F494145
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1463 | 522 | 2926 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300041452|Ga0451793_1516371|Ga0451793_1516371_20_499 |
| Length | 159 |
| Sequence | MAGSDHPQSIVQRQDGDSDLQQFQLSIGTKTMRHQKSGRKFNRTSAHRQAMFSNMAASLFKHELIKTTLPKAKELRRVAEPLITIAKVDGVANRRLAFSRLRDKEAVGKLFVELGPRYQSRPGGYLRILKCGFRAGDNAPMAYVELVDRPTSIAEEVAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 25 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 30 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 45 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 46 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 47 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 175 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 259 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 260 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 276 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 280 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 281 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 282 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 283 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 284 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 285 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 286 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 287 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 288 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 289 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 290 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 291 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 293 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 294 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 295 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 296 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 297 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 298 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 299 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 300 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 301 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 302 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 303 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 306 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 307 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 308 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 309 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 310 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 311 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 312 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 313 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 314 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 316 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 322 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 323 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 324 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 325 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 326 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 329 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 332 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 333 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 334 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 335 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 336 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 337 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 338 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 339 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 340 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 341 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 342 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 343 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 344 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 345 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 346 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 347 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 348 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 349 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 350 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 351 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 352 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 353 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 355 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 356 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 359 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 361 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 362 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 363 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 364 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 365 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 366 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 367 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 368 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 369 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 370 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 371 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 372 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 373 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 374 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 375 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 376 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 377 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 378 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 379 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 380 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 381 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 382 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 383 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 384 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 385 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 386 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 387 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 388 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 389 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 390 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 391 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 392 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 393 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 394 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 395 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 396 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 397 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 398 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 399 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 400 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 401 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 402 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 403 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 404 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 448 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 449 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 450 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 451 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 452 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 453 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 455 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 456 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 457 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 458 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 459 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 460 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 461 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 462 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 463 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 464 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 465 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 466 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 467 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 468 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 503 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 504 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 505 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 506 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 511 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 513 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 514 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 515 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 516 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 517 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 518 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 520 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 521 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 522 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.09 |
| Metatranscriptomes | 9.91 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.13 |
| Nodule | 0.55 |
| Rhizoplane | 2.94 |
| Rhizosphere | 76.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451793_1516371 | 3300041452 | Bacteria | 1076 |
| 2 | MRS2a_Contig_30 | 2124908027 | Bacteria | 50483 |
| 3 | SwRhRL2b_contig_1764583 | 2162886007 | Bacteria | 1193 |
| 4 | JGI24736J21556_1002338 | 3300001904 | Bacteria | 3353 |
| 5 | JGI24741J21665_1002066 | 3300001915 | Bacteria | 5375 |
| 6 | JGI24740J21852_10005249 | 3300001979 | Bacteria | 5499 |
| 7 | JGI24739J22299_10000118 | 3300001989 | Bacteria | 24899 |
| 8 | JGI24737J22298_10000685 | 3300001990 | Bacteria | 11898 |
| 9 | JGI24737J22298_10004035 | 3300001990 | Bacteria | 5132 |
| 10 | JGI24737J22298_10129025 | 3300001990 | Bacteria | 747 |
| 11 | JGI24735J21928_10007003 | 3300002067 | Bacteria | 3685 |
| 12 | JGI24735J21928_10080256 | 3300002067 | Bacteria | 934 |
| 13 | JGI24744J21845_10044038 | 3300002077 | Bacteria | 830 |
| 14 | JGI25156J39149_1005142 | 3300002705 | Bacteria | 3844 |
| 15 | JGI25162J39368_1001066 | 3300002737 | Bacteria | 16772 |
| 16 | JGI25162J39368_1002454 | 3300002737 | Bacteria | 7175 |
| 17 | JGI25162J39368_1004075 | 3300002737 | Bacteria | 3637 |
| 18 | JGI25154J39366_1007603 | 3300002738 | Bacteria | 1465 |
| 19 | JGI25157J39369_1002937 | 3300002741 | Bacteria | 3776 |
| 20 | JGI25163J39215_1000088 | 3300002771 | Bacteria | 38934 |
| 21 | JGI25164J39214_1000264 | 3300002772 | Bacteria | 38934 |
| 22 | JGI25164J39214_1000535 | 3300002772 | Bacteria | 17725 |
| 23 | JGI25164J39214_1000666 | 3300002772 | Bacteria | 14014 |
| 24 | JGI25152J39213_1000284 | 3300002773 | Bacteria | 33794 |
| 25 | JGI25152J39213_1001094 | 3300002773 | Bacteria | 12721 |
| 26 | JGI25152J39213_1031566 | 3300002773 | Bacteria | 812 |
| 27 | JGI25150J39212_1000359 | 3300002774 | Bacteria | 22362 |
| 28 | JGI25151J46595_10000895 | 3300003187 | Bacteria | 23452 |
| 29 | JGI25165J46597_1001865 | 3300003214 | Bacteria | 8677 |
| 30 | JGI25165J46597_1004381 | 3300003214 | Bacteria | 3055 |
| 31 | JGI25153J46596_10000050 | 3300003215 | Bacteria | 140710 |
| 32 | rootH2_10027207 | 3300003320 | Bacteria | 14900 |
| 33 | rootH1_10017276 | 3300003323 | Bacteria | 33770 |
| 34 | JGI26145J50221_1003575 | 3300003371 | Bacteria | 1241 |
| 35 | Ga0006556J51387_1030839 | 3300003479 | Bacteria | 3475 |
| 36 | Ga0006558J51389_1019524 | 3300003558 | Bacteria | 3457 |
| 37 | Ga0006560J51390_1017170 | 3300003565 | Bacteria | 14049 |
| 38 | Ga0006554J51385_1017088 | 3300003567 | Bacteria | 14046 |
| 39 | Ga0006554J51385_1021904 | 3300003567 | Bacteria | 3529 |
| 40 | Ga0006562J51391_1006869 | 3300003578 | Bacteria | 31335 |
| 41 | Ga0006562J51391_1006870 | 3300003578 | Bacteria | 810 |
| 42 | Ga0006562J51391_1017069 | 3300003578 | Bacteria | 3330 |
| 43 | Ga0006562J51391_1017070 | 3300003578 | Bacteria | 650 |
| 44 | Ga0055538_1000042 | 3300003751 | Bacteria | 164754 |
| 45 | Ga0055538_1000183 | 3300003751 | Bacteria | 38934 |
| 46 | Ga0055539_1000055 | 3300003752 | Bacteria | 164754 |
| 47 | Ga0055539_1000232 | 3300003752 | Bacteria | 38934 |
| 48 | Ga0055533_1000067 | 3300003756 | Bacteria | 164754 |
| 49 | Ga0055533_1000224 | 3300003756 | Bacteria | 38934 |
| 50 | Ga0055533_1010841 | 3300003756 | Bacteria | 1015 |
| 51 | Ga0055532_1000053 | 3300003758 | Bacteria | 164751 |
| 52 | Ga0055525_1000103 | 3300003759 | Bacteria | 134778 |
| 53 | Ga0055525_1000316 | 3300003759 | Bacteria | 38934 |
| 54 | Ga0055542_1000409 | 3300003762 | Bacteria | 41890 |
| 55 | Ga0055542_1014770 | 3300003762 | Bacteria | 1272 |
| 56 | Ga0055526_1002877 | 3300003771 | Bacteria | 11337 |
| 57 | Ga0055537_1000851 | 3300003773 | Bacteria | 14843 |
| 58 | Ga0055524_1049473 | 3300003775 | Bacteria | 969 |
| 59 | Ga0055534_1000766 | 3300003784 | Bacteria | 15218 |
| 60 | Ga0055528_1002206 | 3300003790 | Bacteria | 10640 |
| 61 | Ga0055528_1011134 | 3300003790 | Bacteria | 3600 |
| 62 | Ga0055540_1031521 | 3300003792 | Bacteria | 1217 |
| 63 | Ga0055531_10000125 | 3300003794 | Bacteria | 86349 |
| 64 | Ga0055541_1000042 | 3300003841 | Bacteria | 164754 |
| 65 | Ga0055541_1000139 | 3300003841 | Bacteria | 38934 |
| 66 | Ga0058692_1000064 | 3300003856 | Bacteria | 90988 |
| 67 | Ga0058692_1000156 | 3300003856 | Bacteria | 43208 |
| 68 | Ga0058692_1022013 | 3300003856 | Bacteria | 1316 |
| 69 | Ga0058692_1023058 | 3300003856 | Bacteria | 1271 |
| 70 | Ga0058860_10204723 | 3300004801 | Bacteria | 1305 |
| 71 | Ga0065703_1022151 | 3300005272 | Bacteria | 984 |
| 72 | Ga0065714_10000007 | 3300005288 | Bacteria | 22418 |
| 73 | Ga0065704_10000076 | 3300005289 | Bacteria | 33688 |
| 74 | Ga0065704_10005509 | 3300005289 | Bacteria | 3029 |
| 75 | Ga0065704_10006529 | 3300005289 | Bacteria | 3787 |
| 76 | Ga0065704_10014593 | 3300005289 | Bacteria | 2745 |
| 77 | Ga0065704_10071113 | 3300005289 | Bacteria | 13091 |
| 78 | Ga0065712_10069095 | 3300005290 | Bacteria | 8036 |
| 79 | Ga0070690_100518754 | 3300005330 | Bacteria | 894 |
| 80 | Ga0070670_100000015 | 3300005331 | Bacteria | 228819 |
| 81 | Ga0070670_100167063 | 3300005331 | Bacteria | 1908 |
| 82 | Ga0070677_10311487 | 3300005333 | Bacteria | 803 |
| 83 | Ga0070677_10542653 | 3300005333 | Bacteria | 636 |
| 84 | Ga0068869_100088546 | 3300005334 | Bacteria | 2324 |
| 85 | Ga0068869_100262223 | 3300005334 | Bacteria | 1384 |
| 86 | Ga0068869_100609552 | 3300005334 | Bacteria | 923 |
| 87 | Ga0070666_10000795 | 3300005335 | Bacteria | 19131 |
| 88 | Ga0070666_10013955 | 3300005335 | Bacteria | 5107 |
| 89 | Ga0070666_11159626 | 3300005335 | Bacteria | 575 |
| 90 | Ga0070680_100161000 | 3300005336 | Bacteria | 1886 |
| 91 | Ga0070680_100368235 | 3300005336 | Bacteria | 1223 |
| 92 | Ga0070680_101806956 | 3300005336 | Bacteria | 530 |
| 93 | Ga0070682_100020045 | 3300005337 | Bacteria | 3930 |
| 94 | Ga0070682_100167309 | 3300005337 | Bacteria | 1524 |
| 95 | Ga0070682_100194487 | 3300005337 | Bacteria | 1426 |
| 96 | Ga0070682_100254989 | 3300005337 | Bacteria | 1267 |
| 97 | Ga0070682_100641984 | 3300005337 | Bacteria | 844 |
| 98 | Ga0070682_100783973 | 3300005337 | Bacteria | 773 |
| 99 | Ga0068868_100448304 | 3300005338 | Bacteria | 1122 |
| 100 | Ga0068868_100552881 | 3300005338 | Bacteria | 1015 |
| 101 | Ga0070660_100364606 | 3300005339 | Bacteria | 1191 |
| 102 | Ga0070660_100769714 | 3300005339 | Bacteria | 809 |
| 103 | Ga0070660_101133068 | 3300005339 | Bacteria | 662 |
| 104 | Ga0070689_100962894 | 3300005340 | Bacteria | 758 |
| 105 | Ga0070691_10125754 | 3300005341 | Bacteria | 1295 |
| 106 | Ga0070687_100056000 | 3300005343 | Bacteria | 2062 |
| 107 | Ga0070661_100000652 | 3300005344 | Bacteria | 25497 |
| 108 | Ga0070661_100222492 | 3300005344 | Bacteria | 1448 |
| 109 | Ga0070661_100341807 | 3300005344 | Bacteria | 1173 |
| 110 | Ga0070661_100411411 | 3300005344 | Bacteria | 1071 |
| 111 | Ga0070692_10015871 | 3300005345 | Bacteria | 3571 |
| 112 | Ga0070692_10034401 | 3300005345 | Bacteria | 2559 |
| 113 | Ga0070668_100000954 | 3300005347 | Bacteria | 20211 |
| 114 | Ga0070668_100096692 | 3300005347 | Bacteria | 2334 |
| 115 | Ga0070668_100446646 | 3300005347 | Bacteria | 1111 |
| 116 | Ga0070668_100921658 | 3300005347 | Bacteria | 782 |
| 117 | Ga0070668_100951434 | 3300005347 | Bacteria | 770 |
| 118 | Ga0070669_100004607 | 3300005353 | Bacteria | 9957 |
| 119 | Ga0070675_100695103 | 3300005354 | Bacteria | 926 |
| 120 | Ga0070675_102040857 | 3300005354 | Bacteria | 529 |
| 121 | Ga0070671_100351743 | 3300005355 | Bacteria | 1257 |
| 122 | Ga0070671_100836964 | 3300005355 | Bacteria | 802 |
| 123 | Ga0070674_100412177 | 3300005356 | Bacteria | 1107 |
| 124 | Ga0070673_100317799 | 3300005364 | Bacteria | 1375 |
| 125 | Ga0070688_100001170 | 3300005365 | Bacteria | 13058 |
| 126 | Ga0070688_100546824 | 3300005365 | Bacteria | 880 |
| 127 | Ga0070659_100026058 | 3300005366 | Bacteria | 4497 |
| 128 | Ga0070659_100663248 | 3300005366 | Bacteria | 900 |
| 129 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 130 | Ga0070667_100000041 | 3300005367 | Bacteria | 170008 |
| 131 | Ga0070667_100041814 | 3300005367 | Bacteria | 3845 |
| 132 | Ga0070667_100294774 | 3300005367 | Bacteria | 1459 |
| 133 | Ga0070667_100844605 | 3300005367 | Bacteria | 851 |
| 134 | Ga0070667_100999576 | 3300005367 | Bacteria | 780 |
| 135 | Ga0070667_101929219 | 3300005367 | Bacteria | 556 |
| 136 | Ga0070703_10179391 | 3300005406 | Bacteria | 817 |
| 137 | Ga0070709_10157216 | 3300005434 | Bacteria | 1577 |
| 138 | Ga0070709_10809908 | 3300005434 | Bacteria | 735 |
| 139 | Ga0070714_100003062 | 3300005435 | Bacteria | 12403 |
| 140 | Ga0070714_100046919 | 3300005435 | Bacteria | 3667 |
| 141 | Ga0070714_100158171 | 3300005435 | Bacteria | 2048 |
| 142 | Ga0070714_100170555 | 3300005435 | Bacteria | 1974 |
| 143 | Ga0070714_100265067 | 3300005435 | Bacteria | 1592 |
| 144 | Ga0070713_100006537 | 3300005436 | Bacteria | 8093 |
| 145 | Ga0070710_10825403 | 3300005437 | Bacteria | 664 |
| 146 | Ga0070701_10033705 | 3300005438 | Bacteria | 2561 |
| 147 | Ga0070711_100079769 | 3300005439 | Bacteria | 2329 |
| 148 | Ga0070711_101052196 | 3300005439 | Bacteria | 700 |
| 149 | Ga0070705_100200797 | 3300005440 | Bacteria | 1367 |
| 150 | Ga0070705_100676931 | 3300005440 | Bacteria | 807 |
| 151 | Ga0070700_100493287 | 3300005441 | Bacteria | 940 |
| 152 | Ga0070694_100617489 | 3300005444 | Bacteria | 874 |
| 153 | Ga0070663_100001175 | 3300005455 | Bacteria | 14405 |
| 154 | Ga0070663_100033068 | 3300005455 | Bacteria | 3570 |
| 155 | Ga0070663_100221456 | 3300005455 | Bacteria | 1486 |
| 156 | Ga0070663_100224419 | 3300005455 | Bacteria | 1476 |
| 157 | Ga0070663_100301257 | 3300005455 | Bacteria | 1283 |
| 158 | Ga0070663_100405189 | 3300005455 | Bacteria | 1116 |
| 159 | Ga0070663_100411388 | 3300005455 | Bacteria | 1108 |
| 160 | Ga0070663_100498503 | 3300005455 | Bacteria | 1011 |
| 161 | Ga0070663_100773306 | 3300005455 | Bacteria | 821 |
| 162 | Ga0070678_100101533 | 3300005456 | Bacteria | 2230 |
| 163 | Ga0070678_100500660 | 3300005456 | Bacteria | 1072 |
| 164 | Ga0070662_100000042 | 3300005457 | Bacteria | 72274 |
| 165 | Ga0070662_100030703 | 3300005457 | Bacteria | 3764 |
| 166 | Ga0070662_100034778 | 3300005457 | Bacteria | 3555 |
| 167 | Ga0070662_100177367 | 3300005457 | Bacteria | 1678 |
| 168 | Ga0070662_101273412 | 3300005457 | Bacteria | 633 |
| 169 | Ga0070681_10024176 | 3300005458 | Bacteria | 6116 |
| 170 | Ga0070685_10000104 | 3300005466 | Bacteria | 53528 |
| 171 | Ga0070679_100027870 | 3300005530 | Bacteria | 5565 |
| 172 | Ga0070679_100525863 | 3300005530 | Bacteria | 1127 |
| 173 | Ga0070684_101212775 | 3300005535 | Bacteria | 710 |
| 174 | Ga0068853_100003322 | 3300005539 | Bacteria | 12309 |
| 175 | Ga0068853_100006635 | 3300005539 | Bacteria | 9218 |
| 176 | Ga0068853_100017951 | 3300005539 | Bacteria | 5847 |
| 177 | Ga0068853_100056518 | 3300005539 | Bacteria | 3384 |
| 178 | Ga0068853_100056677 | 3300005539 | Bacteria | 3380 |
| 179 | Ga0068853_100171220 | 3300005539 | Bacteria | 1964 |
| 180 | Ga0068853_102455654 | 3300005539 | Bacteria | 505 |
| 181 | Ga0070672_100312180 | 3300005543 | Bacteria | 1335 |
| 182 | Ga0070672_100801777 | 3300005543 | Bacteria | 829 |
| 183 | Ga0070695_100551164 | 3300005545 | Bacteria | 899 |
| 184 | Ga0070695_100714179 | 3300005545 | Bacteria | 797 |
| 185 | Ga0070696_100002929 | 3300005546 | Bacteria | 11345 |
| 186 | Ga0070693_100010756 | 3300005547 | Bacteria | 4590 |
| 187 | Ga0070665_100005720 | 3300005548 | Bacteria | 12763 |
| 188 | Ga0070665_100037817 | 3300005548 | Bacteria | 4852 |
| 189 | Ga0070665_100038905 | 3300005548 | Bacteria | 4782 |
| 190 | Ga0070665_100382972 | 3300005548 | Bacteria | 1414 |
| 191 | Ga0070665_100485369 | 3300005548 | Bacteria | 1246 |
| 192 | Ga0070665_100651265 | 3300005548 | Bacteria | 1066 |
| 193 | Ga0070665_100690977 | 3300005548 | Bacteria | 1033 |
| 194 | Ga0070665_101432677 | 3300005548 | Bacteria | 700 |
| 195 | Ga0070704_100042855 | 3300005549 | Bacteria | 3133 |
| 196 | Ga0068855_100086783 | 3300005563 | Bacteria | 3618 |
| 197 | Ga0068855_100305411 | 3300005563 | Bacteria | 1761 |
| 198 | Ga0068855_100741939 | 3300005563 | Bacteria | 1048 |
| 199 | Ga0068855_100875033 | 3300005563 | Bacteria | 950 |
| 200 | Ga0070664_100000826 | 3300005564 | Bacteria | 23859 |
| 201 | Ga0070664_100043633 | 3300005564 | Bacteria | 3784 |
| 202 | Ga0068857_100000609 | 3300005577 | Bacteria | 26325 |
| 203 | Ga0068857_100000998 | 3300005577 | Bacteria | 21742 |
| 204 | Ga0068857_100183856 | 3300005577 | Bacteria | 1902 |
| 205 | Ga0068857_100316089 | 3300005577 | Bacteria | 1441 |
| 206 | Ga0068857_100625982 | 3300005577 | Bacteria | 1018 |
| 207 | Ga0068857_100773484 | 3300005577 | Bacteria | 915 |
| 208 | Ga0068857_100878841 | 3300005577 | Bacteria | 859 |
| 209 | Ga0068854_100001113 | 3300005578 | Bacteria | 16151 |
| 210 | Ga0068854_100001181 | 3300005578 | Bacteria | 15658 |
| 211 | Ga0068854_100003601 | 3300005578 | Bacteria | 9691 |
| 212 | Ga0068856_100579159 | 3300005614 | Bacteria | 1144 |
| 213 | Ga0070702_100628584 | 3300005615 | Bacteria | 809 |
| 214 | Ga0068852_100040531 | 3300005616 | Bacteria | 3930 |
| 215 | Ga0068852_100062649 | 3300005616 | Bacteria | 3235 |
| 216 | Ga0068852_100229248 | 3300005616 | Bacteria | 1770 |
| 217 | Ga0068852_100306097 | 3300005616 | Bacteria | 1540 |
| 218 | Ga0068852_100797260 | 3300005616 | Bacteria | 958 |
| 219 | Ga0068852_101100538 | 3300005616 | Bacteria | 815 |
| 220 | Ga0068852_101638784 | 3300005616 | Bacteria | 666 |
| 221 | Ga0068859_100105280 | 3300005617 | Bacteria | 2880 |
| 222 | Ga0068859_100182412 | 3300005617 | Bacteria | 2182 |
| 223 | Ga0068859_100213954 | 3300005617 | Bacteria | 2014 |
| 224 | Ga0068864_100000056 | 3300005618 | Bacteria | 127891 |
| 225 | Ga0068864_100015120 | 3300005618 | Bacteria | 6417 |
| 226 | Ga0068864_100656690 | 3300005618 | Bacteria | 1022 |
| 227 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 228 | Ga0068851_10002236 | 3300005834 | Bacteria | 8512 |
| 229 | Ga0068851_10002465 | 3300005834 | Bacteria | 8131 |
| 230 | Ga0068851_10022007 | 3300005834 | Bacteria | 3100 |
| 231 | Ga0068851_10305512 | 3300005834 | Bacteria | 916 |
| 232 | Ga0068863_100025318 | 3300005841 | Bacteria | 5657 |
| 233 | Ga0068863_100036314 | 3300005841 | Bacteria | 4694 |
| 234 | Ga0068863_100064837 | 3300005841 | Bacteria | 3455 |
| 235 | Ga0068863_100151591 | 3300005841 | Bacteria | 2218 |
| 236 | Ga0068863_100405176 | 3300005841 | Bacteria | 1334 |
| 237 | Ga0068858_100022095 | 3300005842 | Bacteria | 5940 |
| 238 | Ga0068858_100025123 | 3300005842 | Bacteria | 5543 |
| 239 | Ga0068858_100639128 | 3300005842 | Bacteria | 1034 |
| 240 | Ga0068858_100927888 | 3300005842 | Bacteria | 852 |
| 241 | Ga0068860_100002410 | 3300005843 | Bacteria | 19616 |
| 242 | Ga0068860_100061930 | 3300005843 | Bacteria | 3555 |
| 243 | Ga0068860_100345652 | 3300005843 | Bacteria | 1463 |
| 244 | Ga0068860_100751366 | 3300005843 | Bacteria | 987 |
| 245 | Ga0068862_100014084 | 3300005844 | Bacteria | 6633 |
| 246 | Ga0068862_100394364 | 3300005844 | Bacteria | 1294 |
| 247 | Ga0081455_10012710 | 3300005937 | Bacteria | 8376 |
| 248 | Ga0081455_10473713 | 3300005937 | Bacteria | 849 |
| 249 | Ga0081540_1000720 | 3300005983 | Bacteria | 30494 |
| 250 | Ga0070717_10307945 | 3300006028 | Bacteria | 1409 |
| 251 | Ga0070717_10402945 | 3300006028 | Bacteria | 1229 |
| 252 | Ga0075365_10637641 | 3300006038 | Bacteria | 753 |
| 253 | Ga0075363_100194892 | 3300006048 | Bacteria | 1156 |
| 254 | Ga0075364_10016532 | 3300006051 | Bacteria | 4591 |
| 255 | Ga0075364_10378582 | 3300006051 | Bacteria | 965 |
| 256 | Ga0075364_10539599 | 3300006051 | Bacteria | 797 |
| 257 | Ga0075364_11026187 | 3300006051 | Bacteria | 560 |
| 258 | Ga0070712_100875191 | 3300006175 | Bacteria | 774 |
| 259 | Ga0075362_10658544 | 3300006177 | Bacteria | 544 |
| 260 | Ga0075367_10273634 | 3300006178 | Bacteria | 1061 |
| 261 | Ga0075369_10273354 | 3300006186 | Bacteria | 786 |
| 262 | Ga0075427_10031688 | 3300006194 | Bacteria | 869 |
| 263 | Ga0075366_10002176 | 3300006195 | Bacteria | 10001 |
| 264 | Ga0075366_10105176 | 3300006195 | Bacteria | 1696 |
| 265 | Ga0075366_10136831 | 3300006195 | Bacteria | 1479 |
| 266 | Ga0097621_100110253 | 3300006237 | Bacteria | 2325 |
| 267 | Ga0097621_100129891 | 3300006237 | Bacteria | 2143 |
| 268 | Ga0097621_100187814 | 3300006237 | Bacteria | 1788 |
| 269 | Ga0097621_100904837 | 3300006237 | Bacteria | 822 |
| 270 | Ga0075370_10275459 | 3300006353 | Bacteria | 999 |
| 271 | Ga0075370_10496105 | 3300006353 | Bacteria | 737 |
| 272 | Ga0068871_100186416 | 3300006358 | Bacteria | 1785 |
| 273 | Ga0068871_101101579 | 3300006358 | Bacteria | 742 |
| 274 | Ga0075428_100283735 | 3300006844 | Bacteria | 1782 |
| 275 | Ga0075430_100082800 | 3300006846 | Bacteria | 2689 |
| 276 | Ga0075430_100151817 | 3300006846 | Bacteria | 1929 |
| 277 | Ga0075430_100858636 | 3300006846 | Bacteria | 748 |
| 278 | Ga0075431_100268455 | 3300006847 | Bacteria | 1730 |
| 279 | Ga0075433_11221835 | 3300006852 | Bacteria | 652 |
| 280 | Ga0075429_100025677 | 3300006880 | Bacteria | 5115 |
| 281 | Ga0068865_100005420 | 3300006881 | Bacteria | 7733 |
| 282 | Ga0068865_100664683 | 3300006881 | Bacteria | 887 |
| 283 | Ga0097620_100105293 | 3300006931 | Bacteria | 2880 |
| 284 | Ga0097620_100182418 | 3300006931 | Bacteria | 2182 |
| 285 | Ga0097620_100213944 | 3300006931 | Bacteria | 2014 |
| 286 | Ga0097620_101042712 | 3300006931 | Bacteria | 899 |
| 287 | Ga0099823_1001424 | 3300006944 | Bacteria | 19746 |
| 288 | Ga0079104_1011549 | 3300006946 | Bacteria | 2832 |
| 289 | Ga0099826_10004264 | 3300006948 | Bacteria | 9981 |
| 290 | Ga0105251_10001384 | 3300009011 | Bacteria | 20990 |
| 291 | Ga0105251_10003365 | 3300009011 | Bacteria | 11643 |
| 292 | Ga0105251_10004275 | 3300009011 | Bacteria | 9818 |
| 293 | Ga0105251_10046768 | 3300009011 | Bacteria | 2081 |
| 294 | Ga0105251_10113970 | 3300009011 | Bacteria | 1230 |
| 295 | Ga0105251_10203057 | 3300009011 | Bacteria | 893 |
| 296 | Ga0105244_10003157 | 3300009036 | Bacteria | 11968 |
| 297 | Ga0105244_10003200 | 3300009036 | Bacteria | 11868 |
| 298 | Ga0105244_10003679 | 3300009036 | Bacteria | 10831 |
| 299 | Ga0105244_10022121 | 3300009036 | Bacteria | 3503 |
| 300 | Ga0105244_10039739 | 3300009036 | Bacteria | 2447 |
| 301 | Ga0105244_10092708 | 3300009036 | Bacteria | 1484 |
| 302 | Ga0105244_10334153 | 3300009036 | Bacteria | 699 |
| 303 | Ga0105244_10360844 | 3300009036 | Bacteria | 669 |
| 304 | Ga0105244_10451587 | 3300009036 | Bacteria | 591 |
| 305 | Ga0105250_10001814 | 3300009092 | Bacteria | 11183 |
| 306 | Ga0105250_10001821 | 3300009092 | Bacteria | 11158 |
| 307 | Ga0105250_10001822 | 3300009092 | Bacteria | 11155 |
| 308 | Ga0105250_10102142 | 3300009092 | Bacteria | 1170 |
| 309 | Ga0105250_10169998 | 3300009092 | Bacteria | 912 |
| 310 | Ga0105250_10254294 | 3300009092 | Bacteria | 751 |
| 311 | Ga0105240_10001463 | 3300009093 | Bacteria | 40357 |
| 312 | Ga0105240_10020349 | 3300009093 | Bacteria | 8856 |
| 313 | Ga0105240_10081338 | 3300009093 | Bacteria | 3981 |
| 314 | Ga0105240_10212903 | 3300009093 | Bacteria | 2257 |
| 315 | Ga0105240_10283630 | 3300009093 | Bacteria | 1902 |
| 316 | Ga0105245_10346633 | 3300009098 | Bacteria | 1470 |
| 317 | Ga0105245_10512475 | 3300009098 | Bacteria | 1217 |
| 318 | Ga0105247_10002905 | 3300009101 | Bacteria | 11410 |
| 319 | Ga0105247_10236253 | 3300009101 | Bacteria | 1243 |
| 320 | Ga0105247_10469118 | 3300009101 | Bacteria | 911 |
| 321 | Ga0114129_11327847 | 3300009147 | Bacteria | 890 |
| 322 | Ga0114129_12808648 | 3300009147 | Bacteria | 579 |
| 323 | Ga0105243_10020634 | 3300009148 | Bacteria | 4996 |
| 324 | Ga0105243_10033041 | 3300009148 | Bacteria | 3999 |
| 325 | Ga0105243_10093860 | 3300009148 | Bacteria | 2477 |
| 326 | Ga0105243_10692280 | 3300009148 | Bacteria | 992 |
| 327 | Ga0105243_10699202 | 3300009148 | Bacteria | 988 |
| 328 | Ga0105241_10000672 | 3300009174 | Bacteria | 25784 |
| 329 | Ga0105241_10646888 | 3300009174 | Bacteria | 960 |
| 330 | Ga0105241_10659840 | 3300009174 | Bacteria | 951 |
| 331 | Ga0105241_11246006 | 3300009174 | Bacteria | 706 |
| 332 | Ga0105241_11799766 | 3300009174 | Bacteria | 598 |
| 333 | Ga0105242_10002241 | 3300009176 | Bacteria | 15255 |
| 334 | Ga0105242_10015431 | 3300009176 | Bacteria | 5933 |
| 335 | Ga0105242_10294709 | 3300009176 | Bacteria | 1478 |
| 336 | Ga0105248_10001072 | 3300009177 | Bacteria | 30268 |
| 337 | Ga0105248_10283186 | 3300009177 | Bacteria | 1866 |
| 338 | Ga0105248_10291539 | 3300009177 | Bacteria | 1837 |
| 339 | Ga0105248_10346592 | 3300009177 | Bacteria | 1672 |
| 340 | Ga0105248_10717759 | 3300009177 | Bacteria | 1128 |
| 341 | Ga0105237_10001741 | 3300009545 | Bacteria | 28104 |
| 342 | Ga0105237_10005934 | 3300009545 | Bacteria | 13696 |
| 343 | Ga0105237_10007392 | 3300009545 | Bacteria | 12030 |
| 344 | Ga0105237_10015499 | 3300009545 | Bacteria | 7931 |
| 345 | Ga0105237_10218268 | 3300009545 | Bacteria | 1907 |
| 346 | Ga0105237_10336995 | 3300009545 | Bacteria | 1513 |
| 347 | Ga0105237_10369507 | 3300009545 | Bacteria | 1439 |
| 348 | Ga0105238_10168817 | 3300009551 | Bacteria | 2164 |
| 349 | Ga0105238_10460288 | 3300009551 | Bacteria | 1270 |
| 350 | Ga0105249_10000622 | 3300009553 | Bacteria | 32271 |
| 351 | Ga0105249_10026163 | 3300009553 | Bacteria | 5255 |
| 352 | Ga0105249_10032534 | 3300009553 | Bacteria | 4719 |
| 353 | Ga0105249_10164198 | 3300009553 | Bacteria | 2148 |
| 354 | Ga0105249_12702864 | 3300009553 | Bacteria | 568 |
| 355 | Ga0105239_10003327 | 3300010375 | Bacteria | 19782 |
| 356 | Ga0105239_10004272 | 3300010375 | Bacteria | 17140 |
| 357 | Ga0105239_10004445 | 3300010375 | Bacteria | 16760 |
| 358 | Ga0105239_10017757 | 3300010375 | Bacteria | 7870 |
| 359 | Ga0105239_10048112 | 3300010375 | Bacteria | 4676 |
| 360 | Ga0105239_10141841 | 3300010375 | Bacteria | 2678 |
| 361 | Ga0105239_10311902 | 3300010375 | Bacteria | 1773 |
| 362 | Ga0105239_10456855 | 3300010375 | Bacteria | 1449 |
| 363 | Ga0105239_10847148 | 3300010375 | Bacteria | 1048 |
| 364 | Ga0105246_10019344 | 3300011119 | Bacteria | 4350 |
| 365 | Ga0105246_10052166 | 3300011119 | Bacteria | 2810 |
| 366 | Ga0105246_10198765 | 3300011119 | Bacteria | 1557 |
| 367 | Ga0157314_1000299 | 3300012500 | Bacteria | 5145 |
| 368 | Ga0157373_10004967 | 3300013100 | Bacteria | 9994 |
| 369 | Ga0157373_10018843 | 3300013100 | Bacteria | 5022 |
| 370 | Ga0157373_10032828 | 3300013100 | Bacteria | 3736 |
| 371 | Ga0157373_10038271 | 3300013100 | Bacteria | 3438 |
| 372 | Ga0157373_10322581 | 3300013100 | Bacteria | 1099 |
| 373 | Ga0157373_10348475 | 3300013100 | Bacteria | 1056 |
| 374 | Ga0157373_10378827 | 3300013100 | Bacteria | 1012 |
| 375 | Ga0157371_10004487 | 3300013102 | Bacteria | 12175 |
| 376 | Ga0157371_10004889 | 3300013102 | Bacteria | 11512 |
| 377 | Ga0157371_10005445 | 3300013102 | Bacteria | 10730 |
| 378 | Ga0157371_10020835 | 3300013102 | Bacteria | 4822 |
| 379 | Ga0157371_10043348 | 3300013102 | Bacteria | 3205 |
| 380 | Ga0157371_10061606 | 3300013102 | Bacteria | 2660 |
| 381 | Ga0157371_10094463 | 3300013102 | Bacteria | 2119 |
| 382 | Ga0157371_10101459 | 3300013102 | Bacteria | 2041 |
| 383 | Ga0157371_10161132 | 3300013102 | Bacteria | 1602 |
| 384 | Ga0157371_10250099 | 3300013102 | Bacteria | 1276 |
| 385 | Ga0157371_11077206 | 3300013102 | Bacteria | 616 |
| 386 | Ga0157370_10000422 | 3300013104 | Bacteria | 53330 |
| 387 | Ga0157370_10005510 | 3300013104 | Bacteria | 14184 |
| 388 | Ga0157370_10008351 | 3300013104 | Bacteria | 11169 |
| 389 | Ga0157370_10009847 | 3300013104 | Bacteria | 10130 |
| 390 | Ga0157370_10110234 | 3300013104 | Bacteria | 2573 |
| 391 | Ga0157370_10123222 | 3300013104 | Bacteria | 2420 |
| 392 | Ga0157370_10205003 | 3300013104 | Bacteria | 1829 |
| 393 | Ga0157370_10255789 | 3300013104 | Bacteria | 1619 |
| 394 | Ga0157370_10280480 | 3300013104 | Bacteria | 1540 |
| 395 | Ga0157370_10354802 | 3300013104 | Bacteria | 1352 |
| 396 | Ga0157370_10367438 | 3300013104 | Bacteria | 1326 |
| 397 | Ga0157370_10751193 | 3300013104 | Bacteria | 889 |
| 398 | Ga0157370_10974266 | 3300013104 | Bacteria | 768 |
| 399 | Ga0157369_10004613 | 3300013105 | Bacteria | 16198 |
| 400 | Ga0157369_10005087 | 3300013105 | Bacteria | 15394 |
| 401 | Ga0157369_10008827 | 3300013105 | Bacteria | 11547 |
| 402 | Ga0157369_10375978 | 3300013105 | Bacteria | 1475 |
| 403 | Ga0157369_10570688 | 3300013105 | Bacteria | 1169 |
| 404 | Ga0157369_11228543 | 3300013105 | Bacteria | 764 |
| 405 | Ga0157374_10007275 | 3300013296 | Bacteria | 9433 |
| 406 | Ga0157378_10026963 | 3300013297 | Bacteria | 5068 |
| 407 | Ga0157378_10081560 | 3300013297 | Bacteria | 2924 |
| 408 | Ga0163162_10005583 | 3300013306 | Bacteria | 12167 |
| 409 | Ga0163162_10017452 | 3300013306 | Bacteria | 7023 |
| 410 | Ga0163162_10096005 | 3300013306 | Bacteria | 3052 |
| 411 | Ga0163162_10180551 | 3300013306 | Bacteria | 2237 |
| 412 | Ga0163162_10394279 | 3300013306 | Bacteria | 1517 |
| 413 | Ga0157372_10006843 | 3300013307 | Bacteria | 12129 |
| 414 | Ga0157372_10012562 | 3300013307 | Bacteria | 9019 |
| 415 | Ga0157372_10020902 | 3300013307 | Bacteria | 7065 |
| 416 | Ga0157372_10065095 | 3300013307 | Bacteria | 4092 |
| 417 | Ga0157372_10270571 | 3300013307 | Bacteria | 1974 |
| 418 | Ga0157372_10677983 | 3300013307 | Bacteria | 1200 |
| 419 | Ga0157375_10000319 | 3300013308 | Bacteria | 43172 |
| 420 | Ga0163163_10000199 | 3300014325 | Bacteria | 62045 |
| 421 | Ga0157380_10773522 | 3300014326 | Bacteria | 974 |
| 422 | Ga0182008_10002668 | 3300014497 | Bacteria | 11072 |
| 423 | Ga0182008_10006926 | 3300014497 | Bacteria | 6291 |
| 424 | Ga0182008_10040391 | 3300014497 | Bacteria | 2330 |
| 425 | Ga0182008_10055211 | 3300014497 | Bacteria | 1965 |
| 426 | Ga0157379_10122139 | 3300014968 | Bacteria | 2343 |
| 427 | Ga0157379_10972511 | 3300014968 | Bacteria | 808 |
| 428 | Ga0157376_10007084 | 3300014969 | Bacteria | 7962 |
| 429 | Ga0157376_10380117 | 3300014969 | Bacteria | 1360 |
| 430 | Ga0182006_1001639 | 3300015261 | Bacteria | 13219 |
| 431 | Ga0182006_1004854 | 3300015261 | Bacteria | 6525 |
| 432 | Ga0182006_1010988 | 3300015261 | Bacteria | 3999 |
| 433 | Ga0182006_1019907 | 3300015261 | Bacteria | 2818 |
| 434 | Ga0182006_1034577 | 3300015261 | Bacteria | 2020 |
| 435 | Ga0182006_1049347 | 3300015261 | Bacteria | 1625 |
| 436 | Ga0182006_1099774 | 3300015261 | Bacteria | 1032 |
| 437 | Ga0182007_10005587 | 3300015262 | Bacteria | 5501 |
| 438 | Ga0182007_10014939 | 3300015262 | Bacteria | 2911 |
| 439 | Ga0182007_10078677 | 3300015262 | Bacteria | 1081 |
| 440 | Ga0182007_10127709 | 3300015262 | Bacteria | 853 |
| 441 | Ga0182005_1000261 | 3300015265 | Bacteria | 33393 |
| 442 | Ga0182005_1011381 | 3300015265 | Bacteria | 2537 |
| 443 | Ga0182005_1090894 | 3300015265 | Bacteria | 849 |
| 444 | Ga0183360_10821 | 3300015689 | Bacteria | 973 |
| 445 | Ga0163161_10003205 | 3300017792 | Bacteria | 11504 |
| 446 | Ga0163161_10016624 | 3300017792 | Bacteria | 5138 |
| 447 | Ga0163161_10060757 | 3300017792 | Bacteria | 2751 |
| 448 | Ga0163161_10066219 | 3300017792 | Bacteria | 2637 |
| 449 | Ga0163161_10113215 | 3300017792 | Bacteria | 2030 |
| 450 | Ga0163161_10357291 | 3300017792 | Bacteria | 1163 |
| 451 | Ga0163161_10589633 | 3300017792 | Bacteria | 915 |
| 452 | Ga0206354_10784947 | 3300020081 | Bacteria | 638 |
| 453 | Ga0213872_10227045 | 3300021361 | Bacteria | 793 |
| 454 | Ga0213876_10000608 | 3300021384 | Bacteria | 26445 |
| 455 | Ga0213876_10190768 | 3300021384 | Bacteria | 1090 |
| 456 | Ga0224712_10477116 | 3300022467 | Bacteria | 601 |
| 457 | Ga0224712_10566405 | 3300022467 | Bacteria | 553 |
| 458 | Ga0209435_100298 | 3300025206 | Bacteria | 12008 |
| 459 | Ga0209760_100117 | 3300025207 | Bacteria | 57229 |
| 460 | Ga0209760_100153 | 3300025207 | Bacteria | 42023 |
| 461 | Ga0209760_100166 | 3300025207 | Bacteria | 39087 |
| 462 | Ga0209760_108483 | 3300025207 | Bacteria | 741 |
| 463 | Ga0209784_100060 | 3300025224 | Bacteria | 164838 |
| 464 | Ga0209784_100218 | 3300025224 | Bacteria | 39215 |
| 465 | Ga0209566_100075 | 3300025225 | Bacteria | 164838 |
| 466 | Ga0209566_100353 | 3300025225 | Bacteria | 39215 |
| 467 | Ga0209674_100100 | 3300025226 | Bacteria | 164838 |
| 468 | Ga0209674_100273 | 3300025226 | Bacteria | 39215 |
| 469 | Ga0209674_100632 | 3300025226 | Bacteria | 12783 |
| 470 | Ga0209147_100096 | 3300025229 | Bacteria | 164838 |
| 471 | Ga0209563_100182 | 3300025230 | Bacteria | 39215 |
| 472 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 473 | Ga0207427_100270 | 3300025231 | Bacteria | 39215 |
| 474 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 475 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 476 | Ga0209437_100616 | 3300025233 | Bacteria | 21817 |
| 477 | Ga0209437_100676 | 3300025233 | Bacteria | 18470 |
| 478 | Ga0209258_100387 | 3300025242 | Bacteria | 56263 |
| 479 | Ga0207425_1000117 | 3300025245 | Bacteria | 74911 |
| 480 | Ga0209646_1000276 | 3300025246 | Bacteria | 45523 |
| 481 | Ga0209677_100057 | 3300025253 | Bacteria | 164838 |
| 482 | Ga0209677_100234 | 3300025253 | Bacteria | 39215 |
| 483 | Ga0209148_1002260 | 3300025254 | Bacteria | 6975 |
| 484 | Ga0209759_1007895 | 3300025256 | Bacteria | 3367 |
| 485 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 486 | Ga0209129_1000540 | 3300025258 | Bacteria | 26365 |
| 487 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 488 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 489 | Ga0209233_1003358 | 3300025261 | Bacteria | 5661 |
| 490 | Ga0209565_1000415 | 3300025263 | Bacteria | 35224 |
| 491 | Ga0209673_1000204 | 3300025273 | Bacteria | 119618 |
| 492 | Ga0209130_1005672 | 3300025284 | Bacteria | 4265 |
| 493 | Ga0209130_1014121 | 3300025284 | Bacteria | 2017 |
| 494 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 495 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 496 | Ga0209676_1000110 | 3300025292 | Bacteria | 214083 |
| 497 | Ga0209676_1001080 | 3300025292 | Bacteria | 30784 |
| 498 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 499 | Ga0209564_1000037 | 3300025295 | Bacteria | 414794 |
| 500 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 501 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 502 | Ga0209050_1002971 | 3300025298 | Bacteria | 13226 |
| 503 | Ga0209256_1018864 | 3300025299 | Bacteria | 2221 |
| 504 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 505 | Ga0209051_1000283 | 3300025303 | Bacteria | 82731 |
| 506 | Ga0209051_1001513 | 3300025303 | Bacteria | 19394 |
| 507 | Ga0209051_1007989 | 3300025303 | Bacteria | 5680 |
| 508 | Ga0209051_1012543 | 3300025303 | Bacteria | 4094 |
| 509 | Ga0209257_1000129 | 3300025304 | Bacteria | 214155 |
| 510 | Ga0209257_1000185 | 3300025304 | Bacteria | 155047 |
| 511 | Ga0209257_1011177 | 3300025304 | Bacteria | 4371 |
| 512 | Ga0209257_1054444 | 3300025304 | Bacteria | 1113 |
| 513 | Ga0209257_1139166 | 3300025304 | Bacteria | 547 |
| 514 | Ga0207656_10000010 | 3300025321 | Bacteria | 192224 |
| 515 | Ga0207656_10076474 | 3300025321 | Bacteria | 1497 |
| 516 | Ga0207656_10083068 | 3300025321 | Bacteria | 1443 |
| 517 | Ga0207656_10306820 | 3300025321 | Bacteria | 786 |
| 518 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 519 | Ga0207696_1000118 | 3300025711 | Bacteria | 147902 |
| 520 | Ga0207696_1000168 | 3300025711 | Bacteria | 103496 |
| 521 | Ga0207696_1000334 | 3300025711 | Bacteria | 49107 |
| 522 | Ga0207696_1001023 | 3300025711 | Bacteria | 16688 |
| 523 | Ga0207696_1001545 | 3300025711 | Bacteria | 12291 |
| 524 | Ga0207696_1001690 | 3300025711 | Bacteria | 11473 |
| 525 | Ga0207696_1001739 | 3300025711 | Bacteria | 11291 |
| 526 | Ga0207696_1001745 | 3300025711 | Bacteria | 11263 |
| 527 | Ga0207696_1001772 | 3300025711 | Bacteria | 11134 |
| 528 | Ga0207696_1004316 | 3300025711 | Bacteria | 6152 |
| 529 | Ga0207655_1000104 | 3300025728 | Bacteria | 184765 |
| 530 | Ga0207655_1000606 | 3300025728 | Bacteria | 43412 |
| 531 | Ga0207655_1001098 | 3300025728 | Bacteria | 26525 |
| 532 | Ga0207655_1001191 | 3300025728 | Bacteria | 25163 |
| 533 | Ga0207655_1001305 | 3300025728 | Bacteria | 23562 |
| 534 | Ga0207655_1002413 | 3300025728 | Bacteria | 15194 |
| 535 | Ga0207655_1003289 | 3300025728 | Bacteria | 12121 |
| 536 | Ga0207655_1003403 | 3300025728 | Bacteria | 11876 |
| 537 | Ga0207655_1003558 | 3300025728 | Bacteria | 11538 |
| 538 | Ga0207655_1003709 | 3300025728 | Bacteria | 11246 |
| 539 | Ga0207655_1006248 | 3300025728 | Bacteria | 7922 |
| 540 | Ga0207655_1023419 | 3300025728 | Bacteria | 3064 |
| 541 | Ga0207655_1028068 | 3300025728 | Bacteria | 2663 |
| 542 | Ga0207655_1030467 | 3300025728 | Bacteria | 2508 |
| 543 | Ga0207655_1186455 | 3300025728 | Bacteria | 629 |
| 544 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 545 | Ga0207713_1000073 | 3300025735 | Bacteria | 181519 |
| 546 | Ga0207713_1001458 | 3300025735 | Bacteria | 18836 |
| 547 | Ga0207713_1003194 | 3300025735 | Bacteria | 11331 |
| 548 | Ga0207713_1012383 | 3300025735 | Bacteria | 4566 |
| 549 | Ga0207713_1013301 | 3300025735 | Bacteria | 4344 |
| 550 | Ga0207713_1069892 | 3300025735 | Bacteria | 1299 |
| 551 | Ga0207713_1258604 | 3300025735 | Bacteria | 511 |
| 552 | Ga0207653_10166297 | 3300025885 | Bacteria | 819 |
| 553 | Ga0207692_10953701 | 3300025898 | Bacteria | 565 |
| 554 | Ga0207710_10000468 | 3300025900 | Bacteria | 25913 |
| 555 | Ga0207710_10004791 | 3300025900 | Bacteria | 5872 |
| 556 | Ga0207710_10344820 | 3300025900 | Bacteria | 758 |
| 557 | Ga0207680_10001411 | 3300025903 | Bacteria | 11370 |
| 558 | Ga0207680_10040636 | 3300025903 | Bacteria | 2708 |
| 559 | Ga0207680_10061368 | 3300025903 | Bacteria | 2292 |
| 560 | Ga0207699_10153906 | 3300025906 | Bacteria | 1524 |
| 561 | Ga0207645_10791902 | 3300025907 | Bacteria | 645 |
| 562 | Ga0207705_10486669 | 3300025909 | Bacteria | 958 |
| 563 | Ga0207654_10000379 | 3300025911 | Bacteria | 25944 |
| 564 | Ga0207707_10953191 | 3300025912 | Bacteria | 706 |
| 565 | Ga0207671_10000380 | 3300025914 | Bacteria | 62950 |
| 566 | Ga0207671_10014065 | 3300025914 | Bacteria | 6343 |
| 567 | Ga0207671_10017764 | 3300025914 | Bacteria | 5475 |
| 568 | Ga0207671_10093262 | 3300025914 | Bacteria | 2271 |
| 569 | Ga0207671_10180802 | 3300025914 | Bacteria | 1641 |
| 570 | Ga0207662_10082749 | 3300025918 | Bacteria | 1961 |
| 571 | Ga0207662_10119540 | 3300025918 | Bacteria | 1651 |
| 572 | Ga0207657_10056527 | 3300025919 | Bacteria | 3385 |
| 573 | Ga0207649_10000041 | 3300025920 | Bacteria | 117781 |
| 574 | Ga0207649_10483093 | 3300025920 | Bacteria | 940 |
| 575 | Ga0207649_10892844 | 3300025920 | Bacteria | 697 |
| 576 | Ga0207649_10955084 | 3300025920 | Bacteria | 673 |
| 577 | Ga0207652_10266670 | 3300025921 | Bacteria | 1545 |
| 578 | Ga0207652_10600806 | 3300025921 | Bacteria | 987 |
| 579 | Ga0207681_10001197 | 3300025923 | Bacteria | 16670 |
| 580 | Ga0207681_10021631 | 3300025923 | Bacteria | 4091 |
| 581 | Ga0207681_10042359 | 3300025923 | Bacteria | 3041 |
| 582 | Ga0207681_10535675 | 3300025923 | Bacteria | 962 |
| 583 | Ga0207694_10095814 | 3300025924 | Bacteria | 2347 |
| 584 | Ga0207694_10373777 | 3300025924 | Bacteria | 1182 |
| 585 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 586 | Ga0207650_10248506 | 3300025925 | Bacteria | 1439 |
| 587 | Ga0207650_10889905 | 3300025925 | Bacteria | 756 |
| 588 | Ga0207650_11891072 | 3300025925 | Bacteria | 504 |
| 589 | Ga0207687_10063514 | 3300025927 | Bacteria | 2615 |
| 590 | Ga0207687_10653867 | 3300025927 | Bacteria | 889 |
| 591 | Ga0207664_10087884 | 3300025929 | Bacteria | 2542 |
| 592 | Ga0207664_10216074 | 3300025929 | Bacteria | 1661 |
| 593 | Ga0207644_10138725 | 3300025931 | Bacteria | 1870 |
| 594 | Ga0207644_10385958 | 3300025931 | Bacteria | 1143 |
| 595 | Ga0207690_10084403 | 3300025932 | Bacteria | 2226 |
| 596 | Ga0207706_10000128 | 3300025933 | Bacteria | 81615 |
| 597 | Ga0207706_10030526 | 3300025933 | Bacteria | 4807 |
| 598 | Ga0207686_10016851 | 3300025934 | Bacteria | 4105 |
| 599 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 600 | Ga0207709_10000343 | 3300025935 | Bacteria | 48072 |
| 601 | Ga0207709_10008703 | 3300025935 | Bacteria | 5599 |
| 602 | Ga0207709_10010135 | 3300025935 | Bacteria | 5190 |
| 603 | Ga0207709_10011110 | 3300025935 | Bacteria | 4965 |
| 604 | Ga0207709_10056312 | 3300025935 | Bacteria | 2433 |
| 605 | Ga0207669_10984965 | 3300025937 | Bacteria | 708 |
| 606 | Ga0207704_10355312 | 3300025938 | Bacteria | 1142 |
| 607 | Ga0207691_10172788 | 3300025940 | Bacteria | 1892 |
| 608 | Ga0207711_10000194 | 3300025941 | Bacteria | 65127 |
| 609 | Ga0207711_10000272 | 3300025941 | Bacteria | 55799 |
| 610 | Ga0207711_10108211 | 3300025941 | Bacteria | 2469 |
| 611 | Ga0207711_10426503 | 3300025941 | Bacteria | 1234 |
| 612 | Ga0207711_10803153 | 3300025941 | Bacteria | 876 |
| 613 | Ga0207711_11527427 | 3300025941 | Bacteria | 611 |
| 614 | Ga0207689_10073424 | 3300025942 | Bacteria | 2810 |
| 615 | Ga0207689_10099611 | 3300025942 | Bacteria | 2388 |
| 616 | Ga0207661_10497578 | 3300025944 | Bacteria | 1114 |
| 617 | Ga0207661_12041632 | 3300025944 | Bacteria | 519 |
| 618 | Ga0207679_10000081 | 3300025945 | Bacteria | 84888 |
| 619 | Ga0207679_11310009 | 3300025945 | Bacteria | 665 |
| 620 | Ga0207667_10482560 | 3300025949 | Bacteria | 1258 |
| 621 | Ga0207667_10569686 | 3300025949 | Bacteria | 1144 |
| 622 | Ga0207667_10839570 | 3300025949 | Bacteria | 913 |
| 623 | Ga0207651_10111114 | 3300025960 | Bacteria | 2058 |
| 624 | Ga0207651_10397877 | 3300025960 | Bacteria | 1171 |
| 625 | Ga0207712_10000839 | 3300025961 | Bacteria | 22597 |
| 626 | Ga0207712_10021372 | 3300025961 | Bacteria | 4249 |
| 627 | Ga0207712_10038480 | 3300025961 | Bacteria | 3271 |
| 628 | Ga0207712_10184842 | 3300025961 | Bacteria | 1640 |
| 629 | Ga0207668_10009496 | 3300025972 | Bacteria | 5835 |
| 630 | Ga0207668_10435299 | 3300025972 | Bacteria | 1116 |
| 631 | Ga0207668_10571449 | 3300025972 | Bacteria | 982 |
| 632 | Ga0207640_10004766 | 3300025981 | Bacteria | 7364 |
| 633 | Ga0207640_10219687 | 3300025981 | Bacteria | 1454 |
| 634 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 635 | Ga0207658_10000028 | 3300025986 | Bacteria | 174550 |
| 636 | Ga0207658_10075889 | 3300025986 | Bacteria | 2559 |
| 637 | Ga0207658_10269819 | 3300025986 | Bacteria | 1454 |
| 638 | Ga0207658_10497040 | 3300025986 | Bacteria | 1086 |
| 639 | Ga0207677_10031823 | 3300026023 | Bacteria | 3383 |
| 640 | Ga0207703_10068783 | 3300026035 | Bacteria | 2918 |
| 641 | Ga0207703_10809199 | 3300026035 | Bacteria | 895 |
| 642 | Ga0207639_10000901 | 3300026041 | Bacteria | 20110 |
| 643 | Ga0207639_10003844 | 3300026041 | Bacteria | 10119 |
| 644 | Ga0207639_10012828 | 3300026041 | Bacteria | 5846 |
| 645 | Ga0207639_10086604 | 3300026041 | Bacteria | 2495 |
| 646 | Ga0207639_10295782 | 3300026041 | Bacteria | 1429 |
| 647 | Ga0207639_11035743 | 3300026041 | Bacteria | 769 |
| 648 | Ga0207678_10005433 | 3300026067 | Bacteria | 11409 |
| 649 | Ga0207678_10094890 | 3300026067 | Bacteria | 2549 |
| 650 | Ga0207678_10198092 | 3300026067 | Bacteria | 1717 |
| 651 | Ga0207678_10377640 | 3300026067 | Bacteria | 1225 |
| 652 | Ga0207708_10780472 | 3300026075 | Bacteria | 821 |
| 653 | Ga0207641_10139344 | 3300026088 | Bacteria | 2186 |
| 654 | Ga0207641_10953208 | 3300026088 | Bacteria | 853 |
| 655 | Ga0207641_10975505 | 3300026088 | Bacteria | 843 |
| 656 | Ga0207641_11017580 | 3300026088 | Bacteria | 825 |
| 657 | Ga0207641_11163664 | 3300026088 | Bacteria | 770 |
| 658 | Ga0207641_11833177 | 3300026088 | Bacteria | 608 |
| 659 | Ga0207648_10590976 | 3300026089 | Bacteria | 1023 |
| 660 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 661 | Ga0207676_10031174 | 3300026095 | Bacteria | 4008 |
| 662 | Ga0207676_10452668 | 3300026095 | Bacteria | 1210 |
| 663 | Ga0207674_10003713 | 3300026116 | Bacteria | 18642 |
| 664 | Ga0207674_10276418 | 3300026116 | Bacteria | 1627 |
| 665 | Ga0207675_100027444 | 3300026118 | Bacteria | 5303 |
| 666 | Ga0207675_101375141 | 3300026118 | Bacteria | 727 |
| 667 | Ga0207683_10216641 | 3300026121 | Bacteria | 1744 |
| 668 | Ga0207698_10023144 | 3300026142 | Bacteria | 4335 |
| 669 | Ga0207698_10032580 | 3300026142 | Bacteria | 3778 |
| 670 | Ga0209281_1000874 | 3300027111 | Bacteria | 26131 |
| 671 | Ga0209281_1001322 | 3300027111 | Bacteria | 15649 |
| 672 | Ga0209281_1001756 | 3300027111 | Bacteria | 11080 |
| 673 | Ga0209389_1000020 | 3300027296 | Bacteria | 172003 |
| 674 | Ga0209371_1000228 | 3300027312 | Bacteria | 72315 |
| 675 | Ga0209371_1000294 | 3300027312 | Bacteria | 56307 |
| 676 | Ga0209371_1000302 | 3300027312 | Bacteria | 55126 |
| 677 | Ga0209371_1001410 | 3300027312 | Bacteria | 16496 |
| 678 | Ga0209371_1002180 | 3300027312 | Bacteria | 11427 |
| 679 | Ga0209371_1002194 | 3300027312 | Bacteria | 11380 |
| 680 | Ga0209371_1003997 | 3300027312 | Bacteria | 6702 |
| 681 | Ga0209371_1006959 | 3300027312 | Bacteria | 4057 |
| 682 | Ga0209371_1015144 | 3300027312 | Bacteria | 2087 |
| 683 | Ga0209969_1005003 | 3300027360 | Bacteria | 1855 |
| 684 | Ga0209969_1007401 | 3300027360 | Bacteria | 1551 |
| 685 | Ga0209981_1006526 | 3300027378 | Bacteria | 1562 |
| 686 | Ga0209996_1001844 | 3300027395 | Bacteria | 2596 |
| 687 | Ga0209984_1014865 | 3300027424 | Bacteria | 1031 |
| 688 | Ga0209995_1001985 | 3300027471 | Bacteria | 3203 |
| 689 | Ga0209995_1020685 | 3300027471 | Bacteria | 1089 |
| 690 | Ga0209995_1063579 | 3300027471 | Bacteria | 629 |
| 691 | Ga0209968_1001116 | 3300027526 | Bacteria | 4100 |
| 692 | Ga0209999_1000717 | 3300027543 | Bacteria | 5377 |
| 693 | Ga0209999_1012766 | 3300027543 | Bacteria | 1522 |
| 694 | Ga0209982_1000139 | 3300027552 | Bacteria | 8091 |
| 695 | Ga0209982_1001049 | 3300027552 | Bacteria | 3688 |
| 696 | Ga0209970_1039649 | 3300027614 | Bacteria | 836 |
| 697 | Ga0209983_1002894 | 3300027665 | Bacteria | 3716 |
| 698 | Ga0209282_1047549 | 3300027666 | Bacteria | 2491 |
| 699 | Ga0209971_1000288 | 3300027682 | Bacteria | 14053 |
| 700 | Ga0209998_10114225 | 3300027717 | Bacteria | 676 |
| 701 | Ga0209974_10014534 | 3300027876 | Bacteria | 2619 |
| 702 | Ga0209974_10323674 | 3300027876 | Bacteria | 594 |
| 703 | Ga0207428_10416354 | 3300027907 | Bacteria | 983 |
| 704 | Ga0268266_10001891 | 3300028379 | Bacteria | 23621 |
| 705 | Ga0268266_10002538 | 3300028379 | Bacteria | 19391 |
| 706 | Ga0268266_10034750 | 3300028379 | Bacteria | 4287 |
| 707 | Ga0268266_10058354 | 3300028379 | Bacteria | 3323 |
| 708 | Ga0268266_10065647 | 3300028379 | Bacteria | 3137 |
| 709 | Ga0268266_10125644 | 3300028379 | Bacteria | 2288 |
| 710 | Ga0268266_10162981 | 3300028379 | Bacteria | 2018 |
| 711 | Ga0268266_10316450 | 3300028379 | Bacteria | 1459 |
| 712 | Ga0268266_10543976 | 3300028379 | Bacteria | 1112 |
| 713 | Ga0268265_10000383 | 3300028380 | Bacteria | 47354 |
| 714 | Ga0268265_11209183 | 3300028380 | Bacteria | 753 |
| 715 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 716 | Ga0268264_10028346 | 3300028381 | Bacteria | 4580 |
| 717 | Ga0265334_10000272 | 3300028573 | Bacteria | 29197 |
| 718 | Ga0307515_10645580 | 3300028794 | Bacteria | 671 |
| 719 | Ga0265338_10011455 | 3300028800 | Bacteria | 10239 |
| 720 | Ga0268256_1000188 | 3300030500 | Bacteria | 72315 |
| 721 | Ga0268256_1000258 | 3300030500 | Bacteria | 56249 |
| 722 | Ga0268256_1000674 | 3300030500 | Bacteria | 25864 |
| 723 | Ga0268256_1001982 | 3300030500 | Bacteria | 11140 |
| 724 | Ga0268256_1003119 | 3300030500 | Bacteria | 7723 |
| 725 | Ga0268256_1003595 | 3300030500 | Bacteria | 6902 |
| 726 | Ga0268256_1003729 | 3300030500 | Bacteria | 6702 |
| 727 | Ga0268256_1017177 | 3300030500 | Bacteria | 2046 |
| 728 | Ga0268256_1031085 | 3300030500 | Bacteria | 1285 |
| 729 | Ga0316177_1166192 | 3300030731 | Bacteria | 4394 |
| 730 | Ga0316176_1207210 | 3300030732 | Bacteria | 4074 |
| 731 | Ga0314311_1030222 | 3300030733 | Bacteria | 8365 |
| 732 | Ga0316178_1033068 | 3300030735 | Bacteria | 14472 |
| 733 | Ga0316178_1127651 | 3300030735 | Bacteria | 1214 |
| 734 | Ga0316180_1043925 | 3300030736 | Bacteria | 661 |
| 735 | Ga0316183_1040327 | 3300030742 | Bacteria | 2620 |
| 736 | Ga0316183_1119066 | 3300030742 | Bacteria | 990 |
| 737 | Ga0316181_1171526 | 3300030744 | Bacteria | 7821 |
| 738 | Ga0316182_1129448 | 3300030745 | Bacteria | 5193 |
| 739 | Ga0316182_1288898 | 3300030745 | Bacteria | 1714 |
| 740 | Ga0265766_1002668 | 3300030863 | Bacteria | 1000 |
| 741 | Ga0265325_10002468 | 3300031241 | Bacteria | 12465 |
| 742 | Ga0265325_10101495 | 3300031241 | Bacteria | 1408 |
| 743 | Ga0265331_10023066 | 3300031250 | Bacteria | 3167 |
| 744 | Ga0265327_10001935 | 3300031251 | Bacteria | 23890 |
| 745 | Ga0307513_10282596 | 3300031456 | Bacteria | 1436 |
| 746 | Ga0307408_100000595 | 3300031548 | Bacteria | 31049 |
| 747 | Ga0307408_100000900 | 3300031548 | Bacteria | 23377 |
| 748 | Ga0307408_100001790 | 3300031548 | Bacteria | 15690 |
| 749 | Ga0307408_100410322 | 3300031548 | Bacteria | 1165 |
| 750 | Ga0307408_100866817 | 3300031548 | Bacteria | 824 |
| 751 | Ga0316575_10006210 | 3300031665 | Bacteria | 4287 |
| 752 | Ga0316575_10018901 | 3300031665 | Bacteria | 2630 |
| 753 | Ga0316575_10028680 | 3300031665 | Bacteria | 2171 |
| 754 | Ga0316575_10043459 | 3300031665 | Bacteria | 1781 |
| 755 | Ga0316575_10059515 | 3300031665 | Bacteria | 1525 |
| 756 | Ga0316575_10300405 | 3300031665 | Bacteria | 679 |
| 757 | Ga0316579_10014436 | 3300031691 | Bacteria | 3414 |
| 758 | Ga0316579_10027879 | 3300031691 | Bacteria | 2567 |
| 759 | Ga0316579_10090094 | 3300031691 | Bacteria | 1464 |
| 760 | Ga0316579_10122014 | 3300031691 | Bacteria | 1252 |
| 761 | Ga0316579_10141294 | 3300031691 | Bacteria | 1161 |
| 762 | Ga0316579_10146412 | 3300031691 | Bacteria | 1139 |
| 763 | Ga0316579_10284115 | 3300031691 | Bacteria | 800 |
| 764 | Ga0316579_10370417 | 3300031691 | Bacteria | 692 |
| 765 | Ga0316579_10418073 | 3300031691 | Bacteria | 648 |
| 766 | Ga0316576_10000365 | 3300031727 | Bacteria | 20446 |
| 767 | Ga0316576_10005233 | 3300031727 | Bacteria | 7894 |
| 768 | Ga0316576_10025746 | 3300031727 | Bacteria | 4121 |
| 769 | Ga0316576_10070262 | 3300031727 | Bacteria | 2582 |
| 770 | Ga0316576_10115217 | 3300031727 | Bacteria | 2016 |
| 771 | Ga0316576_10125769 | 3300031727 | Bacteria | 1926 |
| 772 | Ga0316576_10129454 | 3300031727 | Bacteria | 1898 |
| 773 | Ga0316576_10132290 | 3300031727 | Bacteria | 1877 |
| 774 | Ga0316576_10155933 | 3300031727 | Bacteria | 1721 |
| 775 | Ga0316576_10162064 | 3300031727 | Bacteria | 1687 |
| 776 | Ga0316576_10237148 | 3300031727 | Bacteria | 1371 |
| 777 | Ga0316576_10405174 | 3300031727 | Bacteria | 1010 |
| 778 | Ga0316576_10514197 | 3300031727 | Bacteria | 880 |
| 779 | Ga0316576_10947083 | 3300031727 | Bacteria | 615 |
| 780 | Ga0316576_11143768 | 3300031727 | Bacteria | 551 |
| 781 | Ga0316578_10002390 | 3300031728 | Bacteria | 8210 |
| 782 | Ga0316578_10002871 | 3300031728 | Bacteria | 7704 |
| 783 | Ga0316578_10003816 | 3300031728 | Bacteria | 6981 |
| 784 | Ga0316578_10010349 | 3300031728 | Bacteria | 4839 |
| 785 | Ga0316578_10025441 | 3300031728 | Bacteria | 3328 |
| 786 | Ga0316578_10025755 | 3300031728 | Bacteria | 3310 |
| 787 | Ga0316578_10070604 | 3300031728 | Bacteria | 2067 |
| 788 | Ga0316578_10071160 | 3300031728 | Bacteria | 2059 |
| 789 | Ga0316578_10079834 | 3300031728 | Bacteria | 1946 |
| 790 | Ga0316578_10117559 | 3300031728 | Bacteria | 1597 |
| 791 | Ga0316578_10159106 | 3300031728 | Bacteria | 1361 |
| 792 | Ga0316578_10344108 | 3300031728 | Bacteria | 888 |
| 793 | Ga0316578_10631250 | 3300031728 | Bacteria | 626 |
| 794 | Ga0316578_10830107 | 3300031728 | Bacteria | 535 |
| 795 | Ga0307516_10140749 | 3300031730 | Bacteria | 2183 |
| 796 | Ga0307516_10184359 | 3300031730 | Bacteria | 1818 |
| 797 | Ga0307516_10726710 | 3300031730 | Bacteria | 651 |
| 798 | Ga0307405_10252890 | 3300031731 | Bacteria | 1312 |
| 799 | Ga0316577_10000967 | 3300031733 | Bacteria | 12817 |
| 800 | Ga0316577_10001901 | 3300031733 | Bacteria | 10097 |
| 801 | Ga0316577_10006195 | 3300031733 | Bacteria | 6312 |
| 802 | Ga0316577_10008440 | 3300031733 | Bacteria | 5522 |
| 803 | Ga0316577_10015752 | 3300031733 | Bacteria | 4160 |
| 804 | Ga0316577_10026823 | 3300031733 | Bacteria | 3210 |
| 805 | Ga0316577_10027647 | 3300031733 | Bacteria | 3163 |
| 806 | Ga0316577_10128277 | 3300031733 | Bacteria | 1427 |
| 807 | Ga0316577_10169666 | 3300031733 | Bacteria | 1231 |
| 808 | Ga0316577_10268103 | 3300031733 | Bacteria | 966 |
| 809 | Ga0316577_10457147 | 3300031733 | Bacteria | 725 |
| 810 | Ga0307413_10232804 | 3300031824 | Bacteria | 1354 |
| 811 | Ga0307413_10467415 | 3300031824 | Bacteria | 1005 |
| 812 | Ga0307413_10551424 | 3300031824 | Bacteria | 935 |
| 813 | Ga0307413_11928749 | 3300031824 | Bacteria | 531 |
| 814 | Ga0307410_10585425 | 3300031852 | Bacteria | 929 |
| 815 | Ga0307410_10721614 | 3300031852 | Bacteria | 842 |
| 816 | Ga0307406_10002004 | 3300031901 | Bacteria | 11113 |
| 817 | Ga0307412_10000781 | 3300031911 | Bacteria | 18387 |
| 818 | Ga0307412_10059437 | 3300031911 | Bacteria | 2562 |
| 819 | Ga0307412_10798813 | 3300031911 | Bacteria | 819 |
| 820 | Ga0307412_11834511 | 3300031911 | Bacteria | 558 |
| 821 | Ga0307416_100013048 | 3300032002 | Bacteria | 5631 |
| 822 | Ga0307416_100522706 | 3300032002 | Bacteria | 1255 |
| 823 | Ga0307416_101038308 | 3300032002 | Bacteria | 923 |
| 824 | Ga0307416_101221250 | 3300032002 | Bacteria | 857 |
| 825 | Ga0307414_10010322 | 3300032004 | Bacteria | 5412 |
| 826 | Ga0307414_10174417 | 3300032004 | Bacteria | 1722 |
| 827 | Ga0307414_10179188 | 3300032004 | Bacteria | 1702 |
| 828 | Ga0307414_10356475 | 3300032004 | Bacteria | 1257 |
| 829 | Ga0307414_10410054 | 3300032004 | Bacteria | 1179 |
| 830 | Ga0307414_10608997 | 3300032004 | Bacteria | 980 |
| 831 | Ga0307411_10915952 | 3300032005 | Bacteria | 780 |
| 832 | Ga0316583_10001999 | 3300032133 | Bacteria | 6976 |
| 833 | Ga0316583_10002545 | 3300032133 | Bacteria | 6351 |
| 834 | Ga0316583_10007773 | 3300032133 | Bacteria | 3866 |
| 835 | Ga0316583_10011745 | 3300032133 | Bacteria | 3158 |
| 836 | Ga0316583_10073338 | 3300032133 | Bacteria | 1197 |
| 837 | Ga0316583_10183043 | 3300032133 | Bacteria | 728 |
| 838 | Ga0316585_10029715 | 3300032137 | Bacteria | 1712 |
| 839 | Ga0316585_10050096 | 3300032137 | Bacteria | 1340 |
| 840 | Ga0316585_10073295 | 3300032137 | Bacteria | 1112 |
| 841 | Ga0316585_10161384 | 3300032137 | Bacteria | 740 |
| 842 | Ga0316585_10205620 | 3300032137 | Bacteria | 651 |
| 843 | Ga0316585_10226210 | 3300032137 | Bacteria | 619 |
| 844 | Ga0316585_10306946 | 3300032137 | Bacteria | 527 |
| 845 | Ga0316580_10000629 | 3300032139 | Bacteria | 8312 |
| 846 | Ga0316580_10000991 | 3300032139 | Bacteria | 7073 |
| 847 | Ga0316580_10001942 | 3300032139 | Bacteria | 5571 |
| 848 | Ga0316580_10006714 | 3300032139 | Bacteria | 3402 |
| 849 | Ga0316580_10023405 | 3300032139 | Bacteria | 1907 |
| 850 | Ga0316580_10025521 | 3300032139 | Bacteria | 1828 |
| 851 | Ga0316580_10029179 | 3300032139 | Bacteria | 1706 |
| 852 | Ga0316580_10050738 | 3300032139 | Bacteria | 1279 |
| 853 | Ga0316593_10000037 | 3300032168 | Bacteria | 14308 |
| 854 | Ga0316593_10000090 | 3300032168 | Bacteria | 11405 |
| 855 | Ga0316593_10000105 | 3300032168 | Bacteria | 11043 |
| 856 | Ga0316593_10000170 | 3300032168 | Bacteria | 9614 |
| 857 | Ga0316593_10000239 | 3300032168 | Bacteria | 8907 |
| 858 | Ga0316593_10001113 | 3300032168 | Bacteria | 5670 |
| 859 | Ga0316593_10001316 | 3300032168 | Bacteria | 5415 |
| 860 | Ga0316593_10001765 | 3300032168 | Bacteria | 4911 |
| 861 | Ga0316593_10002310 | 3300032168 | Bacteria | 4482 |
| 862 | Ga0316593_10002877 | 3300032168 | Bacteria | 4177 |
| 863 | Ga0316593_10003511 | 3300032168 | Bacteria | 3904 |
| 864 | Ga0316593_10003674 | 3300032168 | Bacteria | 3840 |
| 865 | Ga0316593_10004626 | 3300032168 | Bacteria | 3550 |
| 866 | Ga0316593_10005492 | 3300032168 | Bacteria | 3349 |
| 867 | Ga0316593_10005752 | 3300032168 | Bacteria | 3300 |
| 868 | Ga0316593_10005754 | 3300032168 | Bacteria | 3300 |
| 869 | Ga0316593_10006095 | 3300032168 | Bacteria | 3234 |
| 870 | Ga0316593_10006651 | 3300032168 | Bacteria | 3134 |
| 871 | Ga0316593_10006666 | 3300032168 | Bacteria | 3132 |
| 872 | Ga0316593_10009160 | 3300032168 | Bacteria | 2787 |
| 873 | Ga0316593_10009462 | 3300032168 | Bacteria | 2753 |
| 874 | Ga0316593_10017013 | 3300032168 | Bacteria | 2213 |
| 875 | Ga0316593_10023909 | 3300032168 | Bacteria | 1933 |
| 876 | Ga0316593_10024309 | 3300032168 | Bacteria | 1920 |
| 877 | Ga0316593_10035643 | 3300032168 | Bacteria | 1637 |
| 878 | Ga0316593_10041816 | 3300032168 | Bacteria | 1526 |
| 879 | Ga0316593_10046536 | 3300032168 | Bacteria | 1457 |
| 880 | Ga0316593_10059026 | 3300032168 | Bacteria | 1309 |
| 881 | Ga0316593_10094491 | 3300032168 | Bacteria | 1055 |
| 882 | Ga0316593_10102570 | 3300032168 | Bacteria | 1016 |
| 883 | Ga0316593_10148823 | 3300032168 | Bacteria | 851 |
| 884 | Ga0316593_10261610 | 3300032168 | Bacteria | 649 |
| 885 | Ga0316593_10324626 | 3300032168 | Bacteria | 586 |
| 886 | Ga0316593_10434371 | 3300032168 | Bacteria | 511 |
| 887 | Ga0307507_10040591 | 3300033179 | Bacteria | 4671 |
| 888 | Ga0316592_1000006 | 3300033524 | Bacteria | 14706 |
| 889 | Ga0316592_1000008 | 3300033524 | Bacteria | 14268 |
| 890 | Ga0316592_1000152 | 3300033524 | Bacteria | 7849 |
| 891 | Ga0316592_1000166 | 3300033524 | Bacteria | 7627 |
| 892 | Ga0316592_1000320 | 3300033524 | Bacteria | 6251 |
| 893 | Ga0316592_1000527 | 3300033524 | Bacteria | 5398 |
| 894 | Ga0316592_1000901 | 3300033524 | Bacteria | 4510 |
| 895 | Ga0316592_1007736 | 3300033524 | Bacteria | 2104 |
| 896 | Ga0316592_1011845 | 3300033524 | Bacteria | 1779 |
| 897 | Ga0316592_1014072 | 3300033524 | Bacteria | 1656 |
| 898 | Ga0316592_1030984 | 3300033524 | Bacteria | 1163 |
| 899 | Ga0316592_1037924 | 3300033524 | Bacteria | 1061 |
| 900 | Ga0316592_1063588 | 3300033524 | Bacteria | 830 |
| 901 | Ga0316592_1083117 | 3300033524 | Bacteria | 729 |
| 902 | Ga0316592_1105302 | 3300033524 | Bacteria | 650 |
| 903 | Ga0316592_1167089 | 3300033524 | Bacteria | 523 |
| 904 | Ga0316586_1000062 | 3300033527 | Bacteria | 7865 |
| 905 | Ga0316586_1000811 | 3300033527 | Bacteria | 3263 |
| 906 | Ga0316586_1001007 | 3300033527 | Bacteria | 3030 |
| 907 | Ga0316586_1001156 | 3300033527 | Bacteria | 2906 |
| 908 | Ga0316586_1003655 | 3300033527 | Bacteria | 2042 |
| 909 | Ga0316586_1005762 | 3300033527 | Bacteria | 1755 |
| 910 | Ga0316586_1008619 | 3300033527 | Bacteria | 1514 |
| 911 | Ga0316586_1009742 | 3300033527 | Bacteria | 1444 |
| 912 | Ga0316586_1010601 | 3300033527 | Bacteria | 1399 |
| 913 | Ga0316586_1010928 | 3300033527 | Bacteria | 1383 |
| 914 | Ga0316586_1024940 | 3300033527 | Bacteria | 1005 |
| 915 | Ga0316586_1036446 | 3300033527 | Bacteria | 855 |
| 916 | Ga0316586_1039744 | 3300033527 | Bacteria | 825 |
| 917 | Ga0316586_1096567 | 3300033527 | Bacteria | 562 |
| 918 | Ga0316588_1000356 | 3300033528 | Bacteria | 5927 |
| 919 | Ga0316588_1000857 | 3300033528 | Bacteria | 4618 |
| 920 | Ga0316588_1001732 | 3300033528 | Bacteria | 3663 |
| 921 | Ga0316588_1002922 | 3300033528 | Bacteria | 3045 |
| 922 | Ga0316588_1010833 | 3300033528 | Bacteria | 1932 |
| 923 | Ga0316588_1050547 | 3300033528 | Bacteria | 1007 |
| 924 | Ga0316588_1122647 | 3300033528 | Bacteria | 658 |
| 925 | Ga0316588_1126439 | 3300033528 | Bacteria | 648 |
| 926 | Ga0316588_1157135 | 3300033528 | Bacteria | 585 |
| 927 | Ga0316587_1000178 | 3300033529 | Bacteria | 5352 |
| 928 | Ga0316587_1000791 | 3300033529 | Bacteria | 3505 |
| 929 | Ga0316587_1001181 | 3300033529 | Bacteria | 3119 |
| 930 | Ga0316587_1003199 | 3300033529 | Bacteria | 2273 |
| 931 | Ga0316587_1005587 | 3300033529 | Bacteria | 1892 |
| 932 | Ga0316587_1008270 | 3300033529 | Bacteria | 1632 |
| 933 | Ga0316587_1010578 | 3300033529 | Bacteria | 1477 |
| 934 | Ga0316587_1011466 | 3300033529 | Bacteria | 1431 |
| 935 | Ga0316587_1026777 | 3300033529 | Bacteria | 1006 |
| 936 | Ga0316587_1045853 | 3300033529 | Bacteria | 795 |
| 937 | Ga0316587_1050351 | 3300033529 | Bacteria | 762 |
| 938 | Ga0316587_1094742 | 3300033529 | Bacteria | 571 |
| 939 | Ga0316596_1000013 | 3300033541 | Bacteria | 16477 |
| 940 | Ga0316596_1000016 | 3300033541 | Bacteria | 15149 |
| 941 | Ga0316596_1000017 | 3300033541 | Bacteria | 15063 |
| 942 | Ga0316596_1000064 | 3300033541 | Bacteria | 12159 |
| 943 | Ga0316596_1000073 | 3300033541 | Bacteria | 11690 |
| 944 | Ga0316596_1000324 | 3300033541 | Bacteria | 7741 |
| 945 | Ga0316596_1000471 | 3300033541 | Bacteria | 6810 |
| 946 | Ga0316596_1000860 | 3300033541 | Bacteria | 5693 |
| 947 | Ga0316596_1000888 | 3300033541 | Bacteria | 5638 |
| 948 | Ga0316596_1001224 | 3300033541 | Bacteria | 5067 |
| 949 | Ga0316596_1001882 | 3300033541 | Bacteria | 4383 |
| 950 | Ga0316596_1003301 | 3300033541 | Bacteria | 3519 |
| 951 | Ga0316596_1009708 | 3300033541 | Bacteria | 2312 |
| 952 | Ga0316596_1010400 | 3300033541 | Bacteria | 2250 |
| 953 | Ga0316596_1019412 | 3300033541 | Bacteria | 1725 |
| 954 | Ga0316596_1024016 | 3300033541 | Bacteria | 1564 |
| 955 | Ga0316596_1039748 | 3300033541 | Bacteria | 1234 |
| 956 | Ga0316596_1040223 | 3300033541 | Bacteria | 1228 |
| 957 | Ga0316596_1048167 | 3300033541 | Bacteria | 1126 |
| 958 | Ga0316596_1050348 | 3300033541 | Bacteria | 1102 |
| 959 | Ga0316596_1094331 | 3300033541 | Bacteria | 807 |
| 960 | Ga0316596_1096969 | 3300033541 | Bacteria | 796 |
| 961 | Ga0316596_1099481 | 3300033541 | Bacteria | 786 |
| 962 | Ga0316596_1114383 | 3300033541 | Bacteria | 733 |
| 963 | Ga0316596_1120386 | 3300033541 | Bacteria | 714 |
| 964 | Ga0316596_1137235 | 3300033541 | Bacteria | 669 |
| 965 | Ga0316596_1178790 | 3300033541 | Bacteria | 587 |
| 966 | Ga0316596_1195447 | 3300033541 | Bacteria | 562 |
| 967 | Ga0373959_0108869 | 3300034820 | Bacteria | 667 |
| 968 | Ga0373951_0127358 | 3300035091 | Bacteria | 698 |
| 969 | Ga0373952_0284129 | 3300035092 | Bacteria | 511 |
| 970 | Ga0316574_0003365 | 3300035398 | Bacteria | 8235 |
| 971 | Ga0316574_0009388 | 3300035398 | Bacteria | 5478 |
| 972 | Ga0316574_0014334 | 3300035398 | Bacteria | 4579 |
| 973 | Ga0316574_0015724 | 3300035398 | Bacteria | 4393 |
| 974 | Ga0316574_0022885 | 3300035398 | Bacteria | 3726 |
| 975 | Ga0316574_0037126 | 3300035398 | Bacteria | 2986 |
| 976 | Ga0316574_0043878 | 3300035398 | Bacteria | 2764 |
| 977 | Ga0316574_0052893 | 3300035398 | Bacteria | 2534 |
| 978 | Ga0316574_0065682 | 3300035398 | Bacteria | 2284 |
| 979 | Ga0316574_0080197 | 3300035398 | Bacteria | 2071 |
| 980 | Ga0316574_0167088 | 3300035398 | Bacteria | 1417 |
| 981 | Ga0316574_0206123 | 3300035398 | Bacteria | 1262 |
| 982 | Ga0316574_0393407 | 3300035398 | Bacteria | 873 |
| 983 | Ga0316574_0432652 | 3300035398 | Bacteria | 826 |
| 984 | Ga0316574_0519034 | 3300035398 | Bacteria | 741 |
| 985 | Ga0316574_0818961 | 3300035398 | Bacteria | 566 |
| 986 | Ga0316582_0000535 | 3300036647 | Bacteria | 14503 |
| 987 | Ga0316582_0007722 | 3300036647 | Bacteria | 5743 |
| 988 | Ga0316582_0009607 | 3300036647 | Bacteria | 5255 |
| 989 | Ga0316582_0009817 | 3300036647 | Bacteria | 5211 |
| 990 | Ga0316582_0045489 | 3300036647 | Bacteria | 2764 |
| 991 | Ga0316582_0069080 | 3300036647 | Bacteria | 2283 |
| 992 | Ga0316582_0116894 | 3300036647 | Bacteria | 1781 |
| 993 | Ga0316582_0142125 | 3300036647 | Bacteria | 1618 |
| 994 | Ga0316582_0195133 | 3300036647 | Bacteria | 1380 |
| 995 | Ga0316582_0253038 | 3300036647 | Bacteria | 1207 |
| 996 | Ga0316582_0327449 | 3300036647 | Bacteria | 1053 |
| 997 | Ga0316582_0874963 | 3300036647 | Bacteria | 615 |
| 998 | Ga0316582_0929862 | 3300036647 | Bacteria | 594 |
| 999 | Ga0316584_0000609 | 3300036712 | Bacteria | 19432 |
| 1000 | Ga0316584_0021743 | 3300036712 | Bacteria | 4667 |
| 1001 | Ga0316584_0038333 | 3300036712 | Bacteria | 3565 |
| 1002 | Ga0316584_0045352 | 3300036712 | Bacteria | 3281 |
| 1003 | Ga0316584_0072361 | 3300036712 | Bacteria | 2584 |
| 1004 | Ga0316584_0123016 | 3300036712 | Bacteria | 1938 |
| 1005 | Ga0316584_0148891 | 3300036712 | Bacteria | 1743 |
| 1006 | Ga0316584_0235482 | 3300036712 | Bacteria | 1341 |
| 1007 | Ga0316584_0269750 | 3300036712 | Bacteria | 1239 |
| 1008 | Ga0316584_0277152 | 3300036712 | Bacteria | 1219 |
| 1009 | Ga0316584_0325327 | 3300036712 | Bacteria | 1108 |
| 1010 | Ga0316584_0627969 | 3300036712 | Bacteria | 742 |
| 1011 | Ga0316584_0727621 | 3300036712 | Bacteria | 678 |
| 1012 | Ga0316584_0949327 | 3300036712 | Bacteria | 577 |
| 1013 | Ga0373925_0560792 | 3300037068 | Bacteria | 940 |
| 1014 | Ga0395899_0040298 | 3300037312 | Bacteria | 3493 |
| 1015 | Ga0395899_0135621 | 3300037312 | Bacteria | 1754 |
| 1016 | Ga0395899_0605066 | 3300037312 | Bacteria | 698 |
| 1017 | Ga0395900_0100423 | 3300037418 | Bacteria | 2972 |
| 1018 | Ga0395900_0851552 | 3300037418 | Bacteria | 837 |
| 1019 | Ga0395898_0131389 | 3300037466 | Bacteria | 2398 |
| 1020 | Ga0395905_0191904 | 3300037471 | Bacteria | 1916 |
| 1021 | Ga0395905_0278731 | 3300037471 | Bacteria | 1558 |
| 1022 | Ga0316581_0028521 | 3300037588 | Bacteria | 1673 |
| 1023 | Ga0316581_0048004 | 3300037588 | Bacteria | 1306 |
| 1024 | Ga0316581_0163692 | 3300037588 | Bacteria | 685 |
| 1025 | Ga0395901_0035575 | 3300038443 | Bacteria | 5146 |
| 1026 | Ga0395901_0105050 | 3300038443 | Bacteria | 2964 |
| 1027 | Ga0395901_0130755 | 3300038443 | Bacteria | 2638 |
| 1028 | Ga0237819_00026 | 3300038705 | Bacteria | 50539 |
| 1029 | Ga0237819_01145 | 3300038705 | Bacteria | 7617 |
| 1030 | Ga0400484_21948 | 3300038725 | Bacteria | 1747 |
| 1031 | Ga0400484_26615 | 3300038725 | Bacteria | 15410 |
| 1032 | Ga0400484_28932 | 3300038725 | Bacteria | 10422 |
| 1033 | Ga0400484_30405 | 3300038725 | Bacteria | 18960 |
| 1034 | Ga0400490_00437 | 3300038726 | Bacteria | 17578 |
| 1035 | Ga0400490_04587 | 3300038726 | Bacteria | 5258 |
| 1036 | Ga0400490_09731 | 3300038726 | Bacteria | 5915 |
| 1037 | Ga0400490_11910 | 3300038726 | Bacteria | 15668 |
| 1038 | Ga0400490_45348 | 3300038726 | Bacteria | 8083 |
| 1039 | Ga0400490_58965 | 3300038726 | Bacteria | 11519 |
| 1040 | Ga0400491_03737 | 3300038727 | Bacteria | 1075 |
| 1041 | Ga0400491_05686 | 3300038727 | Bacteria | 2006 |
| 1042 | Ga0400491_23703 | 3300038727 | Bacteria | 3398 |
| 1043 | Ga0400485_15858 | 3300038735 | Bacteria | 1637 |
| 1044 | Ga0400485_16414 | 3300038735 | Bacteria | 1497 |
| 1045 | Ga0400488_25343 | 3300038741 | Bacteria | 4439 |
| 1046 | Ga0400488_33732 | 3300038741 | Bacteria | 1509 |
| 1047 | Ga0400488_38355 | 3300038741 | Bacteria | 4911 |
| 1048 | Ga0400488_47685 | 3300038741 | Bacteria | 2179 |
| 1049 | Ga0400488_48084 | 3300038741 | Bacteria | 3492 |
| 1050 | Ga0400486_01341 | 3300038742 | Bacteria | 7086 |
| 1051 | Ga0400486_06901 | 3300038742 | Bacteria | 5727 |
| 1052 | Ga0400486_21344 | 3300038742 | Bacteria | 12917 |
| 1053 | Ga0400483_019829 | 3300039062 | Bacteria | 1701 |
| 1054 | Ga0400483_073836 | 3300039062 | Bacteria | 21552 |
| 1055 | Ga0400483_085104 | 3300039062 | Bacteria | 8941 |
| 1056 | Ga0400483_113587 | 3300039062 | Bacteria | 1611 |
| 1057 | Ga0400483_119721 | 3300039062 | Bacteria | 1730 |
| 1058 | Ga0400483_153100 | 3300039062 | Bacteria | 13456 |
| 1059 | Ga0400483_228820 | 3300039062 | Bacteria | 9087 |
| 1060 | Ga0400483_233637 | 3300039062 | Bacteria | 29223 |
| 1061 | Ga0400483_246247 | 3300039062 | Bacteria | 3858 |
| 1062 | Ga0400483_256558 | 3300039062 | Bacteria | 4380 |
| 1063 | Ga0400483_266885 | 3300039062 | Bacteria | 1694 |
| 1064 | Ga0400483_282411 | 3300039062 | Bacteria | 6190 |
| 1065 | Ga0400489_44403 | 3300039093 | Bacteria | 9386 |
| 1066 | Ga0400489_73450 | 3300039093 | Bacteria | 1419 |
| 1067 | Ga0400487_38625 | 3300039110 | Bacteria | 13678 |
| 1068 | Ga0400487_60385 | 3300039110 | Bacteria | 6465 |
| 1069 | Ga0436365_0390798 | 3300039437 | Bacteria | 26679 |
| 1070 | Ga0436365_0804640 | 3300039437 | Bacteria | 2249 |
| 1071 | Ga0436365_0845481 | 3300039437 | Bacteria | 957 |
| 1072 | Ga0436360_0872094 | 3300039438 | Bacteria | 933 |
| 1073 | Ga0436361_0341318 | 3300039447 | Bacteria | 778 |
| 1074 | Ga0436363_0507755 | 3300039450 | Bacteria | 606 |
| 1075 | Ga0439436_0000027 | 3300041404 | Bacteria | 53417 |
| 1076 | Ga0439438_000016 | 3300041405 | Bacteria | 128189 |
| 1077 | Ga0439438_000406 | 3300041405 | Bacteria | 19354 |
| 1078 | Ga0439438_074814 | 3300041405 | Bacteria | 835 |
| 1079 | Ga0439447_002630 | 3300041407 | Bacteria | 6514 |
| 1080 | Ga0439447_023672 | 3300041407 | Bacteria | 1597 |
| 1081 | Ga0439447_108383 | 3300041407 | Bacteria | 637 |
| 1082 | Ga0439466_0000011 | 3300041411 | Bacteria | 221134 |
| 1083 | Ga0439466_0001991 | 3300041411 | Bacteria | 8008 |
| 1084 | Ga0439465_0000141 | 3300041413 | Bacteria | 17802 |
| 1085 | Ga0439465_0164329 | 3300041413 | Bacteria | 797 |
| 1086 | Ga0451789_0621368 | 3300041443 | Bacteria | 746 |
| 1087 | Ga0451789_0864582 | 3300041443 | Bacteria | 1288 |
| 1088 | Ga0451790_50732 | 3300041444 | Bacteria | 626 |
| 1089 | Ga0451792_17887 | 3300041445 | Bacteria | 898 |
| 1090 | Ga0451791_0285136 | 3300041451 | Bacteria | 2195 |
| 1091 | Ga0451791_0398483 | 3300041451 | Bacteria | 516 |
| 1092 | Ga0451791_0591736 | 3300041451 | Bacteria | 851 |
| 1093 | Ga0451791_1092867 | 3300041451 | Bacteria | 752 |
| 1094 | Ga0451793_0147297 | 3300041452 | Bacteria | 2774 |
| 1095 | Ga0451793_1283045 | 3300041452 | Bacteria | 565 |
| 1096 | Ga0451797_0708520 | 3300041453 | Bacteria | 1735 |
| 1097 | Ga0451801_36357 | 3300041455 | Bacteria | 935 |
| 1098 | Ga0451795_0482512 | 3300041456 | Bacteria | 1000 |
| 1099 | Ga0451798_0304695 | 3300041458 | Bacteria | 723 |
| 1100 | Ga0451798_0776824 | 3300041458 | Bacteria | 542 |
| 1101 | Ga0451800_1057945 | 3300041459 | Bacteria | 15810 |
| 1102 | Ga0451802_0320625 | 3300041460 | Bacteria | 906 |
| 1103 | Ga0451802_0850886 | 3300041460 | Bacteria | 1194 |
| 1104 | Ga0451805_070913 | 3300041461 | Bacteria | 2877 |
| 1105 | Ga0451806_234332 | 3300041462 | Bacteria | 19745 |
| 1106 | Ga0451804_0273190 | 3300041463 | Bacteria | 1635 |
| 1107 | Ga0451807_0203642 | 3300041486 | Bacteria | 6914 |
| 1108 | Ga0451833_0641876 | 3300041491 | Bacteria | 1012 |
| 1109 | Ga0451837_0138569 | 3300041494 | Bacteria | 3907 |
| 1110 | Ga0451839_1074144 | 3300041496 | Bacteria | 1008 |
| 1111 | Ga0451841_1135274 | 3300041498 | Bacteria | 2550 |
| 1112 | Ga0451846_29185 | 3300041502 | Bacteria | 1131 |
| 1113 | Ga0451849_0833378 | 3300041505 | Bacteria | 1006 |
| 1114 | Ga0451851_0732648 | 3300041507 | Bacteria | 974 |
| 1115 | Ga0451843_0113374 | 3300041509 | Bacteria | 1228 |
| 1116 | Ga0451843_0415897 | 3300041509 | Bacteria | 650 |
| 1117 | Ga0451854_31420 | 3300041510 | Bacteria | 684 |
| 1118 | Ga0451853_0065199 | 3300041512 | Bacteria | 2396 |
| 1119 | Ga0451853_0286797 | 3300041512 | Bacteria | 871 |
| 1120 | Ga0451853_1411631 | 3300041512 | Bacteria | 2164 |
| 1121 | Ga0451853_3999158 | 3300041512 | Bacteria | 1074 |
| 1122 | Ga0439431_0166628 | 3300041997 | Bacteria | 631 |
| 1123 | Ga0439437_001344 | 3300042000 | Bacteria | 2586 |
| 1124 | Ga0439445_0049863 | 3300042004 | Bacteria | 1128 |
| 1125 | Ga0439445_0081424 | 3300042004 | Bacteria | 905 |
| 1126 | Ga0439445_0092543 | 3300042004 | Bacteria | 852 |
| 1127 | Ga0439432_000824 | 3300042006 | Bacteria | 11560 |
| 1128 | Ga0439432_001037 | 3300042006 | Bacteria | 10543 |
| 1129 | Ga0439432_002401 | 3300042006 | Bacteria | 7068 |
| 1130 | Ga0439432_011571 | 3300042006 | Bacteria | 3040 |
| 1131 | Ga0439432_014624 | 3300042006 | Bacteria | 2655 |
| 1132 | Ga0439432_124463 | 3300042006 | Bacteria | 762 |
| 1133 | Ga0439432_154018 | 3300042006 | Bacteria | 674 |
| 1134 | Ga0439449_0002484 | 3300042007 | Bacteria | 7209 |
| 1135 | Ga0439449_0098257 | 3300042007 | Bacteria | 1081 |
| 1136 | Ga0439452_000010 | 3300042010 | Bacteria | 459139 |
| 1137 | Ga0439452_000384 | 3300042010 | Bacteria | 26380 |
| 1138 | Ga0439452_000388 | 3300042010 | Bacteria | 26215 |
| 1139 | Ga0439452_117984 | 3300042010 | Bacteria | 565 |
| 1140 | Ga0439456_006490 | 3300042013 | Bacteria | 2391 |
| 1141 | Ga0439463_000335 | 3300042016 | Bacteria | 13091 |
| 1142 | Ga0450911_000978 | 3300042115 | Bacteria | 7421 |
| 1143 | Ga0450902_030872 | 3300042137 | Bacteria | 902 |
| 1144 | Ga0450904_000176 | 3300042139 | Bacteria | 13995 |
| 1145 | Ga0450907_001837 | 3300042146 | Bacteria | 4361 |
| 1146 | Ga0439446_0033772 | 3300042156 | Bacteria | 1487 |
| 1147 | Ga0450908_003237 | 3300042184 | Bacteria | 3168 |
| 1148 | Ga0439434_0006646 | 3300042435 | Bacteria | 3380 |
| 1149 | Ga0439459_0010896 | 3300042438 | Bacteria | 1593 |
| 1150 | Ga0439459_0203660 | 3300042438 | Bacteria | 541 |
| 1151 | Ga0439464_0001845 | 3300042439 | Bacteria | 5115 |
| 1152 | Ga0439464_0001931 | 3300042439 | Bacteria | 5010 |
| 1153 | Ga0439464_0004320 | 3300042439 | Bacteria | 3632 |
| 1154 | Ga0450916_063459 | 3300042530 | Bacteria | 604 |
| 1155 | Ga0450893_0001607 | 3300042532 | Bacteria | 3464 |
| 1156 | Ga0451577_0007309 | 3300042876 | Bacteria | 10874 |
| 1157 | Ga0466982_0000210 | 3300044672 | Bacteria | 15368 |
| 1158 | Ga0453683_0029666 | 3300044673 | Bacteria | 3458 |
| 1159 | Ga0453684_0001268 | 3300044712 | Bacteria | 75704 |
| 1160 | Ga0453684_0623450 | 3300044712 | Bacteria | 1180 |
| 1161 | Ga0466968_0654986 | 3300044735 | Bacteria | 533 |
| 1162 | Ga0466957_0089266 | 3300044842 | Bacteria | 1929 |
| 1163 | Ga0451576_1702569 | 3300045051 | Bacteria | 653 |
| 1164 | Ga0466967_0567214 | 3300045976 | Bacteria | 1118 |
| 1165 | Ga0466967_0601757 | 3300045976 | Bacteria | 1085 |
| 1166 | Ga0495617_000213 | 3300046452 | Bacteria | 35551 |
| 1167 | Ga0495617_058347 | 3300046452 | Bacteria | 1279 |
| 1168 | Ga0495627_000696 | 3300046453 | Bacteria | 25746 |
| 1169 | Ga0495591_000658 | 3300046458 | Bacteria | 25518 |
| 1170 | Ga0495591_001371 | 3300046458 | Bacteria | 15266 |
| 1171 | Ga0495638_0001525 | 3300046460 | Bacteria | 20852 |
| 1172 | Ga0495638_0001912 | 3300046460 | Bacteria | 17955 |
| 1173 | Ga0495638_0050575 | 3300046460 | Bacteria | 2595 |
| 1174 | Ga0495650_0000787 | 3300046471 | Bacteria | 38830 |
| 1175 | Ga0495650_0001108 | 3300046471 | Bacteria | 29502 |
| 1176 | Ga0495650_0001677 | 3300046471 | Bacteria | 20464 |
| 1177 | Ga0495650_0011587 | 3300046471 | Bacteria | 4817 |
| 1178 | Ga0495650_0022825 | 3300046471 | Bacteria | 2992 |
| 1179 | Ga0495650_0055509 | 3300046471 | Bacteria | 1611 |
| 1180 | Ga0495605_0011977 | 3300046474 | Bacteria | 4821 |
| 1181 | Ga0495605_0156182 | 3300046474 | Bacteria | 1015 |
| 1182 | Ga0495584_0001537 | 3300046491 | Bacteria | 13711 |
| 1183 | Ga0495584_0011469 | 3300046491 | Bacteria | 4539 |
| 1184 | Ga0495596_0004550 | 3300046500 | Bacteria | 6740 |
| 1185 | Ga0495607_0000012 | 3300046501 | Bacteria | 195369 |
| 1186 | Ga0495607_0018006 | 3300046501 | Bacteria | 4515 |
| 1187 | Ga0495607_0023571 | 3300046501 | Bacteria | 3851 |
| 1188 | Ga0495607_0033957 | 3300046501 | Bacteria | 3100 |
| 1189 | Ga0495606_0001257 | 3300046507 | Bacteria | 35388 |
| 1190 | Ga0495606_0001303 | 3300046507 | Bacteria | 34371 |
| 1191 | Ga0495606_0009659 | 3300046507 | Bacteria | 8123 |
| 1192 | Ga0495606_0070965 | 3300046507 | Bacteria | 2194 |
| 1193 | Ga0495610_0001380 | 3300046512 | Bacteria | 21565 |
| 1194 | Ga0495610_0011725 | 3300046512 | Bacteria | 5329 |
| 1195 | Ga0495610_0074761 | 3300046512 | Bacteria | 1571 |
| 1196 | Ga0495616_0089266 | 3300046513 | Bacteria | 1463 |
| 1197 | Ga0495620_0001298 | 3300046515 | Bacteria | 15206 |
| 1198 | Ga0495620_0007668 | 3300046515 | Bacteria | 5837 |
| 1199 | Ga0495620_0027402 | 3300046515 | Bacteria | 2666 |
| 1200 | Ga0495631_0009976 | 3300046518 | Bacteria | 4721 |
| 1201 | Ga0495631_0021513 | 3300046518 | Bacteria | 3003 |
| 1202 | Ga0495631_0051702 | 3300046518 | Bacteria | 1795 |
| 1203 | Ga0495632_0005953 | 3300046519 | Bacteria | 7945 |
| 1204 | Ga0495632_0025323 | 3300046519 | Bacteria | 3140 |
| 1205 | Ga0495632_0025699 | 3300046519 | Bacteria | 3111 |
| 1206 | Ga0495637_0002718 | 3300046520 | Bacteria | 9640 |
| 1207 | Ga0495637_0076697 | 3300046520 | Bacteria | 1339 |
| 1208 | Ga0495643_0010313 | 3300046522 | Bacteria | 5754 |
| 1209 | Ga0495643_0064611 | 3300046522 | Bacteria | 1933 |
| 1210 | Ga0495643_0232132 | 3300046522 | Bacteria | 869 |
| 1211 | Ga0495644_0000420 | 3300046523 | Bacteria | 18895 |
| 1212 | Ga0495648_0021547 | 3300046524 | Bacteria | 4459 |
| 1213 | Ga0495648_0025079 | 3300046524 | Bacteria | 4044 |
| 1214 | Ga0495648_0326885 | 3300046524 | Bacteria | 708 |
| 1215 | Ga0495654_0000178 | 3300046530 | Bacteria | 62611 |
| 1216 | Ga0495654_0000730 | 3300046530 | Bacteria | 25592 |
| 1217 | Ga0495654_0001501 | 3300046530 | Bacteria | 15950 |
| 1218 | Ga0495654_0012399 | 3300046530 | Bacteria | 4580 |
| 1219 | Ga0495654_0055682 | 3300046530 | Bacteria | 1913 |
| 1220 | Ga0495609_0000089 | 3300046538 | Bacteria | 107029 |
| 1221 | Ga0495609_0001578 | 3300046538 | Bacteria | 14896 |
| 1222 | Ga0495597_0001226 | 3300046542 | Bacteria | 19105 |
| 1223 | Ga0495633_0029543 | 3300046558 | Bacteria | 2666 |
| 1224 | Ga0495656_0074115 | 3300046615 | Bacteria | 1519 |
| 1225 | Ga0495668_0003266 | 3300046616 | Bacteria | 12327 |
| 1226 | Ga0495668_0006136 | 3300046616 | Bacteria | 7956 |
| 1227 | Ga0495668_0020102 | 3300046616 | Bacteria | 3841 |
| 1228 | Ga0495611_0000029 | 3300046648 | Bacteria | 115887 |
| 1229 | Ga0495611_0008135 | 3300046648 | Bacteria | 4447 |
| 1230 | Ga0495625_0001724 | 3300046660 | Bacteria | 25395 |
| 1231 | Ga0495625_0005121 | 3300046660 | Bacteria | 12114 |
| 1232 | Ga0495625_0101380 | 3300046660 | Bacteria | 1977 |
| 1233 | Ga0495625_0159043 | 3300046660 | Bacteria | 1514 |
| 1234 | Ga0495661_0044308 | 3300046665 | Bacteria | 2728 |
| 1235 | Ga0495588_0054483 | 3300046674 | Bacteria | 2063 |
| 1236 | Ga0495588_0186328 | 3300046674 | Bacteria | 1096 |
| 1237 | Ga0495670_0016580 | 3300046691 | Bacteria | 3622 |
| 1238 | Ga0495670_0152107 | 3300046691 | Bacteria | 1213 |
| 1239 | Ga0495670_0206763 | 3300046691 | Bacteria | 1040 |
| 1240 | Ga0495671_0000488 | 3300046692 | Bacteria | 30667 |
| 1241 | Ga0495671_0001281 | 3300046692 | Bacteria | 17150 |
| 1242 | Ga0495649_0025971 | 3300046694 | Bacteria | 3259 |
| 1243 | Ga0495649_0150366 | 3300046694 | Bacteria | 1223 |
| 1244 | Ga0495649_0156349 | 3300046694 | Bacteria | 1196 |
| 1245 | Ga0495589_0000144 | 3300046794 | Bacteria | 65654 |
| 1246 | Ga0495589_0000538 | 3300046794 | Bacteria | 26421 |
| 1247 | Ga0495660_0000286 | 3300046810 | Bacteria | 46967 |
| 1248 | Ga0495660_0000352 | 3300046810 | Bacteria | 40624 |
| 1249 | Ga0495660_0000755 | 3300046810 | Bacteria | 24422 |
| 1250 | Ga0495660_0014492 | 3300046810 | Bacteria | 4559 |
| 1251 | Ga0495636_0009335 | 3300047318 | Bacteria | 3861 |
| 1252 | Ga0495672_0000040 | 3300047320 | Bacteria | 268573 |
| 1253 | Ga0495672_0000057 | 3300047320 | Bacteria | 221635 |
| 1254 | Ga0495672_0004046 | 3300047320 | Bacteria | 12251 |
| 1255 | Ga0495672_0159995 | 3300047320 | Bacteria | 1159 |
| 1256 | Ga0495683_0001368 | 3300047323 | Bacteria | 16223 |
| 1257 | Ga0495683_0019053 | 3300047323 | Bacteria | 3541 |
| 1258 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 1259 | Ga0495679_001362 | 3300047446 | Bacteria | 14046 |
| 1260 | Ga0495673_0000072 | 3300047469 | Bacteria | 213166 |
| 1261 | Ga0495673_0000498 | 3300047469 | Bacteria | 41800 |
| 1262 | Ga0495673_0000948 | 3300047469 | Bacteria | 26258 |
| 1263 | Ga0495673_0001941 | 3300047469 | Bacteria | 15339 |
| 1264 | Ga0495673_0015229 | 3300047469 | Bacteria | 3968 |
| 1265 | Ga0495681_0023793 | 3300047470 | Bacteria | 3243 |
| 1266 | Ga0495686_0002623 | 3300047472 | Bacteria | 16652 |
| 1267 | Ga0495686_0033604 | 3300047472 | Bacteria | 3309 |
| 1268 | Ga0495686_0252482 | 3300047472 | Bacteria | 990 |
| 1269 | Ga0495686_0563429 | 3300047472 | Bacteria | 593 |
| 1270 | Ga0496100_0005912 | 3300048903 | Bacteria | 6632 |
| 1271 | Ga0496101_0002023 | 3300048904 | Bacteria | 12318 |
| 1272 | Ga0496101_0108578 | 3300048904 | Bacteria | 2086 |
| 1273 | Ga0496101_1187336 | 3300048904 | Bacteria | 598 |
| 1274 | Ga0496101_1282701 | 3300048904 | Bacteria | 573 |
| 1275 | Ga0496102_0030781 | 3300048905 | Bacteria | 4805 |
| 1276 | Ga0496102_0731287 | 3300048905 | Bacteria | 912 |
| 1277 | Ga0496103_0043084 | 3300048906 | Bacteria | 2778 |
| 1278 | Ga0496104_0001892 | 3300048907 | Bacteria | 18133 |
| 1279 | Ga0496104_0016472 | 3300048907 | Bacteria | 6715 |
| 1280 | Ga0496105_0002695 | 3300048908 | Bacteria | 12933 |
| 1281 | Ga0496105_0412489 | 3300048908 | Bacteria | 1070 |
| 1282 | Ga0496106_0001522 | 3300048909 | Bacteria | 17429 |
| 1283 | Ga0496108_0913793 | 3300048911 | Bacteria | 753 |
| 1284 | Ga0496108_1736935 | 3300048911 | Unclassified | 513 |
| 1285 | Ga0496109_0919104 | 3300048912 | Bacteria | 813 |
| 1286 | Ga0496109_1304448 | 3300048912 | Bacteria | 662 |
| 1287 | Ga0496110_0222429 | 3300048913 | Bacteria | 1717 |
| 1288 | Ga0496113_0035458 | 3300048916 | Bacteria | 3648 |
| 1289 | Ga0496115_0000605 | 3300048918 | Bacteria | 27378 |
| 1290 | Ga0496116_0003201 | 3300048919 | Bacteria | 16374 |
| 1291 | Ga0496116_0005339 | 3300048919 | Bacteria | 11970 |
| 1292 | Ga0496116_0006976 | 3300048919 | Bacteria | 10121 |
| 1293 | Ga0496116_0011021 | 3300048919 | Bacteria | 7521 |
| 1294 | Ga0496116_0243440 | 3300048919 | Bacteria | 901 |
| 1295 | Ga0496117_0005477 | 3300048920 | Bacteria | 13301 |
| 1296 | Ga0496117_0011774 | 3300048920 | Bacteria | 7796 |
| 1297 | Ga0496117_0024547 | 3300048920 | Bacteria | 4765 |
| 1298 | Ga0496117_0034005 | 3300048920 | Bacteria | 3847 |
| 1299 | Ga0496117_0100689 | 3300048920 | Bacteria | 1829 |
| 1300 | Ga0496117_0395597 | 3300048920 | Bacteria | 699 |
| 1301 | Ga0496118_0007739 | 3300048921 | Bacteria | 11281 |
| 1302 | Ga0496118_0021422 | 3300048921 | Bacteria | 5688 |
| 1303 | Ga0496118_0026816 | 3300048921 | Bacteria | 4896 |
| 1304 | Ga0496118_0031572 | 3300048921 | Bacteria | 4388 |
| 1305 | Ga0496118_0094354 | 3300048921 | Bacteria | 2046 |
| 1306 | Ga0496118_0110724 | 3300048921 | Bacteria | 1823 |
| 1307 | Ga0496118_0148897 | 3300048921 | Bacteria | 1468 |
| 1308 | Ga0496118_0172911 | 3300048921 | Bacteria | 1317 |
| 1309 | Ga0496118_0220442 | 3300048921 | Bacteria | 1104 |
| 1310 | Ga0496119_0003409 | 3300048922 | Bacteria | 16511 |
| 1311 | Ga0496119_0005901 | 3300048922 | Bacteria | 11555 |
| 1312 | Ga0496119_0006104 | 3300048922 | Bacteria | 11284 |
| 1313 | Ga0496119_0006306 | 3300048922 | Bacteria | 11044 |
| 1314 | Ga0496119_0029409 | 3300048922 | Bacteria | 3726 |
| 1315 | Ga0496119_0035175 | 3300048922 | Bacteria | 3285 |
| 1316 | Ga0496119_0108174 | 3300048922 | Bacteria | 1548 |
| 1317 | Ga0496119_0136252 | 3300048922 | Bacteria | 1331 |
| 1318 | Ga0496120_0001572 | 3300048923 | Bacteria | 26689 |
| 1319 | Ga0496120_0002769 | 3300048923 | Bacteria | 17056 |
| 1320 | Ga0496120_0010944 | 3300048923 | Bacteria | 6275 |
| 1321 | Ga0496120_0030470 | 3300048923 | Bacteria | 3278 |
| 1322 | Ga0496120_0055780 | 3300048923 | Bacteria | 2232 |
| 1323 | Ga0496120_0126218 | 3300048923 | Bacteria | 1316 |
| 1324 | Ga0496120_0181388 | 3300048923 | Bacteria | 1033 |
| 1325 | Ga0496121_0003768 | 3300048924 | Bacteria | 21184 |
| 1326 | Ga0496121_0004539 | 3300048924 | Bacteria | 18566 |
| 1327 | Ga0496121_0016935 | 3300048924 | Bacteria | 7487 |
| 1328 | Ga0496121_0033577 | 3300048924 | Bacteria | 4639 |
| 1329 | Ga0496121_0158242 | 3300048924 | Bacteria | 1659 |
| 1330 | Ga0496121_0203442 | 3300048924 | Bacteria | 1409 |
| 1331 | Ga0496122_0001230 | 3300048925 | Bacteria | 43287 |
| 1332 | Ga0496122_0001405 | 3300048925 | Bacteria | 39030 |
| 1333 | Ga0496122_0008393 | 3300048925 | Bacteria | 11157 |
| 1334 | Ga0496122_0015755 | 3300048925 | Bacteria | 7204 |
| 1335 | Ga0496122_0017548 | 3300048925 | Bacteria | 6685 |
| 1336 | Ga0496122_0024616 | 3300048925 | Bacteria | 5262 |
| 1337 | Ga0496122_0128946 | 3300048925 | Bacteria | 1612 |
| 1338 | Ga0496122_0603965 | 3300048925 | Bacteria | 512 |
| 1339 | Ga0496123_0001008 | 3300048926 | Bacteria | 43023 |
| 1340 | Ga0496123_0001162 | 3300048926 | Bacteria | 39028 |
| 1341 | Ga0496123_0006244 | 3300048926 | Bacteria | 11617 |
| 1342 | Ga0496123_0006598 | 3300048926 | Bacteria | 11206 |
| 1343 | Ga0496123_0006627 | 3300048926 | Bacteria | 11177 |
| 1344 | Ga0496123_0008749 | 3300048926 | Bacteria | 9241 |
| 1345 | Ga0496123_0032023 | 3300048926 | Bacteria | 3815 |
| 1346 | Ga0496123_0044605 | 3300048926 | Bacteria | 3030 |
| 1347 | Ga0496123_0047515 | 3300048926 | Bacteria | 2898 |
| 1348 | Ga0496123_0056797 | 3300048926 | Bacteria | 2554 |
| 1349 | Ga0496123_0289445 | 3300048926 | Bacteria | 787 |
| 1350 | Ga0496123_0318158 | 3300048926 | Bacteria | 735 |
| 1351 | Ga0496123_0490111 | 3300048926 | Bacteria | 539 |
| 1352 | Ga0496124_0000472 | 3300048927 | Bacteria | 69226 |
| 1353 | Ga0496124_0001250 | 3300048927 | Bacteria | 38944 |
| 1354 | Ga0496124_0001586 | 3300048927 | Bacteria | 32782 |
| 1355 | Ga0496124_0004282 | 3300048927 | Bacteria | 16770 |
| 1356 | Ga0496124_0007859 | 3300048927 | Bacteria | 11246 |
| 1357 | Ga0496124_0016466 | 3300048927 | Bacteria | 7024 |
| 1358 | Ga0496124_0027994 | 3300048927 | Bacteria | 5046 |
| 1359 | Ga0496124_0157468 | 3300048927 | Bacteria | 1774 |
| 1360 | Ga0496124_0268946 | 3300048927 | Bacteria | 1249 |
| 1361 | Ga0496125_0000100 | 3300048928 | Bacteria | 202713 |
| 1362 | Ga0496125_0036970 | 3300048928 | Bacteria | 4252 |
| 1363 | Ga0496125_0040942 | 3300048928 | Bacteria | 3966 |
| 1364 | Ga0496125_0187377 | 3300048928 | Bacteria | 1370 |
| 1365 | Ga0496125_0305756 | 3300048928 | Bacteria | 972 |
| 1366 | Ga0496126_0000033 | 3300048929 | Bacteria | 368851 |
| 1367 | Ga0496126_0003866 | 3300048929 | Bacteria | 18480 |
| 1368 | Ga0496126_0013100 | 3300048929 | Bacteria | 8457 |
| 1369 | Ga0496126_0022691 | 3300048929 | Bacteria | 6097 |
| 1370 | Ga0496126_0033686 | 3300048929 | Bacteria | 4818 |
| 1371 | Ga0496126_0083436 | 3300048929 | Bacteria | 2820 |
| 1372 | Ga0496126_0195964 | 3300048929 | Bacteria | 1708 |
| 1373 | Ga0496126_0300169 | 3300048929 | Bacteria | 1325 |
| 1374 | Ga0496126_0330660 | 3300048929 | Bacteria | 1250 |
| 1375 | Ga0496126_0463736 | 3300048929 | Bacteria | 1017 |
| 1376 | Ga0501306_008659 | 3300049127 | Bacteria | 1246 |
| 1377 | Ga0501308_053469 | 3300049128 | Bacteria | 596 |
| 1378 | Ga0501309_026767 | 3300049129 | Bacteria | 834 |
| 1379 | Ga0501310_013500 | 3300049130 | Bacteria | 949 |
| 1380 | Ga0501307_000588 | 3300049162 | Bacteria | 2586 |
| 1381 | Ga0495678_000882 | 3300049459 | Bacteria | 26697 |
| 1382 | Ga0495678_003548 | 3300049459 | Bacteria | 9567 |
| 1383 | Ga0495682_0000520 | 3300049460 | Bacteria | 26623 |
| 1384 | Ga0501312_000128 | 3300049528 | Bacteria | 4717 |
| 1385 | Ga0501313_038755 | 3300049529 | Bacteria | 636 |
| 1386 | Ga0501316_000026 | 3300049532 | Bacteria | 6215 |
| 1387 | Ga0501320_002144 | 3300049536 | Bacteria | 1550 |
| 1388 | Ga0501321_040733 | 3300049537 | Bacteria | 653 |
| 1389 | Ga0501330_018742 | 3300049546 | Bacteria | 545 |
| 1390 | Ga0501338_04571 | 3300049554 | Bacteria | 841 |
| 1391 | Ga0501031_0003929 | 3300049568 | Bacteria | 9569 |
| 1392 | Ga0501031_0453984 | 3300049568 | Bacteria | 828 |
| 1393 | Ga0501032_0002355 | 3300049569 | Bacteria | 14808 |
| 1394 | Ga0501033_0004184 | 3300049570 | Bacteria | 11618 |
| 1395 | Ga0501033_0029320 | 3300049570 | Bacteria | 4135 |
| 1396 | Ga0501033_0745431 | 3300049570 | Bacteria | 664 |
| 1397 | Ga0501034_0090022 | 3300049571 | Bacteria | 3067 |
| 1398 | Ga0501034_0218862 | 3300049571 | Bacteria | 1857 |
| 1399 | Ga0501036_0006195 | 3300049572 | Bacteria | 9705 |
| 1400 | Ga0501036_0083509 | 3300049572 | Bacteria | 2700 |
| 1401 | Ga0501036_1136989 | 3300049572 | Bacteria | 637 |
| 1402 | Ga0501037_0001372 | 3300049573 | Bacteria | 17876 |
| 1403 | Ga0501037_0065318 | 3300049573 | Bacteria | 2651 |
| 1404 | Ga0501038_0000314 | 3300049574 | Bacteria | 41462 |
| 1405 | Ga0501038_0243106 | 3300049574 | Bacteria | 1428 |
| 1406 | Ga0501039_0003833 | 3300049575 | Bacteria | 11292 |
| 1407 | Ga0501039_0797842 | 3300049575 | Bacteria | 737 |
| 1408 | Ga0501040_0319239 | 3300049576 | Bacteria | 1111 |
| 1409 | Ga0501041_0836094 | 3300049577 | Bacteria | 591 |
| 1410 | Ga0501042_0030954 | 3300049578 | Bacteria | 3784 |
| 1411 | Ga0501043_0001324 | 3300049579 | Bacteria | 21677 |
| 1412 | Ga0501043_0011177 | 3300049579 | Bacteria | 7030 |
| 1413 | Ga0501046_0001012 | 3300049580 | Bacteria | 27395 |
| 1414 | Ga0501046_0450357 | 3300049580 | Bacteria | 926 |
| 1415 | Ga0501047_0017837 | 3300049581 | Bacteria | 6799 |
| 1416 | Ga0501047_0244141 | 3300049581 | Bacteria | 1645 |
| 1417 | Ga0501047_0383636 | 3300049581 | Bacteria | 1239 |
| 1418 | Ga0501047_0387183 | 3300049581 | Bacteria | 1232 |
| 1419 | Ga0501047_0669514 | 3300049581 | Bacteria | 856 |
| 1420 | Ga0501047_0675659 | 3300049581 | Bacteria | 851 |
| 1421 | Ga0501047_0884130 | 3300049581 | Bacteria | 707 |
| 1422 | Ga0501067_0194539 | 3300049583 | Bacteria | 1130 |
| 1423 | Ga0501067_0513761 | 3300049583 | Bacteria | 670 |
| 1424 | Ga0501068_0183409 | 3300049584 | Bacteria | 1324 |
| 1425 | Ga0501068_0207541 | 3300049584 | Bacteria | 1243 |
| 1426 | Ga0501068_0713906 | 3300049584 | Bacteria | 656 |
| 1427 | Ga0501070_0557055 | 3300049586 | Bacteria | 917 |
| 1428 | Ga0501071_0741147 | 3300049587 | Bacteria | 757 |
| 1429 | Ga0501073_0005913 | 3300049589 | Bacteria | 9132 |
| 1430 | Ga0501073_1078068 | 3300049589 | Bacteria | 552 |
| 1431 | Ga0501074_0320358 | 3300049590 | Bacteria | 1101 |
| 1432 | Ga0501227_120792 | 3300049665 | Bacteria | 707 |
| 1433 | Ga0501249_042535 | 3300049679 | Bacteria | 1033 |
| 1434 | Ga0501251_073724 | 3300049681 | Bacteria | 587 |
| 1435 | Ga0501257_047708 | 3300049686 | Bacteria | 1063 |
| 1436 | Ga0501225_0105837 | 3300049705 | Bacteria | 825 |
| 1437 | Ga0501080_0145438 | 3300049742 | Bacteria | 2191 |
| 1438 | Ga0501035_0000666 | 3300049822 | Bacteria | 37861 |
| 1439 | Ga0501035_0049862 | 3300049822 | Bacteria | 3752 |
| 1440 | Ga0501035_0349554 | 3300049822 | Bacteria | 1237 |
| 1441 | Ga0501035_0426462 | 3300049822 | Bacteria | 1100 |
| 1442 | Ga0501044_0004802 | 3300049823 | Bacteria | 15112 |
| 1443 | Ga0501044_0025623 | 3300049823 | Bacteria | 6252 |
| 1444 | Ga0501044_0054246 | 3300049823 | Bacteria | 4122 |
| 1445 | Ga0501044_0230592 | 3300049823 | Bacteria | 1799 |
| 1446 | Ga0501044_1369177 | 3300049823 | Bacteria | 573 |
| 1447 | nmdc:mga00v17_1225_c1 | 3300050491 | Bacteria | 13469 |
| 1448 | nmdc:mga00v17_304144_c1 | 3300050491 | Bacteria | 1036 |
| 1449 | nmdc:mga00v17_83351_c1 | 3300050491 | Bacteria | 2000 |
| 1450 | nmdc:mga0qj67_163083_c1 | 3300050509 | Bacteria | 1809 |
| 1451 | nmdc:mga0qj67_757457_c1 | 3300050509 | Bacteria | 770 |
| 1452 | nmdc:mga0sz30_200195_c1 | 3300050516 | Bacteria | 887 |
| 1453 | nmdc:mga0sz30_91353_c1 | 3300050516 | Bacteria | 1325 |
| 1454 | Ga0500643_000120 | 3300053087 | Bacteria | 81701 |
| 1455 | Ga0500651_0003556 | 3300053093 | Bacteria | 8533 |
| 1456 | Ga0500555_001019 | 3300053103 | Bacteria | 9511 |
| 1457 | Ga0500595_034558 | 3300053119 | Bacteria | 1671 |
| 1458 | Ga0500621_000035 | 3300053126 | Bacteria | 26463 |
| 1459 | Ga0500564_040396 | 3300053138 | Bacteria | 2148 |
| 1460 | Ga0500633_0008712 | 3300053160 | Bacteria | 2630 |
| 1461 | Ga0500634_0000084 | 3300053161 | Bacteria | 36722 |
| 1462 | Ga0500645_002030 | 3300053730 | Bacteria | 9458 |
| 1463 | Ga0500661_041519 | 3300055283 | Bacteria | 815 |
| 1464 | Ga0451793_1516371 | |||
| 1465 | MRS2a_Contig_30 | |||
| 1466 | SwRhRL2b_contig_1764583 | |||
| 1467 | JGI24736J21556_1002338 | |||
| 1468 | JGI24741J21665_1002066 | |||
| 1469 | JGI24740J21852_10005249 | |||
| 1470 | JGI24739J22299_10000118 | |||
| 1471 | JGI24737J22298_10000685 | |||
| 1472 | JGI24737J22298_10004035 | |||
| 1473 | JGI24737J22298_10129025 | |||
| 1474 | JGI24735J21928_10007003 | |||
| 1475 | JGI24735J21928_10080256 | |||
| 1476 | JGI24744J21845_10044038 | |||
| 1477 | JGI25156J39149_1005142 | |||
| 1478 | JGI25162J39368_1001066 | |||
| 1479 | JGI25162J39368_1002454 | |||
| 1480 | JGI25162J39368_1004075 | |||
| 1481 | JGI25154J39366_1007603 | |||
| 1482 | JGI25157J39369_1002937 | |||
| 1483 | JGI25163J39215_1000088 | |||
| 1484 | JGI25164J39214_1000264 | |||
| 1485 | JGI25164J39214_1000535 | |||
| 1486 | JGI25164J39214_1000666 | |||
| 1487 | JGI25152J39213_1000284 | |||
| 1488 | JGI25152J39213_1001094 | |||
| 1489 | JGI25152J39213_1031566 | |||
| 1490 | JGI25150J39212_1000359 | |||
| 1491 | JGI25151J46595_10000895 | |||
| 1492 | JGI25165J46597_1001865 | |||
| 1493 | JGI25165J46597_1004381 | |||
| 1494 | JGI25153J46596_10000050 | |||
| 1495 | rootH2_10027207 | |||
| 1496 | rootH1_10017276 | |||
| 1497 | JGI26145J50221_1003575 | |||
| 1498 | Ga0006556J51387_1030839 | |||
| 1499 | Ga0006558J51389_1019524 | |||
| 1500 | Ga0006560J51390_1017170 | |||
| 1501 | Ga0006554J51385_1017088 | |||
| 1502 | Ga0006554J51385_1021904 | |||
| 1503 | Ga0006562J51391_1006869 | |||
| 1504 | Ga0006562J51391_1006870 | |||
| 1505 | Ga0006562J51391_1017069 | |||
| 1506 | Ga0006562J51391_1017070 | |||
| 1507 | Ga0055538_1000042 | |||
| 1508 | Ga0055538_1000183 | |||
| 1509 | Ga0055539_1000055 | |||
| 1510 | Ga0055539_1000232 | |||
| 1511 | Ga0055533_1000067 | |||
| 1512 | Ga0055533_1000224 | |||
| 1513 | Ga0055533_1010841 | |||
| 1514 | Ga0055532_1000053 | |||
| 1515 | Ga0055525_1000103 | |||
| 1516 | Ga0055525_1000316 | |||
| 1517 | Ga0055542_1000409 | |||
| 1518 | Ga0055542_1014770 | |||
| 1519 | Ga0055526_1002877 | |||
| 1520 | Ga0055537_1000851 | |||
| 1521 | Ga0055524_1049473 | |||
| 1522 | Ga0055534_1000766 | |||
| 1523 | Ga0055528_1002206 | |||
| 1524 | Ga0055528_1011134 | |||
| 1525 | Ga0055540_1031521 | |||
| 1526 | Ga0055531_10000125 | |||
| 1527 | Ga0055541_1000042 | |||
| 1528 | Ga0055541_1000139 | |||
| 1529 | Ga0058692_1000064 | |||
| 1530 | Ga0058692_1000156 | |||
| 1531 | Ga0058692_1022013 | |||
| 1532 | Ga0058692_1023058 | |||
| 1533 | Ga0058860_10204723 | |||
| 1534 | Ga0065703_1022151 | |||
| 1535 | Ga0065714_10000007 | |||
| 1536 | Ga0065704_10000076 | |||
| 1537 | Ga0065704_10005509 | |||
| 1538 | Ga0065704_10006529 | |||
| 1539 | Ga0065704_10014593 | |||
| 1540 | Ga0065704_10071113 | |||
| 1541 | Ga0065712_10069095 | |||
| 1542 | Ga0070690_100518754 | |||
| 1543 | Ga0070670_100000015 | |||
| 1544 | Ga0070670_100167063 | |||
| 1545 | Ga0070677_10311487 | |||
| 1546 | Ga0070677_10542653 | |||
| 1547 | Ga0068869_100088546 | |||
| 1548 | Ga0068869_100262223 | |||
| 1549 | Ga0068869_100609552 | |||
| 1550 | Ga0070666_10000795 | |||
| 1551 | Ga0070666_10013955 | |||
| 1552 | Ga0070666_11159626 | |||
| 1553 | Ga0070680_100161000 | |||
| 1554 | Ga0070680_100368235 | |||
| 1555 | Ga0070680_101806956 | |||
| 1556 | Ga0070682_100020045 | |||
| 1557 | Ga0070682_100167309 | |||
| 1558 | Ga0070682_100194487 | |||
| 1559 | Ga0070682_100254989 | |||
| 1560 | Ga0070682_100641984 | |||
| 1561 | Ga0070682_100783973 | |||
| 1562 | Ga0068868_100448304 | |||
| 1563 | Ga0068868_100552881 | |||
| 1564 | Ga0070660_100364606 | |||
| 1565 | Ga0070660_100769714 | |||
| 1566 | Ga0070660_101133068 | |||
| 1567 | Ga0070689_100962894 | |||
| 1568 | Ga0070691_10125754 | |||
| 1569 | Ga0070687_100056000 | |||
| 1570 | Ga0070661_100000652 | |||
| 1571 | Ga0070661_100222492 | |||
| 1572 | Ga0070661_100341807 | |||
| 1573 | Ga0070661_100411411 | |||
| 1574 | Ga0070692_10015871 | |||
| 1575 | Ga0070692_10034401 | |||
| 1576 | Ga0070668_100000954 | |||
| 1577 | Ga0070668_100096692 | |||
| 1578 | Ga0070668_100446646 | |||
| 1579 | Ga0070668_100921658 | |||
| 1580 | Ga0070668_100951434 | |||
| 1581 | Ga0070669_100004607 | |||
| 1582 | Ga0070675_100695103 | |||
| 1583 | Ga0070675_102040857 | |||
| 1584 | Ga0070671_100351743 | |||
| 1585 | Ga0070671_100836964 | |||
| 1586 | Ga0070674_100412177 | |||
| 1587 | Ga0070673_100317799 | |||
| 1588 | Ga0070688_100001170 | |||
| 1589 | Ga0070688_100546824 | |||
| 1590 | Ga0070659_100026058 | |||
| 1591 | Ga0070659_100663248 | |||
| 1592 | Ga0070667_100000015 | |||
| 1593 | Ga0070667_100000041 | |||
| 1594 | Ga0070667_100041814 | |||
| 1595 | Ga0070667_100294774 | |||
| 1596 | Ga0070667_100844605 | |||
| 1597 | Ga0070667_100999576 | |||
| 1598 | Ga0070667_101929219 | |||
| 1599 | Ga0070703_10179391 | |||
| 1600 | Ga0070709_10157216 | |||
| 1601 | Ga0070709_10809908 | |||
| 1602 | Ga0070714_100003062 | |||
| 1603 | Ga0070714_100046919 | |||
| 1604 | Ga0070714_100158171 | |||
| 1605 | Ga0070714_100170555 | |||
| 1606 | Ga0070714_100265067 | |||
| 1607 | Ga0070713_100006537 | |||
| 1608 | Ga0070710_10825403 | |||
| 1609 | Ga0070701_10033705 | |||
| 1610 | Ga0070711_100079769 | |||
| 1611 | Ga0070711_101052196 | |||
| 1612 | Ga0070705_100200797 | |||
| 1613 | Ga0070705_100676931 | |||
| 1614 | Ga0070700_100493287 | |||
| 1615 | Ga0070694_100617489 | |||
| 1616 | Ga0070663_100001175 | |||
| 1617 | Ga0070663_100033068 | |||
| 1618 | Ga0070663_100221456 | |||
| 1619 | Ga0070663_100224419 | |||
| 1620 | Ga0070663_100301257 | |||
| 1621 | Ga0070663_100405189 | |||
| 1622 | Ga0070663_100411388 | |||
| 1623 | Ga0070663_100498503 | |||
| 1624 | Ga0070663_100773306 | |||
| 1625 | Ga0070678_100101533 | |||
| 1626 | Ga0070678_100500660 | |||
| 1627 | Ga0070662_100000042 | |||
| 1628 | Ga0070662_100030703 | |||
| 1629 | Ga0070662_100034778 | |||
| 1630 | Ga0070662_100177367 | |||
| 1631 | Ga0070662_101273412 | |||
| 1632 | Ga0070681_10024176 | |||
| 1633 | Ga0070685_10000104 | |||
| 1634 | Ga0070679_100027870 | |||
| 1635 | Ga0070679_100525863 | |||
| 1636 | Ga0070684_101212775 | |||
| 1637 | Ga0068853_100003322 | |||
| 1638 | Ga0068853_100006635 | |||
| 1639 | Ga0068853_100017951 | |||
| 1640 | Ga0068853_100056518 | |||
| 1641 | Ga0068853_100056677 | |||
| 1642 | Ga0068853_100171220 | |||
| 1643 | Ga0068853_102455654 | |||
| 1644 | Ga0070672_100312180 | |||
| 1645 | Ga0070672_100801777 | |||
| 1646 | Ga0070695_100551164 | |||
| 1647 | Ga0070695_100714179 | |||
| 1648 | Ga0070696_100002929 | |||
| 1649 | Ga0070693_100010756 | |||
| 1650 | Ga0070665_100005720 | |||
| 1651 | Ga0070665_100037817 | |||
| 1652 | Ga0070665_100038905 | |||
| 1653 | Ga0070665_100382972 | |||
| 1654 | Ga0070665_100485369 | |||
| 1655 | Ga0070665_100651265 | |||
| 1656 | Ga0070665_100690977 | |||
| 1657 | Ga0070665_101432677 | |||
| 1658 | Ga0070704_100042855 | |||
| 1659 | Ga0068855_100086783 | |||
| 1660 | Ga0068855_100305411 | |||
| 1661 | Ga0068855_100741939 | |||
| 1662 | Ga0068855_100875033 | |||
| 1663 | Ga0070664_100000826 | |||
| 1664 | Ga0070664_100043633 | |||
| 1665 | Ga0068857_100000609 | |||
| 1666 | Ga0068857_100000998 | |||
| 1667 | Ga0068857_100183856 | |||
| 1668 | Ga0068857_100316089 | |||
| 1669 | Ga0068857_100625982 | |||
| 1670 | Ga0068857_100773484 | |||
| 1671 | Ga0068857_100878841 | |||
| 1672 | Ga0068854_100001113 | |||
| 1673 | Ga0068854_100001181 | |||
| 1674 | Ga0068854_100003601 | |||
| 1675 | Ga0068856_100579159 | |||
| 1676 | Ga0070702_100628584 | |||
| 1677 | Ga0068852_100040531 | |||
| 1678 | Ga0068852_100062649 | |||
| 1679 | Ga0068852_100229248 | |||
| 1680 | Ga0068852_100306097 | |||
| 1681 | Ga0068852_100797260 | |||
| 1682 | Ga0068852_101100538 | |||
| 1683 | Ga0068852_101638784 | |||
| 1684 | Ga0068859_100105280 | |||
| 1685 | Ga0068859_100182412 | |||
| 1686 | Ga0068859_100213954 | |||
| 1687 | Ga0068864_100000056 | |||
| 1688 | Ga0068864_100015120 | |||
| 1689 | Ga0068864_100656690 | |||
| 1690 | Ga0068851_10000002 | |||
| 1691 | Ga0068851_10002236 | |||
| 1692 | Ga0068851_10002465 | |||
| 1693 | Ga0068851_10022007 | |||
| 1694 | Ga0068851_10305512 | |||
| 1695 | Ga0068863_100025318 | |||
| 1696 | Ga0068863_100036314 | |||
| 1697 | Ga0068863_100064837 | |||
| 1698 | Ga0068863_100151591 | |||
| 1699 | Ga0068863_100405176 | |||
| 1700 | Ga0068858_100022095 | |||
| 1701 | Ga0068858_100025123 | |||
| 1702 | Ga0068858_100639128 | |||
| 1703 | Ga0068858_100927888 | |||
| 1704 | Ga0068860_100002410 | |||
| 1705 | Ga0068860_100061930 | |||
| 1706 | Ga0068860_100345652 | |||
| 1707 | Ga0068860_100751366 | |||
| 1708 | Ga0068862_100014084 | |||
| 1709 | Ga0068862_100394364 | |||
| 1710 | Ga0081455_10012710 | |||
| 1711 | Ga0081455_10473713 | |||
| 1712 | Ga0081540_1000720 | |||
| 1713 | Ga0070717_10307945 | |||
| 1714 | Ga0070717_10402945 | |||
| 1715 | Ga0075365_10637641 | |||
| 1716 | Ga0075363_100194892 | |||
| 1717 | Ga0075364_10016532 | |||
| 1718 | Ga0075364_10378582 | |||
| 1719 | Ga0075364_10539599 | |||
| 1720 | Ga0075364_11026187 | |||
| 1721 | Ga0070712_100875191 | |||
| 1722 | Ga0075362_10658544 | |||
| 1723 | Ga0075367_10273634 | |||
| 1724 | Ga0075369_10273354 | |||
| 1725 | Ga0075427_10031688 | |||
| 1726 | Ga0075366_10002176 | |||
| 1727 | Ga0075366_10105176 | |||
| 1728 | Ga0075366_10136831 | |||
| 1729 | Ga0097621_100110253 | |||
| 1730 | Ga0097621_100129891 | |||
| 1731 | Ga0097621_100187814 | |||
| 1732 | Ga0097621_100904837 | |||
| 1733 | Ga0075370_10275459 | |||
| 1734 | Ga0075370_10496105 | |||
| 1735 | Ga0068871_100186416 | |||
| 1736 | Ga0068871_101101579 | |||
| 1737 | Ga0075428_100283735 | |||
| 1738 | Ga0075430_100082800 | |||
| 1739 | Ga0075430_100151817 | |||
| 1740 | Ga0075430_100858636 | |||
| 1741 | Ga0075431_100268455 | |||
| 1742 | Ga0075433_11221835 | |||
| 1743 | Ga0075429_100025677 | |||
| 1744 | Ga0068865_100005420 | |||
| 1745 | Ga0068865_100664683 | |||
| 1746 | Ga0097620_100105293 | |||
| 1747 | Ga0097620_100182418 | |||
| 1748 | Ga0097620_100213944 | |||
| 1749 | Ga0097620_101042712 | |||
| 1750 | Ga0099823_1001424 | |||
| 1751 | Ga0079104_1011549 | |||
| 1752 | Ga0099826_10004264 | |||
| 1753 | Ga0105251_10001384 | |||
| 1754 | Ga0105251_10003365 | |||
| 1755 | Ga0105251_10004275 | |||
| 1756 | Ga0105251_10046768 | |||
| 1757 | Ga0105251_10113970 | |||
| 1758 | Ga0105251_10203057 | |||
| 1759 | Ga0105244_10003157 | |||
| 1760 | Ga0105244_10003200 | |||
| 1761 | Ga0105244_10003679 | |||
| 1762 | Ga0105244_10022121 | |||
| 1763 | Ga0105244_10039739 | |||
| 1764 | Ga0105244_10092708 | |||
| 1765 | Ga0105244_10334153 | |||
| 1766 | Ga0105244_10360844 | |||
| 1767 | Ga0105244_10451587 | |||
| 1768 | Ga0105250_10001814 | |||
| 1769 | Ga0105250_10001821 | |||
| 1770 | Ga0105250_10001822 | |||
| 1771 | Ga0105250_10102142 | |||
| 1772 | Ga0105250_10169998 | |||
| 1773 | Ga0105250_10254294 | |||
| 1774 | Ga0105240_10001463 | |||
| 1775 | Ga0105240_10020349 | |||
| 1776 | Ga0105240_10081338 | |||
| 1777 | Ga0105240_10212903 | |||
| 1778 | Ga0105240_10283630 | |||
| 1779 | Ga0105245_10346633 | |||
| 1780 | Ga0105245_10512475 | |||
| 1781 | Ga0105247_10002905 | |||
| 1782 | Ga0105247_10236253 | |||
| 1783 | Ga0105247_10469118 | |||
| 1784 | Ga0114129_11327847 | |||
| 1785 | Ga0114129_12808648 | |||
| 1786 | Ga0105243_10020634 | |||
| 1787 | Ga0105243_10033041 | |||
| 1788 | Ga0105243_10093860 | |||
| 1789 | Ga0105243_10692280 | |||
| 1790 | Ga0105243_10699202 | |||
| 1791 | Ga0105241_10000672 | |||
| 1792 | Ga0105241_10646888 | |||
| 1793 | Ga0105241_10659840 | |||
| 1794 | Ga0105241_11246006 | |||
| 1795 | Ga0105241_11799766 | |||
| 1796 | Ga0105242_10002241 | |||
| 1797 | Ga0105242_10015431 | |||
| 1798 | Ga0105242_10294709 | |||
| 1799 | Ga0105248_10001072 | |||
| 1800 | Ga0105248_10283186 | |||
| 1801 | Ga0105248_10291539 | |||
| 1802 | Ga0105248_10346592 | |||
| 1803 | Ga0105248_10717759 | |||
| 1804 | Ga0105237_10001741 | |||
| 1805 | Ga0105237_10005934 | |||
| 1806 | Ga0105237_10007392 | |||
| 1807 | Ga0105237_10015499 | |||
| 1808 | Ga0105237_10218268 | |||
| 1809 | Ga0105237_10336995 | |||
| 1810 | Ga0105237_10369507 | |||
| 1811 | Ga0105238_10168817 | |||
| 1812 | Ga0105238_10460288 | |||
| 1813 | Ga0105249_10000622 | |||
| 1814 | Ga0105249_10026163 | |||
| 1815 | Ga0105249_10032534 | |||
| 1816 | Ga0105249_10164198 | |||
| 1817 | Ga0105249_12702864 | |||
| 1818 | Ga0105239_10003327 | |||
| 1819 | Ga0105239_10004272 | |||
| 1820 | Ga0105239_10004445 | |||
| 1821 | Ga0105239_10017757 | |||
| 1822 | Ga0105239_10048112 | |||
| 1823 | Ga0105239_10141841 | |||
| 1824 | Ga0105239_10311902 | |||
| 1825 | Ga0105239_10456855 | |||
| 1826 | Ga0105239_10847148 | |||
| 1827 | Ga0105246_10019344 | |||
| 1828 | Ga0105246_10052166 | |||
| 1829 | Ga0105246_10198765 | |||
| 1830 | Ga0157314_1000299 | |||
| 1831 | Ga0157373_10004967 | |||
| 1832 | Ga0157373_10018843 | |||
| 1833 | Ga0157373_10032828 | |||
| 1834 | Ga0157373_10038271 | |||
| 1835 | Ga0157373_10322581 | |||
| 1836 | Ga0157373_10348475 | |||
| 1837 | Ga0157373_10378827 | |||
| 1838 | Ga0157371_10004487 | |||
| 1839 | Ga0157371_10004889 | |||
| 1840 | Ga0157371_10005445 | |||
| 1841 | Ga0157371_10020835 | |||
| 1842 | Ga0157371_10043348 | |||
| 1843 | Ga0157371_10061606 | |||
| 1844 | Ga0157371_10094463 | |||
| 1845 | Ga0157371_10101459 | |||
| 1846 | Ga0157371_10161132 | |||
| 1847 | Ga0157371_10250099 | |||
| 1848 | Ga0157371_11077206 | |||
| 1849 | Ga0157370_10000422 | |||
| 1850 | Ga0157370_10005510 | |||
| 1851 | Ga0157370_10008351 | |||
| 1852 | Ga0157370_10009847 | |||
| 1853 | Ga0157370_10110234 | |||
| 1854 | Ga0157370_10123222 | |||
| 1855 | Ga0157370_10205003 | |||
| 1856 | Ga0157370_10255789 | |||
| 1857 | Ga0157370_10280480 | |||
| 1858 | Ga0157370_10354802 | |||
| 1859 | Ga0157370_10367438 | |||
| 1860 | Ga0157370_10751193 | |||
| 1861 | Ga0157370_10974266 | |||
| 1862 | Ga0157369_10004613 | |||
| 1863 | Ga0157369_10005087 | |||
| 1864 | Ga0157369_10008827 | |||
| 1865 | Ga0157369_10375978 | |||
| 1866 | Ga0157369_10570688 | |||
| 1867 | Ga0157369_11228543 | |||
| 1868 | Ga0157374_10007275 | |||
| 1869 | Ga0157378_10026963 | |||
| 1870 | Ga0157378_10081560 | |||
| 1871 | Ga0163162_10005583 | |||
| 1872 | Ga0163162_10017452 | |||
| 1873 | Ga0163162_10096005 | |||
| 1874 | Ga0163162_10180551 | |||
| 1875 | Ga0163162_10394279 | |||
| 1876 | Ga0157372_10006843 | |||
| 1877 | Ga0157372_10012562 | |||
| 1878 | Ga0157372_10020902 | |||
| 1879 | Ga0157372_10065095 | |||
| 1880 | Ga0157372_10270571 | |||
| 1881 | Ga0157372_10677983 | |||
| 1882 | Ga0157375_10000319 | |||
| 1883 | Ga0163163_10000199 | |||
| 1884 | Ga0157380_10773522 | |||
| 1885 | Ga0182008_10002668 | |||
| 1886 | Ga0182008_10006926 | |||
| 1887 | Ga0182008_10040391 | |||
| 1888 | Ga0182008_10055211 | |||
| 1889 | Ga0157379_10122139 | |||
| 1890 | Ga0157379_10972511 | |||
| 1891 | Ga0157376_10007084 | |||
| 1892 | Ga0157376_10380117 | |||
| 1893 | Ga0182006_1001639 | |||
| 1894 | Ga0182006_1004854 | |||
| 1895 | Ga0182006_1010988 | |||
| 1896 | Ga0182006_1019907 | |||
| 1897 | Ga0182006_1034577 | |||
| 1898 | Ga0182006_1049347 | |||
| 1899 | Ga0182006_1099774 | |||
| 1900 | Ga0182007_10005587 | |||
| 1901 | Ga0182007_10014939 | |||
| 1902 | Ga0182007_10078677 | |||
| 1903 | Ga0182007_10127709 | |||
| 1904 | Ga0182005_1000261 | |||
| 1905 | Ga0182005_1011381 | |||
| 1906 | Ga0182005_1090894 | |||
| 1907 | Ga0183360_10821 | |||
| 1908 | Ga0163161_10003205 | |||
| 1909 | Ga0163161_10016624 | |||
| 1910 | Ga0163161_10060757 | |||
| 1911 | Ga0163161_10066219 | |||
| 1912 | Ga0163161_10113215 | |||
| 1913 | Ga0163161_10357291 | |||
| 1914 | Ga0163161_10589633 | |||
| 1915 | Ga0206354_10784947 | |||
| 1916 | Ga0213872_10227045 | |||
| 1917 | Ga0213876_10000608 | |||
| 1918 | Ga0213876_10190768 | |||
| 1919 | Ga0224712_10477116 | |||
| 1920 | Ga0224712_10566405 | |||
| 1921 | Ga0209435_100298 | |||
| 1922 | Ga0209760_100117 | |||
| 1923 | Ga0209760_100153 | |||
| 1924 | Ga0209760_100166 | |||
| 1925 | Ga0209760_108483 | |||
| 1926 | Ga0209784_100060 | |||
| 1927 | Ga0209784_100218 | |||
| 1928 | Ga0209566_100075 | |||
| 1929 | Ga0209566_100353 | |||
| 1930 | Ga0209674_100100 | |||
| 1931 | Ga0209674_100273 | |||
| 1932 | Ga0209674_100632 | |||
| 1933 | Ga0209147_100096 | |||
| 1934 | Ga0209563_100182 | |||
| 1935 | Ga0207427_100063 | |||
| 1936 | Ga0207427_100270 | |||
| 1937 | Ga0209437_100065 | |||
| 1938 | Ga0209437_100133 | |||
| 1939 | Ga0209437_100616 | |||
| 1940 | Ga0209437_100676 | |||
| 1941 | Ga0209258_100387 | |||
| 1942 | Ga0207425_1000117 | |||
| 1943 | Ga0209646_1000276 | |||
| 1944 | Ga0209677_100057 | |||
| 1945 | Ga0209677_100234 | |||
| 1946 | Ga0209148_1002260 | |||
| 1947 | Ga0209759_1007895 | |||
| 1948 | Ga0209129_1000011 | |||
| 1949 | Ga0209129_1000540 | |||
| 1950 | Ga0209233_1000085 | |||
| 1951 | Ga0209233_1000133 | |||
| 1952 | Ga0209233_1003358 | |||
| 1953 | Ga0209565_1000415 | |||
| 1954 | Ga0209673_1000204 | |||
| 1955 | Ga0209130_1005672 | |||
| 1956 | Ga0209130_1014121 | |||
| 1957 | Ga0209675_1000015 | |||
| 1958 | Ga0209676_1000076 | |||
| 1959 | Ga0209676_1000110 | |||
| 1960 | Ga0209676_1001080 | |||
| 1961 | Ga0209025_1000002 | |||
| 1962 | Ga0209564_1000037 | |||
| 1963 | Ga0209758_1000003 | |||
| 1964 | Ga0209050_1000063 | |||
| 1965 | Ga0209050_1002971 | |||
| 1966 | Ga0209256_1018864 | |||
| 1967 | Ga0209051_1000045 | |||
| 1968 | Ga0209051_1000283 | |||
| 1969 | Ga0209051_1001513 | |||
| 1970 | Ga0209051_1007989 | |||
| 1971 | Ga0209051_1012543 | |||
| 1972 | Ga0209257_1000129 | |||
| 1973 | Ga0209257_1000185 | |||
| 1974 | Ga0209257_1011177 | |||
| 1975 | Ga0209257_1054444 | |||
| 1976 | Ga0209257_1139166 | |||
| 1977 | Ga0207656_10000010 | |||
| 1978 | Ga0207656_10076474 | |||
| 1979 | Ga0207656_10083068 | |||
| 1980 | Ga0207656_10306820 | |||
| 1981 | Ga0207696_1000047 | |||
| 1982 | Ga0207696_1000118 | |||
| 1983 | Ga0207696_1000168 | |||
| 1984 | Ga0207696_1000334 | |||
| 1985 | Ga0207696_1001023 | |||
| 1986 | Ga0207696_1001545 | |||
| 1987 | Ga0207696_1001690 | |||
| 1988 | Ga0207696_1001739 | |||
| 1989 | Ga0207696_1001745 | |||
| 1990 | Ga0207696_1001772 | |||
| 1991 | Ga0207696_1004316 | |||
| 1992 | Ga0207655_1000104 | |||
| 1993 | Ga0207655_1000606 | |||
| 1994 | Ga0207655_1001098 | |||
| 1995 | Ga0207655_1001191 | |||
| 1996 | Ga0207655_1001305 | |||
| 1997 | Ga0207655_1002413 | |||
| 1998 | Ga0207655_1003289 | |||
| 1999 | Ga0207655_1003403 | |||
| 2000 | Ga0207655_1003558 | |||
| 2001 | Ga0207655_1003709 | |||
| 2002 | Ga0207655_1006248 | |||
| 2003 | Ga0207655_1023419 | |||
| 2004 | Ga0207655_1028068 | |||
| 2005 | Ga0207655_1030467 | |||
| 2006 | Ga0207655_1186455 | |||
| 2007 | Ga0207713_1000049 | |||
| 2008 | Ga0207713_1000073 | |||
| 2009 | Ga0207713_1001458 | |||
| 2010 | Ga0207713_1003194 | |||
| 2011 | Ga0207713_1012383 | |||
| 2012 | Ga0207713_1013301 | |||
| 2013 | Ga0207713_1069892 | |||
| 2014 | Ga0207713_1258604 | |||
| 2015 | Ga0207653_10166297 | |||
| 2016 | Ga0207692_10953701 | |||
| 2017 | Ga0207710_10000468 | |||
| 2018 | Ga0207710_10004791 | |||
| 2019 | Ga0207710_10344820 | |||
| 2020 | Ga0207680_10001411 | |||
| 2021 | Ga0207680_10040636 | |||
| 2022 | Ga0207680_10061368 | |||
| 2023 | Ga0207699_10153906 | |||
| 2024 | Ga0207645_10791902 | |||
| 2025 | Ga0207705_10486669 | |||
| 2026 | Ga0207654_10000379 | |||
| 2027 | Ga0207707_10953191 | |||
| 2028 | Ga0207671_10000380 | |||
| 2029 | Ga0207671_10014065 | |||
| 2030 | Ga0207671_10017764 | |||
| 2031 | Ga0207671_10093262 | |||
| 2032 | Ga0207671_10180802 | |||
| 2033 | Ga0207662_10082749 | |||
| 2034 | Ga0207662_10119540 | |||
| 2035 | Ga0207657_10056527 | |||
| 2036 | Ga0207649_10000041 | |||
| 2037 | Ga0207649_10483093 | |||
| 2038 | Ga0207649_10892844 | |||
| 2039 | Ga0207649_10955084 | |||
| 2040 | Ga0207652_10266670 | |||
| 2041 | Ga0207652_10600806 | |||
| 2042 | Ga0207681_10001197 | |||
| 2043 | Ga0207681_10021631 | |||
| 2044 | Ga0207681_10042359 | |||
| 2045 | Ga0207681_10535675 | |||
| 2046 | Ga0207694_10095814 | |||
| 2047 | Ga0207694_10373777 | |||
| 2048 | Ga0207650_10000013 | |||
| 2049 | Ga0207650_10248506 | |||
| 2050 | Ga0207650_10889905 | |||
| 2051 | Ga0207650_11891072 | |||
| 2052 | Ga0207687_10063514 | |||
| 2053 | Ga0207687_10653867 | |||
| 2054 | Ga0207664_10087884 | |||
| 2055 | Ga0207664_10216074 | |||
| 2056 | Ga0207644_10138725 | |||
| 2057 | Ga0207644_10385958 | |||
| 2058 | Ga0207690_10084403 | |||
| 2059 | Ga0207706_10000128 | |||
| 2060 | Ga0207706_10030526 | |||
| 2061 | Ga0207686_10016851 | |||
| 2062 | Ga0207709_10000030 | |||
| 2063 | Ga0207709_10000343 | |||
| 2064 | Ga0207709_10008703 | |||
| 2065 | Ga0207709_10010135 | |||
| 2066 | Ga0207709_10011110 | |||
| 2067 | Ga0207709_10056312 | |||
| 2068 | Ga0207669_10984965 | |||
| 2069 | Ga0207704_10355312 | |||
| 2070 | Ga0207691_10172788 | |||
| 2071 | Ga0207711_10000194 | |||
| 2072 | Ga0207711_10000272 | |||
| 2073 | Ga0207711_10108211 | |||
| 2074 | Ga0207711_10426503 | |||
| 2075 | Ga0207711_10803153 | |||
| 2076 | Ga0207711_11527427 | |||
| 2077 | Ga0207689_10073424 | |||
| 2078 | Ga0207689_10099611 | |||
| 2079 | Ga0207661_10497578 | |||
| 2080 | Ga0207661_12041632 | |||
| 2081 | Ga0207679_10000081 | |||
| 2082 | Ga0207679_11310009 | |||
| 2083 | Ga0207667_10482560 | |||
| 2084 | Ga0207667_10569686 | |||
| 2085 | Ga0207667_10839570 | |||
| 2086 | Ga0207651_10111114 | |||
| 2087 | Ga0207651_10397877 | |||
| 2088 | Ga0207712_10000839 | |||
| 2089 | Ga0207712_10021372 | |||
| 2090 | Ga0207712_10038480 | |||
| 2091 | Ga0207712_10184842 | |||
| 2092 | Ga0207668_10009496 | |||
| 2093 | Ga0207668_10435299 | |||
| 2094 | Ga0207668_10571449 | |||
| 2095 | Ga0207640_10004766 | |||
| 2096 | Ga0207640_10219687 | |||
| 2097 | Ga0207658_10000005 | |||
| 2098 | Ga0207658_10000028 | |||
| 2099 | Ga0207658_10075889 | |||
| 2100 | Ga0207658_10269819 | |||
| 2101 | Ga0207658_10497040 | |||
| 2102 | Ga0207677_10031823 | |||
| 2103 | Ga0207703_10068783 | |||
| 2104 | Ga0207703_10809199 | |||
| 2105 | Ga0207639_10000901 | |||
| 2106 | Ga0207639_10003844 | |||
| 2107 | Ga0207639_10012828 | |||
| 2108 | Ga0207639_10086604 | |||
| 2109 | Ga0207639_10295782 | |||
| 2110 | Ga0207639_11035743 | |||
| 2111 | Ga0207678_10005433 | |||
| 2112 | Ga0207678_10094890 | |||
| 2113 | Ga0207678_10198092 | |||
| 2114 | Ga0207678_10377640 | |||
| 2115 | Ga0207708_10780472 | |||
| 2116 | Ga0207641_10139344 | |||
| 2117 | Ga0207641_10953208 | |||
| 2118 | Ga0207641_10975505 | |||
| 2119 | Ga0207641_11017580 | |||
| 2120 | Ga0207641_11163664 | |||
| 2121 | Ga0207641_11833177 | |||
| 2122 | Ga0207648_10590976 | |||
| 2123 | Ga0207676_10000010 | |||
| 2124 | Ga0207676_10031174 | |||
| 2125 | Ga0207676_10452668 | |||
| 2126 | Ga0207674_10003713 | |||
| 2127 | Ga0207674_10276418 | |||
| 2128 | Ga0207675_100027444 | |||
| 2129 | Ga0207675_101375141 | |||
| 2130 | Ga0207683_10216641 | |||
| 2131 | Ga0207698_10023144 | |||
| 2132 | Ga0207698_10032580 | |||
| 2133 | Ga0209281_1000874 | |||
| 2134 | Ga0209281_1001322 | |||
| 2135 | Ga0209281_1001756 | |||
| 2136 | Ga0209389_1000020 | |||
| 2137 | Ga0209371_1000228 | |||
| 2138 | Ga0209371_1000294 | |||
| 2139 | Ga0209371_1000302 | |||
| 2140 | Ga0209371_1001410 | |||
| 2141 | Ga0209371_1002180 | |||
| 2142 | Ga0209371_1002194 | |||
| 2143 | Ga0209371_1003997 | |||
| 2144 | Ga0209371_1006959 | |||
| 2145 | Ga0209371_1015144 | |||
| 2146 | Ga0209969_1005003 | |||
| 2147 | Ga0209969_1007401 | |||
| 2148 | Ga0209981_1006526 | |||
| 2149 | Ga0209996_1001844 | |||
| 2150 | Ga0209984_1014865 | |||
| 2151 | Ga0209995_1001985 | |||
| 2152 | Ga0209995_1020685 | |||
| 2153 | Ga0209995_1063579 | |||
| 2154 | Ga0209968_1001116 | |||
| 2155 | Ga0209999_1000717 | |||
| 2156 | Ga0209999_1012766 | |||
| 2157 | Ga0209982_1000139 | |||
| 2158 | Ga0209982_1001049 | |||
| 2159 | Ga0209970_1039649 | |||
| 2160 | Ga0209983_1002894 | |||
| 2161 | Ga0209282_1047549 | |||
| 2162 | Ga0209971_1000288 | |||
| 2163 | Ga0209998_10114225 | |||
| 2164 | Ga0209974_10014534 | |||
| 2165 | Ga0209974_10323674 | |||
| 2166 | Ga0207428_10416354 | |||
| 2167 | Ga0268266_10001891 | |||
| 2168 | Ga0268266_10002538 | |||
| 2169 | Ga0268266_10034750 | |||
| 2170 | Ga0268266_10058354 | |||
| 2171 | Ga0268266_10065647 | |||
| 2172 | Ga0268266_10125644 | |||
| 2173 | Ga0268266_10162981 | |||
| 2174 | Ga0268266_10316450 | |||
| 2175 | Ga0268266_10543976 | |||
| 2176 | Ga0268265_10000383 | |||
| 2177 | Ga0268265_11209183 | |||
| 2178 | Ga0268264_10000036 | |||
| 2179 | Ga0268264_10028346 | |||
| 2180 | Ga0265334_10000272 | |||
| 2181 | Ga0307515_10645580 | |||
| 2182 | Ga0265338_10011455 | |||
| 2183 | Ga0268256_1000188 | |||
| 2184 | Ga0268256_1000258 | |||
| 2185 | Ga0268256_1000674 | |||
| 2186 | Ga0268256_1001982 | |||
| 2187 | Ga0268256_1003119 | |||
| 2188 | Ga0268256_1003595 | |||
| 2189 | Ga0268256_1003729 | |||
| 2190 | Ga0268256_1017177 | |||
| 2191 | Ga0268256_1031085 | |||
| 2192 | Ga0316177_1166192 | |||
| 2193 | Ga0316176_1207210 | |||
| 2194 | Ga0314311_1030222 | |||
| 2195 | Ga0316178_1033068 | |||
| 2196 | Ga0316178_1127651 | |||
| 2197 | Ga0316180_1043925 | |||
| 2198 | Ga0316183_1040327 | |||
| 2199 | Ga0316183_1119066 | |||
| 2200 | Ga0316181_1171526 | |||
| 2201 | Ga0316182_1129448 | |||
| 2202 | Ga0316182_1288898 | |||
| 2203 | Ga0265766_1002668 | |||
| 2204 | Ga0265325_10002468 | |||
| 2205 | Ga0265325_10101495 | |||
| 2206 | Ga0265331_10023066 | |||
| 2207 | Ga0265327_10001935 | |||
| 2208 | Ga0307513_10282596 | |||
| 2209 | Ga0307408_100000595 | |||
| 2210 | Ga0307408_100000900 | |||
| 2211 | Ga0307408_100001790 | |||
| 2212 | Ga0307408_100410322 | |||
| 2213 | Ga0307408_100866817 | |||
| 2214 | Ga0316575_10006210 | |||
| 2215 | Ga0316575_10018901 | |||
| 2216 | Ga0316575_10028680 | |||
| 2217 | Ga0316575_10043459 | |||
| 2218 | Ga0316575_10059515 | |||
| 2219 | Ga0316575_10300405 | |||
| 2220 | Ga0316579_10014436 | |||
| 2221 | Ga0316579_10027879 | |||
| 2222 | Ga0316579_10090094 | |||
| 2223 | Ga0316579_10122014 | |||
| 2224 | Ga0316579_10141294 | |||
| 2225 | Ga0316579_10146412 | |||
| 2226 | Ga0316579_10284115 | |||
| 2227 | Ga0316579_10370417 | |||
| 2228 | Ga0316579_10418073 | |||
| 2229 | Ga0316576_10000365 | |||
| 2230 | Ga0316576_10005233 | |||
| 2231 | Ga0316576_10025746 | |||
| 2232 | Ga0316576_10070262 | |||
| 2233 | Ga0316576_10115217 | |||
| 2234 | Ga0316576_10125769 | |||
| 2235 | Ga0316576_10129454 | |||
| 2236 | Ga0316576_10132290 | |||
| 2237 | Ga0316576_10155933 | |||
| 2238 | Ga0316576_10162064 | |||
| 2239 | Ga0316576_10237148 | |||
| 2240 | Ga0316576_10405174 | |||
| 2241 | Ga0316576_10514197 | |||
| 2242 | Ga0316576_10947083 | |||
| 2243 | Ga0316576_11143768 | |||
| 2244 | Ga0316578_10002390 | |||
| 2245 | Ga0316578_10002871 | |||
| 2246 | Ga0316578_10003816 | |||
| 2247 | Ga0316578_10010349 | |||
| 2248 | Ga0316578_10025441 | |||
| 2249 | Ga0316578_10025755 | |||
| 2250 | Ga0316578_10070604 | |||
| 2251 | Ga0316578_10071160 | |||
| 2252 | Ga0316578_10079834 | |||
| 2253 | Ga0316578_10117559 | |||
| 2254 | Ga0316578_10159106 | |||
| 2255 | Ga0316578_10344108 | |||
| 2256 | Ga0316578_10631250 | |||
| 2257 | Ga0316578_10830107 | |||
| 2258 | Ga0307516_10140749 | |||
| 2259 | Ga0307516_10184359 | |||
| 2260 | Ga0307516_10726710 | |||
| 2261 | Ga0307405_10252890 | |||
| 2262 | Ga0316577_10000967 | |||
| 2263 | Ga0316577_10001901 | |||
| 2264 | Ga0316577_10006195 | |||
| 2265 | Ga0316577_10008440 | |||
| 2266 | Ga0316577_10015752 | |||
| 2267 | Ga0316577_10026823 | |||
| 2268 | Ga0316577_10027647 | |||
| 2269 | Ga0316577_10128277 | |||
| 2270 | Ga0316577_10169666 | |||
| 2271 | Ga0316577_10268103 | |||
| 2272 | Ga0316577_10457147 | |||
| 2273 | Ga0307413_10232804 | |||
| 2274 | Ga0307413_10467415 | |||
| 2275 | Ga0307413_10551424 | |||
| 2276 | Ga0307413_11928749 | |||
| 2277 | Ga0307410_10585425 | |||
| 2278 | Ga0307410_10721614 | |||
| 2279 | Ga0307406_10002004 | |||
| 2280 | Ga0307412_10000781 | |||
| 2281 | Ga0307412_10059437 | |||
| 2282 | Ga0307412_10798813 | |||
| 2283 | Ga0307412_11834511 | |||
| 2284 | Ga0307416_100013048 | |||
| 2285 | Ga0307416_100522706 | |||
| 2286 | Ga0307416_101038308 | |||
| 2287 | Ga0307416_101221250 | |||
| 2288 | Ga0307414_10010322 | |||
| 2289 | Ga0307414_10174417 | |||
| 2290 | Ga0307414_10179188 | |||
| 2291 | Ga0307414_10356475 | |||
| 2292 | Ga0307414_10410054 | |||
| 2293 | Ga0307414_10608997 | |||
| 2294 | Ga0307411_10915952 | |||
| 2295 | Ga0316583_10001999 | |||
| 2296 | Ga0316583_10002545 | |||
| 2297 | Ga0316583_10007773 | |||
| 2298 | Ga0316583_10011745 | |||
| 2299 | Ga0316583_10073338 | |||
| 2300 | Ga0316583_10183043 | |||
| 2301 | Ga0316585_10029715 | |||
| 2302 | Ga0316585_10050096 | |||
| 2303 | Ga0316585_10073295 | |||
| 2304 | Ga0316585_10161384 | |||
| 2305 | Ga0316585_10205620 | |||
| 2306 | Ga0316585_10226210 | |||
| 2307 | Ga0316585_10306946 | |||
| 2308 | Ga0316580_10000629 | |||
| 2309 | Ga0316580_10000991 | |||
| 2310 | Ga0316580_10001942 | |||
| 2311 | Ga0316580_10006714 | |||
| 2312 | Ga0316580_10023405 | |||
| 2313 | Ga0316580_10025521 | |||
| 2314 | Ga0316580_10029179 | |||
| 2315 | Ga0316580_10050738 | |||
| 2316 | Ga0316593_10000037 | |||
| 2317 | Ga0316593_10000090 | |||
| 2318 | Ga0316593_10000105 | |||
| 2319 | Ga0316593_10000170 | |||
| 2320 | Ga0316593_10000239 | |||
| 2321 | Ga0316593_10001113 | |||
| 2322 | Ga0316593_10001316 | |||
| 2323 | Ga0316593_10001765 | |||
| 2324 | Ga0316593_10002310 | |||
| 2325 | Ga0316593_10002877 | |||
| 2326 | Ga0316593_10003511 | |||
| 2327 | Ga0316593_10003674 | |||
| 2328 | Ga0316593_10004626 | |||
| 2329 | Ga0316593_10005492 | |||
| 2330 | Ga0316593_10005752 | |||
| 2331 | Ga0316593_10005754 | |||
| 2332 | Ga0316593_10006095 | |||
| 2333 | Ga0316593_10006651 | |||
| 2334 | Ga0316593_10006666 | |||
| 2335 | Ga0316593_10009160 | |||
| 2336 | Ga0316593_10009462 | |||
| 2337 | Ga0316593_10017013 | |||
| 2338 | Ga0316593_10023909 | |||
| 2339 | Ga0316593_10024309 | |||
| 2340 | Ga0316593_10035643 | |||
| 2341 | Ga0316593_10041816 | |||
| 2342 | Ga0316593_10046536 | |||
| 2343 | Ga0316593_10059026 | |||
| 2344 | Ga0316593_10094491 | |||
| 2345 | Ga0316593_10102570 | |||
| 2346 | Ga0316593_10148823 | |||
| 2347 | Ga0316593_10261610 | |||
| 2348 | Ga0316593_10324626 | |||
| 2349 | Ga0316593_10434371 | |||
| 2350 | Ga0307507_10040591 | |||
| 2351 | Ga0316592_1000006 | |||
| 2352 | Ga0316592_1000008 | |||
| 2353 | Ga0316592_1000152 | |||
| 2354 | Ga0316592_1000166 | |||
| 2355 | Ga0316592_1000320 | |||
| 2356 | Ga0316592_1000527 | |||
| 2357 | Ga0316592_1000901 | |||
| 2358 | Ga0316592_1007736 | |||
| 2359 | Ga0316592_1011845 | |||
| 2360 | Ga0316592_1014072 | |||
| 2361 | Ga0316592_1030984 | |||
| 2362 | Ga0316592_1037924 | |||
| 2363 | Ga0316592_1063588 | |||
| 2364 | Ga0316592_1083117 | |||
| 2365 | Ga0316592_1105302 | |||
| 2366 | Ga0316592_1167089 | |||
| 2367 | Ga0316586_1000062 | |||
| 2368 | Ga0316586_1000811 | |||
| 2369 | Ga0316586_1001007 | |||
| 2370 | Ga0316586_1001156 | |||
| 2371 | Ga0316586_1003655 | |||
| 2372 | Ga0316586_1005762 | |||
| 2373 | Ga0316586_1008619 | |||
| 2374 | Ga0316586_1009742 | |||
| 2375 | Ga0316586_1010601 | |||
| 2376 | Ga0316586_1010928 | |||
| 2377 | Ga0316586_1024940 | |||
| 2378 | Ga0316586_1036446 | |||
| 2379 | Ga0316586_1039744 | |||
| 2380 | Ga0316586_1096567 | |||
| 2381 | Ga0316588_1000356 | |||
| 2382 | Ga0316588_1000857 | |||
| 2383 | Ga0316588_1001732 | |||
| 2384 | Ga0316588_1002922 | |||
| 2385 | Ga0316588_1010833 | |||
| 2386 | Ga0316588_1050547 | |||
| 2387 | Ga0316588_1122647 | |||
| 2388 | Ga0316588_1126439 | |||
| 2389 | Ga0316588_1157135 | |||
| 2390 | Ga0316587_1000178 | |||
| 2391 | Ga0316587_1000791 | |||
| 2392 | Ga0316587_1001181 | |||
| 2393 | Ga0316587_1003199 | |||
| 2394 | Ga0316587_1005587 | |||
| 2395 | Ga0316587_1008270 | |||
| 2396 | Ga0316587_1010578 | |||
| 2397 | Ga0316587_1011466 | |||
| 2398 | Ga0316587_1026777 | |||
| 2399 | Ga0316587_1045853 | |||
| 2400 | Ga0316587_1050351 | |||
| 2401 | Ga0316587_1094742 | |||
| 2402 | Ga0316596_1000013 | |||
| 2403 | Ga0316596_1000016 | |||
| 2404 | Ga0316596_1000017 | |||
| 2405 | Ga0316596_1000064 | |||
| 2406 | Ga0316596_1000073 | |||
| 2407 | Ga0316596_1000324 | |||
| 2408 | Ga0316596_1000471 | |||
| 2409 | Ga0316596_1000860 | |||
| 2410 | Ga0316596_1000888 | |||
| 2411 | Ga0316596_1001224 | |||
| 2412 | Ga0316596_1001882 | |||
| 2413 | Ga0316596_1003301 | |||
| 2414 | Ga0316596_1009708 | |||
| 2415 | Ga0316596_1010400 | |||
| 2416 | Ga0316596_1019412 | |||
| 2417 | Ga0316596_1024016 | |||
| 2418 | Ga0316596_1039748 | |||
| 2419 | Ga0316596_1040223 | |||
| 2420 | Ga0316596_1048167 | |||
| 2421 | Ga0316596_1050348 | |||
| 2422 | Ga0316596_1094331 | |||
| 2423 | Ga0316596_1096969 | |||
| 2424 | Ga0316596_1099481 | |||
| 2425 | Ga0316596_1114383 | |||
| 2426 | Ga0316596_1120386 | |||
| 2427 | Ga0316596_1137235 | |||
| 2428 | Ga0316596_1178790 | |||
| 2429 | Ga0316596_1195447 | |||
| 2430 | Ga0373959_0108869 | |||
| 2431 | Ga0373951_0127358 | |||
| 2432 | Ga0373952_0284129 | |||
| 2433 | Ga0316574_0003365 | |||
| 2434 | Ga0316574_0009388 | |||
| 2435 | Ga0316574_0014334 | |||
| 2436 | Ga0316574_0015724 | |||
| 2437 | Ga0316574_0022885 | |||
| 2438 | Ga0316574_0037126 | |||
| 2439 | Ga0316574_0043878 | |||
| 2440 | Ga0316574_0052893 | |||
| 2441 | Ga0316574_0065682 | |||
| 2442 | Ga0316574_0080197 | |||
| 2443 | Ga0316574_0167088 | |||
| 2444 | Ga0316574_0206123 | |||
| 2445 | Ga0316574_0393407 | |||
| 2446 | Ga0316574_0432652 | |||
| 2447 | Ga0316574_0519034 | |||
| 2448 | Ga0316574_0818961 | |||
| 2449 | Ga0316582_0000535 | |||
| 2450 | Ga0316582_0007722 | |||
| 2451 | Ga0316582_0009607 | |||
| 2452 | Ga0316582_0009817 | |||
| 2453 | Ga0316582_0045489 | |||
| 2454 | Ga0316582_0069080 | |||
| 2455 | Ga0316582_0116894 | |||
| 2456 | Ga0316582_0142125 | |||
| 2457 | Ga0316582_0195133 | |||
| 2458 | Ga0316582_0253038 | |||
| 2459 | Ga0316582_0327449 | |||
| 2460 | Ga0316582_0874963 | |||
| 2461 | Ga0316582_0929862 | |||
| 2462 | Ga0316584_0000609 | |||
| 2463 | Ga0316584_0021743 | |||
| 2464 | Ga0316584_0038333 | |||
| 2465 | Ga0316584_0045352 | |||
| 2466 | Ga0316584_0072361 | |||
| 2467 | Ga0316584_0123016 | |||
| 2468 | Ga0316584_0148891 | |||
| 2469 | Ga0316584_0235482 | |||
| 2470 | Ga0316584_0269750 | |||
| 2471 | Ga0316584_0277152 | |||
| 2472 | Ga0316584_0325327 | |||
| 2473 | Ga0316584_0627969 | |||
| 2474 | Ga0316584_0727621 | |||
| 2475 | Ga0316584_0949327 | |||
| 2476 | Ga0373925_0560792 | |||
| 2477 | Ga0395899_0040298 | |||
| 2478 | Ga0395899_0135621 | |||
| 2479 | Ga0395899_0605066 | |||
| 2480 | Ga0395900_0100423 | |||
| 2481 | Ga0395900_0851552 | |||
| 2482 | Ga0395898_0131389 | |||
| 2483 | Ga0395905_0191904 | |||
| 2484 | Ga0395905_0278731 | |||
| 2485 | Ga0316581_0028521 | |||
| 2486 | Ga0316581_0048004 | |||
| 2487 | Ga0316581_0163692 | |||
| 2488 | Ga0395901_0035575 | |||
| 2489 | Ga0395901_0105050 | |||
| 2490 | Ga0395901_0130755 | |||
| 2491 | Ga0237819_00026 | |||
| 2492 | Ga0237819_01145 | |||
| 2493 | Ga0400484_21948 | |||
| 2494 | Ga0400484_26615 | |||
| 2495 | Ga0400484_28932 | |||
| 2496 | Ga0400484_30405 | |||
| 2497 | Ga0400490_00437 | |||
| 2498 | Ga0400490_04587 | |||
| 2499 | Ga0400490_09731 | |||
| 2500 | Ga0400490_11910 | |||
| 2501 | Ga0400490_45348 | |||
| 2502 | Ga0400490_58965 | |||
| 2503 | Ga0400491_03737 | |||
| 2504 | Ga0400491_05686 | |||
| 2505 | Ga0400491_23703 | |||
| 2506 | Ga0400485_15858 | |||
| 2507 | Ga0400485_16414 | |||
| 2508 | Ga0400488_25343 | |||
| 2509 | Ga0400488_33732 | |||
| 2510 | Ga0400488_38355 | |||
| 2511 | Ga0400488_47685 | |||
| 2512 | Ga0400488_48084 | |||
| 2513 | Ga0400486_01341 | |||
| 2514 | Ga0400486_06901 | |||
| 2515 | Ga0400486_21344 | |||
| 2516 | Ga0400483_019829 | |||
| 2517 | Ga0400483_073836 | |||
| 2518 | Ga0400483_085104 | |||
| 2519 | Ga0400483_113587 | |||
| 2520 | Ga0400483_119721 | |||
| 2521 | Ga0400483_153100 | |||
| 2522 | Ga0400483_228820 | |||
| 2523 | Ga0400483_233637 | |||
| 2524 | Ga0400483_246247 | |||
| 2525 | Ga0400483_256558 | |||
| 2526 | Ga0400483_266885 | |||
| 2527 | Ga0400483_282411 | |||
| 2528 | Ga0400489_44403 | |||
| 2529 | Ga0400489_73450 | |||
| 2530 | Ga0400487_38625 | |||
| 2531 | Ga0400487_60385 | |||
| 2532 | Ga0436365_0390798 | |||
| 2533 | Ga0436365_0804640 | |||
| 2534 | Ga0436365_0845481 | |||
| 2535 | Ga0436360_0872094 | |||
| 2536 | Ga0436361_0341318 | |||
| 2537 | Ga0436363_0507755 | |||
| 2538 | Ga0439436_0000027 | |||
| 2539 | Ga0439438_000016 | |||
| 2540 | Ga0439438_000406 | |||
| 2541 | Ga0439438_074814 | |||
| 2542 | Ga0439447_002630 | |||
| 2543 | Ga0439447_023672 | |||
| 2544 | Ga0439447_108383 | |||
| 2545 | Ga0439466_0000011 | |||
| 2546 | Ga0439466_0001991 | |||
| 2547 | Ga0439465_0000141 | |||
| 2548 | Ga0439465_0164329 | |||
| 2549 | Ga0451789_0621368 | |||
| 2550 | Ga0451789_0864582 | |||
| 2551 | Ga0451790_50732 | |||
| 2552 | Ga0451792_17887 | |||
| 2553 | Ga0451791_0285136 | |||
| 2554 | Ga0451791_0398483 | |||
| 2555 | Ga0451791_0591736 | |||
| 2556 | Ga0451791_1092867 | |||
| 2557 | Ga0451793_0147297 | |||
| 2558 | Ga0451793_1283045 | |||
| 2559 | Ga0451797_0708520 | |||
| 2560 | Ga0451801_36357 | |||
| 2561 | Ga0451795_0482512 | |||
| 2562 | Ga0451798_0304695 | |||
| 2563 | Ga0451798_0776824 | |||
| 2564 | Ga0451800_1057945 | |||
| 2565 | Ga0451802_0320625 | |||
| 2566 | Ga0451802_0850886 | |||
| 2567 | Ga0451805_070913 | |||
| 2568 | Ga0451806_234332 | |||
| 2569 | Ga0451804_0273190 | |||
| 2570 | Ga0451807_0203642 | |||
| 2571 | Ga0451833_0641876 | |||
| 2572 | Ga0451837_0138569 | |||
| 2573 | Ga0451839_1074144 | |||
| 2574 | Ga0451841_1135274 | |||
| 2575 | Ga0451846_29185 | |||
| 2576 | Ga0451849_0833378 | |||
| 2577 | Ga0451851_0732648 | |||
| 2578 | Ga0451843_0113374 | |||
| 2579 | Ga0451843_0415897 | |||
| 2580 | Ga0451854_31420 | |||
| 2581 | Ga0451853_0065199 | |||
| 2582 | Ga0451853_0286797 | |||
| 2583 | Ga0451853_1411631 | |||
| 2584 | Ga0451853_3999158 | |||
| 2585 | Ga0439431_0166628 | |||
| 2586 | Ga0439437_001344 | |||
| 2587 | Ga0439445_0049863 | |||
| 2588 | Ga0439445_0081424 | |||
| 2589 | Ga0439445_0092543 | |||
| 2590 | Ga0439432_000824 | |||
| 2591 | Ga0439432_001037 | |||
| 2592 | Ga0439432_002401 | |||
| 2593 | Ga0439432_011571 | |||
| 2594 | Ga0439432_014624 | |||
| 2595 | Ga0439432_124463 | |||
| 2596 | Ga0439432_154018 | |||
| 2597 | Ga0439449_0002484 | |||
| 2598 | Ga0439449_0098257 | |||
| 2599 | Ga0439452_000010 | |||
| 2600 | Ga0439452_000384 | |||
| 2601 | Ga0439452_000388 | |||
| 2602 | Ga0439452_117984 | |||
| 2603 | Ga0439456_006490 | |||
| 2604 | Ga0439463_000335 | |||
| 2605 | Ga0450911_000978 | |||
| 2606 | Ga0450902_030872 | |||
| 2607 | Ga0450904_000176 | |||
| 2608 | Ga0450907_001837 | |||
| 2609 | Ga0439446_0033772 | |||
| 2610 | Ga0450908_003237 | |||
| 2611 | Ga0439434_0006646 | |||
| 2612 | Ga0439459_0010896 | |||
| 2613 | Ga0439459_0203660 | |||
| 2614 | Ga0439464_0001845 | |||
| 2615 | Ga0439464_0001931 | |||
| 2616 | Ga0439464_0004320 | |||
| 2617 | Ga0450916_063459 | |||
| 2618 | Ga0450893_0001607 | |||
| 2619 | Ga0451577_0007309 | |||
| 2620 | Ga0466982_0000210 | |||
| 2621 | Ga0453683_0029666 | |||
| 2622 | Ga0453684_0001268 | |||
| 2623 | Ga0453684_0623450 | |||
| 2624 | Ga0466968_0654986 | |||
| 2625 | Ga0466957_0089266 | |||
| 2626 | Ga0451576_1702569 | |||
| 2627 | Ga0466967_0567214 | |||
| 2628 | Ga0466967_0601757 | |||
| 2629 | Ga0495617_000213 | |||
| 2630 | Ga0495617_058347 | |||
| 2631 | Ga0495627_000696 | |||
| 2632 | Ga0495591_000658 | |||
| 2633 | Ga0495591_001371 | |||
| 2634 | Ga0495638_0001525 | |||
| 2635 | Ga0495638_0001912 | |||
| 2636 | Ga0495638_0050575 | |||
| 2637 | Ga0495650_0000787 | |||
| 2638 | Ga0495650_0001108 | |||
| 2639 | Ga0495650_0001677 | |||
| 2640 | Ga0495650_0011587 | |||
| 2641 | Ga0495650_0022825 | |||
| 2642 | Ga0495650_0055509 | |||
| 2643 | Ga0495605_0011977 | |||
| 2644 | Ga0495605_0156182 | |||
| 2645 | Ga0495584_0001537 | |||
| 2646 | Ga0495584_0011469 | |||
| 2647 | Ga0495596_0004550 | |||
| 2648 | Ga0495607_0000012 | |||
| 2649 | Ga0495607_0018006 | |||
| 2650 | Ga0495607_0023571 | |||
| 2651 | Ga0495607_0033957 | |||
| 2652 | Ga0495606_0001257 | |||
| 2653 | Ga0495606_0001303 | |||
| 2654 | Ga0495606_0009659 | |||
| 2655 | Ga0495606_0070965 | |||
| 2656 | Ga0495610_0001380 | |||
| 2657 | Ga0495610_0011725 | |||
| 2658 | Ga0495610_0074761 | |||
| 2659 | Ga0495616_0089266 | |||
| 2660 | Ga0495620_0001298 | |||
| 2661 | Ga0495620_0007668 | |||
| 2662 | Ga0495620_0027402 | |||
| 2663 | Ga0495631_0009976 | |||
| 2664 | Ga0495631_0021513 | |||
| 2665 | Ga0495631_0051702 | |||
| 2666 | Ga0495632_0005953 | |||
| 2667 | Ga0495632_0025323 | |||
| 2668 | Ga0495632_0025699 | |||
| 2669 | Ga0495637_0002718 | |||
| 2670 | Ga0495637_0076697 | |||
| 2671 | Ga0495643_0010313 | |||
| 2672 | Ga0495643_0064611 | |||
| 2673 | Ga0495643_0232132 | |||
| 2674 | Ga0495644_0000420 | |||
| 2675 | Ga0495648_0021547 | |||
| 2676 | Ga0495648_0025079 | |||
| 2677 | Ga0495648_0326885 | |||
| 2678 | Ga0495654_0000178 | |||
| 2679 | Ga0495654_0000730 | |||
| 2680 | Ga0495654_0001501 | |||
| 2681 | Ga0495654_0012399 | |||
| 2682 | Ga0495654_0055682 | |||
| 2683 | Ga0495609_0000089 | |||
| 2684 | Ga0495609_0001578 | |||
| 2685 | Ga0495597_0001226 | |||
| 2686 | Ga0495633_0029543 | |||
| 2687 | Ga0495656_0074115 | |||
| 2688 | Ga0495668_0003266 | |||
| 2689 | Ga0495668_0006136 | |||
| 2690 | Ga0495668_0020102 | |||
| 2691 | Ga0495611_0000029 | |||
| 2692 | Ga0495611_0008135 | |||
| 2693 | Ga0495625_0001724 | |||
| 2694 | Ga0495625_0005121 | |||
| 2695 | Ga0495625_0101380 | |||
| 2696 | Ga0495625_0159043 | |||
| 2697 | Ga0495661_0044308 | |||
| 2698 | Ga0495588_0054483 | |||
| 2699 | Ga0495588_0186328 | |||
| 2700 | Ga0495670_0016580 | |||
| 2701 | Ga0495670_0152107 | |||
| 2702 | Ga0495670_0206763 | |||
| 2703 | Ga0495671_0000488 | |||
| 2704 | Ga0495671_0001281 | |||
| 2705 | Ga0495649_0025971 | |||
| 2706 | Ga0495649_0150366 | |||
| 2707 | Ga0495649_0156349 | |||
| 2708 | Ga0495589_0000144 | |||
| 2709 | Ga0495589_0000538 | |||
| 2710 | Ga0495660_0000286 | |||
| 2711 | Ga0495660_0000352 | |||
| 2712 | Ga0495660_0000755 | |||
| 2713 | Ga0495660_0014492 | |||
| 2714 | Ga0495636_0009335 | |||
| 2715 | Ga0495672_0000040 | |||
| 2716 | Ga0495672_0000057 | |||
| 2717 | Ga0495672_0004046 | |||
| 2718 | Ga0495672_0159995 | |||
| 2719 | Ga0495683_0001368 | |||
| 2720 | Ga0495683_0019053 | |||
| 2721 | Ga0495679_000001 | |||
| 2722 | Ga0495679_001362 | |||
| 2723 | Ga0495673_0000072 | |||
| 2724 | Ga0495673_0000498 | |||
| 2725 | Ga0495673_0000948 | |||
| 2726 | Ga0495673_0001941 | |||
| 2727 | Ga0495673_0015229 | |||
| 2728 | Ga0495681_0023793 | |||
| 2729 | Ga0495686_0002623 | |||
| 2730 | Ga0495686_0033604 | |||
| 2731 | Ga0495686_0252482 | |||
| 2732 | Ga0495686_0563429 | |||
| 2733 | Ga0496100_0005912 | |||
| 2734 | Ga0496101_0002023 | |||
| 2735 | Ga0496101_0108578 | |||
| 2736 | Ga0496101_1187336 | |||
| 2737 | Ga0496101_1282701 | |||
| 2738 | Ga0496102_0030781 | |||
| 2739 | Ga0496102_0731287 | |||
| 2740 | Ga0496103_0043084 | |||
| 2741 | Ga0496104_0001892 | |||
| 2742 | Ga0496104_0016472 | |||
| 2743 | Ga0496105_0002695 | |||
| 2744 | Ga0496105_0412489 | |||
| 2745 | Ga0496106_0001522 | |||
| 2746 | Ga0496108_0913793 | |||
| 2747 | Ga0496108_1736935 | |||
| 2748 | Ga0496109_0919104 | |||
| 2749 | Ga0496109_1304448 | |||
| 2750 | Ga0496110_0222429 | |||
| 2751 | Ga0496113_0035458 | |||
| 2752 | Ga0496115_0000605 | |||
| 2753 | Ga0496116_0003201 | |||
| 2754 | Ga0496116_0005339 | |||
| 2755 | Ga0496116_0006976 | |||
| 2756 | Ga0496116_0011021 | |||
| 2757 | Ga0496116_0243440 | |||
| 2758 | Ga0496117_0005477 | |||
| 2759 | Ga0496117_0011774 | |||
| 2760 | Ga0496117_0024547 | |||
| 2761 | Ga0496117_0034005 | |||
| 2762 | Ga0496117_0100689 | |||
| 2763 | Ga0496117_0395597 | |||
| 2764 | Ga0496118_0007739 | |||
| 2765 | Ga0496118_0021422 | |||
| 2766 | Ga0496118_0026816 | |||
| 2767 | Ga0496118_0031572 | |||
| 2768 | Ga0496118_0094354 | |||
| 2769 | Ga0496118_0110724 | |||
| 2770 | Ga0496118_0148897 | |||
| 2771 | Ga0496118_0172911 | |||
| 2772 | Ga0496118_0220442 | |||
| 2773 | Ga0496119_0003409 | |||
| 2774 | Ga0496119_0005901 | |||
| 2775 | Ga0496119_0006104 | |||
| 2776 | Ga0496119_0006306 | |||
| 2777 | Ga0496119_0029409 | |||
| 2778 | Ga0496119_0035175 | |||
| 2779 | Ga0496119_0108174 | |||
| 2780 | Ga0496119_0136252 | |||
| 2781 | Ga0496120_0001572 | |||
| 2782 | Ga0496120_0002769 | |||
| 2783 | Ga0496120_0010944 | |||
| 2784 | Ga0496120_0030470 | |||
| 2785 | Ga0496120_0055780 | |||
| 2786 | Ga0496120_0126218 | |||
| 2787 | Ga0496120_0181388 | |||
| 2788 | Ga0496121_0003768 | |||
| 2789 | Ga0496121_0004539 | |||
| 2790 | Ga0496121_0016935 | |||
| 2791 | Ga0496121_0033577 | |||
| 2792 | Ga0496121_0158242 | |||
| 2793 | Ga0496121_0203442 | |||
| 2794 | Ga0496122_0001230 | |||
| 2795 | Ga0496122_0001405 | |||
| 2796 | Ga0496122_0008393 | |||
| 2797 | Ga0496122_0015755 | |||
| 2798 | Ga0496122_0017548 | |||
| 2799 | Ga0496122_0024616 | |||
| 2800 | Ga0496122_0128946 | |||
| 2801 | Ga0496122_0603965 | |||
| 2802 | Ga0496123_0001008 | |||
| 2803 | Ga0496123_0001162 | |||
| 2804 | Ga0496123_0006244 | |||
| 2805 | Ga0496123_0006598 | |||
| 2806 | Ga0496123_0006627 | |||
| 2807 | Ga0496123_0008749 | |||
| 2808 | Ga0496123_0032023 | |||
| 2809 | Ga0496123_0044605 | |||
| 2810 | Ga0496123_0047515 | |||
| 2811 | Ga0496123_0056797 | |||
| 2812 | Ga0496123_0289445 | |||
| 2813 | Ga0496123_0318158 | |||
| 2814 | Ga0496123_0490111 | |||
| 2815 | Ga0496124_0000472 | |||
| 2816 | Ga0496124_0001250 | |||
| 2817 | Ga0496124_0001586 | |||
| 2818 | Ga0496124_0004282 | |||
| 2819 | Ga0496124_0007859 | |||
| 2820 | Ga0496124_0016466 | |||
| 2821 | Ga0496124_0027994 | |||
| 2822 | Ga0496124_0157468 | |||
| 2823 | Ga0496124_0268946 | |||
| 2824 | Ga0496125_0000100 | |||
| 2825 | Ga0496125_0036970 | |||
| 2826 | Ga0496125_0040942 | |||
| 2827 | Ga0496125_0187377 | |||
| 2828 | Ga0496125_0305756 | |||
| 2829 | Ga0496126_0000033 | |||
| 2830 | Ga0496126_0003866 | |||
| 2831 | Ga0496126_0013100 | |||
| 2832 | Ga0496126_0022691 | |||
| 2833 | Ga0496126_0033686 | |||
| 2834 | Ga0496126_0083436 | |||
| 2835 | Ga0496126_0195964 | |||
| 2836 | Ga0496126_0300169 | |||
| 2837 | Ga0496126_0330660 | |||
| 2838 | Ga0496126_0463736 | |||
| 2839 | Ga0501306_008659 | |||
| 2840 | Ga0501308_053469 | |||
| 2841 | Ga0501309_026767 | |||
| 2842 | Ga0501310_013500 | |||
| 2843 | Ga0501307_000588 | |||
| 2844 | Ga0495678_000882 | |||
| 2845 | Ga0495678_003548 | |||
| 2846 | Ga0495682_0000520 | |||
| 2847 | Ga0501312_000128 | |||
| 2848 | Ga0501313_038755 | |||
| 2849 | Ga0501316_000026 | |||
| 2850 | Ga0501320_002144 | |||
| 2851 | Ga0501321_040733 | |||
| 2852 | Ga0501330_018742 | |||
| 2853 | Ga0501338_04571 | |||
| 2854 | Ga0501031_0003929 | |||
| 2855 | Ga0501031_0453984 | |||
| 2856 | Ga0501032_0002355 | |||
| 2857 | Ga0501033_0004184 | |||
| 2858 | Ga0501033_0029320 | |||
| 2859 | Ga0501033_0745431 | |||
| 2860 | Ga0501034_0090022 | |||
| 2861 | Ga0501034_0218862 | |||
| 2862 | Ga0501036_0006195 | |||
| 2863 | Ga0501036_0083509 | |||
| 2864 | Ga0501036_1136989 | |||
| 2865 | Ga0501037_0001372 | |||
| 2866 | Ga0501037_0065318 | |||
| 2867 | Ga0501038_0000314 | |||
| 2868 | Ga0501038_0243106 | |||
| 2869 | Ga0501039_0003833 | |||
| 2870 | Ga0501039_0797842 | |||
| 2871 | Ga0501040_0319239 | |||
| 2872 | Ga0501041_0836094 | |||
| 2873 | Ga0501042_0030954 | |||
| 2874 | Ga0501043_0001324 | |||
| 2875 | Ga0501043_0011177 | |||
| 2876 | Ga0501046_0001012 | |||
| 2877 | Ga0501046_0450357 | |||
| 2878 | Ga0501047_0017837 | |||
| 2879 | Ga0501047_0244141 | |||
| 2880 | Ga0501047_0383636 | |||
| 2881 | Ga0501047_0387183 | |||
| 2882 | Ga0501047_0669514 | |||
| 2883 | Ga0501047_0675659 | |||
| 2884 | Ga0501047_0884130 | |||
| 2885 | Ga0501067_0194539 | |||
| 2886 | Ga0501067_0513761 | |||
| 2887 | Ga0501068_0183409 | |||
| 2888 | Ga0501068_0207541 | |||
| 2889 | Ga0501068_0713906 | |||
| 2890 | Ga0501070_0557055 | |||
| 2891 | Ga0501071_0741147 | |||
| 2892 | Ga0501073_0005913 | |||
| 2893 | Ga0501073_1078068 | |||
| 2894 | Ga0501074_0320358 | |||
| 2895 | Ga0501227_120792 | |||
| 2896 | Ga0501249_042535 | |||
| 2897 | Ga0501251_073724 | |||
| 2898 | Ga0501257_047708 | |||
| 2899 | Ga0501225_0105837 | |||
| 2900 | Ga0501080_0145438 | |||
| 2901 | Ga0501035_0000666 | |||
| 2902 | Ga0501035_0049862 | |||
| 2903 | Ga0501035_0349554 | |||
| 2904 | Ga0501035_0426462 | |||
| 2905 | Ga0501044_0004802 | |||
| 2906 | Ga0501044_0025623 | |||
| 2907 | Ga0501044_0054246 | |||
| 2908 | Ga0501044_0230592 | |||
| 2909 | Ga0501044_1369177 | |||
| 2910 | nmdc:mga00v17_1225_c1 | |||
| 2911 | nmdc:mga00v17_304144_c1 | |||
| 2912 | nmdc:mga00v17_83351_c1 | |||
| 2913 | nmdc:mga0qj67_163083_c1 | |||
| 2914 | nmdc:mga0qj67_757457_c1 | |||
| 2915 | nmdc:mga0sz30_200195_c1 | |||
| 2916 | nmdc:mga0sz30_91353_c1 | |||
| 2917 | Ga0500643_000120 | |||
| 2918 | Ga0500651_0003556 | |||
| 2919 | Ga0500555_001019 | |||
| 2920 | Ga0500595_034558 | |||
| 2921 | Ga0500621_000035 | |||
| 2922 | Ga0500564_040396 | |||
| 2923 | Ga0500633_0008712 | |||
| 2924 | Ga0500634_0000084 | |||
| 2925 | Ga0500645_002030 | |||
| 2926 | Ga0500661_041519 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sfr-assembly1.cif.gz_N | unmethylated mtb ribosome 50s with seq-9 | 0.977 | 14 | 116 |
| 8cvm-assembly1.cif.gz_m | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9665 | 13 | 116 |
| 1nwy-assembly1.cif.gz_L | complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin | 0.956 | 12 | 116 |
| 5xym-assembly1.cif.gz_N | large subunit of mycobacterium smegmatis | 0.9514 | 10 | 116 |
| 6wru-assembly1.cif.gz_Z | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.9509 | 12 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9735 | 13 | 115 | 3.90.1030.10 |
| 5v7qN00 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9664 | 13 | 116 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9647 | 13 | 115 | 3.90.1030.10 |
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9643 | 13 | 115 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9556 | 13 | 115 | 3.90.1030.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2TK58-F1-model_v4 | 50S ribosomal protein L17 | 0.9933 | 23 | 120 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A450YG75-F1-model_v4 | 50S ribosomal protein L17 | 0.9925 | 49 | 119 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1F9ENG3-F1-model_v4 | 50S ribosomal protein L17 | 0.9885 | 20 | 114 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A559UJT1-F1-model_v4 | deleted | 0.9877 | 14 | 116 |
|
| AF-A0A165K8I5-F1-model_v4 | 50S ribosomal protein L17 | 0.9876 | 31 | 124 |
GO:0003735
GO:0006412 GO:0022625 |