631 Ga0070662_101273412
1632 Ga0070681_10024176
1633 Ga0070685_10000104
1634 Ga0070679_100027870
1635 Ga0070679_100525863
1636 Ga0070684_101212775
1637 Ga0068853_100003322
1638 Ga0068853_100006635
1639 Ga0068853_100017951
1640 Ga0068853_100056518
1641 Ga0068853_100056677
1642 Ga0068853_100171220
1643 Ga0068853_102455654
1644 Ga0070672_100312180
1645 Ga0070672_100801777
1646 Ga0070695_100551164
1647 Ga0070695_100714179
1648 Ga0070696_100002929
1649 Ga0070693_100010756
1650 Ga0070665_100005720
1651 Ga0070665_100037817
1652 Ga0070665_100038905
1653 Ga0070665_100382972
1654 Ga0070665_100485369
1655 Ga0070665_100651265
1656 Ga0070665_100690977
1657 Ga0070665_101432677
1658 Ga0070704_100042855
1659 Ga0068855_100086783
1660 Ga0068855_100305411
1661 Ga0068855_100741939
1662 Ga0068855_100875033
1663 Ga0070664_100000826
1664 Ga0070664_100043633
1665 Ga0068857_100000609
1666 Ga0068857_100000998
1667 Ga0068857_100183856
1668 Ga0068857_100316089
1669 Ga0068857_100625982
1670 Ga0068857_100773484
1671 Ga0068857_100878841
1672 Ga0068854_100001113
1673 Ga0068854_100001181
1674 Ga0068854_100003601
1675 Ga0068856_100579159
1676 Ga0070702_100628584
1677 Ga0068852_100040531
1678 Ga0068852_100062649
1679 Ga0068852_100229248
1680 Ga0068852_100306097
1681 Ga0068852_100797260
1682 Ga0068852_101100538
1683 Ga0068852_101638784
1684 Ga0068859_100105280
1685 Ga0068859_100182412
1686 Ga0068859_100213954
1687 Ga0068864_100000056
1688 Ga0068864_100015120
1689 Ga0068864_100656690
1690 Ga0068851_10000002
1691 Ga0068851_10002236
1692 Ga0068851_10002465
1693 Ga0068851_10022007
1694 Ga0068851_10305512
1695 Ga0068863_100025318
1696 Ga0068863_100036314
1697 Ga0068863_100064837
1698 Ga0068863_100151591
1699 Ga0068863_100405176
1700 Ga0068858_100022095
1701 Ga0068858_100025123
1702 Ga0068858_100639128
1703 Ga0068858_100927888
1704 Ga0068860_100002410
1705 Ga0068860_100061930
1706 Ga0068860_100345652
1707 Ga0068860_100751366
1708 Ga0068862_100014084
1709 Ga0068862_100394364
1710 Ga0081455_10012710
1711 Ga0081455_10473713
1712 Ga0081540_1000720
1713 Ga0070717_10307945
1714 Ga0070717_10402945
1715 Ga0075365_10637641
1716 Ga0075363_100194892
1717 Ga0075364_10016532
1718 Ga0075364_10378582
1719 Ga0075364_10539599
1720 Ga0075364_11026187
1721 Ga0070712_100875191
1722 Ga0075362_10658544
1723 Ga0075367_10273634
1724 Ga0075369_10273354
1725 Ga0075427_10031688
1726 Ga0075366_10002176
1727 Ga0075366_10105176
1728 Ga0075366_10136831
1729 Ga0097621_100110253
1730 Ga0097621_100129891
1731 Ga0097621_100187814
1732 Ga0097621_100904837
1733 Ga0075370_10275459
1734 Ga0075370_10496105
1735 Ga0068871_100186416
1736 Ga0068871_101101579
1737 Ga0075428_100283735
1738 Ga0075430_100082800
1739 Ga0075430_100151817
1740 Ga0075430_100858636
1741 Ga0075431_100268455
1742 Ga0075433_11221835
1743 Ga0075429_100025677
1744 Ga0068865_100005420
1745 Ga0068865_100664683
1746 Ga0097620_100105293
1747 Ga0097620_100182418
1748 Ga0097620_100213944
1749 Ga0097620_101042712
1750 Ga0099823_1001424
1751 Ga0079104_1011549
1752 Ga0099826_10004264
1753 Ga0105251_10001384
1754 Ga0105251_10003365
1755 Ga0105251_10004275
1756 Ga0105251_10046768
1757 Ga0105251_10113970
1758 Ga0105251_10203057
1759 Ga0105244_10003157
1760 Ga0105244_10003200
1761 Ga0105244_10003679
1762 Ga0105244_10022121
1763 Ga0105244_10039739
1764 Ga0105244_10092708
1765 Ga0105244_10334153
1766 Ga0105244_10360844
1767 Ga0105244_10451587
1768 Ga0105250_10001814
1769 Ga0105250_10001821
1770 Ga0105250_10001822
1771 Ga0105250_10102142
1772 Ga0105250_10169998
1773 Ga0105250_10254294
1774 Ga0105240_10001463
1775 Ga0105240_10020349
1776 Ga0105240_10081338
1777 Ga0105240_10212903
1778 Ga0105240_10283630
1779 Ga0105245_10346633
1780 Ga0105245_10512475
1781 Ga0105247_10002905
1782 Ga0105247_10236253
1783 Ga0105247_10469118
1784 Ga0114129_11327847
1785 Ga0114129_12808648
1786 Ga0105243_10020634
1787 Ga0105243_10033041
1788 Ga0105243_10093860
1789 Ga0105243_10692280
1790 Ga0105243_10699202
1791 Ga0105241_10000672
1792 Ga0105241_10646888
1793 Ga0105241_10659840
1794 Ga0105241_11246006
1795 Ga0105241_11799766
1796 Ga0105242_10002241
1797 Ga0105242_10015431
1798 Ga0105242_10294709
1799 Ga0105248_10001072
1800 Ga0105248_10283186
1801 Ga0105248_10291539
1802 Ga0105248_10346592
1803 Ga0105248_10717759
1804 Ga0105237_10001741
1805 Ga0105237_10005934
1806 Ga0105237_10007392
1807 Ga0105237_10015499
1808 Ga0105237_10218268
1809 Ga0105237_10336995
1810 Ga0105237_10369507
1811 Ga0105238_10168817
1812 Ga0105238_10460288
1813 Ga0105249_10000622
1814 Ga0105249_10026163
1815 Ga0105249_10032534
1816 Ga0105249_10164198
1817 Ga0105249_12702864
1818 Ga0105239_10003327
1819 Ga0105239_10004272
1820 Ga0105239_10004445
1821 Ga0105239_10017757
1822 Ga0105239_10048112
1823 Ga0105239_10141841
1824 Ga0105239_10311902
1825 Ga0105239_10456855
1826 Ga0105239_10847148
1827 Ga0105246_10019344
1828 Ga0105246_10052166
1829 Ga0105246_10198765
1830 Ga0157314_1000299
1831 Ga0157373_10004967
1832 Ga0157373_10018843
1833 Ga0157373_10032828
1834 Ga0157373_10038271
1835 Ga0157373_10322581
1836 Ga0157373_10348475
1837 Ga0157373_10378827
1838 Ga0157371_10004487
1839 Ga0157371_10004889
1840 Ga0157371_10005445
1841 Ga0157371_10020835
1842 Ga0157371_10043348
1843 Ga0157371_10061606
1844 Ga0157371_10094463
1845 Ga0157371_10101459
1846 Ga0157371_10161132
1847 Ga0157371_10250099
1848 Ga0157371_11077206
1849 Ga0157370_10000422
1850 Ga0157370_10005510
1851 Ga0157370_10008351
1852 Ga0157370_10009847
1853 Ga0157370_10110234
1854 Ga0157370_10123222
1855 Ga0157370_10205003
1856 Ga0157370_10255789
1857 Ga0157370_10280480
1858 Ga0157370_10354802
1859 Ga0157370_10367438
1860 Ga0157370_10751193
1861 Ga0157370_10974266
1862 Ga0157369_10004613
1863 Ga0157369_10005087
1864 Ga0157369_10008827
1865 Ga0157369_10375978
1866 Ga0157369_10570688
1867 Ga0157369_11228543
1868 Ga0157374_10007275
1869 Ga0157378_10026963
1870 Ga0157378_10081560
1871 Ga0163162_10005583
1872 Ga0163162_10017452
1873 Ga0163162_10096005
1874 Ga0163162_10180551
1875 Ga0163162_10394279
1876 Ga0157372_10006843
1877 Ga0157372_10012562
1878 Ga0157372_10020902
1879 Ga0157372_10065095
1880 Ga0157372_10270571
1881 Ga0157372_10677983
1882 Ga0157375_10000319
1883 Ga0163163_10000199
1884 Ga0157380_10773522
1885 Ga0182008_10002668
1886 Ga0182008_10006926
1887 Ga0182008_10040391
1888 Ga0182008_10055211
1889 Ga0157379_10122139
1890 Ga0157379_10972511
1891 Ga0157376_10007084
1892 Ga0157376_10380117
1893 Ga0182006_1001639
1894 Ga0182006_1004854
1895 Ga0182006_1010988
1896 Ga0182006_1019907
1897 Ga0182006_1034577
1898 Ga0182006_1049347
1899 Ga0182006_1099774
1900 Ga0182007_10005587
1901 Ga0182007_10014939
1902 Ga0182007_10078677
1903 Ga0182007_10127709
1904 Ga0182005_1000261
1905 Ga0182005_1011381
1906 Ga0182005_1090894
1907 Ga0183360_10821
1908 Ga0163161_10003205
1909 Ga0163161_10016624
1910 Ga0163161_10060757
1911 Ga0163161_10066219
1912 Ga0163161_10113215
1913 Ga0163161_10357291
1914 Ga0163161_10589633
1915 Ga0206354_10784947
1916 Ga0213872_10227045
1917 Ga0213876_10000608
1918 Ga0213876_10190768
1919 Ga0224712_10477116
1920 Ga0224712_10566405
1921 Ga0209435_100298
1922 Ga0209760_100117
1923 Ga0209760_100153
1924 Ga0209760_100166
1925 Ga0209760_108483
1926 Ga0209784_100060
1927 Ga0209784_100218
1928 Ga0209566_100075
1929 Ga0209566_100353
1930 Ga0209674_100100
1931 Ga0209674_100273
1932 Ga0209674_100632
1933 Ga0209147_100096
1934 Ga0209563_100182
1935 Ga0207427_100063
1936 Ga0207427_100270
1937 Ga0209437_100065
1938 Ga0209437_100133
1939 Ga0209437_100616
1940 Ga0209437_100676
1941 Ga0209258_100387
1942 Ga0207425_1000117
1943 Ga0209646_1000276
1944 Ga0209677_100057
1945 Ga0209677_100234
1946 Ga0209148_1002260
1947 Ga0209759_1007895
1948 Ga0209129_1000011
1949 Ga0209129_1000540
1950 Ga0209233_1000085
1951 Ga0209233_1000133
1952 Ga0209233_1003358
1953 Ga0209565_1000415
1954 Ga0209673_1000204
1955 Ga0209130_1005672
1956 Ga0209130_1014121
1957 Ga0209675_1000015
1958 Ga0209676_1000076
1959 Ga0209676_1000110
1960 Ga0209676_1001080
1961 Ga0209025_1000002
1962 Ga0209564_1000037
1963 Ga0209758_1000003
1964 Ga0209050_1000063
1965 Ga0209050_1002971
1966 Ga0209256_1018864
1967 Ga0209051_1000045
1968 Ga0209051_1000283
1969 Ga0209051_1001513
1970 Ga0209051_1007989
1971 Ga0209051_1012543
1972 Ga0209257_1000129
1973 Ga0209257_1000185
1974 Ga0209257_1011177
1975 Ga0209257_1054444
1976 Ga0209257_1139166
1977 Ga0207656_10000010
1978 Ga0207656_10076474
1979 Ga0207656_10083068
1980 Ga0207656_10306820
1981 Ga0207696_1000047
1982 Ga0207696_1000118
1983 Ga0207696_1000168
1984 Ga0207696_1000334
1985 Ga0207696_1001023
1986 Ga0207696_1001545
1987 Ga0207696_1001690
1988 Ga0207696_1001739
1989 Ga0207696_1001745
1990 Ga0207696_1001772
1991 Ga0207696_1004316
1992 Ga0207655_1000104
1993 Ga0207655_1000606
1994 Ga0207655_1001098
1995 Ga0207655_1001191
1996 Ga0207655_1001305
1997 Ga0207655_1002413
1998 Ga0207655_1003289
1999 Ga0207655_1003403
2000 Ga0207655_1003558
2001 Ga0207655_1003709
2002 Ga0207655_1006248
2003 Ga0207655_1023419
2004 Ga0207655_1028068
2005 Ga0207655_1030467
2006 Ga0207655_1186455
2007 Ga0207713_1000049
2008 Ga0207713_1000073
2009 Ga0207713_1001458
2010 Ga0207713_1003194
2011 Ga0207713_1012383
2012 Ga0207713_1013301
2013 Ga0207713_1069892
2014 Ga0207713_1258604
2015 Ga0207653_10166297
2016 Ga0207692_10953701
2017 Ga0207710_10000468
2018 Ga0207710_10004791
2019 Ga0207710_10344820
2020 Ga0207680_10001411
2021 Ga0207680_10040636
2022 Ga0207680_10061368
2023 Ga0207699_10153906
2024 Ga0207645_10791902
2025 Ga0207705_10486669
2026 Ga0207654_10000379
2027 Ga0207707_10953191
2028 Ga0207671_10000380
2029 Ga0207671_10014065
2030 Ga0207671_10017764
2031 Ga0207671_10093262
2032 Ga0207671_10180802
2033 Ga0207662_10082749
2034 Ga0207662_10119540
2035 Ga0207657_10056527
2036 Ga0207649_10000041
2037 Ga0207649_10483093
2038 Ga0207649_10892844
2039 Ga0207649_10955084
2040 Ga0207652_10266670
2041 Ga0207652_10600806
2042 Ga0207681_10001197
2043 Ga0207681_10021631
2044 Ga0207681_10042359
2045 Ga0207681_10535675
2046 Ga0207694_10095814
2047 Ga0207694_10373777
2048 Ga0207650_10000013
2049 Ga0207650_10248506
2050 Ga0207650_10889905
2051 Ga0207650_11891072
2052 Ga0207687_10063514
2053 Ga0207687_10653867
2054 Ga0207664_10087884
2055 Ga0207664_10216074
2056 Ga0207644_10138725
2057 Ga0207644_10385958
2058 Ga0207690_10084403
2059 Ga0207706_10000128
2060 Ga0207706_10030526
2061 Ga0207686_10016851
2062 Ga0207709_10000030
2063 Ga0207709_10000343
2064 Ga0207709_10008703
2065 Ga0207709_10010135
2066 Ga0207709_10011110
2067 Ga0207709_10056312
2068 Ga0207669_10984965
2069 Ga0207704_10355312
2070 Ga0207691_10172788
2071 Ga0207711_10000194
2072 Ga0207711_10000272
2073 Ga0207711_10108211
2074 Ga0207711_10426503
2075 Ga0207711_10803153
2076 Ga0207711_11527427
2077 Ga0207689_10073424
2078 Ga0207689_10099611
2079 Ga0207661_10497578
2080 Ga0207661_12041632
2081 Ga0207679_10000081
2082 Ga0207679_11310009
2083 Ga0207667_10482560
2084 Ga0207667_10569686
2085 Ga0207667_10839570
2086 Ga0207651_10111114
2087 Ga0207651_10397877
2088 Ga0207712_10000839
2089 Ga0207712_10021372
2090 Ga0207712_10038480
2091 Ga0207712_10184842
2092 Ga0207668_10009496
2093 Ga0207668_10435299
2094 Ga0207668_10571449
2095 Ga0207640_10004766
2096 Ga0207640_10219687
2097 Ga0207658_10000005
2098 Ga0207658_10000028
2099 Ga0207658_10075889
2100 Ga0207658_10269819
2101 Ga0207658_10497040
2102 Ga0207677_10031823
2103 Ga0207703_10068783
2104 Ga0207703_10809199
2105 Ga0207639_10000901
2106 Ga0207639_10003844
2107 Ga0207639_10012828
2108 Ga0207639_10086604
2109 Ga0207639_10295782
2110 Ga0207639_11035743
2111 Ga0207678_10005433
2112 Ga0207678_10094890
2113 Ga0207678_10198092
2114 Ga0207678_10377640
2115 Ga0207708_10780472
2116 Ga0207641_10139344
2117 Ga0207641_10953208
2118 Ga0207641_10975505
2119 Ga0207641_11017580
2120 Ga0207641_11163664
2121 Ga0207641_11833177
2122 Ga0207648_10590976
2123 Ga0207676_10000010
2124 Ga0207676_10031174
2125 Ga0207676_10452668
2126 Ga0207674_10003713
2127 Ga0207674_10276418
2128 Ga0207675_100027444
2129 Ga0207675_101375141
2130 Ga0207683_10216641
2131 Ga0207698_10023144
2132 Ga0207698_10032580
2133 Ga0209281_1000874
2134 Ga0209281_1001322
2135 Ga0209281_1001756
2136 Ga0209389_1000020
2137 Ga0209371_1000228
2138 Ga0209371_1000294
2139 Ga0209371_1000302
2140 Ga0209371_1001410
2141 Ga0209371_1002180
2142 Ga0209371_1002194
2143 Ga0209371_1003997
2144 Ga0209371_1006959
2145 Ga0209371_1015144
2146 Ga0209969_1005003
2147 Ga0209969_1007401
2148 Ga0209981_1006526
2149 Ga0209996_1001844
2150 Ga0209984_1014865
2151 Ga0209995_1001985
2152 Ga0209995_1020685
2153 Ga0209995_1063579
2154 Ga0209968_1001116
2155 Ga0209999_1000717
2156 Ga0209999_1012766
2157 Ga0209982_1000139
2158 Ga0209982_1001049
2159 Ga0209970_1039649
2160 Ga0209983_1002894
2161 Ga0209282_1047549
2162 Ga0209971_1000288
2163 Ga0209998_10114225
2164 Ga0209974_10014534
2165 Ga0209974_10323674
2166 Ga0207428_10416354
2167 Ga0268266_10001891
2168 Ga0268266_10002538
2169 Ga0268266_10034750
2170 Ga0268266_10058354
2171 Ga0268266_10065647
2172 Ga0268266_10125644
2173 Ga0268266_10162981
2174 Ga0268266_10316450
2175 Ga0268266_10543976
2176 Ga0268265_10000383
2177 Ga0268265_11209183
2178 Ga0268264_10000036
2179 Ga0268264_10028346
2180 Ga0265334_10000272
2181 Ga0307515_10645580
2182 Ga0265338_10011455
2183 Ga0268256_1000188
2184 Ga0268256_1000258
2185 Ga0268256_1000674
2186 Ga0268256_1001982
2187 Ga0268256_1003119
2188 Ga0268256_1003595
2189 Ga0268256_1003729
2190 Ga0268256_1017177
2191 Ga0268256_1031085
2192 Ga0316177_1166192
2193 Ga0316176_1207210
2194 Ga0314311_1030222
2195 Ga0316178_1033068
2196 Ga0316178_1127651
2197 Ga0316180_1043925
2198 Ga0316183_1040327
2199 Ga0316183_1119066
2200 Ga0316181_1171526
2201 Ga0316182_1129448
2202 Ga0316182_1288898
2203 Ga0265766_1002668
2204 Ga0265325_10002468
2205 Ga0265325_10101495
2206 Ga0265331_10023066
2207 Ga0265327_10001935
2208 Ga0307513_10282596
2209 Ga0307408_100000595
2210 Ga0307408_100000900
2211 Ga0307408_100001790
2212 Ga0307408_100410322
2213 Ga0307408_100866817
2214 Ga0316575_10006210
2215 Ga0316575_10018901
2216 Ga0316575_10028680
2217 Ga0316575_10043459
2218 Ga0316575_10059515
2219 Ga0316575_10300405
2220 Ga0316579_10014436
2221 Ga0316579_10027879
2222 Ga0316579_10090094
2223 Ga0316579_10122014
2224 Ga0316579_10141294
2225 Ga0316579_10146412
2226 Ga0316579_10284115
2227 Ga0316579_10370417
2228 Ga0316579_10418073
2229 Ga0316576_10000365
2230 Ga0316576_10005233
2231 Ga0316576_10025746
2232 Ga0316576_10070262
2233 Ga0316576_10115217
2234 Ga0316576_10125769
2235 Ga0316576_10129454
2236 Ga0316576_10132290
2237 Ga0316576_10155933
2238 Ga0316576_10162064
2239 Ga0316576_10237148
2240 Ga0316576_10405174
2241 Ga0316576_10514197
2242 Ga0316576_10947083
2243 Ga0316576_11143768
2244 Ga0316578_10002390
2245 Ga0316578_10002871
2246 Ga0316578_10003816
2247 Ga0316578_10010349
2248 Ga0316578_10025441
2249 Ga0316578_10025755
2250 Ga0316578_10070604
2251 Ga0316578_10071160
2252 Ga0316578_10079834
2253 Ga0316578_10117559
2254 Ga0316578_10159106
2255 Ga0316578_10344108
2256 Ga0316578_10631250
2257 Ga0316578_10830107
2258 Ga0307516_10140749
2259 Ga0307516_10184359
2260 Ga0307516_10726710
2261 Ga0307405_10252890
2262 Ga0316577_10000967
2263 Ga0316577_10001901
2264 Ga0316577_10006195
2265 Ga0316577_10008440
2266 Ga0316577_10015752
2267 Ga0316577_10026823
2268 Ga0316577_10027647
2269 Ga0316577_10128277
2270 Ga0316577_10169666
2271 Ga0316577_10268103
2272 Ga0316577_10457147
2273 Ga0307413_10232804
2274 Ga0307413_10467415
2275 Ga0307413_10551424
2276 Ga0307413_11928749
2277 Ga0307410_10585425
2278 Ga0307410_10721614
2279 Ga0307406_10002004
2280 Ga0307412_10000781
2281 Ga0307412_10059437
2282 Ga0307412_10798813
2283 Ga0307412_11834511
2284 Ga0307416_100013048
2285 Ga0307416_100522706
2286 Ga0307416_101038308
2287 Ga0307416_101221250
2288 Ga0307414_10010322
2289 Ga0307414_10174417
2290 Ga0307414_10179188
2291 Ga0307414_10356475
2292 Ga0307414_10410054
2293 Ga0307414_10608997
2294 Ga0307411_10915952
2295 Ga0316583_10001999
2296 Ga0316583_10002545
2297 Ga0316583_10007773
2298 Ga0316583_10011745
2299 Ga0316583_10073338
2300 Ga0316583_10183043
2301 Ga0316585_10029715
2302 Ga0316585_10050096
2303 Ga0316585_10073295
2304 Ga0316585_10161384
2305 Ga0316585_10205620
2306 Ga0316585_10226210
2307 Ga0316585_10306946
2308 Ga0316580_10000629
2309 Ga0316580_10000991
2310 Ga0316580_10001942
2311 Ga0316580_10006714
2312 Ga0316580_10023405
2313 Ga0316580_10025521
2314 Ga0316580_10029179
2315 Ga0316580_10050738
2316 Ga0316593_10000037
2317 Ga0316593_10000090
2318 Ga0316593_10000105
2319 Ga0316593_10000170
2320 Ga0316593_10000239
2321 Ga0316593_10001113
2322 Ga0316593_10001316
2323 Ga0316593_10001765
2324 Ga0316593_10002310
2325 Ga0316593_10002877
2326 Ga0316593_10003511
2327 Ga0316593_10003674
2328 Ga0316593_10004626
2329 Ga0316593_10005492
2330 Ga0316593_10005752
2331 Ga0316593_10005754
2332 Ga0316593_10006095
2333 Ga0316593_10006651
2334 Ga0316593_10006666
2335 Ga0316593_10009160
2336 Ga0316593_10009462
2337 Ga0316593_10017013
2338 Ga0316593_10023909
2339 Ga0316593_10024309
2340 Ga0316593_10035643
2341 Ga0316593_10041816
2342 Ga0316593_10046536
2343 Ga0316593_10059026
2344 Ga0316593_10094491
2345 Ga0316593_10102570
2346 Ga0316593_10148823
2347 Ga0316593_10261610
2348 Ga0316593_10324626
2349 Ga0316593_10434371
2350 Ga0307507_10040591
2351 Ga0316592_1000006
2352 Ga0316592_1000008
2353 Ga0316592_1000152
2354 Ga0316592_1000166
2355 Ga0316592_1000320
2356 Ga0316592_1000527
2357 Ga0316592_1000901
2358 Ga0316592_1007736
2359 Ga0316592_1011845
2360 Ga0316592_1014072
2361 Ga0316592_1030984
2362 Ga0316592_1037924
2363 Ga0316592_1063588
2364 Ga0316592_1083117
2365 Ga0316592_1105302
2366 Ga0316592_1167089
2367 Ga0316586_1000062
2368 Ga0316586_1000811
2369 Ga0316586_1001007
2370 Ga0316586_1001156
2371 Ga0316586_1003655
2372 Ga0316586_1005762
2373 Ga0316586_1008619
2374 Ga0316586_1009742
2375 Ga0316586_1010601
2376 Ga0316586_1010928
2377 Ga0316586_1024940
2378 Ga0316586_1036446
2379 Ga0316586_1039744
2380 Ga0316586_1096567
2381 Ga0316588_1000356
2382 Ga0316588_1000857
2383 Ga0316588_1001732
2384 Ga0316588_1002922
2385 Ga0316588_1010833
2386 Ga0316588_1050547
2387 Ga0316588_1122647
2388 Ga0316588_1126439
2389 Ga0316588_1157135
2390 Ga0316587_1000178
2391 Ga0316587_1000791
2392 Ga0316587_1001181
2393 Ga0316587_1003199
2394 Ga0316587_1005587
2395 Ga0316587_1008270
2396 Ga0316587_1010578
2397 Ga0316587_1011466
2398 Ga0316587_1026777
2399 Ga0316587_1045853
2400 Ga0316587_1050351
2401 Ga0316587_1094742
2402 Ga0316596_1000013
2403 Ga0316596_1000016
2404 Ga0316596_1000017
2405 Ga0316596_1000064
2406 Ga0316596_1000073
2407 Ga0316596_1000324
2408 Ga0316596_1000471
2409 Ga0316596_1000860
2410 Ga0316596_1000888
2411 Ga0316596_1001224
2412 Ga0316596_1001882
2413 Ga0316596_1003301
2414 Ga0316596_1009708
2415 Ga0316596_1010400
2416 Ga0316596_1019412
2417 Ga0316596_1024016
2418 Ga0316596_1039748
2419 Ga0316596_1040223
2420 Ga0316596_1048167
2421 Ga0316596_1050348
2422 Ga0316596_1094331
2423 Ga0316596_1096969
2424 Ga0316596_1099481
2425 Ga0316596_1114383
2426 Ga0316596_1120386
2427 Ga0316596_1137235
2428 Ga0316596_1178790
2429 Ga0316596_1195447
2430 Ga0373959_0108869
2431 Ga0373951_0127358
2432 Ga0373952_0284129
2433 Ga0316574_0003365
2434 Ga0316574_0009388
2435 Ga0316574_0014334
2436 Ga0316574_0015724
2437 Ga0316574_0022885
2438 Ga0316574_0037126
2439 Ga0316574_0043878
2440 Ga0316574_0052893
2441 Ga0316574_0065682
2442 Ga0316574_0080197
2443 Ga0316574_0167088
2444 Ga0316574_0206123
2445 Ga0316574_0393407
2446 Ga0316574_0432652
2447 Ga0316574_0519034
2448 Ga0316574_0818961
2449 Ga0316582_0000535
2450 Ga0316582_0007722
2451 Ga0316582_0009607
2452 Ga0316582_0009817
2453 Ga0316582_0045489
2454 Ga0316582_0069080
2455 Ga0316582_0116894
2456 Ga0316582_0142125
2457 Ga0316582_0195133
2458 Ga0316582_0253038
2459 Ga0316582_0327449
2460 Ga0316582_0874963
2461 Ga0316582_0929862
2462 Ga0316584_0000609
2463 Ga0316584_0021743
2464 Ga0316584_0038333
2465 Ga0316584_0045352
2466 Ga0316584_0072361
2467 Ga0316584_0123016
2468 Ga0316584_0148891
2469 Ga0316584_0235482
2470 Ga0316584_0269750
2471 Ga0316584_0277152
2472 Ga0316584_0325327
2473 Ga0316584_0627969
2474 Ga0316584_0727621
2475 Ga0316584_0949327
2476 Ga0373925_0560792
2477 Ga0395899_0040298
2478 Ga0395899_0135621
2479 Ga0395899_0605066
2480 Ga0395900_0100423
2481 Ga0395900_0851552
2482 Ga0395898_0131389
2483 Ga0395905_0191904
2484 Ga0395905_0278731
2485 Ga0316581_0028521
2486 Ga0316581_0048004
2487 Ga0316581_0163692
2488 Ga0395901_0035575
2489 Ga0395901_0105050
2490 Ga0395901_0130755
2491 Ga0237819_00026
2492 Ga0237819_01145
2493 Ga0400484_21948
2494 Ga0400484_26615
2495 Ga0400484_28932
2496 Ga0400484_30405
2497 Ga0400490_00437
2498 Ga0400490_04587
2499 Ga0400490_09731
2500 Ga0400490_11910
2501 Ga0400490_45348
2502 Ga0400490_58965
2503 Ga0400491_03737
2504 Ga0400491_05686
2505 Ga0400491_23703
2506 Ga0400485_15858
2507 Ga0400485_16414
2508 Ga0400488_25343
2509 Ga0400488_33732
2510 Ga0400488_38355
2511 Ga0400488_47685
2512 Ga0400488_48084
2513 Ga0400486_01341
2514 Ga0400486_06901
2515 Ga0400486_21344
2516 Ga0400483_019829
2517 Ga0400483_073836
2518 Ga0400483_085104
2519 Ga0400483_113587
2520 Ga0400483_119721
2521 Ga0400483_153100
2522 Ga0400483_228820
2523 Ga0400483_233637
2524 Ga0400483_246247
2525 Ga0400483_256558
2526 Ga0400483_266885
2527 Ga0400483_282411
2528 Ga0400489_44403
2529 Ga0400489_73450
2530 Ga0400487_38625
2531 Ga0400487_60385
2532 Ga0436365_0390798
2533 Ga0436365_0804640
2534 Ga0436365_0845481
2535 Ga0436360_0872094
2536 Ga0436361_0341318
2537 Ga0436363_0507755
2538 Ga0439436_0000027
2539 Ga0439438_000016
2540 Ga0439438_000406
2541 Ga0439438_074814
2542 Ga0439447_002630
2543 Ga0439447_023672
2544 Ga0439447_108383
2545 Ga0439466_0000011
2546 Ga0439466_0001991
2547 Ga0439465_0000141
2548 Ga0439465_0164329
2549 Ga0451789_0621368
2550 Ga0451789_0864582
2551 Ga0451790_50732
2552 Ga0451792_17887
2553 Ga0451791_0285136
2554 Ga0451791_0398483
2555 Ga0451791_0591736
2556 Ga0451791_1092867
2557 Ga0451793_0147297
2558 Ga0451793_1283045
2559 Ga0451797_0708520
2560 Ga0451801_36357
2561 Ga0451795_0482512
2562 Ga0451798_0304695
2563 Ga0451798_0776824
2564 Ga0451800_1057945
2565 Ga0451802_0320625
2566 Ga0451802_0850886
2567 Ga0451805_070913
2568 Ga0451806_234332
2569 Ga0451804_0273190
2570 Ga0451807_0203642
2571 Ga0451833_0641876
2572 Ga0451837_0138569
2573 Ga0451839_1074144
2574 Ga0451841_1135274
2575 Ga0451846_29185
2576 Ga0451849_0833378
2577 Ga0451851_0732648
2578 Ga0451843_0113374
2579 Ga0451843_0415897
2580 Ga0451854_31420
2581 Ga0451853_0065199
2582 Ga0451853_0286797
2583 Ga0451853_1411631
2584 Ga0451853_3999158
2585 Ga0439431_0166628
2586 Ga0439437_001344
2587 Ga0439445_0049863
2588 Ga0439445_0081424
2589 Ga0439445_0092543
2590 Ga0439432_000824
2591 Ga0439432_001037
2592 Ga0439432_002401
2593 Ga0439432_011571
2594 Ga0439432_014624
2595 Ga0439432_124463
2596 Ga0439432_154018
2597 Ga0439449_0002484
2598 Ga0439449_0098257
2599 Ga0439452_000010
2600 Ga0439452_000384
2601 Ga0439452_000388
2602 Ga0439452_117984
2603 Ga0439456_006490
2604 Ga0439463_000335
2605 Ga0450911_000978
2606 Ga0450902_030872
2607 Ga0450904_000176
2608 Ga0450907_001837
2609 Ga0439446_0033772
2610 Ga0450908_003237
2611 Ga0439434_0006646
2612 Ga0439459_0010896
2613 Ga0439459_0203660
2614 Ga0439464_0001845
2615 Ga0439464_0001931
2616 Ga0439464_0004320
2617 Ga0450916_063459
2618 Ga0450893_0001607
2619 Ga0451577_0007309
2620 Ga0466982_0000210
2621 Ga0453683_0029666
2622 Ga0453684_0001268
2623 Ga0453684_0623450
2624 Ga0466968_0654986
2625 Ga0466957_0089266
2626 Ga0451576_1702569
2627 Ga0466967_0567214
2628 Ga0466967_0601757
2629 Ga0495617_000213
2630 Ga0495617_058347
2631 Ga0495627_000696
2632 Ga0495591_000658
2633 Ga0495591_001371
2634 Ga0495638_0001525
2635 Ga0495638_0001912
2636 Ga0495638_0050575
2637 Ga0495650_0000787
2638 Ga0495650_0001108
2639 Ga0495650_0001677
2640 Ga0495650_0011587
2641 Ga0495650_0022825
2642 Ga0495650_0055509
2643 Ga0495605_0011977
2644 Ga0495605_0156182
2645 Ga0495584_0001537
2646 Ga0495584_0011469
2647 Ga0495596_0004550
2648 Ga0495607_0000012
2649 Ga0495607_0018006
2650 Ga0495607_0023571
2651 Ga0495607_0033957
2652 Ga0495606_0001257
2653 Ga0495606_0001303
2654 Ga0495606_0009659
2655 Ga0495606_0070965
2656 Ga0495610_0001380
2657 Ga0495610_0011725
2658 Ga0495610_0074761
2659 Ga0495616_0089266
2660 Ga0495620_0001298
2661 Ga0495620_0007668
2662 Ga0495620_0027402
2663 Ga0495631_0009976
2664 Ga0495631_0021513
2665 Ga0495631_0051702
2666 Ga0495632_0005953
2667 Ga0495632_0025323
2668 Ga0495632_0025699
2669 Ga0495637_0002718
2670 Ga0495637_0076697
2671 Ga0495643_0010313
2672 Ga0495643_0064611
2673 Ga0495643_0232132
2674 Ga0495644_0000420
2675 Ga0495648_0021547
2676 Ga0495648_0025079
2677 Ga0495648_0326885
2678 Ga0495654_0000178
2679 Ga0495654_0000730
2680 Ga0495654_0001501
2681 Ga0495654_0012399
2682 Ga0495654_0055682
2683 Ga0495609_0000089
2684 Ga0495609_0001578
2685 Ga0495597_0001226
2686 Ga0495633_0029543
2687 Ga0495656_0074115
2688 Ga0495668_0003266
2689 Ga0495668_0006136
2690 Ga0495668_0020102
2691 Ga0495611_0000029
2692 Ga0495611_0008135
2693 Ga0495625_0001724
2694 Ga0495625_0005121
2695 Ga0495625_0101380
2696 Ga0495625_0159043
2697 Ga0495661_0044308
2698 Ga0495588_0054483
2699 Ga0495588_0186328
2700 Ga0495670_0016580
2701 Ga0495670_0152107
2702 Ga0495670_0206763
2703 Ga0495671_0000488
2704 Ga0495671_0001281
2705 Ga0495649_0025971
2706 Ga0495649_0150366
2707 Ga0495649_0156349
2708 Ga0495589_0000144
2709 Ga0495589_0000538
2710 Ga0495660_0000286
2711 Ga0495660_0000352
2712 Ga0495660_0000755
2713 Ga0495660_0014492
2714 Ga0495636_0009335
2715 Ga0495672_0000040
2716 Ga0495672_0000057
2717 Ga0495672_0004046
2718 Ga0495672_0159995
2719 Ga0495683_0001368
2720 Ga0495683_0019053
2721 Ga0495679_000001
2722 Ga0495679_001362
2723 Ga0495673_0000072
2724 Ga0495673_0000498
2725 Ga0495673_0000948
2726 Ga0495673_0001941
2727 Ga0495673_0015229
2728 Ga0495681_0023793
2729 Ga0495686_0002623
2730 Ga0495686_0033604
2731 Ga0495686_0252482
2732 Ga0495686_0563429
2733 Ga0496100_0005912
2734 Ga0496101_0002023
2735 Ga0496101_0108578
2736 Ga0496101_1187336
2737 Ga0496101_1282701
2738 Ga0496102_0030781
2739 Ga0496102_0731287
2740 Ga0496103_0043084
2741 Ga0496104_0001892
2742 Ga0496104_0016472
2743 Ga0496105_0002695
2744 Ga0496105_0412489
2745 Ga0496106_0001522
2746 Ga0496108_0913793
2747 Ga0496108_1736935
2748 Ga0496109_0919104
2749 Ga0496109_1304448
2750 Ga0496110_0222429
2751 Ga0496113_0035458
2752 Ga0496115_0000605
2753 Ga0496116_0003201
2754 Ga0496116_0005339
2755 Ga0496116_0006976
2756 Ga0496116_0011021
2757 Ga0496116_0243440
2758 Ga0496117_0005477
2759 Ga0496117_0011774
2760 Ga0496117_0024547
2761 Ga0496117_0034005
2762 Ga0496117_0100689
2763 Ga0496117_0395597
2764 Ga0496118_0007739
2765 Ga0496118_0021422
2766 Ga0496118_0026816
2767 Ga0496118_0031572
2768 Ga0496118_0094354
2769 Ga0496118_0110724
2770 Ga0496118_0148897
2771 Ga0496118_0172911
2772 Ga0496118_0220442
2773 Ga0496119_0003409
2774 Ga0496119_0005901
2775 Ga0496119_0006104
2776 Ga0496119_0006306
2777 Ga0496119_0029409
2778 Ga0496119_0035175
2779 Ga0496119_0108174
2780 Ga0496119_0136252
2781 Ga0496120_0001572
2782 Ga0496120_0002769
2783 Ga0496120_0010944
2784 Ga0496120_0030470
2785 Ga0496120_0055780
2786 Ga0496120_0126218
2787 Ga0496120_0181388
2788 Ga0496121_0003768
2789 Ga0496121_0004539
2790 Ga0496121_0016935
2791 Ga0496121_0033577
2792 Ga0496121_0158242
2793 Ga0496121_0203442
2794 Ga0496122_0001230
2795 Ga0496122_0001405
2796 Ga0496122_0008393
2797 Ga0496122_0015755
2798 Ga0496122_0017548
2799 Ga0496122_0024616
2800 Ga0496122_0128946
2801 Ga0496122_0603965
2802 Ga0496123_0001008
2803 Ga0496123_0001162
2804 Ga0496123_0006244
2805 Ga0496123_0006598
2806 Ga0496123_0006627
2807 Ga0496123_0008749
2808 Ga0496123_0032023
2809 Ga0496123_0044605
2810 Ga0496123_0047515
2811 Ga0496123_0056797
2812 Ga0496123_0289445
2813 Ga0496123_0318158
2814 Ga0496123_0490111
2815 Ga0496124_0000472
2816 Ga0496124_0001250
2817 Ga0496124_0001586
2818 Ga0496124_0004282
2819 Ga0496124_0007859
2820 Ga0496124_0016466
2821 Ga0496124_0027994
2822 Ga0496124_0157468
2823 Ga0496124_0268946
2824 Ga0496125_0000100
2825 Ga0496125_0036970
2826 Ga0496125_0040942
2827 Ga0496125_0187377
2828 Ga0496125_0305756
2829 Ga0496126_0000033
2830 Ga0496126_0003866
2831 Ga0496126_0013100
2832 Ga0496126_0022691
2833 Ga0496126_0033686
2834 Ga0496126_0083436
2835 Ga0496126_0195964
2836 Ga0496126_0300169
2837 Ga0496126_0330660
2838 Ga0496126_0463736
2839 Ga0501306_008659
2840 Ga0501308_053469
2841 Ga0501309_026767
2842 Ga0501310_013500
2843 Ga0501307_000588
2844 Ga0495678_000882
2845 Ga0495678_003548
2846 Ga0495682_0000520
2847 Ga0501312_000128
2848 Ga0501313_038755
2849 Ga0501316_000026
2850 Ga0501320_002144
2851 Ga0501321_040733
2852 Ga0501330_018742
2853 Ga0501338_04571
2854 Ga0501031_0003929
2855 Ga0501031_0453984
2856 Ga0501032_0002355
2857 Ga0501033_0004184
2858 Ga0501033_0029320
2859 Ga0501033_0745431
2860 Ga0501034_0090022
2861 Ga0501034_0218862
2862 Ga0501036_0006195
2863 Ga0501036_0083509
2864 Ga0501036_1136989
2865 Ga0501037_0001372
2866 Ga0501037_0065318
2867 Ga0501038_0000314
2868 Ga0501038_0243106
2869 Ga0501039_0003833
2870 Ga0501039_0797842
2871 Ga0501040_0319239
2872 Ga0501041_0836094
2873 Ga0501042_0030954
2874 Ga0501043_0001324
2875 Ga0501043_0011177
2876 Ga0501046_0001012
2877 Ga0501046_0450357
2878 Ga0501047_0017837
2879 Ga0501047_0244141
2880 Ga0501047_0383636
2881 Ga0501047_0387183
2882 Ga0501047_0669514
2883 Ga0501047_0675659
2884 Ga0501047_0884130
2885 Ga0501067_0194539
2886 Ga0501067_0513761
2887 Ga0501068_0183409
2888 Ga0501068_0207541
2889 Ga0501068_0713906
2890 Ga0501070_0557055
2891 Ga0501071_0741147
2892 Ga0501073_0005913
2893 Ga0501073_1078068
2894 Ga0501074_0320358
2895 Ga0501227_120792
2896 Ga0501249_042535
2897 Ga0501251_073724
2898 Ga0501257_047708
2899 Ga0501225_0105837
2900 Ga0501080_0145438
2901 Ga0501035_0000666
2902 Ga0501035_0049862
2903 Ga0501035_0349554
2904 Ga0501035_0426462
2905 Ga0501044_0004802
2906 Ga0501044_0025623
2907 Ga0501044_0054246
2908 Ga0501044_0230592
2909 Ga0501044_1369177
2910 nmdc:mga00v17_1225_c1
2911 nmdc:mga00v17_304144_c1
2912 nmdc:mga00v17_83351_c1
2913 nmdc:mga0qj67_163083_c1
2914 nmdc:mga0qj67_757457_c1
2915 nmdc:mga0sz30_200195_c1
2916 nmdc:mga0sz30_91353_c1
2917 Ga0500643_000120
2918 Ga0500651_0003556
2919 Ga0500555_001019
2920 Ga0500595_034558
2921 Ga0500621_000035
2922 Ga0500564_040396
2923 Ga0500633_0008712
2924 Ga0500634_0000084
2925 Ga0500645_002030
2926 Ga0500661_041519

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

51

147

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.977 14 116
8cvm-assembly1.cif.gz_m cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9665 13 116
1nwy-assembly1.cif.gz_L complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin 0.956 12 116
5xym-assembly1.cif.gz_N large subunit of mycobacterium smegmatis 0.9514 10 116
6wru-assembly1.cif.gz_Z structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9509 12 116
ID Description Score Start End Superfamily
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9735 13 115 3.90.1030.10
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9664 13 116 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9647 13 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9643 13 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9556 13 115 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A2E2TK58-F1-model_v4 50S ribosomal protein L17 0.9933 23 120 GO:0003735
GO:0006412
GO:0022625
AF-A0A450YG75-F1-model_v4 50S ribosomal protein L17 0.9925 49 119 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F9ENG3-F1-model_v4 50S ribosomal protein L17 0.9885 20 114 GO:0003735
GO:0006412
GO:0022625
AF-A0A559UJT1-F1-model_v4 deleted 0.9877 14 116
AF-A0A165K8I5-F1-model_v4 50S ribosomal protein L17 0.9876 31 124 GO:0003735
GO:0006412
GO:0022625

Map