F494131

General Info

Members Datasets Scaffolds Average Seq Length
1461 499 1403 175

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10642792|Ga0207683_106427922
Length 197
Sequence MTTHTLSVLVENKPGVLARIAGLFSRRGFNIESLAVGPTEHAEISRMTIVVNVEDSPLEQVTKQLNKLIEVLKIVELDGPLSVNRELMLVKVRADAATRGQVIDAVQLFRAKVVDVAPDAVTIEVTGNADKLSDFRRVLEPFGIRELVQSGMVAIGRGSRSISERTPRPIAVSTCARFTIGRGAPVAVMTMSALASA

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2576861822 Frankia sp. CeD Isolate Nodule
5 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
6 2626541554 Frankia sp. AvcI.1 Isolate Nodule
7 2643221561 Nocardioides sp. Root151 Isolate Unclassified
8 2643221576 Nocardioides sp. Root614 Isolate Unclassified
9 2643221590 Nocardioides sp. Root682 Isolate Unclassified
10 2643221604 Nocardioides sp. Root190 Isolate Unclassified
11 2643221615 Nocardioides sp. Root224 Isolate Unclassified
12 2643221617 Nocardioides sp. Root79 Isolate Unclassified
13 2643221620 Nocardioides sp. Root240 Isolate Unclassified
14 2643221641 Nocardioides sp. Root122 Isolate Unclassified
15 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
16 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
17 2643221696 Nocardioides sp. Root140 Isolate Unclassified
18 2671180195 Frankia sp. CcI49 Isolate Nodule
19 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
20 2684623036 Frankia sp. CgIM4 Isolate Nodule
21 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
22 2710264753 Frankia sp. KB5 Isolate Nodule
23 2738541305 Nocardioides sp. CF167 Isolate Unclassified
24 2739367898 Nocardioides sp. CF479 Isolate Unclassified
25 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
26 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
27 2773857922 Frankia sp. CcI49 Isolate Nodule
28 2773857933 Frankia sp. BMG5.30 Isolate Nodule
29 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
30 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
31 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
32 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
33 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
34 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
35 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
36 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
37 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
38 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
39 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
40 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
41 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
42 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
43 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
44 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
45 2891562705 Microbispora tritici MT50 Isolate Unclassified
46 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
47 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
48 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
49 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
50 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
51 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
52 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
53 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
54 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
55 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
56 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
157 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
182 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
183 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
255 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
256 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
257 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
258 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
263 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
264 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
265 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
269 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
270 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
271 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
272 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
273 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
274 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
278 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
281 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
282 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
283 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
285 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
286 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
288 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
289 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
290 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
298 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
308 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
309 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
312 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
313 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
314 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
315 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
316 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
317 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
318 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
319 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
320 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
321 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
322 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
323 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
324 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
325 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
326 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
327 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
328 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
329 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
330 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
331 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
332 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
341 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
342 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
343 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
348 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
349 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
350 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
351 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
354 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
370 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
374 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
378 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
379 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
380 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
390 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
393 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
422 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
423 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
424 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
425 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
426 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
427 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
432 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
433 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
434 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
435 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
436 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
437 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
447 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
451 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
455 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
456 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
457 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
458 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
459 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
460 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
461 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
462 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
463 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
464 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
465 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
466 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
467 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
468 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
473 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
492 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
493 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
494 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
495 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
496 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
497 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
498 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
499 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.88
Metatranscriptomes 3.15
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 6.43
Nodule 1.3
Rhizoplane 6.78
Rhizosphere 78.17
Stem 0
Stem Tuber 0.07
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10039812 3300001990 Bacteria 1444
2 JGI24735J21928_10014015 3300002067 Bacteria 2514
3 JGI24745J21846_1000420 3300002073 Bacteria 3759
4 JGI25406J46586_10076100 3300003203 Bacteria 1040
5 JGI25406J46586_10095686 3300003203 Bacteria 890
6 JGI25405J52794_10005273 3300003911 Bacteria 2327
7 Ga0058861_10006428 3300004800 Bacteria 787
8 Ga0065704_10018886 3300005289 Bacteria 1563
9 Ga0070658_10000309 3300005327 Bacteria 42138
10 Ga0070658_10055038 3300005327 Bacteria 3231
11 Ga0070658_10136667 3300005327 Bacteria 2045
12 Ga0070658_10548451 3300005327 Bacteria 1000
13 Ga0070676_10110840 3300005328 Bacteria 1708
14 Ga0070683_100000365 3300005329 Bacteria 31299
15 Ga0070683_100021777 3300005329 Bacteria 5722
16 Ga0070683_100064383 3300005329 Bacteria 3413
17 Ga0070683_100123383 3300005329 Bacteria 2448
18 Ga0070683_100309195 3300005329 Bacteria 1504
19 Ga0070683_100362731 3300005329 Bacteria 1380
20 Ga0070683_100871656 3300005329 Bacteria 863
21 Ga0070670_100178830 3300005331 Bacteria 1841
22 Ga0070670_100617619 3300005331 Bacteria 971
23 Ga0070670_101247016 3300005331 Bacteria 680
24 Ga0070677_10286521 3300005333 Bacteria 832
25 Ga0068869_100031689 3300005334 Bacteria 3719
26 Ga0068869_100835560 3300005334 Bacteria 794
27 Ga0070666_10004975 3300005335 Bacteria 8126
28 Ga0070666_10377334 3300005335 Bacteria 1017
29 Ga0070666_10435444 3300005335 Bacteria 946
30 Ga0070680_100067439 3300005336 Bacteria 2935
31 Ga0070680_100178696 3300005336 Bacteria 1787
32 Ga0070680_100472595 3300005336 Bacteria 1071
33 Ga0070682_100000691 3300005337 Bacteria 20383
34 Ga0070682_100045887 3300005337 Bacteria 2710
35 Ga0070682_100207806 3300005337 Bacteria 1385
36 Ga0070682_100281829 3300005337 Bacteria 1212
37 Ga0070682_100285508 3300005337 Bacteria 1205
38 Ga0070682_100546763 3300005337 Bacteria 905
39 Ga0070682_100723362 3300005337 Bacteria 800
40 Ga0068868_100030305 3300005338 Bacteria 4148
41 Ga0068868_100423829 3300005338 Bacteria 1153
42 Ga0070660_100036967 3300005339 Bacteria 3701
43 Ga0070660_100075006 3300005339 Bacteria 2647
44 Ga0070660_100089282 3300005339 Bacteria 2428
45 Ga0070660_100092060 3300005339 Bacteria 2393
46 Ga0070660_100120260 3300005339 Bacteria 2096
47 Ga0070660_100295253 3300005339 Bacteria 1328
48 Ga0070660_100487434 3300005339 Bacteria 1025
49 Ga0070660_100962679 3300005339 Bacteria 721
50 Ga0070660_101098857 3300005339 Bacteria 673
51 Ga0070689_100127817 3300005340 Bacteria 2035
52 Ga0070689_100171424 3300005340 Bacteria 1758
53 Ga0070687_100542988 3300005343 Bacteria 790
54 Ga0070661_100138402 3300005344 Bacteria 1833
55 Ga0070661_100306210 3300005344 Bacteria 1238
56 Ga0070661_100527228 3300005344 Bacteria 948
57 Ga0070668_100000160 3300005347 Bacteria 42522
58 Ga0070668_100152106 3300005347 Bacteria 1872
59 Ga0070668_100203316 3300005347 Bacteria 1627
60 Ga0070668_100254561 3300005347 Bacteria 1458
61 Ga0070669_100105200 3300005353 Bacteria 2135
62 Ga0070675_100083321 3300005354 Bacteria 2669
63 Ga0070675_100539854 3300005354 Bacteria 1054
64 Ga0070675_100706953 3300005354 Bacteria 918
65 Ga0070675_100833483 3300005354 Bacteria 844
66 Ga0070671_100065944 3300005355 Bacteria 3017
67 Ga0070671_100328830 3300005355 Bacteria 1303
68 Ga0070671_100710057 3300005355 Bacteria 872
69 Ga0070674_100105070 3300005356 Bacteria 2064
70 Ga0070674_100564144 3300005356 Bacteria 957
71 Ga0070673_100044251 3300005364 Bacteria 3446
72 Ga0070673_100432429 3300005364 Bacteria 1181
73 Ga0070688_100287462 3300005365 Bacteria 1184
74 Ga0070688_100610686 3300005365 Bacteria 836
75 Ga0070659_100077895 3300005366 Bacteria 2644
76 Ga0070659_100098357 3300005366 Bacteria 2353
77 Ga0070659_100205854 3300005366 Bacteria 1621
78 Ga0070659_100441695 3300005366 Bacteria 1102
79 Ga0070659_100693867 3300005366 Bacteria 880
80 Ga0070659_101020390 3300005366 Bacteria 727
81 Ga0070667_100004070 3300005367 Bacteria 12361
82 Ga0070667_100152181 3300005367 Bacteria 2033
83 Ga0070667_100558545 3300005367 Bacteria 1052
84 Ga0070714_100000525 3300005435 Bacteria 27804
85 Ga0070714_100017121 3300005435 Bacteria 5868
86 Ga0070714_100443028 3300005435 Bacteria 1233
87 Ga0070714_100443111 3300005435 Bacteria 1233
88 Ga0070714_100955955 3300005435 Bacteria 833
89 Ga0070714_101400591 3300005435 Bacteria 683
90 Ga0070713_100421485 3300005436 Bacteria 1250
91 Ga0070710_10191413 3300005437 Bacteria 1287
92 Ga0070701_10021162 3300005438 Bacteria 3100
93 Ga0070701_10231625 3300005438 Bacteria 1107
94 Ga0070705_100233669 3300005440 Bacteria 1281
95 Ga0070700_100000088 3300005441 Bacteria 61864
96 Ga0070700_100029490 3300005441 Bacteria 3271
97 Ga0070700_100370682 3300005441 Bacteria 1068
98 Ga0070700_100729470 3300005441 Bacteria 791
99 Ga0070700_100869067 3300005441 Bacteria 732
100 Ga0070700_100874825 3300005441 Bacteria 730
101 Ga0070663_100225408 3300005455 Bacteria 1473
102 Ga0070663_100261206 3300005455 Bacteria 1374
103 Ga0070663_100320369 3300005455 Bacteria 1246
104 Ga0070678_100379920 3300005456 Bacteria 1222
105 Ga0070678_100533608 3300005456 Bacteria 1040
106 Ga0070678_100606373 3300005456 Bacteria 978
107 Ga0070678_100830490 3300005456 Bacteria 841
108 Ga0070662_100986958 3300005457 Bacteria 721
109 Ga0070681_10012690 3300005458 Bacteria 8360
110 Ga0070681_10499355 3300005458 Bacteria 1130
111 Ga0070681_11297932 3300005458 Bacteria 651
112 Ga0068867_100080112 3300005459 Bacteria 2458
113 Ga0070685_10046945 3300005466 Bacteria 2481
114 Ga0070685_10139107 3300005466 Bacteria 1526
115 Ga0070685_10911513 3300005466 Bacteria 655
116 Ga0070707_100091317 3300005468 Bacteria 2948
117 Ga0070698_100073014 3300005471 Bacteria 3438
118 Ga0070698_101468328 3300005471 Bacteria 633
119 Ga0070679_100015719 3300005530 Bacteria 7277
120 Ga0070679_100021008 3300005530 Bacteria 6370
121 Ga0070679_100316299 3300005530 Bacteria 1511
122 Ga0070679_100464907 3300005530 Bacteria 1210
123 Ga0070679_100813502 3300005530 Bacteria 878
124 Ga0070684_100001882 3300005535 Bacteria 15377
125 Ga0070684_100006238 3300005535 Bacteria 9203
126 Ga0070684_100132813 3300005535 Bacteria 2246
127 Ga0070684_100162822 3300005535 Bacteria 2024
128 Ga0070684_100286592 3300005535 Bacteria 1509
129 Ga0070684_100296259 3300005535 Bacteria 1484
130 Ga0070684_101159535 3300005535 Bacteria 727
131 Ga0070684_101159911 3300005535 Bacteria 726
132 Ga0068853_100223777 3300005539 Bacteria 1719
133 Ga0068853_100523868 3300005539 Bacteria 1121
134 Ga0068853_100617944 3300005539 Bacteria 1030
135 Ga0070672_100922743 3300005543 Bacteria 772
136 Ga0070672_101232748 3300005543 Bacteria 667
137 Ga0070686_100130599 3300005544 Bacteria 1736
138 Ga0070686_100861268 3300005544 Bacteria 734
139 Ga0070696_100002684 3300005546 Bacteria 11794
140 Ga0070693_100229895 3300005547 Bacteria 1219
141 Ga0070693_100653955 3300005547 Bacteria 765
142 Ga0070665_100000754 3300005548 Bacteria 42987
143 Ga0070665_100001179 3300005548 Bacteria 32016
144 Ga0070665_100046768 3300005548 Bacteria 4345
145 Ga0070665_100923105 3300005548 Bacteria 885
146 Ga0070665_102198501 3300005548 Bacteria 555
147 Ga0068855_100080022 3300005563 Bacteria 3789
148 Ga0068855_100145855 3300005563 Bacteria 2695
149 Ga0068855_100502218 3300005563 Bacteria 1318
150 Ga0068855_101229225 3300005563 Bacteria 778
151 Ga0070664_100199414 3300005564 Bacteria 1785
152 Ga0070664_100277545 3300005564 Bacteria 1511
153 Ga0070664_100801291 3300005564 Bacteria 881
154 Ga0068857_100201416 3300005577 Bacteria 1815
155 Ga0068857_100212230 3300005577 Bacteria 1767
156 Ga0068857_100261440 3300005577 Bacteria 1588
157 Ga0068857_100330922 3300005577 Bacteria 1408
158 Ga0068857_100454025 3300005577 Bacteria 1198
159 Ga0068857_101183419 3300005577 Bacteria 740
160 Ga0068854_100043672 3300005578 Bacteria 3178
161 Ga0068854_100229123 3300005578 Bacteria 1474
162 Ga0068856_100299868 3300005614 Bacteria 1624
163 Ga0068856_101104226 3300005614 Bacteria 810
164 Ga0070702_100111487 3300005615 Bacteria 1697
165 Ga0070702_100134723 3300005615 Bacteria 1565
166 Ga0070702_100144866 3300005615 Bacteria 1517
167 Ga0070702_100145113 3300005615 Bacteria 1516
168 Ga0070702_100431826 3300005615 Bacteria 951
169 Ga0070702_100478267 3300005615 Bacteria 910
170 Ga0068852_100146418 3300005616 Bacteria 2191
171 Ga0068852_100192419 3300005616 Bacteria 1926
172 Ga0068852_100263270 3300005616 Bacteria 1656
173 Ga0068852_100464073 3300005616 Bacteria 1256
174 Ga0068852_100553847 3300005616 Bacteria 1151
175 Ga0068852_100757280 3300005616 Bacteria 983
176 Ga0068859_100081255 3300005617 Bacteria 3283
177 Ga0068859_100454167 3300005617 Bacteria 1377
178 Ga0068859_100896522 3300005617 Bacteria 971
179 Ga0068864_100364413 3300005618 Bacteria 1366
180 Ga0068864_100369193 3300005618 Bacteria 1358
181 Ga0068864_100620890 3300005618 Bacteria 1050
182 Ga0068864_100791322 3300005618 Bacteria 931
183 Ga0068866_10206463 3300005718 Bacteria 1177
184 Ga0068866_10612139 3300005718 Bacteria 737
185 Ga0068866_10742681 3300005718 Bacteria 677
186 Ga0068861_100068058 3300005719 Bacteria 2750
187 Ga0068851_10096947 3300005834 Bacteria 1560
188 Ga0068870_10065588 3300005840 Bacteria 1964
189 Ga0068870_10398846 3300005840 Bacteria 895
190 Ga0068863_100024453 3300005841 Bacteria 5760
191 Ga0068863_100973554 3300005841 Bacteria 850
192 Ga0068863_101277253 3300005841 Bacteria 741
193 Ga0068858_100014693 3300005842 Bacteria 7371
194 Ga0068858_100192931 3300005842 Bacteria 1925
195 Ga0068858_100263850 3300005842 Bacteria 1638
196 Ga0068860_100000134 3300005843 Bacteria 120350
197 Ga0068860_100000357 3300005843 Bacteria 60525
198 Ga0068860_100035215 3300005843 Bacteria 4803
199 Ga0068860_100223988 3300005843 Bacteria 1826
200 Ga0068860_100568994 3300005843 Bacteria 1136
201 Ga0068862_100135674 3300005844 Bacteria 2180
202 Ga0068862_100183221 3300005844 Bacteria 1880
203 Ga0068862_100358991 3300005844 Bacteria 1354
204 Ga0081455_10000134 3300005937 Bacteria 87309
205 Ga0081455_10000873 3300005937 Bacteria 38958
206 Ga0081455_10002407 3300005937 Bacteria 22331
207 Ga0081455_10075031 3300005937 Bacteria 2791
208 Ga0081455_10131031 3300005937 Bacteria 1960
209 Ga0081455_10716268 3300005937 Bacteria 636
210 Ga0081540_1012440 3300005983 Bacteria 5602
211 Ga0081539_10000692 3300005985 Bacteria 67584
212 Ga0081539_10001544 3300005985 Bacteria 38499
213 Ga0081539_10052944 3300005985 Bacteria 2276
214 Ga0070717_10248108 3300006028 Bacteria 1572
215 Ga0070717_10454414 3300006028 Bacteria 1155
216 Ga0075365_10002919 3300006038 Bacteria 8630
217 Ga0075365_10014332 3300006038 Bacteria 4766
218 Ga0075365_10108600 3300006038 Bacteria 1905
219 Ga0075365_10168331 3300006038 Bacteria 1529
220 Ga0075365_10193863 3300006038 Bacteria 1422
221 Ga0075365_10299598 3300006038 Bacteria 1131
222 Ga0075365_10305257 3300006038 Bacteria 1120
223 Ga0075365_10356304 3300006038 Bacteria 1031
224 Ga0075365_10360204 3300006038 Bacteria 1025
225 Ga0075365_10380748 3300006038 Bacteria 995
226 Ga0075365_10392102 3300006038 Bacteria 980
227 Ga0075365_10411627 3300006038 Bacteria 954
228 Ga0075365_10494291 3300006038 Bacteria 864
229 Ga0075368_10021578 3300006042 Bacteria 2447
230 Ga0075368_10053871 3300006042 Bacteria 1602
231 Ga0075368_10173081 3300006042 Bacteria 908
232 Ga0075363_100014711 3300006048 Bacteria 3832
233 Ga0075363_100045195 3300006048 Bacteria 2335
234 Ga0075363_100138596 3300006048 Bacteria 1368
235 Ga0075363_100313741 3300006048 Bacteria 911
236 Ga0075364_10004748 3300006051 Bacteria 7851
237 Ga0075364_10077439 3300006051 Bacteria 2195
238 Ga0075364_10114445 3300006051 Bacteria 1802
239 Ga0075364_10133631 3300006051 Bacteria 1666
240 Ga0075364_10190898 3300006051 Bacteria 1387
241 Ga0075364_10196313 3300006051 Bacteria 1367
242 Ga0075364_10569083 3300006051 Bacteria 774
243 Ga0070716_100021188 3300006173 Bacteria 3422
244 Ga0075362_10013735 3300006177 Bacteria 3249
245 Ga0075367_10011121 3300006178 Bacteria 4748
246 Ga0075367_10106317 3300006178 Bacteria 1719
247 Ga0075367_10180950 3300006178 Bacteria 1314
248 Ga0075367_10225088 3300006178 Bacteria 1174
249 Ga0075367_10287834 3300006178 Bacteria 1033
250 Ga0075367_10375296 3300006178 Bacteria 898
251 Ga0097621_100166487 3300006237 Bacteria 1898
252 Ga0097621_100250892 3300006237 Bacteria 1549
253 Ga0097621_100748040 3300006237 Bacteria 903
254 Ga0075370_10016140 3300006353 Bacteria 4014
255 Ga0075370_10168154 3300006353 Bacteria 1288
256 Ga0075370_10509462 3300006353 Bacteria 726
257 Ga0075428_100013282 3300006844 Bacteria 9164
258 Ga0075430_100000816 3300006846 Bacteria 24281
259 Ga0075430_100046548 3300006846 Bacteria 3663
260 Ga0075430_100098568 3300006846 Bacteria 2442
261 Ga0075430_100128130 3300006846 Bacteria 2116
262 Ga0075430_100332627 3300006846 Bacteria 1255
263 Ga0075431_100002532 3300006847 Bacteria 17632
264 Ga0075431_100039232 3300006847 Bacteria 4879
265 Ga0075431_100338147 3300006847 Bacteria 1515
266 Ga0075429_100007033 3300006880 Bacteria 9774
267 Ga0075429_100289239 3300006880 Bacteria 1435
268 Ga0075429_100467718 3300006880 Bacteria 1105
269 Ga0068865_100178735 3300006881 Bacteria 1633
270 Ga0068865_100568036 3300006881 Bacteria 955
271 Ga0068865_100622542 3300006881 Bacteria 914
272 Ga0068865_101203455 3300006881 Bacteria 671
273 Ga0097620_100081257 3300006931 Bacteria 3283
274 Ga0097620_100454190 3300006931 Bacteria 1377
275 Ga0097620_100896570 3300006931 Bacteria 971
276 Ga0079104_1000050 3300006946 Bacteria 173000
277 Ga0079104_1003814 3300006946 Bacteria 6768
278 Ga0079104_1004462 3300006946 Bacteria 5974
279 Ga0079104_1009138 3300006946 Bacteria 3383
280 Ga0105251_10107784 3300009011 Bacteria 1271
281 Ga0105244_10297250 3300009036 Bacteria 747
282 Ga0105240_10575666 3300009093 Bacteria 1243
283 Ga0105240_11031374 3300009093 Bacteria 878
284 Ga0111539_10170938 3300009094 Bacteria 2539
285 Ga0111539_10192655 3300009094 Bacteria 2378
286 Ga0111539_10292690 3300009094 Bacteria 1895
287 Ga0111539_10433252 3300009094 Bacteria 1531
288 Ga0111539_10797349 3300009094 Bacteria 1099
289 Ga0111539_11065196 3300009094 Bacteria 940
290 Ga0105245_10022603 3300009098 Bacteria 5521
291 Ga0105245_10250968 3300009098 Bacteria 1719
292 Ga0105245_10289780 3300009098 Bacteria 1603
293 Ga0105245_10658864 3300009098 Bacteria 1077
294 Ga0105245_11517476 3300009098 Bacteria 721
295 Ga0105247_10068814 3300009101 Bacteria 2208
296 Ga0105247_10445401 3300009101 Bacteria 932
297 Ga0114129_10078312 3300009147 Bacteria 4598
298 Ga0114129_10806062 3300009147 Bacteria 1197
299 Ga0105243_10128449 3300009148 Bacteria 2147
300 Ga0105243_10199230 3300009148 Bacteria 1755
301 Ga0105243_10335091 3300009148 Bacteria 1384
302 Ga0105243_10874444 3300009148 Bacteria 892
303 Ga0105243_10924743 3300009148 Bacteria 869
304 Ga0105243_11043437 3300009148 Bacteria 823
305 Ga0105241_10184910 3300009174 Bacteria 1731
306 Ga0105241_10984870 3300009174 Bacteria 788
307 Ga0105242_11124919 3300009176 Bacteria 801
308 Ga0105248_10291296 3300009177 Bacteria 1838
309 Ga0105248_10603156 3300009177 Bacteria 1239
310 Ga0105248_10729754 3300009177 Bacteria 1118
311 Ga0105248_10766577 3300009177 Bacteria 1089
312 Ga0105248_11929241 3300009177 Bacteria 670
313 Ga0105237_10293689 3300009545 Bacteria 1628
314 Ga0105237_10503324 3300009545 Bacteria 1218
315 Ga0105237_10591893 3300009545 Bacteria 1116
316 Ga0105237_12194946 3300009545 Bacteria 562
317 Ga0105238_10103133 3300009551 Bacteria 2834
318 Ga0105238_10676940 3300009551 Bacteria 1043
319 Ga0105238_10754112 3300009551 Bacteria 987
320 Ga0105238_10956836 3300009551 Bacteria 876
321 Ga0105249_10291186 3300009553 Bacteria 1634
322 Ga0105249_10324550 3300009553 Bacteria 1551
323 Ga0105249_10415586 3300009553 Bacteria 1378
324 Ga0105249_10863356 3300009553 Bacteria 971
325 Ga0105249_11076932 3300009553 Bacteria 874
326 Ga0105249_11202759 3300009553 Bacteria 829
327 Ga0105032_104602 3300009979 Bacteria 1175
328 Ga0105033_107526 3300009986 Bacteria 946
329 Ga0105239_10001015 3300010375 Bacteria 39219
330 Ga0105239_10123075 3300010375 Bacteria 2882
331 Ga0105239_10251546 3300010375 Bacteria 1985
332 Ga0105239_12307704 3300010375 Bacteria 626
333 Ga0105246_10004416 3300011119 Bacteria 8563
334 Ga0105246_10221352 3300011119 Bacteria 1484
335 Ga0105246_10347981 3300011119 Bacteria 1213
336 Ga0105246_10714195 3300011119 Bacteria 880
337 Ga0105246_10925563 3300011119 Bacteria 784
338 Ga0157338_1003597 3300012515 Bacteria 1296
339 Ga0157371_10147252 3300013102 Bacteria 1678
340 Ga0157370_10104374 3300013104 Bacteria 2653
341 Ga0157370_10295087 3300013104 Bacteria 1497
342 Ga0157370_10514312 3300013104 Bacteria 1099
343 Ga0157369_10029439 3300013105 Bacteria 6068
344 Ga0157369_10203560 3300013105 Bacteria 2077
345 Ga0157369_10355977 3300013105 Bacteria 1520
346 Ga0157369_10698767 3300013105 Bacteria 1044
347 Ga0157369_10705463 3300013105 Bacteria 1039
348 Ga0157369_10778843 3300013105 Bacteria 983
349 Ga0157369_11034602 3300013105 Bacteria 840
350 Ga0157369_11231529 3300013105 Bacteria 763
351 Ga0157369_11435316 3300013105 Bacteria 702
352 Ga0157369_11811647 3300013105 Bacteria 620
353 Ga0157374_10018630 3300013296 Bacteria 6131
354 Ga0157374_10307896 3300013296 Bacteria 1568
355 Ga0157374_10573391 3300013296 Bacteria 1137
356 Ga0157374_10679102 3300013296 Bacteria 1042
357 Ga0157374_10778339 3300013296 Bacteria 972
358 Ga0157374_10975343 3300013296 Bacteria 866
359 Ga0157378_10131365 3300013297 Bacteria 2318
360 Ga0157378_10247535 3300013297 Bacteria 1705
361 Ga0157378_10374396 3300013297 Bacteria 1397
362 Ga0163162_10024096 3300013306 Bacteria 6006
363 Ga0163162_10289922 3300013306 Bacteria 1769
364 Ga0163162_10345938 3300013306 Bacteria 1619
365 Ga0157372_10000057 3300013307 Bacteria 125915
366 Ga0157372_10055250 3300013307 Bacteria 4434
367 Ga0157372_10231641 3300013307 Bacteria 2142
368 Ga0157372_10276492 3300013307 Bacteria 1952
369 Ga0157372_10557029 3300013307 Bacteria 1336
370 Ga0157372_10831065 3300013307 Bacteria 1073
371 Ga0157372_11031498 3300013307 Bacteria 952
372 Ga0157372_11070612 3300013307 Bacteria 933
373 Ga0157372_11145760 3300013307 Bacteria 899
374 Ga0157372_12093567 3300013307 Bacteria 650
375 Ga0157375_10118462 3300013308 Bacteria 2754
376 Ga0157375_10169491 3300013308 Bacteria 2330
377 Ga0157375_10507635 3300013308 Bacteria 1370
378 Ga0157375_10542033 3300013308 Bacteria 1326
379 Ga0157375_10648325 3300013308 Bacteria 1212
380 Ga0157375_10736858 3300013308 Bacteria 1137
381 Ga0157375_10812438 3300013308 Bacteria 1083
382 Ga0157375_10920405 3300013308 Bacteria 1017
383 Ga0163163_10035901 3300014325 Bacteria 4812
384 Ga0163163_10154683 3300014325 Bacteria 2337
385 Ga0163163_11100365 3300014325 Bacteria 857
386 Ga0157380_10183016 3300014326 Bacteria 1842
387 Ga0157380_10749040 3300014326 Bacteria 988
388 Ga0157380_10769734 3300014326 Bacteria 976
389 Ga0157380_11365402 3300014326 Bacteria 758
390 Ga0157380_11600722 3300014326 Bacteria 707
391 Ga0182008_10126916 3300014497 Bacteria 1271
392 Ga0182008_10212987 3300014497 Bacteria 986
393 Ga0157377_10041633 3300014745 Bacteria 2549
394 Ga0157377_10054023 3300014745 Bacteria 2273
395 Ga0157377_10149623 3300014745 Bacteria 1442
396 Ga0157377_10623673 3300014745 Bacteria 772
397 Ga0157379_10138434 3300014968 Bacteria 2194
398 Ga0157379_10279851 3300014968 Bacteria 1518
399 Ga0157379_10313742 3300014968 Bacteria 1431
400 Ga0157379_10319073 3300014968 Bacteria 1418
401 Ga0157379_10458368 3300014968 Bacteria 1178
402 Ga0157379_11361857 3300014968 Bacteria 687
403 Ga0157376_10269671 3300014969 Bacteria 1598
404 Ga0157376_10276376 3300014969 Bacteria 1580
405 Ga0157376_10546808 3300014969 Bacteria 1145
406 Ga0157376_10739258 3300014969 Bacteria 992
407 Ga0157376_11988440 3300014969 Bacteria 619
408 Ga0163161_10316970 3300017792 Bacteria 1232
409 Ga0163161_10385792 3300017792 Bacteria 1120
410 Ga0163161_10390200 3300017792 Bacteria 1114
411 Ga0163161_10599684 3300017792 Bacteria 908
412 Ga0197907_10338604 3300020069 Bacteria 1906
413 Ga0206356_10089054 3300020070 Bacteria 950
414 Ga0206356_11757810 3300020070 Bacteria 1774
415 Ga0206349_1138990 3300020075 Bacteria 741
416 Ga0206349_1145956 3300020075 Bacteria 611
417 Ga0206354_10447794 3300020081 Bacteria 2244
418 Ga0206353_10048937 3300020082 Bacteria 907
419 Ga0206353_11053797 3300020082 Bacteria 973
420 Ga0206353_11201113 3300020082 Bacteria 645
421 Ga0206353_12028049 3300020082 Bacteria 1532
422 Ga0213873_10004954 3300021358 Bacteria 2519
423 Ga0213875_10000448 3300021388 Bacteria 35901
424 Ga0213875_10003334 3300021388 Bacteria 9172
425 Ga0213875_10074585 3300021388 Bacteria 1583
426 Ga0224712_10087884 3300022467 Bacteria 1296
427 Ga0224712_10140428 3300022467 Bacteria 1063
428 Ga0207656_10011084 3300025321 Bacteria 3397
429 Ga0207656_10085075 3300025321 Bacteria 1427
430 Ga0207655_1005169 3300025728 Bacteria 8980
431 Ga0207692_10274992 3300025898 Bacteria 1017
432 Ga0207642_10356126 3300025899 Bacteria 865
433 Ga0207688_10006084 3300025901 Bacteria 6564
434 Ga0207688_10041299 3300025901 Bacteria 2566
435 Ga0207688_10136289 3300025901 Bacteria 1442
436 Ga0207688_10509919 3300025901 Bacteria 754
437 Ga0207680_10003699 3300025903 Bacteria 7187
438 Ga0207680_10351374 3300025903 Bacteria 1036
439 Ga0207647_10013238 3300025904 Bacteria 5725
440 Ga0207647_10016063 3300025904 Bacteria 5114
441 Ga0207647_10053815 3300025904 Bacteria 2479
442 Ga0207647_10350905 3300025904 Bacteria 835
443 Ga0207645_10026249 3300025907 Bacteria 3765
444 Ga0207645_10077321 3300025907 Bacteria 2132
445 Ga0207643_10012842 3300025908 Bacteria 4528
446 Ga0207643_10194751 3300025908 Bacteria 1232
447 Ga0207643_10210658 3300025908 Bacteria 1186
448 Ga0207705_10037876 3300025909 Bacteria 3451
449 Ga0207705_10204329 3300025909 Bacteria 1497
450 Ga0207705_10563486 3300025909 Bacteria 886
451 Ga0207654_10152679 3300025911 Bacteria 1484
452 Ga0207654_11129268 3300025911 Bacteria 571
453 Ga0207707_10083475 3300025912 Bacteria 2790
454 Ga0207707_10268036 3300025912 Bacteria 1480
455 Ga0207707_11005839 3300025912 Bacteria 684
456 Ga0207695_10129714 3300025913 Bacteria 2480
457 Ga0207695_10138503 3300025913 Bacteria 2385
458 Ga0207695_10714084 3300025913 Bacteria 883
459 Ga0207671_10000024 3300025914 Bacteria 274628
460 Ga0207671_10216137 3300025914 Bacteria 1501
461 Ga0207671_10309964 3300025914 Bacteria 1248
462 Ga0207663_10712845 3300025916 Bacteria 795
463 Ga0207660_10025206 3300025917 Bacteria 4035
464 Ga0207660_10158066 3300025917 Bacteria 1746
465 Ga0207660_10209143 3300025917 Bacteria 1527
466 Ga0207660_10218830 3300025917 Bacteria 1494
467 Ga0207662_10230374 3300025918 Bacteria 1210
468 Ga0207662_10376770 3300025918 Bacteria 958
469 Ga0207657_10002812 3300025919 Bacteria 18725
470 Ga0207657_10037856 3300025919 Bacteria 4302
471 Ga0207657_10043658 3300025919 Bacteria 3947
472 Ga0207657_10083103 3300025919 Bacteria 2687
473 Ga0207657_10176377 3300025919 Bacteria 1729
474 Ga0207657_10219579 3300025919 Bacteria 1523
475 Ga0207657_10387725 3300025919 Bacteria 1099
476 Ga0207657_10673050 3300025919 Bacteria 805
477 Ga0207649_10356406 3300025920 Bacteria 1084
478 Ga0207649_10913919 3300025920 Bacteria 688
479 Ga0207652_10094714 3300025921 Bacteria 2630
480 Ga0207652_10401349 3300025921 Bacteria 1237
481 Ga0207652_10407918 3300025921 Bacteria 1226
482 Ga0207652_10611253 3300025921 Bacteria 977
483 Ga0207681_10210796 3300025923 Bacteria 1497
484 Ga0207681_10312614 3300025923 Bacteria 1247
485 Ga0207694_10017123 3300025924 Bacteria 5476
486 Ga0207694_10077535 3300025924 Bacteria 2604
487 Ga0207694_10322291 3300025924 Bacteria 1275
488 Ga0207694_10419450 3300025924 Bacteria 1115
489 Ga0207694_10735806 3300025924 Bacteria 832
490 Ga0207650_10326204 3300025925 Bacteria 1258
491 Ga0207650_10470458 3300025925 Bacteria 1048
492 Ga0207650_11007270 3300025925 Bacteria 709
493 Ga0207659_10342631 3300025926 Bacteria 1238
494 Ga0207659_10348927 3300025926 Bacteria 1227
495 Ga0207659_10444539 3300025926 Bacteria 1091
496 Ga0207687_10215980 3300025927 Bacteria 1507
497 Ga0207687_10230513 3300025927 Bacteria 1463
498 Ga0207687_10762621 3300025927 Bacteria 824
499 Ga0207687_10827763 3300025927 Bacteria 790
500 Ga0207700_10296241 3300025928 Bacteria 1395
501 Ga0207700_10440289 3300025928 Bacteria 1147
502 Ga0207664_10000047 3300025929 Bacteria 139122
503 Ga0207664_10028755 3300025929 Bacteria 4227
504 Ga0207664_10125472 3300025929 Bacteria 2154
505 Ga0207664_10739278 3300025929 Bacteria 885
506 Ga0207644_10097663 3300025931 Bacteria 2200
507 Ga0207644_10268240 3300025931 Bacteria 1367
508 Ga0207644_10401217 3300025931 Bacteria 1121
509 Ga0207690_10011953 3300025932 Bacteria 5190
510 Ga0207690_10150024 3300025932 Bacteria 1727
511 Ga0207690_10178822 3300025932 Bacteria 1596
512 Ga0207690_10397311 3300025932 Bacteria 1099
513 Ga0207706_10020883 3300025933 Bacteria 5880
514 Ga0207706_10352499 3300025933 Bacteria 1279
515 Ga0207706_10517766 3300025933 Bacteria 1029
516 Ga0207686_10868050 3300025934 Bacteria 727
517 Ga0207686_10895839 3300025934 Bacteria 716
518 Ga0207709_10359428 3300025935 Bacteria 1102
519 Ga0207670_10066689 3300025936 Bacteria 2473
520 Ga0207670_10290980 3300025936 Bacteria 1276
521 Ga0207670_10676925 3300025936 Bacteria 852
522 Ga0207669_10130485 3300025937 Bacteria 1726
523 Ga0207669_10434741 3300025937 Bacteria 1036
524 Ga0207669_10471107 3300025937 Bacteria 999
525 Ga0207704_10013410 3300025938 Bacteria 4099
526 Ga0207704_10214671 3300025938 Bacteria 1419
527 Ga0207704_10258523 3300025938 Bacteria 1312
528 Ga0207704_10391223 3300025938 Bacteria 1094
529 Ga0207704_10506687 3300025938 Bacteria 974
530 Ga0207665_10317748 3300025939 Bacteria 1168
531 Ga0207691_10076404 3300025940 Bacteria 3018
532 Ga0207691_10609752 3300025940 Bacteria 924
533 Ga0207691_10731712 3300025940 Bacteria 833
534 Ga0207711_10349909 3300025941 Bacteria 1368
535 Ga0207711_10355511 3300025941 Bacteria 1357
536 Ga0207711_11414084 3300025941 Bacteria 638
537 Ga0207689_10037178 3300025942 Bacteria 4040
538 Ga0207689_10330466 3300025942 Bacteria 1266
539 Ga0207689_10747615 3300025942 Bacteria 825
540 Ga0207661_10004491 3300025944 Bacteria 9781
541 Ga0207661_10009201 3300025944 Bacteria 7079
542 Ga0207661_10028385 3300025944 Bacteria 4284
543 Ga0207661_10115631 3300025944 Bacteria 2276
544 Ga0207661_10123240 3300025944 Bacteria 2210
545 Ga0207661_10291045 3300025944 Bacteria 1462
546 Ga0207661_10486940 3300025944 Bacteria 1126
547 Ga0207679_10523521 3300025945 Bacteria 1061
548 Ga0207679_10930204 3300025945 Bacteria 796
549 Ga0207679_10995966 3300025945 Bacteria 768
550 Ga0207679_11246882 3300025945 Bacteria 682
551 Ga0207667_10028642 3300025949 Bacteria 6048
552 Ga0207667_10137141 3300025949 Bacteria 2519
553 Ga0207667_10437785 3300025949 Bacteria 1329
554 Ga0207667_10473467 3300025949 Bacteria 1272
555 Ga0207651_10645498 3300025960 Bacteria 929
556 Ga0207651_10698226 3300025960 Bacteria 894
557 Ga0207712_10506564 3300025961 Bacteria 1033
558 Ga0207712_10555396 3300025961 Bacteria 988
559 Ga0207668_10000597 3300025972 Bacteria 22455
560 Ga0207668_10409262 3300025972 Bacteria 1149
561 Ga0207668_10825338 3300025972 Bacteria 822
562 Ga0207640_11153974 3300025981 Bacteria 687
563 Ga0207658_10035711 3300025986 Bacteria 3561
564 Ga0207658_10180024 3300025986 Bacteria 1749
565 Ga0207658_10191433 3300025986 Bacteria 1700
566 Ga0207677_11066434 3300026023 Bacteria 735
567 Ga0207703_10036141 3300026035 Bacteria 3929
568 Ga0207703_10051351 3300026035 Bacteria 3341
569 Ga0207703_10169521 3300026035 Bacteria 1919
570 Ga0207703_10784096 3300026035 Bacteria 909
571 Ga0207639_10027963 3300026041 Bacteria 4112
572 Ga0207639_10334899 3300026041 Bacteria 1348
573 Ga0207639_10427644 3300026041 Bacteria 1198
574 Ga0207678_10000523 3300026067 Bacteria 34843
575 Ga0207678_10056907 3300026067 Bacteria 3365
576 Ga0207678_10184000 3300026067 Bacteria 1784
577 Ga0207678_10525207 3300026067 Bacteria 1033
578 Ga0207708_10000079 3300026075 Bacteria 75645
579 Ga0207708_10013463 3300026075 Bacteria 6116
580 Ga0207708_10040962 3300026075 Bacteria 3532
581 Ga0207708_10510073 3300026075 Bacteria 1009
582 Ga0207708_10510218 3300026075 Bacteria 1009
583 Ga0207702_10382876 3300026078 Bacteria 1353
584 Ga0207702_10536486 3300026078 Bacteria 1143
585 Ga0207702_10652121 3300026078 Bacteria 1035
586 Ga0207641_10089828 3300026088 Bacteria 2685
587 Ga0207641_10255119 3300026088 Bacteria 1639
588 Ga0207641_10327985 3300026088 Bacteria 1453
589 Ga0207648_10220586 3300026089 Bacteria 1685
590 Ga0207648_10445173 3300026089 Bacteria 1179
591 Ga0207648_10738490 3300026089 Bacteria 914
592 Ga0207676_10100384 3300026095 Bacteria 2398
593 Ga0207676_10146583 3300026095 Bacteria 2028
594 Ga0207676_10162055 3300026095 Bacteria 1939
595 Ga0207676_10405819 3300026095 Bacteria 1274
596 Ga0207676_11758912 3300026095 Bacteria 618
597 Ga0207674_10001716 3300026116 Bacteria 28034
598 Ga0207674_10076109 3300026116 Bacteria 3365
599 Ga0207674_10157477 3300026116 Bacteria 2226
600 Ga0207674_10211700 3300026116 Bacteria 1887
601 Ga0207674_10283304 3300026116 Bacteria 1605
602 Ga0207674_10384360 3300026116 Bacteria 1357
603 Ga0207674_10522338 3300026116 Bacteria 1147
604 Ga0207674_11228733 3300026116 Bacteria 719
605 Ga0207675_100006593 3300026118 Bacteria 10983
606 Ga0207675_100098146 3300026118 Bacteria 2759
607 Ga0207675_100557654 3300026118 Bacteria 1145
608 Ga0207675_101455614 3300026118 Bacteria 706
609 Ga0207683_10124058 3300026121 Bacteria 2320
610 Ga0207683_10161393 3300026121 Bacteria 2026
611 Ga0207683_10228233 3300026121 Bacteria 1697
612 Ga0207683_10353678 3300026121 Bacteria 1348
613 Ga0207683_10572914 3300026121 Bacteria 1044
614 Ga0207683_10642792 3300026121 Bacteria 983
615 Ga0207683_10924848 3300026121 Bacteria 810
616 Ga0207698_10038668 3300026142 Bacteria 3527
617 Ga0207698_10101287 3300026142 Bacteria 2388
618 Ga0207698_10200205 3300026142 Bacteria 1787
619 Ga0207698_10308285 3300026142 Bacteria 1477
620 Ga0207698_10467452 3300026142 Bacteria 1221
621 Ga0207698_11135470 3300026142 Bacteria 795
622 Ga0209281_1000059 3300027111 Bacteria 295913
623 Ga0209281_1000420 3300027111 Bacteria 63574
624 Ga0209281_1039396 3300027111 Bacteria 802
625 Ga0209813_10028595 3300027866 Bacteria 1627
626 Ga0209813_10078227 3300027866 Bacteria 1088
627 Ga0207428_10032991 3300027907 Bacteria 4256
628 Ga0207428_10050300 3300027907 Bacteria 3335
629 Ga0268266_10001751 3300028379 Bacteria 24833
630 Ga0268266_10007568 3300028379 Bacteria 9782
631 Ga0268266_10129425 3300028379 Bacteria 2256
632 Ga0268266_10461938 3300028379 Bacteria 1208
633 Ga0268266_10587352 3300028379 Bacteria 1069
634 Ga0268266_11240430 3300028379 Bacteria 721
635 Ga0268265_10118282 3300028380 Bacteria 2178
636 Ga0268265_10501577 3300028380 Bacteria 1144
637 Ga0268264_10000206 3300028381 Bacteria 120365
638 Ga0268264_10000242 3300028381 Bacteria 103492
639 Ga0268264_10129696 3300028381 Bacteria 2233
640 Ga0268264_10292870 3300028381 Bacteria 1529
641 Ga0268264_11424082 3300028381 Bacteria 704
642 Ga0265334_10007935 3300028573 Bacteria 4536
643 Ga0307517_10025081 3300028786 Bacteria 7313
644 Ga0307515_10001304 3300028794 Bacteria 56606
645 Ga0307515_10020413 3300028794 Bacteria 11821
646 Ga0265338_10123408 3300028800 Bacteria 2060
647 Ga0307511_10000622 3300030521 Bacteria 37906
648 Ga0307512_10002198 3300030522 Bacteria 25432
649 Ga0307512_10010941 3300030522 Bacteria 8624
650 Ga0314311_1058424 3300030733 Bacteria 1392
651 Ga0265329_10263641 3300031242 Bacteria 577
652 Ga0265316_10154245 3300031344 Bacteria 1719
653 Ga0265316_10295613 3300031344 Bacteria 1181
654 Ga0307513_10006735 3300031456 Bacteria 14994
655 Ga0307513_10153391 3300031456 Bacteria 2208
656 Ga0307509_10092054 3300031507 Bacteria 3101
657 Ga0307508_10000986 3300031616 Bacteria 33078
658 Ga0307508_10008438 3300031616 Bacteria 9515
659 Ga0307508_10325354 3300031616 Bacteria 1129
660 Ga0316575_10000007 3300031665 Bacteria 79369
661 Ga0316575_10004327 3300031665 Bacteria 4992
662 Ga0316575_10253005 3300031665 Bacteria 739
663 Ga0316579_10003811 3300031691 Bacteria 5937
664 Ga0316579_10022204 3300031691 Bacteria 2836
665 Ga0316579_10138496 3300031691 Bacteria 1173
666 Ga0316576_10000924 3300031727 Bacteria 15000
667 Ga0316576_10006868 3300031727 Bacteria 7114
668 Ga0316576_10019948 3300031727 Bacteria 4601
669 Ga0316576_10021671 3300031727 Bacteria 4448
670 Ga0316576_10080388 3300031727 Bacteria 2417
671 Ga0316576_10152837 3300031727 Bacteria 1739
672 Ga0316576_10203535 3300031727 Bacteria 1491
673 Ga0316578_10000847 3300031728 Bacteria 11474
674 Ga0316578_10010985 3300031728 Bacteria 4718
675 Ga0316578_10015874 3300031728 Bacteria 4063
676 Ga0316578_10023055 3300031728 Bacteria 3481
677 Ga0316578_10024402 3300031728 Bacteria 3392
678 Ga0307516_10123037 3300031730 Bacteria 2381
679 Ga0307516_10569667 3300031730 Bacteria 786
680 Ga0307405_10055230 3300031731 Bacteria 2484
681 Ga0307405_10627765 3300031731 Bacteria 880
682 Ga0307405_11078688 3300031731 Bacteria 689
683 Ga0316577_10039457 3300031733 Bacteria 2641
684 Ga0316577_10111481 3300031733 Bacteria 1535
685 Ga0307413_10000247 3300031824 Bacteria 16231
686 Ga0307413_10476573 3300031824 Bacteria 996
687 Ga0307518_10000118 3300031838 Bacteria 55183
688 Ga0307410_10018609 3300031852 Bacteria 4202
689 Ga0307410_10873506 3300031852 Bacteria 769
690 Ga0307410_11052973 3300031852 Bacteria 703
691 Ga0326468_10000081 3300031889 Bacteria 8146
692 Ga0307406_10029929 3300031901 Bacteria 3301
693 Ga0307406_10163516 3300031901 Bacteria 1603
694 Ga0307406_10413473 3300031901 Bacteria 1073
695 Ga0307406_10813959 3300031901 Bacteria 789
696 Ga0307407_10054629 3300031903 Bacteria 2304
697 Ga0307407_10513707 3300031903 Bacteria 880
698 Ga0307409_100025490 3300031995 Bacteria 4149
699 Ga0307409_100084637 3300031995 Bacteria 2576
700 Ga0307409_100163826 3300031995 Bacteria 1948
701 Ga0307409_100564308 3300031995 Bacteria 1120
702 Ga0307409_100604793 3300031995 Bacteria 1084
703 Ga0307409_100909318 3300031995 Bacteria 894
704 Ga0307409_101848587 3300031995 Bacteria 633
705 Ga0307416_100289792 3300032002 Bacteria 1620
706 Ga0307416_100298953 3300032002 Bacteria 1599
707 Ga0307416_100763407 3300032002 Bacteria 1060
708 Ga0307416_100931022 3300032002 Bacteria 970
709 Ga0307416_101317125 3300032002 Bacteria 828
710 Ga0307414_11037519 3300032004 Bacteria 756
711 Ga0307411_10047739 3300032005 Bacteria 2770
712 Ga0307411_10177666 3300032005 Bacteria 1612
713 Ga0307411_11503052 3300032005 Bacteria 619
714 Ga0307415_100012020 3300032126 Bacteria 4987
715 Ga0307415_100069569 3300032126 Bacteria 2469
716 Ga0307415_100251065 3300032126 Bacteria 1437
717 Ga0307415_100637992 3300032126 Bacteria 953
718 Ga0307415_100893650 3300032126 Bacteria 818
719 Ga0307415_101446913 3300032126 Bacteria 656
720 Ga0316583_10015541 3300032133 Bacteria 2739
721 Ga0316585_10043168 3300032137 Bacteria 1439
722 Ga0316585_10063312 3300032137 Bacteria 1196
723 Ga0316580_10112688 3300032139 Bacteria 832
724 Ga0316593_10047141 3300032168 Bacteria 1448
725 Ga0316593_10083840 3300032168 Bacteria 1115
726 Ga0316593_10101654 3300032168 Bacteria 1020
727 Ga0307507_10191123 3300033179 Bacteria 1439
728 Ga0307510_10043746 3300033180 Bacteria 4863
729 Ga0307510_10081325 3300033180 Bacteria 3142
730 Ga0316596_1006263 3300033541 Bacteria 2760
731 Ga0316596_1006402 3300033541 Bacteria 2738
732 Ga0373940_0005689 3300035088 Bacteria 2717
733 Ga0373951_0000004 3300035091 Bacteria 95240
734 Ga0373941_0029477 3300035115 Bacteria 1619
735 Ga0373956_0056473 3300035119 Bacteria 1772
736 Ga0373942_0000016 3300035207 Bacteria 32728
737 Ga0373962_0007303 3300035242 Bacteria 2704
738 Ga0316574_0001558 3300035398 Bacteria 10951
739 Ga0316574_0009181 3300035398 Bacteria 5527
740 Ga0316574_0011597 3300035398 Bacteria 5016
741 Ga0316574_0021015 3300035398 Bacteria 3869
742 Ga0316574_0051177 3300035398 Bacteria 2574
743 Ga0316574_0055665 3300035398 Bacteria 2472
744 Ga0316574_0152423 3300035398 Bacteria 1489
745 Ga0316574_0330071 3300035398 Bacteria 967
746 Ga0373931_0160215 3300035691 Bacteria 1319
747 Ga0373935_0002550 3300035692 Bacteria 10445
748 Ga0373937_0457742 3300036401 Bacteria 1212
749 Ga0316582_0007056 3300036647 Bacteria 5961
750 Ga0316582_0017128 3300036647 Bacteria 4183
751 Ga0316582_0124651 3300036647 Bacteria 1727
752 Ga0316582_0261372 3300036647 Bacteria 1187
753 Ga0316582_0394555 3300036647 Bacteria 953
754 Ga0316584_0002036 3300036712 Bacteria 12660
755 Ga0316584_0026290 3300036712 Bacteria 4278
756 Ga0316584_0056317 3300036712 Bacteria 2943
757 Ga0316584_0085295 3300036712 Bacteria 2365
758 Ga0373925_0793567 3300037068 Bacteria 781
759 Ga0373925_0837215 3300037068 Bacteria 758
760 Ga0395899_0012950 3300037312 Bacteria 6381
761 Ga0395899_0134696 3300037312 Bacteria 1762
762 Ga0395899_0266954 3300037312 Bacteria 1168
763 Ga0395899_0282397 3300037312 Bacteria 1129
764 Ga0395900_0038706 3300037418 Bacteria 4915
765 Ga0395900_0077838 3300037418 Bacteria 3407
766 Ga0395900_0078843 3300037418 Bacteria 3384
767 Ga0395900_0136094 3300037418 Bacteria 2517
768 Ga0395900_0273082 3300037418 Bacteria 1685
769 Ga0395900_0336551 3300037418 Bacteria 1486
770 Ga0395900_0462723 3300037418 Bacteria 1223
771 Ga0395898_0009998 3300037466 Bacteria 9932
772 Ga0395898_0052591 3300037466 Bacteria 3979
773 Ga0395898_0053847 3300037466 Bacteria 3928
774 Ga0395898_0125694 3300037466 Bacteria 2457
775 Ga0395898_0149465 3300037466 Bacteria 2235
776 Ga0395898_0206428 3300037466 Bacteria 1875
777 Ga0395898_0419817 3300037466 Bacteria 1275
778 Ga0395898_0448767 3300037466 Bacteria 1228
779 Ga0395898_0497337 3300037466 Bacteria 1160
780 Ga0395898_0777704 3300037466 Bacteria 898
781 Ga0395898_0852734 3300037466 Bacteria 850
782 Ga0395898_0914131 3300037466 Bacteria 815
783 Ga0395898_1321186 3300037466 Bacteria 650
784 Ga0395905_0012701 3300037471 Bacteria 8101
785 Ga0395905_0390723 3300037471 Bacteria 1286
786 Ga0316581_0063334 3300037588 Bacteria 1135
787 Ga0436364_0080666 3300037853 Bacteria 47494
788 Ga0436364_0137134 3300037853 Bacteria 3521
789 Ga0436364_0627922 3300037853 Bacteria 1166
790 Ga0436364_1022766 3300037853 Bacteria 78417
791 Ga0436364_1049772 3300037853 Bacteria 1370
792 Ga0436364_1394950 3300037853 Bacteria 1299
793 Ga0395901_0068803 3300038443 Bacteria 3688
794 Ga0395901_0071769 3300038443 Bacteria 3609
795 Ga0395901_0104322 3300038443 Bacteria 2975
796 Ga0395901_0192244 3300038443 Bacteria 2140
797 Ga0395901_0243234 3300038443 Bacteria 1876
798 Ga0395901_0386155 3300038443 Bacteria 1440
799 Ga0395901_0577244 3300038443 Bacteria 1136
800 Ga0242420_060471 3300038996 Bacteria 755
801 Ga0400483_180869 3300039062 Bacteria 1325
802 Ga0400489_28232 3300039093 Bacteria 1162
803 Ga0436365_0901407 3300039437 Bacteria 1281
804 Ga0436362_0306738 3300039453 Bacteria 2049
805 Ga0436362_0812882 3300039453 Bacteria 26487
806 Ga0439436_0044236 3300041404 Bacteria 1269
807 Ga0439447_024330 3300041407 Bacteria 1569
808 Ga0439465_0052509 3300041413 Bacteria 1338
809 Ga0451787_377975 3300041441 Bacteria 728
810 Ga0451791_1411455 3300041451 Bacteria 1681
811 Ga0451793_1545661 3300041452 Bacteria 1392
812 Ga0451793_1664778 3300041452 Bacteria 1408
813 Ga0451797_0028926 3300041453 Bacteria 909
814 Ga0451795_0232519 3300041456 Bacteria 870
815 Ga0451798_0836924 3300041458 Bacteria 727
816 Ga0451800_0033403 3300041459 Bacteria 837
817 Ga0451833_0792302 3300041491 Bacteria 863
818 Ga0451837_0625810 3300041494 Bacteria 1694
819 Ga0451837_1708515 3300041494 Bacteria 1154
820 Ga0451837_1753042 3300041494 Bacteria 661
821 Ga0451847_0450451 3300041503 Bacteria 834
822 Ga0451849_0090656 3300041505 Bacteria 737
823 Ga0451843_0361191 3300041509 Bacteria 2140
824 Ga0451843_1613533 3300041509 Bacteria 846
825 Ga0451853_1725959 3300041512 Bacteria 1703
826 Ga0451853_2569345 3300041512 Bacteria 1323
827 Ga0450907_013349 3300042146 Bacteria 1368
828 Ga0439446_0070043 3300042156 Bacteria 1071
829 Ga0450908_014888 3300042184 Bacteria 1395
830 Ga0439434_0003171 3300042435 Bacteria 4830
831 Ga0439434_0153358 3300042435 Bacteria 764
832 Ga0451577_0449162 3300042876 Bacteria 1171
833 Ga0466969_0021281 3300044656 Bacteria 3354
834 Ga0466972_0019445 3300044658 Bacteria 3395
835 Ga0466972_0063472 3300044658 Bacteria 1769
836 Ga0466972_0085237 3300044658 Bacteria 1502
837 Ga0466965_0018835 3300044683 Bacteria 3312
838 Ga0466965_0057761 3300044683 Bacteria 1934
839 Ga0466965_0076284 3300044683 Bacteria 1691
840 Ga0466965_0147481 3300044683 Bacteria 1228
841 Ga0466965_0151038 3300044683 Bacteria 1214
842 Ga0466965_0339895 3300044683 Bacteria 821
843 Ga0466965_0387016 3300044683 Bacteria 771
844 Ga0466965_0530697 3300044683 Bacteria 663
845 Ga0466966_0014054 3300044684 Bacteria 5300
846 Ga0466966_0050102 3300044684 Bacteria 2657
847 Ga0466966_0054227 3300044684 Bacteria 2541
848 Ga0466966_0066424 3300044684 Bacteria 2267
849 Ga0466966_0082004 3300044684 Bacteria 2007
850 Ga0466966_0099549 3300044684 Bacteria 1799
851 Ga0466966_0122295 3300044684 Bacteria 1598
852 Ga0466966_0126542 3300044684 Bacteria 1567
853 Ga0466966_0182261 3300044684 Bacteria 1274
854 Ga0466966_0279087 3300044684 Bacteria 1005
855 Ga0466961_0007878 3300044693 Bacteria 6785
856 Ga0466961_0011228 3300044693 Bacteria 5726
857 Ga0466961_0048947 3300044693 Bacteria 2702
858 Ga0466961_0094509 3300044693 Bacteria 1886
859 Ga0466961_0112809 3300044693 Bacteria 1709
860 Ga0466961_0211703 3300044693 Bacteria 1196
861 Ga0466963_0061308 3300044694 Bacteria 2514
862 Ga0466963_0072668 3300044694 Bacteria 2317
863 Ga0466963_0095941 3300044694 Bacteria 2025
864 Ga0466963_0145586 3300044694 Bacteria 1643
865 Ga0466963_0190610 3300044694 Bacteria 1432
866 Ga0466963_0192218 3300044694 Bacteria 1426
867 Ga0466963_0337801 3300044694 Bacteria 1060
868 Ga0466963_0371587 3300044694 Bacteria 1007
869 Ga0466963_0376306 3300044694 Bacteria 1001
870 Ga0466964_0007124 3300044706 Bacteria 4181
871 Ga0466964_0008788 3300044706 Bacteria 3797
872 Ga0466964_0022666 3300044706 Bacteria 2438
873 Ga0466964_0060508 3300044706 Bacteria 1575
874 Ga0466964_0110209 3300044706 Bacteria 1226
875 Ga0466964_0472335 3300044706 Bacteria 669
876 Ga0453684_0135561 3300044712 Bacteria 2948
877 Ga0466971_0003697 3300044719 Bacteria 6541
878 Ga0466971_0015494 3300044719 Bacteria 3356
879 Ga0466971_0016810 3300044719 Bacteria 3232
880 Ga0466971_0413739 3300044719 Bacteria 658
881 Ga0466968_0002184 3300044735 Bacteria 7140
882 Ga0466968_0056596 3300044735 Bacteria 1685
883 Ga0466968_0216934 3300044735 Bacteria 900
884 Ga0466970_0029005 3300044765 Bacteria 2911
885 Ga0466970_0034202 3300044765 Bacteria 2689
886 Ga0466970_0047773 3300044765 Bacteria 2281
887 Ga0466970_0064300 3300044765 Bacteria 1967
888 Ga0466970_0067318 3300044765 Bacteria 1923
889 Ga0466970_0106065 3300044765 Bacteria 1532
890 Ga0466970_0126555 3300044765 Bacteria 1401
891 Ga0466970_0137707 3300044765 Bacteria 1343
892 Ga0466970_0217235 3300044765 Bacteria 1066
893 Ga0466970_0219028 3300044765 Bacteria 1062
894 Ga0466970_0242430 3300044765 Bacteria 1009
895 Ga0466970_0275576 3300044765 Bacteria 945
896 Ga0466970_0710362 3300044765 Bacteria 586
897 Ga0466970_0790533 3300044765 Bacteria 555
898 Ga0466957_0008751 3300044842 Bacteria 5761
899 Ga0466957_0020399 3300044842 Bacteria 3899
900 Ga0466957_0192294 3300044842 Bacteria 1337
901 Ga0466957_0342809 3300044842 Bacteria 1012
902 Ga0466960_0005943 3300044901 Bacteria 4868
903 Ga0466960_0015763 3300044901 Bacteria 3265
904 Ga0466960_0048446 3300044901 Bacteria 2042
905 Ga0466960_0053519 3300044901 Bacteria 1956
906 Ga0466960_0071805 3300044901 Bacteria 1724
907 Ga0466960_0100167 3300044901 Bacteria 1491
908 Ga0466960_0201598 3300044901 Bacteria 1087
909 Ga0466960_0450161 3300044901 Bacteria 748
910 Ga0466960_0455075 3300044901 Bacteria 744
911 Ga0466959_0065780 3300045049 Bacteria 2631
912 Ga0466959_0101880 3300045049 Bacteria 2055
913 Ga0466959_0160452 3300045049 Bacteria 1581
914 Ga0466959_0209959 3300045049 Bacteria 1353
915 Ga0466959_0478407 3300045049 Bacteria 843
916 Ga0466959_0749684 3300045049 Bacteria 653
917 Ga0466959_0821819 3300045049 Bacteria 621
918 Ga0451576_0078337 3300045051 Bacteria 3440
919 Ga0466958_0011282 3300045836 Bacteria 5031
920 Ga0466958_0015072 3300045836 Bacteria 4423
921 Ga0466958_0094333 3300045836 Bacteria 1854
922 Ga0466958_0148430 3300045836 Bacteria 1478
923 Ga0466967_0003568 3300045976 Bacteria 10202
924 Ga0466967_0005409 3300045976 Bacteria 8845
925 Ga0466967_0012807 3300045976 Bacteria 6443
926 Ga0466967_0017900 3300045976 Bacteria 5645
927 Ga0466967_0040650 3300045976 Bacteria 4005
928 Ga0466967_0070979 3300045976 Bacteria 3117
929 Ga0466967_0124421 3300045976 Bacteria 2387
930 Ga0466967_0210814 3300045976 Bacteria 1842
931 Ga0466967_0274753 3300045976 Bacteria 1615
932 Ga0466967_0318478 3300045976 Bacteria 1499
933 Ga0466967_0344713 3300045976 Bacteria 1441
934 Ga0466967_0356546 3300045976 Bacteria 1416
935 Ga0466967_0366372 3300045976 Bacteria 1397
936 Ga0466967_0484231 3300045976 Bacteria 1212
937 Ga0466967_0518826 3300045976 Bacteria 1171
938 Ga0466967_0669662 3300045976 Bacteria 1027
939 Ga0466967_0702254 3300045976 Bacteria 1002
940 Ga0466967_0840288 3300045976 Bacteria 912
941 Ga0466967_1313871 3300045976 Bacteria 720
942 Ga0495603_0285320 3300046455 Bacteria 949
943 Ga0495591_034952 3300046458 Bacteria 1475
944 Ga0495638_0167684 3300046460 Bacteria 1262
945 Ga0495638_0362642 3300046460 Bacteria 762
946 Ga0495641_0180517 3300046461 Bacteria 945
947 Ga0495641_0188925 3300046461 Bacteria 923
948 Ga0495653_0438095 3300046463 Bacteria 824
949 Ga0495582_0117253 3300046473 Bacteria 1498
950 Ga0495610_0253650 3300046512 Bacteria 696
951 Ga0495620_0041632 3300046515 Bacteria 2013
952 Ga0495620_0062145 3300046515 Bacteria 1552
953 Ga0495620_0143780 3300046515 Bacteria 932
954 Ga0495628_0374403 3300046516 Bacteria 1044
955 Ga0495632_0024817 3300046519 Bacteria 3179
956 Ga0495643_0327822 3300046522 Bacteria 691
957 Ga0495652_0311245 3300046529 Bacteria 1141
958 Ga0495654_0017136 3300046530 Bacteria 3814
959 Ga0495640_0361636 3300046533 Bacteria 895
960 Ga0495657_0389247 3300046675 Bacteria 822
961 Ga0495658_0165255 3300046683 Bacteria 1367
962 Ga0495658_0769110 3300046683 Bacteria 617
963 Ga0495671_0505211 3300046692 Bacteria 577
964 Ga0495649_0175137 3300046694 Bacteria 1121
965 Ga0495581_0259901 3300047315 Bacteria 1015
966 Ga0495674_0489441 3300047319 Bacteria 985
967 Ga0495672_0002387 3300047320 Bacteria 17349
968 Ga0495676_0205561 3300047321 Bacteria 1366
969 Ga0495602_0714098 3300048088 Bacteria 679
970 Ga0496100_0031907 3300048903 Bacteria 3279
971 Ga0496100_0041042 3300048903 Bacteria 2947
972 Ga0496100_0244469 3300048903 Bacteria 1325
973 Ga0496100_0402301 3300048903 Bacteria 1043
974 Ga0496100_1366991 3300048903 Bacteria 559
975 Ga0496101_0201491 3300048904 Bacteria 1539
976 Ga0496101_0220649 3300048904 Bacteria 1471
977 Ga0496101_0476207 3300048904 Bacteria 986
978 Ga0496101_0500546 3300048904 Bacteria 960
979 Ga0496101_1104846 3300048904 Bacteria 622
980 Ga0496102_0010787 3300048905 Bacteria 7869
981 Ga0496102_0020875 3300048905 Bacteria 5789
982 Ga0496102_0048158 3300048905 Bacteria 3875
983 Ga0496102_0232896 3300048905 Bacteria 1736
984 Ga0496102_0710582 3300048905 Bacteria 928
985 Ga0496102_0784897 3300048905 Bacteria 875
986 Ga0496103_0031373 3300048906 Bacteria 3237
987 Ga0496103_0135482 3300048906 Bacteria 1574
988 Ga0496103_0300100 3300048906 Bacteria 1033
989 Ga0496104_0003968 3300048907 Bacteria 12807
990 Ga0496104_0322817 3300048907 Bacteria 1457
991 Ga0496104_0371784 3300048907 Bacteria 1342
992 Ga0496104_1013242 3300048907 Bacteria 734
993 Ga0496105_0034871 3300048908 Bacteria 4140
994 Ga0496105_0214530 3300048908 Bacteria 1568
995 Ga0496105_0236394 3300048908 Bacteria 1484
996 Ga0496105_0397683 3300048908 Bacteria 1094
997 Ga0496105_0571702 3300048908 Bacteria 880
998 Ga0496105_0714554 3300048908 Bacteria 768
999 Ga0496106_0005256 3300048909 Bacteria 9594
1000 Ga0496106_0085284 3300048909 Bacteria 2432
1001 Ga0496106_0214568 3300048909 Bacteria 1534
1002 Ga0496107_0033655 3300048910 Bacteria 3668
1003 Ga0496107_0068600 3300048910 Bacteria 2573
1004 Ga0496107_0237785 3300048910 Bacteria 1355
1005 Ga0496107_0260980 3300048910 Bacteria 1289
1006 Ga0496108_0000613 3300048911 Bacteria 27954
1007 Ga0496108_0075928 3300048911 Bacteria 2840
1008 Ga0496108_0122461 3300048911 Bacteria 2231
1009 Ga0496108_0138501 3300048911 Bacteria 2096
1010 Ga0496108_0164702 3300048911 Bacteria 1917
1011 Ga0496108_0165443 3300048911 Bacteria 1912
1012 Ga0496108_0242846 3300048911 Bacteria 1566
1013 Ga0496108_0316807 3300048911 Bacteria 1360
1014 Ga0496108_0411259 3300048911 Bacteria 1181
1015 Ga0496109_0022687 3300048912 Bacteria 5560
1016 Ga0496109_0037024 3300048912 Bacteria 4407
1017 Ga0496109_0056118 3300048912 Bacteria 3594
1018 Ga0496109_0104460 3300048912 Bacteria 2630
1019 Ga0496109_0426773 3300048912 Bacteria 1252
1020 Ga0496109_0619268 3300048912 Bacteria 1019
1021 Ga0496109_0739406 3300048912 Bacteria 921
1022 Ga0496110_0004744 3300048913 Bacteria 10581
1023 Ga0496110_0106140 3300048913 Bacteria 2520
1024 Ga0496110_0310406 3300048913 Bacteria 1436
1025 Ga0496110_0313688 3300048913 Bacteria 1428
1026 Ga0496110_0406906 3300048913 Bacteria 1240
1027 Ga0496110_0424569 3300048913 Bacteria 1212
1028 Ga0496110_0460576 3300048913 Bacteria 1159
1029 Ga0496110_0523794 3300048913 Bacteria 1078
1030 Ga0496110_0584076 3300048913 Bacteria 1014
1031 Ga0496111_0002165 3300048914 Bacteria 11764
1032 Ga0496111_0059883 3300048914 Bacteria 2759
1033 Ga0496111_0062761 3300048914 Bacteria 2694
1034 Ga0496111_0104152 3300048914 Bacteria 2087
1035 Ga0496111_0386255 3300048914 Bacteria 1035
1036 Ga0496112_0170027 3300048915 Bacteria 2145
1037 Ga0496112_0245759 3300048915 Bacteria 1741
1038 Ga0496112_0268534 3300048915 Bacteria 1654
1039 Ga0496112_0446387 3300048915 Bacteria 1231
1040 Ga0496112_1084025 3300048915 Bacteria 719
1041 Ga0496113_0024790 3300048916 Bacteria 4269
1042 Ga0496113_0171879 3300048916 Bacteria 1716
1043 Ga0496113_0245176 3300048916 Bacteria 1430
1044 Ga0496113_0317635 3300048916 Bacteria 1248
1045 Ga0496113_0397949 3300048916 Bacteria 1106
1046 Ga0496113_0721055 3300048916 Bacteria 795
1047 Ga0496114_0005860 3300048917 Bacteria 9651
1048 Ga0496114_0039311 3300048917 Bacteria 3914
1049 Ga0496114_0056947 3300048917 Bacteria 3263
1050 Ga0496114_0158228 3300048917 Bacteria 1968
1051 Ga0496114_0175911 3300048917 Bacteria 1867
1052 Ga0496114_0191105 3300048917 Bacteria 1791
1053 Ga0496114_0275360 3300048917 Bacteria 1483
1054 Ga0496114_0520071 3300048917 Bacteria 1052
1055 Ga0496114_0692920 3300048917 Bacteria 894
1056 Ga0496114_0762489 3300048917 Bacteria 845
1057 Ga0496115_0004879 3300048918 Bacteria 9736
1058 Ga0496115_0028842 3300048918 Bacteria 4353
1059 Ga0496115_0547118 3300048918 Bacteria 926
1060 Ga0496115_0745479 3300048918 Bacteria 766
1061 Ga0496116_0003599 3300048919 Bacteria 15237
1062 Ga0496116_0030057 3300048919 Bacteria 3908
1063 Ga0496117_0000336 3300048920 Bacteria 82888
1064 Ga0496118_0035069 3300048921 Bacteria 4081
1065 Ga0496119_0000036 3300048922 Bacteria 212109
1066 Ga0496119_0199761 3300048922 Bacteria 1035
1067 Ga0496119_0288374 3300048922 Bacteria 813
1068 Ga0496120_0000020 3300048923 Bacteria 259925
1069 Ga0496120_0000058 3300048923 Bacteria 176944
1070 Ga0496120_0027353 3300048923 Bacteria 3510
1071 Ga0496120_0032029 3300048923 Bacteria 3175
1072 Ga0496122_0000011 3300048925 Bacteria 545274
1073 Ga0496122_0000143 3300048925 Bacteria 168086
1074 Ga0496122_0001746 3300048925 Bacteria 33567
1075 Ga0496122_0073701 3300048925 Bacteria 2419
1076 Ga0496122_0100735 3300048925 Bacteria 1932
1077 Ga0496123_0000629 3300048926 Bacteria 59000
1078 Ga0496123_0004229 3300048926 Bacteria 15309
1079 Ga0496123_0043590 3300048926 Bacteria 3079
1080 Ga0496124_0207769 3300048927 Bacteria 1484
1081 Ga0496124_0468492 3300048927 Bacteria 854
1082 Ga0496125_0000004 3300048928 Bacteria 843089
1083 Ga0496125_0196952 3300048928 Bacteria 1324
1084 Ga0496126_0000002 3300048929 Bacteria 1001703
1085 Ga0496126_0000171 3300048929 Bacteria 148394
1086 Ga0496126_0000190 3300048929 Bacteria 137687
1087 Ga0496126_0001392 3300048929 Bacteria 38279
1088 Ga0496126_0013317 3300048929 Bacteria 8375
1089 Ga0496126_0144272 3300048929 Bacteria 2047
1090 Ga0501307_014333 3300049162 Bacteria 967
1091 Ga0501311_013934 3300049527 Bacteria 1021
1092 Ga0501311_037643 3300049527 Bacteria 723
1093 Ga0501313_036081 3300049529 Bacteria 654
1094 Ga0501316_009947 3300049532 Bacteria 1076
1095 Ga0501317_019743 3300049533 Bacteria 903
1096 Ga0501321_033306 3300049537 Bacteria 698
1097 Ga0501325_007861 3300049541 Bacteria 913
1098 Ga0501031_0102494 3300049568 Bacteria 1867
1099 Ga0501031_0330207 3300049568 Bacteria 987
1100 Ga0501031_0433463 3300049568 Bacteria 849
1101 Ga0501032_0003214 3300049569 Bacteria 12563
1102 Ga0501032_0017506 3300049569 Bacteria 5031
1103 Ga0501032_0172242 3300049569 Bacteria 1419
1104 Ga0501032_0194335 3300049569 Bacteria 1326
1105 Ga0501032_0248127 3300049569 Bacteria 1156
1106 Ga0501033_0003357 3300049570 Bacteria 13212
1107 Ga0501033_0058505 3300049570 Bacteria 2847
1108 Ga0501033_0088543 3300049570 Bacteria 2265
1109 Ga0501033_0101778 3300049570 Bacteria 2096
1110 Ga0501033_0238310 3300049570 Bacteria 1291
1111 Ga0501033_0505017 3300049570 Bacteria 836
1112 Ga0501033_0610207 3300049570 Bacteria 748
1113 Ga0501034_0012389 3300049571 Bacteria 8808
1114 Ga0501034_0016472 3300049571 Bacteria 7586
1115 Ga0501034_0089184 3300049571 Bacteria 3082
1116 Ga0501034_0123667 3300049571 Bacteria 2573
1117 Ga0501034_0518674 3300049571 Bacteria 1104
1118 Ga0501034_0767022 3300049571 Bacteria 859
1119 Ga0501036_0003988 3300049572 Bacteria 11863
1120 Ga0501036_0005800 3300049572 Bacteria 10007
1121 Ga0501036_0012810 3300049572 Bacteria 6957
1122 Ga0501036_0013945 3300049572 Bacteria 6684
1123 Ga0501036_0054602 3300049572 Bacteria 3384
1124 Ga0501036_0061660 3300049572 Bacteria 3176
1125 Ga0501036_0257750 3300049572 Bacteria 1461
1126 Ga0501036_0588375 3300049572 Bacteria 924
1127 Ga0501036_0611847 3300049572 Bacteria 903
1128 Ga0501037_0010219 3300049573 Bacteria 6886
1129 Ga0501037_0028153 3300049573 Bacteria 4151
1130 Ga0501037_0040461 3300049573 Bacteria 3430
1131 Ga0501037_0390543 3300049573 Bacteria 955
1132 Ga0501037_0429767 3300049573 Bacteria 903
1133 Ga0501037_0678318 3300049573 Bacteria 687
1134 Ga0501038_0000864 3300049574 Bacteria 26869
1135 Ga0501038_0006843 3300049574 Bacteria 10531
1136 Ga0501038_0011612 3300049574 Bacteria 8035
1137 Ga0501038_0030042 3300049574 Bacteria 4811
1138 Ga0501038_0037830 3300049574 Bacteria 4229
1139 Ga0501038_0069746 3300049574 Bacteria 2985
1140 Ga0501038_1191463 3300049574 Bacteria 553
1141 Ga0501039_0007694 3300049575 Bacteria 8226
1142 Ga0501039_0014673 3300049575 Bacteria 5994
1143 Ga0501039_0015970 3300049575 Bacteria 5749
1144 Ga0501039_0064427 3300049575 Bacteria 2841
1145 Ga0501039_0073757 3300049575 Bacteria 2651
1146 Ga0501039_0120818 3300049575 Bacteria 2053
1147 Ga0501039_0145977 3300049575 Bacteria 1859
1148 Ga0501039_0281088 3300049575 Bacteria 1308
1149 Ga0501039_0323408 3300049575 Bacteria 1212
1150 Ga0501040_0034142 3300049576 Bacteria 3446
1151 Ga0501040_0112194 3300049576 Bacteria 1907
1152 Ga0501041_0005290 3300049577 Bacteria 7546
1153 Ga0501041_0154409 3300049577 Bacteria 1434
1154 Ga0501041_0238582 3300049577 Bacteria 1142
1155 Ga0501041_0703909 3300049577 Bacteria 646
1156 Ga0501042_0014432 3300049578 Bacteria 5393
1157 Ga0501042_0016724 3300049578 Bacteria 5042
1158 Ga0501042_0062787 3300049578 Bacteria 2654
1159 Ga0501042_0067894 3300049578 Bacteria 2549
1160 Ga0501042_0100534 3300049578 Bacteria 2079
1161 Ga0501042_0340998 3300049578 Bacteria 1083
1162 Ga0501043_0004811 3300049579 Bacteria 10930
1163 Ga0501043_0042257 3300049579 Bacteria 3582
1164 Ga0501043_0058990 3300049579 Bacteria 3011
1165 Ga0501043_0224472 3300049579 Bacteria 1452
1166 Ga0501043_0358383 3300049579 Bacteria 1107
1167 Ga0501046_0000184 3300049580 Bacteria 63497
1168 Ga0501046_0004617 3300049580 Bacteria 12443
1169 Ga0501046_0006246 3300049580 Bacteria 10577
1170 Ga0501046_0091598 3300049580 Bacteria 2338
1171 Ga0501046_0195025 3300049580 Bacteria 1509
1172 Ga0501047_0021831 3300049581 Bacteria 6147
1173 Ga0501047_0057617 3300049581 Bacteria 3756
1174 Ga0501047_0079450 3300049581 Bacteria 3154
1175 Ga0501047_0132208 3300049581 Bacteria 2375
1176 Ga0501047_0134926 3300049581 Bacteria 2348
1177 Ga0501047_0496096 3300049581 Bacteria 1048
1178 Ga0501048_0024509 3300049582 Bacteria 4403
1179 Ga0501048_0033844 3300049582 Bacteria 3690
1180 Ga0501048_0099412 3300049582 Bacteria 2052
1181 Ga0501048_0391346 3300049582 Bacteria 993
1182 Ga0501067_0000461 3300049583 Bacteria 22155
1183 Ga0501067_0001018 3300049583 Bacteria 15074
1184 Ga0501067_0001635 3300049583 Bacteria 12307
1185 Ga0501067_0027893 3300049583 Bacteria 3129
1186 Ga0501067_0034472 3300049583 Bacteria 2809
1187 Ga0501067_0073593 3300049583 Bacteria 1893
1188 Ga0501067_0434517 3300049583 Bacteria 733
1189 Ga0501068_0001742 3300049584 Bacteria 11572
1190 Ga0501068_0001917 3300049584 Bacteria 11062
1191 Ga0501068_0044007 3300049584 Bacteria 2687
1192 Ga0501068_0069927 3300049584 Bacteria 2141
1193 Ga0501068_0148853 3300049584 Bacteria 1470
1194 Ga0501068_0178277 3300049584 Bacteria 1343
1195 Ga0501068_0250953 3300049584 Bacteria 1128
1196 Ga0501069_0020666 3300049585 Bacteria 3568
1197 Ga0501069_0061013 3300049585 Bacteria 2105
1198 Ga0501069_0109083 3300049585 Bacteria 1575
1199 Ga0501069_0381276 3300049585 Bacteria 833
1200 Ga0501070_0001031 3300049586 Bacteria 25041
1201 Ga0501070_0001455 3300049586 Bacteria 21188
1202 Ga0501070_0001739 3300049586 Bacteria 19256
1203 Ga0501070_0023464 3300049586 Bacteria 5167
1204 Ga0501070_0029069 3300049586 Bacteria 4635
1205 Ga0501070_0049113 3300049586 Bacteria 3504
1206 Ga0501070_0058424 3300049586 Bacteria 3197
1207 Ga0501070_0125781 3300049586 Bacteria 2118
1208 Ga0501070_0161322 3300049586 Bacteria 1848
1209 Ga0501070_0501239 3300049586 Bacteria 975
1210 Ga0501071_0005032 3300049587 Bacteria 8452
1211 Ga0501071_0011824 3300049587 Bacteria 5891
1212 Ga0501071_0101472 3300049587 Bacteria 2121
1213 Ga0501071_0190442 3300049587 Bacteria 1538
1214 Ga0501071_0395694 3300049587 Bacteria 1055
1215 Ga0501072_0002112 3300049588 Bacteria 14811
1216 Ga0501072_0006559 3300049588 Bacteria 8861
1217 Ga0501072_0007372 3300049588 Bacteria 8344
1218 Ga0501072_0136997 3300049588 Bacteria 1952
1219 Ga0501072_0144978 3300049588 Bacteria 1893
1220 Ga0501072_0161017 3300049588 Bacteria 1790
1221 Ga0501072_0196835 3300049588 Bacteria 1607
1222 Ga0501072_0204478 3300049588 Bacteria 1574
1223 Ga0501073_0003609 3300049589 Bacteria 11634
1224 Ga0501073_0003614 3300049589 Bacteria 11629
1225 Ga0501073_0036440 3300049589 Bacteria 3495
1226 Ga0501073_0103600 3300049589 Bacteria 1975
1227 Ga0501073_0120884 3300049589 Bacteria 1815
1228 Ga0501074_0001017 3300049590 Bacteria 18243
1229 Ga0501074_0001632 3300049590 Bacteria 15208
1230 Ga0501074_0005637 3300049590 Bacteria 9017
1231 Ga0501074_0047572 3300049590 Bacteria 3100
1232 Ga0501074_0145571 3300049590 Bacteria 1694
1233 Ga0501074_0152295 3300049590 Bacteria 1653
1234 Ga0501074_0191414 3300049590 Bacteria 1458
1235 Ga0501074_0419878 3300049590 Bacteria 949
1236 Ga0501075_0259055 3300049591 Bacteria 1326
1237 Ga0501075_0353985 3300049591 Bacteria 1119
1238 Ga0501075_0538764 3300049591 Bacteria 891
1239 Ga0501075_0589073 3300049591 Bacteria 848
1240 Ga0501075_0794086 3300049591 Bacteria 720
1241 Ga0501076_0000415 3300049592 Bacteria 26782
1242 Ga0501076_0030665 3300049592 Bacteria 4189
1243 Ga0501076_0043320 3300049592 Bacteria 3545
1244 Ga0501076_0071733 3300049592 Bacteria 2771
1245 Ga0501076_0278885 3300049592 Bacteria 1369
1246 Ga0501076_0803567 3300049592 Bacteria 776
1247 Ga0501077_0003022 3300049593 Bacteria 10084
1248 Ga0501077_0025215 3300049593 Bacteria 3777
1249 Ga0501077_0036023 3300049593 Bacteria 3151
1250 Ga0501077_0057543 3300049593 Bacteria 2468
1251 Ga0501077_0297006 3300049593 Bacteria 1029
1252 Ga0501208_026952 3300049655 Bacteria 989
1253 Ga0501225_0039936 3300049705 Bacteria 1293
1254 Ga0501079_0000566 3300049741 Bacteria 24352
1255 Ga0501079_0023792 3300049741 Bacteria 4700
1256 Ga0501079_0075822 3300049741 Bacteria 2601
1257 Ga0501080_0006051 3300049742 Bacteria 10847
1258 Ga0501080_0015715 3300049742 Bacteria 6980
1259 Ga0501080_0046788 3300049742 Bacteria 4027
1260 Ga0501080_0052200 3300049742 Bacteria 3805
1261 Ga0501080_0126967 3300049742 Bacteria 2362
1262 Ga0501080_0291213 3300049742 Bacteria 1482
1263 Ga0501081_0007311 3300049743 Bacteria 7171
1264 Ga0501081_0033526 3300049743 Bacteria 3490
1265 Ga0501081_0322440 3300049743 Bacteria 1136
1266 Ga0501081_0755919 3300049743 Bacteria 731
1267 Ga0501081_0788843 3300049743 Bacteria 715
1268 Ga0501083_0086481 3300049744 Bacteria 2073
1269 Ga0501035_0001566 3300049822 Bacteria 23270
1270 Ga0501035_0058132 3300049822 Bacteria 3447
1271 Ga0501035_0065902 3300049822 Bacteria 3214
1272 Ga0501035_0099200 3300049822 Bacteria 2557
1273 Ga0501035_0175592 3300049822 Bacteria 1848
1274 Ga0501035_0322368 3300049822 Bacteria 1298
1275 Ga0501044_0011917 3300049823 Bacteria 9421
1276 Ga0501044_0020750 3300049823 Bacteria 7013
1277 Ga0501044_0078049 3300049823 Bacteria 3356
1278 Ga0501044_0086636 3300049823 Bacteria 3163
1279 Ga0501044_0124592 3300049823 Bacteria 2575
1280 Ga0501044_0474311 3300049823 Bacteria 1155
1281 Ga0501044_1466643 3300049823 Bacteria 547
1282 Ga0501045_0000293 3300049824 Bacteria 29261
1283 Ga0501045_0028523 3300049824 Bacteria 4027
1284 Ga0501045_0057095 3300049824 Bacteria 2856
1285 Ga0501045_0252230 3300049824 Bacteria 1313
1286 Ga0501045_0317944 3300049824 Bacteria 1158
1287 Ga0501212_013754 3300049851 Bacteria 1191
1288 nmdc:mga03683_195812_c1 3300050489 Bacteria 926
1289 nmdc:mga03683_270669_c1 3300050489 Bacteria 792
1290 nmdc:mga03683_32256_c1 3300050489 Bacteria 2107
1291 nmdc:mga03n38_45567_c1 3300050490 Bacteria 1932
1292 nmdc:mga03n38_458984_c1 3300050490 Bacteria 710
1293 nmdc:mga00v17_15733_c1 3300050491 Bacteria 4252
1294 nmdc:mga00v17_257830_c1 3300050491 Bacteria 1131
1295 nmdc:mga00v17_299355_c1 3300050491 Bacteria 1045
1296 nmdc:mga00v17_349589_c1 3300050491 Bacteria 961
1297 nmdc:mga00v17_419978_c1 3300050491 Bacteria 869
1298 nmdc:mga00v17_54712_c1 3300050491 Bacteria 2435
1299 nmdc:mga00v17_791720_c1 3300050491 Bacteria 604
1300 nmdc:mga00v17_81024_c1 3300050491 Bacteria 2027
1301 nmdc:mga00v17_81537_c1 3300050491 Bacteria 2021
1302 nmdc:mga00v17_9684_c1 3300050491 Bacteria 5227
1303 nmdc:mga0yw44_109982_c1 3300050492 Bacteria 1765
1304 nmdc:mga0yw44_242251_c1 3300050492 Bacteria 1199
1305 nmdc:mga0yw44_301251_c1 3300050492 Bacteria 1074
1306 nmdc:mga0yw44_36854_c1 3300050492 Bacteria 2885
1307 nmdc:mga0yw44_459492_c1 3300050492 Bacteria 863
1308 nmdc:mga0yw44_5319_c1 3300050492 Bacteria 6055
1309 nmdc:mga0yw44_54651_c1 3300050492 Bacteria 2428
1310 nmdc:mga0yw44_630921_c1 3300050492 Bacteria 728
1311 nmdc:mga0yw44_651134_c1 3300050492 Bacteria 716
1312 nmdc:mga0yw44_682783_c1 3300050492 Bacteria 698
1313 nmdc:mga0yw44_80156_c1 3300050492 Bacteria 2044
1314 nmdc:mga0yw44_90654_c1 3300050492 Bacteria 1932
1315 nmdc:mga0yw44_9901_c1 3300050492 Bacteria 4844
1316 nmdc:mga06z11_139870_c1 3300050494 Bacteria 1368
1317 nmdc:mga06z11_5409_c1 3300050494 Bacteria 5119
1318 nmdc:mga04h51_33975_c1 3300050495 Bacteria 1627
1319 nmdc:mga07m45_15705_c1 3300050496 Bacteria 4045
1320 nmdc:mga07m45_542540_c1 3300050496 Bacteria 673
1321 nmdc:mga07m45_72821_c1 3300050496 Bacteria 1956
1322 nmdc:mga07m45_8666_c1 3300050496 Bacteria 5238
1323 nmdc:mga05p37_1355_c1 3300050507 Bacteria 28485
1324 nmdc:mga05p37_140187_c1 3300050507 Bacteria 2963
1325 nmdc:mga09592_1246_c1 3300050508 Bacteria 20413
1326 nmdc:mga09592_84439_c1 3300050508 Bacteria 2707
1327 nmdc:mga0qj67_29724_c1 3300050509 Bacteria 4245
1328 nmdc:mga0qj67_63851_c1 3300050509 Bacteria 2928
1329 nmdc:mga0qj67_9421_c1 3300050509 Bacteria 7266
1330 nmdc:mga06r32_13884_c1 3300050510 Bacteria 7309
1331 nmdc:mga06r32_394797_c1 3300050510 Bacteria 1366
1332 nmdc:mga06r32_62849_c1 3300050510 Bacteria 3577
1333 nmdc:mga06r32_761_c1 3300050510 Bacteria 28397
1334 nmdc:mga08y16_350257_c1 3300050511 Bacteria 1517
1335 nmdc:mga08y16_39322_c1 3300050511 Bacteria 4964
1336 nmdc:mga08y16_55319_c1 3300050511 Bacteria 4147
1337 nmdc:mga08y16_773279_c1 3300050511 Bacteria 955
1338 nmdc:mga08y16_964155_c1 3300050511 Bacteria 835
1339 Ga0495601_0756780 3300053077 Bacteria 618
1340 Ga0500610_0267079 3300053079 Bacteria 777
1341 Ga0495595_0020577 3300053084 Bacteria 2873
1342 Ga0495619_0203486 3300053085 Bacteria 1371
1343 Ga0500644_0029866 3300053088 Bacteria 1718
1344 Ga0500644_0079711 3300053088 Bacteria 1201
1345 Ga0500644_0141679 3300053088 Bacteria 956
1346 Ga0500644_0181817 3300053088 Bacteria 861
1347 Ga0500651_0013574 3300053093 Bacteria 4967
1348 Ga0500641_0006428 3300053096 Bacteria 4172
1349 Ga0500641_0357996 3300053096 Bacteria 585
1350 Ga0500650_0070106 3300053098 Bacteria 1639
1351 Ga0500556_0001337 3300053104 Bacteria 10898
1352 Ga0500562_102684 3300053108 Bacteria 778
1353 Ga0500593_001021 3300053117 Bacteria 10151
1354 Ga0500594_0002508 3300053118 Bacteria 3993
1355 Ga0500658_0125489 3300053134 Bacteria 1141
1356 Ga0500559_0010051 3300053136 Bacteria 4075
1357 Ga0500573_0007226 3300053140 Bacteria 6052
1358 Ga0500573_0249319 3300053140 Bacteria 916
1359 Ga0500577_0001480 3300053142 Bacteria 5999
1360 Ga0500577_0066772 3300053142 Bacteria 1400
1361 Ga0500600_0038311 3300053149 Bacteria 2776
1362 Ga0501084_0001330 3300054114 Bacteria 19498
1363 Ga0501084_0024881 3300054114 Bacteria 4996
1364 Ga0501084_0033676 3300054114 Bacteria 4285
1365 Ga0501084_0053996 3300054114 Bacteria 3360
1366 Ga0501084_0238820 3300054114 Bacteria 1534
1367 Ga0501084_0328073 3300054114 Bacteria 1293
1368 Ga0501084_0672554 3300054114 Bacteria 874
1369 Ga0590075_023586 3300059424 Bacteria 1542
1370 Ga0587093_015412 3300059478 Bacteria 965
1371 Ga0587066_004437 3300059490 Bacteria 1728
1372 Ga0587073_0007031 3300059492 Bacteria 1760
1373 Ga0587077_059289 3300059493 Bacteria 824
1374 Ga0587082_008194 3300059504 Bacteria 1449
1375 Ga0587082_083115 3300059504 Bacteria 671
1376 Ga0587083_0005058 3300059505 Bacteria 1881
1377 Ga0587088_077942 3300059508 Bacteria 704
1378 Ga0587090_078938 3300059510 Bacteria 656
1379 Ga0587091_124420 3300059511 Bacteria 630
1380 Ga0587092_008238 3300059512 Bacteria 1373
1381 Ga0587095_025250 3300059514 Bacteria 591
1382 Ga0587098_027760 3300059604 Bacteria 761
1383 Ga0587067_020837 3300059640 Bacteria 1125
1384 Ga0587068_057970 3300059641 Bacteria 739
1385 Ga0587069_027482 3300059642 Bacteria 898
1386 Ga0587102_023248 3300059649 Bacteria 714
1387 Ga0587107_006978 3300059652 Bacteria 1257
1388 Ga0587107_011239 3300059652 Bacteria 1093
1389 Ga0587111_0097459 3300060346 Bacteria 728
1390 Ga0501082_0001840 3300060353 Bacteria 18665
1391 Ga0501082_0010964 3300060353 Bacteria 7799
1392 Ga0501082_0024494 3300060353 Bacteria 5203
1393 Ga0501082_0036004 3300060353 Bacteria 4265
1394 Ga0501082_0237271 3300060353 Bacteria 1587
1395 Ga0501082_0682436 3300060353 Bacteria 899
1396 Ga0466962_0045609 3300061719 Bacteria 2095
1397 Ga0466962_0050276 3300061719 Bacteria 1992
1398 Ga0466962_0118644 3300061719 Bacteria 1276
1399 Ga0530510_0013336 3300061734 Bacteria 5779
1400 Ga0530510_0033797 3300061734 Bacteria 3682
1401 Ga0530510_0079212 3300061734 Bacteria 2389
1402 Ga0530510_0340023 3300061734 Bacteria 1127
1403 Ga0530510_0376749 3300061734 Bacteria 1068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0288374 Ga0496119_0288374_25_468 147
2 3300031242 Ga0265329_10263641 Ga0265329_102636411 158
3 3300031344 Ga0265316_10154245 Ga0265316_101542452 158
4 3300031344 Ga0265316_10295613 Ga0265316_102956132 158
5 3300031727 Ga0316576_10203535 Ga0316576_102035352 159
6 3300036647 Ga0316582_0124651 Ga0316582_0124651_393_875 159
7 3300039093 Ga0400489_28232 Ga0400489_28232_284_766 159
8 3300048923 Ga0496120_0027353 Ga0496120_0027353_556_1056 159
9 3300048925 Ga0496122_0000011 Ga0496122_0000011_100234_100734 159
10 3300048926 Ga0496123_0004229 Ga0496123_0004229_8570_9070 159
11 3300048929 Ga0496126_0000002 Ga0496126_0000002_447918_448418 159
12 3300005289 Ga0065704_10018886 Ga0065704_100188862 160
13 3300021388 Ga0213875_10003334 Ga0213875_1000333412 160
14 3300035398 Ga0316574_0051177 Ga0316574_0051177_1859_2344 160
15 3300037853 Ga0436364_1022766 Ga0436364_1022766_64206_64697 160
16 3300049569 Ga0501032_0194335 Ga0501032_0194335_524_1009 160
17 3300049570 Ga0501033_0610207 Ga0501033_0610207_208_693 160
18 3300049573 Ga0501037_0678318 Ga0501037_0678318_130_615 160
19 3300049584 Ga0501068_0250953 Ga0501068_0250953_591_1076 160
20 3300049588 Ga0501072_0161017 Ga0501072_0161017_767_1252 160
21 3300049588 Ga0501072_0196835 Ga0501072_0196835_1041_1526 160
22 3300049592 Ga0501076_0071733 Ga0501076_0071733_320_805 160
23 3300049593 Ga0501077_0057543 Ga0501077_0057543_520_1005 160
24 3300049824 Ga0501045_0252230 Ga0501045_0252230_492_977 160
25 3300061734 Ga0530510_0013336 Ga0530510_0013336_1191_1676 160
26 3300061734 Ga0530510_0340023 Ga0530510_0340023_594_1079 160
27 3300005530 Ga0070679_100316299 Ga0070679_1003162992 161
28 3300025921 Ga0207652_10611253 Ga0207652_106112532 161
29 3300046512 Ga0495610_0253650 Ga0495610_0253650_194_679 161
30 3300050507 nmdc:mga05p37_140187_c1 nmdc:mga05p37_140187_c1_414_902 161
31 3300050509 nmdc:mga0qj67_29724_c1 nmdc:mga0qj67_29724_c1_394_882 161
32 3300050510 nmdc:mga06r32_394797_c1 nmdc:mga06r32_394797_c1_303_791 161
33 3300013296 Ga0157374_10018630 Ga0157374_100186303 162
34 3300025914 Ga0207671_10000024 Ga0207671_1000002466 162
35 3300025924 Ga0207694_10017123 Ga0207694_100171234 162
36 3300028800 Ga0265338_10123408 Ga0265338_101234081 162
37 3300037312 Ga0395899_0266954 Ga0395899_0266954_62_619 162
38 3300037466 Ga0395898_0009998 Ga0395898_0009998_3018_3575 162
39 3300037466 Ga0395898_0497337 Ga0395898_0497337_467_1024 162
40 3300037471 Ga0395905_0012701 Ga0395905_0012701_6905_7462 162
41 3300038443 Ga0395901_0104322 Ga0395901_0104322_2315_2872 162
42 3300048914 Ga0496111_0386255 Ga0496111_0386255_378_938 162
43 3300048915 Ga0496112_0170027 Ga0496112_0170027_773_1333 162
44 3300048915 Ga0496112_0446387 Ga0496112_0446387_357_914 162
45 3300050508 nmdc:mga09592_84439_c1 nmdc:mga09592_84439_c1_133_624 163
46 iso_pu_bacteria 2558860112 2558910793 164
47 iso_pu_bacteria 2585427649 2586058992 164
48 iso_pu_bacteria 2795385470 2795784180 164
49 iso_pu_bacteria 2795385472 2795794308 164
50 iso_pu_bacteria 2808606522 2809592254 164
51 iso_pu_bacteria 2857479173 2857480032 164
52 iso_pu_bacteria 2857632687 2857634630 164
53 iso_pu_bacteria 2866612099 2866616538 164
54 iso_pu_bacteria 2870782633 2870784785 164
55 iso_pu_bacteria 2870801768 2870802801 164
56 iso_pu_bacteria 2870804320 2870804874 164
57 iso_pu_bacteria 2899359706 2899362165 164
58 iso_pu_bacteria 2899370129 2899372641 164
59 iso_pu_bacteria 2915768154 2915768929 164
60 iso_pu_bacteria 2917736166 2917743434 164
61 3300005435 Ga0070714_100443028 Ga0070714_1004430282 165
62 3300006028 Ga0070717_10454414 Ga0070717_104544142 165
63 3300021388 Ga0213875_10074585 Ga0213875_100745852 165
64 3300035398 Ga0316574_0330071 Ga0316574_0330071_302_799 165
65 3300037853 Ga0436364_0137134 Ga0436364_0137134_2502_3002 165
66 3300042876 Ga0451577_0449162 Ga0451577_0449162_650_1147 165
67 3300044712 Ga0453684_0135561 Ga0453684_0135561_1109_1606 165
68 3300044735 Ga0466968_0002184 Ga0466968_0002184_5790_6287 165
69 3300049574 Ga0501038_1191463 Ga0501038_1191463_19_540 165
70 3300049578 Ga0501042_0340998 Ga0501042_0340998_519_1028 165
71 3300061719 Ga0466962_0118644 Ga0466962_0118644_532_1032 165
72 3300009098 Ga0105245_11517476 Ga0105245_115174761 166
73 3300013307 Ga0157372_10231641 Ga0157372_102316413 166
74 3300044694 Ga0466963_0190610 Ga0466963_0190610_155_658 166
75 3300044694 Ga0466963_0376306 Ga0466963_0376306_277_780 166
76 3300044842 Ga0466957_0342809 Ga0466957_0342809_78_581 166
77 3300045976 Ga0466967_0005409 Ga0466967_0005409_4116_4619 166
78 3300048919 Ga0496116_0030057 Ga0496116_0030057_2815_3315 166
79 3300048920 Ga0496117_0000336 Ga0496117_0000336_18012_18512 166
80 3300048921 Ga0496118_0035069 Ga0496118_0035069_1857_2357 166
81 3300048922 Ga0496119_0000036 Ga0496119_0000036_156564_157064 166
82 3300048922 Ga0496119_0199761 Ga0496119_0199761_488_988 166
83 3300048923 Ga0496120_0000020 Ga0496120_0000020_178716_179216 166
84 3300048923 Ga0496120_0000058 Ga0496120_0000058_19881_20381 166
85 3300048923 Ga0496120_0032029 Ga0496120_0032029_1802_2302 166
86 3300048925 Ga0496122_0001746 Ga0496122_0001746_12046_12546 166
87 3300048926 Ga0496123_0000629 Ga0496123_0000629_36238_36738 166
88 3300048928 Ga0496125_0000004 Ga0496125_0000004_148617_149117 166
89 3300048929 Ga0496126_0000171 Ga0496126_0000171_118968_119468 166
90 3300048929 Ga0496126_0013317 Ga0496126_0013317_5595_6095 166
91 iso_pu_bacteria 2515154202 2516082423 166
92 iso_pu_bacteria 2751185782 2753264816 166
93 iso_pu_bacteria 2772190715 2772642544 166
94 iso_pu_bacteria 3001889506 3001890892 166
95 iso_pu_bacteria 8003870546 8003876809 166
96 iso_pu_bacteria 8007375930 8007379574 166
97 3300009098 Ga0105245_10658864 Ga0105245_106588642 167
98 3300048919 Ga0496116_0003599 Ga0496116_0003599_9208_9711 167
99 3300002073 JGI24745J21846_1000420 JGI24745J21846_10004202 168
100 3300003911 JGI25405J52794_10005273 JGI25405J52794_100052732 168
101 3300005327 Ga0070658_10055038 Ga0070658_100550383 168
102 3300005328 Ga0070676_10110840 Ga0070676_101108402 168
103 3300005331 Ga0070670_100178830 Ga0070670_1001788302 168
104 3300005331 Ga0070670_100617619 Ga0070670_1006176192 168
105 3300005334 Ga0068869_100031689 Ga0068869_1000316892 168
106 3300005334 Ga0068869_100835560 Ga0068869_1008355601 168
107 3300005337 Ga0070682_100045887 Ga0070682_1000458872 168
108 3300005337 Ga0070682_100207806 Ga0070682_1002078062 168
109 3300005337 Ga0070682_100546763 Ga0070682_1005467632 168
110 3300005338 Ga0068868_100030305 Ga0068868_1000303055 168
111 3300005338 Ga0068868_100423829 Ga0068868_1004238291 168
112 3300005339 Ga0070660_100089282 Ga0070660_1000892823 168
113 3300005339 Ga0070660_100120260 Ga0070660_1001202602 168
114 3300005340 Ga0070689_100127817 Ga0070689_1001278172 168
115 3300005340 Ga0070689_100171424 Ga0070689_1001714242 168
116 3300005344 Ga0070661_100138402 Ga0070661_1001384022 168
117 3300005347 Ga0070668_100254561 Ga0070668_1002545612 168
118 3300005353 Ga0070669_100105200 Ga0070669_1001052002 168
119 3300005354 Ga0070675_100083321 Ga0070675_1000833212 168
120 3300005364 Ga0070673_100044251 Ga0070673_1000442512 168
121 3300005365 Ga0070688_100287462 Ga0070688_1002874622 168
122 3300005366 Ga0070659_100098357 Ga0070659_1000983572 168
123 3300005366 Ga0070659_101020390 Ga0070659_1010203901 168
124 3300005435 Ga0070714_101400591 Ga0070714_1014005911 168
125 3300005436 Ga0070713_100421485 Ga0070713_1004214852 168
126 3300005438 Ga0070701_10021162 Ga0070701_100211622 168
127 3300005440 Ga0070705_100233669 Ga0070705_1002336692 168
128 3300005441 Ga0070700_100874825 Ga0070700_1008748251 168
129 3300005455 Ga0070663_100225408 Ga0070663_1002254082 168
130 3300005455 Ga0070663_100261206 Ga0070663_1002612062 168
131 3300005459 Ga0068867_100080112 Ga0068867_1000801122 168
132 3300005466 Ga0070685_10046945 Ga0070685_100469452 168
133 3300005466 Ga0070685_10139107 Ga0070685_101391072 168
134 3300005471 Ga0070698_101468328 Ga0070698_1014683281 168
135 3300005535 Ga0070684_100132813 Ga0070684_1001328132 168
136 3300005539 Ga0068853_100223777 Ga0068853_1002237772 168
137 3300005543 Ga0070672_101232748 Ga0070672_1012327482 168
138 3300005544 Ga0070686_100130599 Ga0070686_1001305992 168
139 3300005548 Ga0070665_100923105 Ga0070665_1009231052 168
140 3300005548 Ga0070665_102198501 Ga0070665_1021985011 168
141 3300005563 Ga0068855_100145855 Ga0068855_1001458552 168
142 3300005577 Ga0068857_100201416 Ga0068857_1002014162 168
143 3300005577 Ga0068857_100212230 Ga0068857_1002122302 168
144 3300005577 Ga0068857_100454025 Ga0068857_1004540252 168
145 3300005578 Ga0068854_100043672 Ga0068854_1000436722 168
146 3300005614 Ga0068856_101104226 Ga0068856_1011042262 168
147 3300005615 Ga0070702_100145113 Ga0070702_1001451132 168
148 3300005615 Ga0070702_100431826 Ga0070702_1004318261 168
149 3300005616 Ga0068852_100146418 Ga0068852_1001464182 168
150 3300005617 Ga0068859_100081255 Ga0068859_1000812553 168
151 3300005618 Ga0068864_100620890 Ga0068864_1006208902 168
152 3300005718 Ga0068866_10742681 Ga0068866_107426812 168
153 3300005719 Ga0068861_100068058 Ga0068861_1000680582 168
154 3300005840 Ga0068870_10065588 Ga0068870_100655882 168
155 3300005841 Ga0068863_100973554 Ga0068863_1009735542 168
156 3300005842 Ga0068858_100263850 Ga0068858_1002638502 168
157 3300005843 Ga0068860_100223988 Ga0068860_1002239882 168
158 3300005843 Ga0068860_100568994 Ga0068860_1005689942 168
159 3300005844 Ga0068862_100183221 Ga0068862_1001832212 168
160 3300005937 Ga0081455_10000873 Ga0081455_1000087312 168
161 3300005937 Ga0081455_10131031 Ga0081455_101310312 168
162 3300005985 Ga0081539_10000692 Ga0081539_1000069247 168
163 3300006237 Ga0097621_100166487 Ga0097621_1001664871 168
164 3300006880 Ga0075429_100289239 Ga0075429_1002892392 168
165 3300006880 Ga0075429_100467718 Ga0075429_1004677182 168
166 3300006881 Ga0068865_100622542 Ga0068865_1006225421 168
167 3300006931 Ga0097620_100081257 Ga0097620_1000812573 168
168 3300009011 Ga0105251_10107784 Ga0105251_101077841 168
169 3300009036 Ga0105244_10297250 Ga0105244_102972502 168
170 3300009094 Ga0111539_10170938 Ga0111539_101709382 168
171 3300009094 Ga0111539_10292690 Ga0111539_102926902 168
172 3300009098 Ga0105245_10250968 Ga0105245_102509682 168
173 3300009101 Ga0105247_10068814 Ga0105247_100688142 168
174 3300009148 Ga0105243_10128449 Ga0105243_101284491 168
175 3300009148 Ga0105243_10924743 Ga0105243_109247431 168
176 3300009174 Ga0105241_10184910 Ga0105241_101849102 168
177 3300009176 Ga0105242_11124919 Ga0105242_111249192 168
178 3300009177 Ga0105248_11929241 Ga0105248_119292411 168
179 3300009545 Ga0105237_10503324 Ga0105237_105033242 168
180 3300009545 Ga0105237_12194946 Ga0105237_121949461 168
181 3300009551 Ga0105238_10956836 Ga0105238_109568362 168
182 3300009553 Ga0105249_10415586 Ga0105249_104155862 168
183 3300009979 Ga0105032_104602 Ga0105032_1046022 168
184 3300009986 Ga0105033_107526 Ga0105033_1075262 168
185 3300010375 Ga0105239_10123075 Ga0105239_101230752 168
186 3300011119 Ga0105246_10347981 Ga0105246_103479811 168
187 3300011119 Ga0105246_10714195 Ga0105246_107141952 168
188 3300012515 Ga0157338_1003597 Ga0157338_10035972 168
189 3300013102 Ga0157371_10147252 Ga0157371_101472522 168
190 3300013104 Ga0157370_10295087 Ga0157370_102950872 168
191 3300013105 Ga0157369_10203560 Ga0157369_102035602 168
192 3300013296 Ga0157374_10573391 Ga0157374_105733911 168
193 3300013297 Ga0157378_10131365 Ga0157378_101313652 168
194 3300013306 Ga0163162_10289922 Ga0163162_102899221 168
195 3300013307 Ga0157372_10276492 Ga0157372_102764922 168
196 3300013307 Ga0157372_11070612 Ga0157372_110706122 168
197 3300013307 Ga0157372_12093567 Ga0157372_120935671 168
198 3300013308 Ga0157375_10169491 Ga0157375_101694912 168
199 3300013308 Ga0157375_10736858 Ga0157375_107368582 168
200 3300013308 Ga0157375_10920405 Ga0157375_109204052 168
201 3300014326 Ga0157380_10769734 Ga0157380_107697342 168
202 3300014497 Ga0182008_10126916 Ga0182008_101269162 168
203 3300014745 Ga0157377_10149623 Ga0157377_101496232 168
204 3300014968 Ga0157379_10279851 Ga0157379_102798512 168
205 3300014969 Ga0157376_10546808 Ga0157376_105468082 168
206 3300014969 Ga0157376_11988440 Ga0157376_119884402 168
207 3300017792 Ga0163161_10316970 Ga0163161_103169701 168
208 3300020075 Ga0206349_1138990 Ga0206349_11389902 168
209 3300020081 Ga0206354_10447794 Ga0206354_104477942 168
210 3300020082 Ga0206353_11053797 Ga0206353_110537972 168
211 3300021358 Ga0213873_10004954 Ga0213873_100049542 168
212 3300021388 Ga0213875_10000448 Ga0213875_1000044822 168
213 3300025321 Ga0207656_10011084 Ga0207656_100110842 168
214 3300025321 Ga0207656_10085075 Ga0207656_100850752 168
215 3300025901 Ga0207688_10006084 Ga0207688_100060842 168
216 3300025901 Ga0207688_10041299 Ga0207688_100412992 168
217 3300025901 Ga0207688_10136289 Ga0207688_101362892 168
218 3300025904 Ga0207647_10016063 Ga0207647_100160635 168
219 3300025907 Ga0207645_10026249 Ga0207645_100262492 168
220 3300025908 Ga0207643_10012842 Ga0207643_100128423 168
221 3300025908 Ga0207643_10194751 Ga0207643_101947512 168
222 3300025911 Ga0207654_10152679 Ga0207654_101526792 168
223 3300025914 Ga0207671_10216137 Ga0207671_102161372 168
224 3300025916 Ga0207663_10712845 Ga0207663_107128452 168
225 3300025917 Ga0207660_10158066 Ga0207660_101580662 168
226 3300025919 Ga0207657_10043658 Ga0207657_100436583 168
227 3300025919 Ga0207657_10387725 Ga0207657_103877251 168
228 3300025923 Ga0207681_10210796 Ga0207681_102107962 168
229 3300025924 Ga0207694_10322291 Ga0207694_103222912 168
230 3300025924 Ga0207694_10735806 Ga0207694_107358062 168
231 3300025925 Ga0207650_10470458 Ga0207650_104704582 168
232 3300025926 Ga0207659_10342631 Ga0207659_103426312 168
233 3300025926 Ga0207659_10348927 Ga0207659_103489272 168
234 3300025928 Ga0207700_10296241 Ga0207700_102962412 168
235 3300025928 Ga0207700_10440289 Ga0207700_104402892 168
236 3300025932 Ga0207690_10150024 Ga0207690_101500242 168
237 3300025933 Ga0207706_10020883 Ga0207706_100208833 168
238 3300025936 Ga0207670_10066689 Ga0207670_100666892 168
239 3300025936 Ga0207670_10290980 Ga0207670_102909802 168
240 3300025936 Ga0207670_10676925 Ga0207670_106769252 168
241 3300025937 Ga0207669_10471107 Ga0207669_104711072 168
242 3300025938 Ga0207704_10013410 Ga0207704_100134101 168
243 3300025939 Ga0207665_10317748 Ga0207665_103177482 168
244 3300025940 Ga0207691_10076404 Ga0207691_100764042 168
245 3300025941 Ga0207711_11414084 Ga0207711_114140841 168
246 3300025942 Ga0207689_10037178 Ga0207689_100371782 168
247 3300025942 Ga0207689_10330466 Ga0207689_103304662 168
248 3300025942 Ga0207689_10747615 Ga0207689_107476151 168
249 3300025960 Ga0207651_10645498 Ga0207651_106454982 168
250 3300026035 Ga0207703_10784096 Ga0207703_107840962 168
251 3300026041 Ga0207639_10027963 Ga0207639_100279633 168
252 3300026041 Ga0207639_10334899 Ga0207639_103348992 168
253 3300026067 Ga0207678_10000523 Ga0207678_1000052313 168
254 3300026067 Ga0207678_10056907 Ga0207678_100569072 168
255 3300026067 Ga0207678_10525207 Ga0207678_105252071 168
256 3300026075 Ga0207708_10013463 Ga0207708_100134635 168
257 3300026075 Ga0207708_10510218 Ga0207708_105102181 168
258 3300026089 Ga0207648_10220586 Ga0207648_102205862 168
259 3300026095 Ga0207676_10100384 Ga0207676_101003842 168
260 3300026095 Ga0207676_10405819 Ga0207676_104058192 168
261 3300026116 Ga0207674_10076109 Ga0207674_100761092 168
262 3300026116 Ga0207674_10157477 Ga0207674_101574773 168
263 3300026116 Ga0207674_10283304 Ga0207674_102833042 168
264 3300026118 Ga0207675_100006593 Ga0207675_1000065935 168
265 3300026121 Ga0207683_10124058 Ga0207683_101240582 168
266 3300026142 Ga0207698_10038668 Ga0207698_100386682 168
267 3300026142 Ga0207698_10101287 Ga0207698_101012872 168
268 3300027907 Ga0207428_10050300 Ga0207428_100503002 168
269 3300028379 Ga0268266_10461938 Ga0268266_104619382 168
270 3300028380 Ga0268265_10501577 Ga0268265_105015772 168
271 3300028381 Ga0268264_10129696 Ga0268264_101296962 168
272 3300030521 Ga0307511_10000622 Ga0307511_1000062219 168
273 3300030522 Ga0307512_10010941 Ga0307512_100109416 168
274 3300031456 Ga0307513_10153391 Ga0307513_101533912 168
275 3300031824 Ga0307413_10000247 Ga0307413_1000024715 168
276 3300031824 Ga0307413_10476573 Ga0307413_104765731 168
277 3300031838 Ga0307518_10000118 Ga0307518_1000011851 168
278 3300031995 Ga0307409_101848587 Ga0307409_1018485871 168
279 3300032126 Ga0307415_100069569 Ga0307415_1000695693 168
280 3300033179 Ga0307507_10191123 Ga0307507_101911231 168
281 3300035691 Ga0373931_0160215 Ga0373931_0160215_690_1199 168
282 3300036401 Ga0373937_0457742 Ga0373937_0457742_118_624 168
283 3300037853 Ga0436364_0080666 Ga0436364_0080666_24711_25217 168
284 3300039453 Ga0436362_0306738 Ga0436362_0306738_1474_1980 168
285 3300039453 Ga0436362_0812882 Ga0436362_0812882_624_1130 168
286 3300041503 Ga0451847_0450451 Ga0451847_0450451_117_647 168
287 3300044684 Ga0466966_0082004 Ga0466966_0082004_133_645 168
288 3300044684 Ga0466966_0122295 Ga0466966_0122295_560_1066 168
289 3300044694 Ga0466963_0192218 Ga0466963_0192218_457_966 168
290 3300044735 Ga0466968_0216934 Ga0466968_0216934_181_693 168
291 3300044765 Ga0466970_0126555 Ga0466970_0126555_122_634 168
292 3300044765 Ga0466970_0137707 Ga0466970_0137707_97_603 168
293 3300044765 Ga0466970_0710362 Ga0466970_0710362_29_535 168
294 3300044901 Ga0466960_0100167 Ga0466960_0100167_173_679 168
295 3300045049 Ga0466959_0209959 Ga0466959_0209959_559_1065 168
296 3300045976 Ga0466967_0356546 Ga0466967_0356546_816_1322 168
297 3300045976 Ga0466967_0366372 Ga0466967_0366372_49_558 168
298 3300045976 Ga0466967_0518826 Ga0466967_0518826_308_814 168
299 3300048903 Ga0496100_0244469 Ga0496100_0244469_689_1195 168
300 3300048905 Ga0496102_0232896 Ga0496102_0232896_841_1347 168
301 3300048907 Ga0496104_1013242 Ga0496104_1013242_53_559 168
302 3300048908 Ga0496105_0397683 Ga0496105_0397683_250_756 168
303 3300048909 Ga0496106_0085284 Ga0496106_0085284_137_643 168
304 3300048911 Ga0496108_0122461 Ga0496108_0122461_903_1409 168
305 3300048912 Ga0496109_0426773 Ga0496109_0426773_507_1013 168
306 3300048912 Ga0496109_0739406 Ga0496109_0739406_397_903 168
307 3300048913 Ga0496110_0310406 Ga0496110_0310406_532_1041 168
308 3300048913 Ga0496110_0406906 Ga0496110_0406906_65_571 168
309 3300048914 Ga0496111_0104152 Ga0496111_0104152_1323_1829 168
310 3300048915 Ga0496112_0268534 Ga0496112_0268534_589_1095 168
311 3300048916 Ga0496113_0024790 Ga0496113_0024790_435_941 168
312 3300048917 Ga0496114_0056947 Ga0496114_0056947_2383_2913 168
313 3300048925 Ga0496122_0000143 Ga0496122_0000143_29722_30240 168
314 3300048927 Ga0496124_0468492 Ga0496124_0468492_30_551 168
315 3300048928 Ga0496125_0196952 Ga0496125_0196952_698_1204 168
316 3300048929 Ga0496126_0001392 Ga0496126_0001392_8012_8530 168
317 3300049570 Ga0501033_0058505 Ga0501033_0058505_1578_2096 168
318 3300049575 Ga0501039_0281088 Ga0501039_0281088_715_1233 168
319 3300049588 Ga0501072_0136997 Ga0501072_0136997_1337_1843 168
320 3300049591 Ga0501075_0794086 Ga0501075_0794086_161_667 168
321 3300049743 Ga0501081_0322440 Ga0501081_0322440_450_956 168
322 3300050491 nmdc:mga00v17_257830_c1 nmdc:mga00v17_257830_c1_353_865 168
323 3300050492 nmdc:mga0yw44_5319_c1 nmdc:mga0yw44_5319_c1_357_869 168
324 3300050496 nmdc:mga07m45_72821_c1 nmdc:mga07m45_72821_c1_753_1295 168
325 3300050511 nmdc:mga08y16_350257_c1 nmdc:mga08y16_350257_c1_879_1385 168
326 3300050511 nmdc:mga08y16_55319_c1 nmdc:mga08y16_55319_c1_2759_3265 168
327 3300053088 Ga0500644_0079711 Ga0500644_0079711_118_624 168
328 3300053136 Ga0500559_0010051 Ga0500559_0010051_3367_3873 168
329 3300053142 Ga0500577_0001480 Ga0500577_0001480_2239_2745 168
330 3300054114 Ga0501084_0238820 Ga0501084_0238820_666_1172 168
331 3300059508 Ga0587088_077942 Ga0587088_077942_130_636 168
332 3300059511 Ga0587091_124420 Ga0587091_124420_32_544 168
333 3300059604 Ga0587098_027760 Ga0587098_027760_58_564 168
334 3300059640 Ga0587067_020837 Ga0587067_020837_58_567 168
335 3300059649 Ga0587102_023248 Ga0587102_023248_172_678 168
336 3300059652 Ga0587107_011239 Ga0587107_011239_224_730 168
337 3300060353 Ga0501082_0237271 Ga0501082_0237271_429_935 168
338 iso_pu_bacteria 2506783011 2506868325 168
339 iso_pu_bacteria 2576861822 2579749534 168
340 iso_pu_bacteria 2626541554 2626635233 168
341 iso_pu_bacteria 2671180195 2671839972 168
342 iso_pu_bacteria 2684623036 2686542594 168
343 iso_pu_bacteria 2687453743 2689990740 168
344 iso_pu_bacteria 2710264753 2710602401 168
345 iso_pu_bacteria 2773857922 2774858128 168
346 iso_pu_bacteria 2773857933 2774902711 168
347 iso_pu_bacteria 2856741275 2856745493 168
348 iso_pu_bacteria 2891395885 2891397978 168
349 iso_pu_bacteria 2891554331 2891559643 168
350 iso_pu_bacteria 2891562705 2891567574 168
351 iso_pu_bacteria 8053945823 8053946664 168
352 iso_pu_bacteria 8054913762 8054919763 168
353 iso_pu_bacteria 8054920844 8054925854 168
354 3300005456 Ga0070678_100830490 Ga0070678_1008304902 169
355 3300006946 Ga0079104_1000050 Ga0079104_100005096 169
356 3300006946 Ga0079104_1003814 Ga0079104_10038146 169
357 3300006946 Ga0079104_1009138 Ga0079104_10091383 169
358 3300009148 Ga0105243_10199230 Ga0105243_101992302 169
359 3300025728 Ga0207655_1005169 Ga0207655_10051695 169
360 3300027111 Ga0209281_1000059 Ga0209281_1000059130 169
361 3300027111 Ga0209281_1000420 Ga0209281_100042024 169
362 3300027111 Ga0209281_1039396 Ga0209281_10393961 169
363 3300035119 Ga0373956_0056473 Ga0373956_0056473_260_772 169
364 3300037466 Ga0395898_0419817 Ga0395898_0419817_127_648 169
365 3300038443 Ga0395901_0577244 Ga0395901_0577244_132_653 169
366 3300046458 Ga0495591_034952 Ga0495591_034952_459_968 169
367 3300046515 Ga0495620_0041632 Ga0495620_0041632_1065_1574 169
368 3300046515 Ga0495620_0143780 Ga0495620_0143780_166_675 169
369 3300046530 Ga0495654_0017136 Ga0495654_0017136_2527_3036 169
370 3300046694 Ga0495649_0175137 Ga0495649_0175137_90_599 169
371 3300047320 Ga0495672_0002387 Ga0495672_0002387_12327_12836 169
372 3300048929 Ga0496126_0000190 Ga0496126_0000190_82284_82793 169
373 3300049568 Ga0501031_0102494 Ga0501031_0102494_1230_1751 169
374 3300049570 Ga0501033_0088543 Ga0501033_0088543_1422_1943 169
375 3300049571 Ga0501034_0767022 Ga0501034_0767022_303_824 169
376 3300049572 Ga0501036_0012810 Ga0501036_0012810_2841_3362 169
377 3300049574 Ga0501038_0037830 Ga0501038_0037830_3574_4095 169
378 3300049575 Ga0501039_0015970 Ga0501039_0015970_2639_3160 169
379 3300049576 Ga0501040_0034142 Ga0501040_0034142_260_781 169
380 3300049577 Ga0501041_0005290 Ga0501041_0005290_5729_6250 169
381 3300049577 Ga0501041_0703909 Ga0501041_0703909_105_626 169
382 3300049578 Ga0501042_0062787 Ga0501042_0062787_251_772 169
383 3300049579 Ga0501043_0224472 Ga0501043_0224472_538_1059 169
384 3300049580 Ga0501046_0004617 Ga0501046_0004617_6239_6760 169
385 3300049581 Ga0501047_0079450 Ga0501047_0079450_843_1364 169
386 3300049582 Ga0501048_0024509 Ga0501048_0024509_1918_2439 169
387 3300049584 Ga0501068_0044007 Ga0501068_0044007_503_1024 169
388 3300049585 Ga0501069_0061013 Ga0501069_0061013_400_921 169
389 3300049588 Ga0501072_0204478 Ga0501072_0204478_241_762 169
390 3300049590 Ga0501074_0145571 Ga0501074_0145571_298_819 169
391 3300049592 Ga0501076_0000415 Ga0501076_0000415_5192_5713 169
392 3300049593 Ga0501077_0036023 Ga0501077_0036023_894_1415 169
393 3300049741 Ga0501079_0000566 Ga0501079_0000566_5703_6224 169
394 3300049742 Ga0501080_0126967 Ga0501080_0126967_402_923 169
395 3300049743 Ga0501081_0007311 Ga0501081_0007311_976_1497 169
396 3300049822 Ga0501035_0058132 Ga0501035_0058132_2503_3024 169
397 3300049823 Ga0501044_0474311 Ga0501044_0474311_231_752 169
398 3300049824 Ga0501045_0000293 Ga0501045_0000293_238_759 169
399 3300049824 Ga0501045_0317944 Ga0501045_0317944_474_995 169
400 3300054114 Ga0501084_0001330 Ga0501084_0001330_16498_17019 169
401 3300059490 Ga0587066_004437 Ga0587066_004437_1095_1616 169
402 3300059492 Ga0587073_0007031 Ga0587073_0007031_1110_1631 169
403 3300059493 Ga0587077_059289 Ga0587077_059289_181_702 169
404 3300059504 Ga0587082_008194 Ga0587082_008194_726_1247 169
405 3300059505 Ga0587083_0005058 Ga0587083_0005058_726_1247 169
406 3300059652 Ga0587107_006978 Ga0587107_006978_565_1086 169
407 3300060353 Ga0501082_0001840 Ga0501082_0001840_15397_15918 169
408 3300061734 Ga0530510_0033797 Ga0530510_0033797_618_1139 169
409 3300003203 JGI25406J46586_10076100 JGI25406J46586_100761001 170
410 3300003203 JGI25406J46586_10095686 JGI25406J46586_100956861 170
411 3300004800 Ga0058861_10006428 Ga0058861_100064282 170
412 3300005329 Ga0070683_100871656 Ga0070683_1008716562 170
413 3300005335 Ga0070666_10435444 Ga0070666_104354441 170
414 3300005339 Ga0070660_100962679 Ga0070660_1009626791 170
415 3300005347 Ga0070668_100000160 Ga0070668_10000016026 170
416 3300005354 Ga0070675_100833483 Ga0070675_1008334832 170
417 3300005355 Ga0070671_100710057 Ga0070671_1007100572 170
418 3300005364 Ga0070673_100432429 Ga0070673_1004324292 170
419 3300005365 Ga0070688_100610686 Ga0070688_1006106861 170
420 3300005366 Ga0070659_100441695 Ga0070659_1004416952 170
421 3300005367 Ga0070667_100558545 Ga0070667_1005585452 170
422 3300005437 Ga0070710_10191413 Ga0070710_101914132 170
423 3300005441 Ga0070700_100370682 Ga0070700_1003706821 170
424 3300005455 Ga0070663_100320369 Ga0070663_1003203692 170
425 3300005457 Ga0070662_100986958 Ga0070662_1009869581 170
426 3300005458 Ga0070681_11297932 Ga0070681_112979321 170
427 3300005530 Ga0070679_100813502 Ga0070679_1008135021 170
428 3300005535 Ga0070684_100162822 Ga0070684_1001628222 170
429 3300005535 Ga0070684_101159911 Ga0070684_1011599112 170
430 3300005539 Ga0068853_100523868 Ga0068853_1005238682 170
431 3300005544 Ga0070686_100861268 Ga0070686_1008612681 170
432 3300005546 Ga0070696_100002684 Ga0070696_1000026846 170
433 3300005547 Ga0070693_100229895 Ga0070693_1002298951 170
434 3300005564 Ga0070664_100199414 Ga0070664_1001994142 170
435 3300005617 Ga0068859_100454167 Ga0068859_1004541672 170
436 3300005617 Ga0068859_100896522 Ga0068859_1008965221 170
437 3300005618 Ga0068864_100791322 Ga0068864_1007913222 170
438 3300005718 Ga0068866_10612139 Ga0068866_106121391 170
439 3300005834 Ga0068851_10096947 Ga0068851_100969472 170
440 3300005844 Ga0068862_100135674 Ga0068862_1001356742 170
441 3300005937 Ga0081455_10075031 Ga0081455_100750312 170
442 3300005983 Ga0081540_1012440 Ga0081540_10124403 170
443 3300005985 Ga0081539_10001544 Ga0081539_1000154442 170
444 3300005985 Ga0081539_10052944 Ga0081539_100529442 170
445 3300006028 Ga0070717_10248108 Ga0070717_102481082 170
446 3300006173 Ga0070716_100021188 Ga0070716_1000211883 170
447 3300006237 Ga0097621_100250892 Ga0097621_1002508922 170
448 3300006846 Ga0075430_100000816 Ga0075430_1000008166 170
449 3300006846 Ga0075430_100046548 Ga0075430_1000465482 170
450 3300006847 Ga0075431_100338147 Ga0075431_1003381472 170
451 3300006931 Ga0097620_100454190 Ga0097620_1004541902 170
452 3300006931 Ga0097620_100896570 Ga0097620_1008965701 170
453 3300009094 Ga0111539_11065196 Ga0111539_110651961 170
454 3300009101 Ga0105247_10445401 Ga0105247_104454012 170
455 3300009147 Ga0114129_10806062 Ga0114129_108060622 170
456 3300009148 Ga0105243_10874444 Ga0105243_108744441 170
457 3300009174 Ga0105241_10984870 Ga0105241_109848701 170
458 3300009177 Ga0105248_10603156 Ga0105248_106031562 170
459 3300009545 Ga0105237_10591893 Ga0105237_105918932 170
460 3300009551 Ga0105238_10754112 Ga0105238_107541122 170
461 3300009553 Ga0105249_10863356 Ga0105249_108633562 170
462 3300013105 Ga0157369_10355977 Ga0157369_103559772 170
463 3300013105 Ga0157369_11034602 Ga0157369_110346022 170
464 3300013296 Ga0157374_10778339 Ga0157374_107783391 170
465 3300013297 Ga0157378_10374396 Ga0157378_103743962 170
466 3300013307 Ga0157372_11145760 Ga0157372_111457602 170
467 3300014325 Ga0163163_11100365 Ga0163163_111003652 170
468 3300014326 Ga0157380_11600722 Ga0157380_116007221 170
469 3300014497 Ga0182008_10212987 Ga0182008_102129871 170
470 3300014745 Ga0157377_10623673 Ga0157377_106236731 170
471 3300014968 Ga0157379_10313742 Ga0157379_103137422 170
472 3300014968 Ga0157379_10319073 Ga0157379_103190732 170
473 3300014969 Ga0157376_10269671 Ga0157376_102696712 170
474 3300017792 Ga0163161_10599684 Ga0163161_105996841 170
475 3300020075 Ga0206349_1145956 Ga0206349_11459561 170
476 3300025898 Ga0207692_10274992 Ga0207692_102749921 170
477 3300025911 Ga0207654_11129268 Ga0207654_111292681 170
478 3300025914 Ga0207671_10309964 Ga0207671_103099642 170
479 3300025921 Ga0207652_10401349 Ga0207652_104013492 170
480 3300025924 Ga0207694_10419450 Ga0207694_104194502 170
481 3300025925 Ga0207650_10326204 Ga0207650_103262042 170
482 3300025926 Ga0207659_10444539 Ga0207659_104445392 170
483 3300025931 Ga0207644_10268240 Ga0207644_102682402 170
484 3300025938 Ga0207704_10258523 Ga0207704_102585231 170
485 3300025941 Ga0207711_10349909 Ga0207711_103499092 170
486 3300025944 Ga0207661_10486940 Ga0207661_104869401 170
487 3300025945 Ga0207679_10995966 Ga0207679_109959662 170
488 3300025972 Ga0207668_10000597 Ga0207668_1000059713 170
489 3300026023 Ga0207677_11066434 Ga0207677_110664342 170
490 3300026035 Ga0207703_10051351 Ga0207703_100513512 170
491 3300026041 Ga0207639_10427644 Ga0207639_104276442 170
492 3300026067 Ga0207678_10184000 Ga0207678_101840002 170
493 3300026078 Ga0207702_10536486 Ga0207702_105364862 170
494 3300026088 Ga0207641_10089828 Ga0207641_100898282 170
495 3300026089 Ga0207648_10738490 Ga0207648_107384902 170
496 3300026095 Ga0207676_10162055 Ga0207676_101620552 170
497 3300028380 Ga0268265_10118282 Ga0268265_101182822 170
498 3300028381 Ga0268264_10292870 Ga0268264_102928702 170
499 3300028573 Ga0265334_10007935 Ga0265334_100079353 170
500 3300028786 Ga0307517_10025081 Ga0307517_100250814 170
501 3300028794 Ga0307515_10001304 Ga0307515_1000130428 170
502 3300028794 Ga0307515_10020413 Ga0307515_100204133 170
503 3300030522 Ga0307512_10002198 Ga0307512_1000219813 170
504 3300031456 Ga0307513_10006735 Ga0307513_100067358 170
505 3300031507 Ga0307509_10092054 Ga0307509_100920542 170
506 3300031616 Ga0307508_10000986 Ga0307508_100009868 170
507 3300031616 Ga0307508_10008438 Ga0307508_100084384 170
508 3300031616 Ga0307508_10325354 Ga0307508_103253541 170
509 3300031665 Ga0316575_10004327 Ga0316575_100043273 170
510 3300031665 Ga0316575_10253005 Ga0316575_102530051 170
511 3300031691 Ga0316579_10003811 Ga0316579_100038112 170
512 3300031691 Ga0316579_10022204 Ga0316579_100222043 170
513 3300031727 Ga0316576_10021671 Ga0316576_100216711 170
514 3300031727 Ga0316576_10080388 Ga0316576_100803881 170
515 3300031727 Ga0316576_10152837 Ga0316576_101528372 170
516 3300031728 Ga0316578_10010985 Ga0316578_100109852 170
517 3300031728 Ga0316578_10024402 Ga0316578_100244022 170
518 3300031730 Ga0307516_10123037 Ga0307516_101230372 170
519 3300031730 Ga0307516_10569667 Ga0307516_105696672 170
520 3300031731 Ga0307405_10055230 Ga0307405_100552302 170
521 3300031733 Ga0316577_10039457 Ga0316577_100394572 170
522 3300031733 Ga0316577_10111481 Ga0316577_101114812 170
523 3300031889 Ga0326468_10000081 Ga0326468_100000813 170
524 3300031995 Ga0307409_100084637 Ga0307409_1000846372 170
525 3300032126 Ga0307415_100637992 Ga0307415_1006379922 170
526 3300032133 Ga0316583_10015541 Ga0316583_100155412 170
527 3300032137 Ga0316585_10063312 Ga0316585_100633121 170
528 3300032168 Ga0316593_10047141 Ga0316593_100471412 170
529 3300033180 Ga0307510_10043746 Ga0307510_100437462 170
530 3300033180 Ga0307510_10081325 Ga0307510_100813252 170
531 3300033541 Ga0316596_1006263 Ga0316596_10062632 170
532 3300035088 Ga0373940_0005689 Ga0373940_0005689_809_1324 170
533 3300035091 Ga0373951_0000004 Ga0373951_0000004_89674_90189 170
534 3300035115 Ga0373941_0029477 Ga0373941_0029477_419_934 170
535 3300035207 Ga0373942_0000016 Ga0373942_0000016_20888_21403 170
536 3300035242 Ga0373962_0007303 Ga0373962_0007303_811_1326 170
537 3300035398 Ga0316574_0001558 Ga0316574_0001558_386_916 170
538 3300035398 Ga0316574_0021015 Ga0316574_0021015_1254_1766 170
539 3300035398 Ga0316574_0055665 Ga0316574_0055665_1132_1644 170
540 3300035398 Ga0316574_0152423 Ga0316574_0152423_756_1268 170
541 3300035692 Ga0373935_0002550 Ga0373935_0002550_9174_9689 170
542 3300036647 Ga0316582_0007056 Ga0316582_0007056_2847_3359 170
543 3300036647 Ga0316582_0017128 Ga0316582_0017128_1886_2416 170
544 3300036712 Ga0316584_0002036 Ga0316584_0002036_10359_10871 170
545 3300037068 Ga0373925_0837215 Ga0373925_0837215_170_685 170
546 3300037418 Ga0395900_0462723 Ga0395900_0462723_104_616 170
547 3300037466 Ga0395898_1321186 Ga0395898_1321186_41_553 170
548 3300037588 Ga0316581_0063334 Ga0316581_0063334_493_1023 170
549 3300037853 Ga0436364_1049772 Ga0436364_1049772_776_1297 170
550 3300038443 Ga0395901_0192244 Ga0395901_0192244_459_971 170
551 3300038443 Ga0395901_0386155 Ga0395901_0386155_656_1168 170
552 3300038996 Ga0242420_060471 Ga0242420_060471_223_735 170
553 3300041441 Ga0451787_377975 Ga0451787_377975_13_534 170
554 3300041451 Ga0451791_1411455 Ga0451791_1411455_816_1331 170
555 3300041452 Ga0451793_1545661 Ga0451793_1545661_248_763 170
556 3300041509 Ga0451843_1613533 Ga0451843_1613533_227_742 170
557 3300044765 Ga0466970_0790533 Ga0466970_0790533_10_525 170
558 3300045976 Ga0466967_0040650 Ga0466967_0040650_681_1199 170
559 3300045976 Ga0466967_0484231 Ga0466967_0484231_79_594 170
560 3300046460 Ga0495638_0167684 Ga0495638_0167684_188_703 170
561 3300046460 Ga0495638_0362642 Ga0495638_0362642_102_617 170
562 3300046519 Ga0495632_0024817 Ga0495632_0024817_2219_2734 170
563 3300046692 Ga0495671_0505211 Ga0495671_0505211_29_544 170
564 3300047319 Ga0495674_0489441 Ga0495674_0489441_135_650 170
565 3300048903 Ga0496100_0031907 Ga0496100_0031907_1605_2117 170
566 3300048903 Ga0496100_1366991 Ga0496100_1366991_15_533 170
567 3300048904 Ga0496101_1104846 Ga0496101_1104846_27_539 170
568 3300048907 Ga0496104_0322817 Ga0496104_0322817_373_885 170
569 3300048911 Ga0496108_0000613 Ga0496108_0000613_20264_20779 170
570 3300048917 Ga0496114_0762489 Ga0496114_0762489_235_750 170
571 3300048925 Ga0496122_0100735 Ga0496122_0100735_1297_1812 170
572 3300049581 Ga0501047_0496096 Ga0501047_0496096_514_1035 170
573 3300049583 Ga0501067_0434517 Ga0501067_0434517_81_599 170
574 3300049591 Ga0501075_0259055 Ga0501075_0259055_803_1315 170
575 3300049591 Ga0501075_0589073 Ga0501075_0589073_268_783 170
576 3300053079 Ga0500610_0267079 Ga0500610_0267079_74_589 170
577 3300053088 Ga0500644_0029866 Ga0500644_0029866_1150_1665 170
578 3300053088 Ga0500644_0141679 Ga0500644_0141679_332_847 170
579 3300053093 Ga0500651_0013574 Ga0500651_0013574_2737_3252 170
580 3300053096 Ga0500641_0006428 Ga0500641_0006428_1942_2457 170
581 3300053096 Ga0500641_0357996 Ga0500641_0357996_23_541 170
582 3300053098 Ga0500650_0070106 Ga0500650_0070106_1113_1628 170
583 3300053108 Ga0500562_102684 Ga0500562_102684_139_654 170
584 3300053118 Ga0500594_0002508 Ga0500594_0002508_2024_2539 170
585 3300053134 Ga0500658_0125489 Ga0500658_0125489_172_687 170
586 3300053142 Ga0500577_0066772 Ga0500577_0066772_748_1263 170
587 3300053149 Ga0500600_0038311 Ga0500600_0038311_622_1137 170
588 3300059478 Ga0587093_015412 Ga0587093_015412_376_891 170
589 3300059641 Ga0587068_057970 Ga0587068_057970_206_721 170
590 3300059642 Ga0587069_027482 Ga0587069_027482_358_870 170
591 3300060346 Ga0587111_0097459 Ga0587111_0097459_131_646 170
592 3300005329 Ga0070683_100021777 Ga0070683_1000217776 171
593 3300005435 Ga0070714_100955955 Ga0070714_1009559551 171
594 3300005535 Ga0070684_100006238 Ga0070684_1000062382 171
595 3300005577 Ga0068857_100330922 Ga0068857_1003309222 171
596 3300013105 Ga0157369_10778843 Ga0157369_107788432 171
597 3300025929 Ga0207664_10739278 Ga0207664_107392782 171
598 3300025944 Ga0207661_10004491 Ga0207661_100044912 171
599 3300025945 Ga0207679_11246882 Ga0207679_112468822 171
600 3300026116 Ga0207674_10211700 Ga0207674_102117002 171
601 3300031901 Ga0307406_10413473 Ga0307406_104134732 171
602 3300039437 Ga0436365_0901407 Ga0436365_0901407_604_1140 171
603 3300046516 Ga0495628_0374403 Ga0495628_0374403_462_1016 171
604 3300048088 Ga0495602_0714098 Ga0495602_0714098_50_565 171
605 3300049571 Ga0501034_0016472 Ga0501034_0016472_5424_5939 171
606 3300049589 Ga0501073_0003614 Ga0501073_0003614_3235_3750 171
607 3300049593 Ga0501077_0003022 Ga0501077_0003022_2252_2767 171
608 3300049742 Ga0501080_0006051 Ga0501080_0006051_5441_5956 171
609 3300049823 Ga0501044_0124592 Ga0501044_0124592_1339_1854 171
610 3300054114 Ga0501084_0053996 Ga0501084_0053996_212_727 171
611 3300060353 Ga0501082_0010964 Ga0501082_0010964_6454_6969 171
612 iso_pu_bacteria 2643221681 2644457618 171
613 iso_pu_bacteria 2675903058 2676478505 171
614 iso_pu_bacteria 2827628540 2827629565 171
615 3300005327 Ga0070658_10000309 Ga0070658_100003099 172
616 3300005336 Ga0070680_100067439 Ga0070680_1000674392 172
617 3300005337 Ga0070682_100281829 Ga0070682_1002818292 172
618 3300005339 Ga0070660_100295253 Ga0070660_1002952532 172
619 3300005339 Ga0070660_100487434 Ga0070660_1004874342 172
620 3300005339 Ga0070660_101098857 Ga0070660_1010988571 172
621 3300005344 Ga0070661_100527228 Ga0070661_1005272282 172
622 3300005366 Ga0070659_100205854 Ga0070659_1002058541 172
623 3300005435 Ga0070714_100443111 Ga0070714_1004431112 172
624 3300005441 Ga0070700_100000088 Ga0070700_10000008829 172
625 3300005458 Ga0070681_10012690 Ga0070681_100126904 172
626 3300005530 Ga0070679_100015719 Ga0070679_1000157193 172
627 3300005563 Ga0068855_100080022 Ga0068855_1000800222 172
628 3300005577 Ga0068857_101183419 Ga0068857_1011834192 172
629 3300005578 Ga0068854_100229123 Ga0068854_1002291232 172
630 3300005616 Ga0068852_100192419 Ga0068852_1001924192 172
631 3300005937 Ga0081455_10716268 Ga0081455_107162681 172
632 3300006846 Ga0075430_100332627 Ga0075430_1003326272 172
633 3300009093 Ga0105240_10575666 Ga0105240_105756661 172
634 3300011119 Ga0105246_10925563 Ga0105246_109255632 172
635 3300013104 Ga0157370_10514312 Ga0157370_105143122 172
636 3300013105 Ga0157369_10029439 Ga0157369_100294391 172
637 3300013307 Ga0157372_10557029 Ga0157372_105570292 172
638 3300020070 Ga0206356_10089054 Ga0206356_100890542 172
639 3300020070 Ga0206356_11757810 Ga0206356_117578102 172
640 3300020082 Ga0206353_11201113 Ga0206353_112011131 172
641 3300022467 Ga0224712_10087884 Ga0224712_100878842 172
642 3300022467 Ga0224712_10140428 Ga0224712_101404282 172
643 3300025909 Ga0207705_10037876 Ga0207705_100378762 172
644 3300025912 Ga0207707_10083475 Ga0207707_100834753 172
645 3300025913 Ga0207695_10129714 Ga0207695_101297143 172
646 3300025913 Ga0207695_10138503 Ga0207695_101385032 172
647 3300025917 Ga0207660_10025206 Ga0207660_100252062 172
648 3300025919 Ga0207657_10037856 Ga0207657_100378564 172
649 3300025919 Ga0207657_10219579 Ga0207657_102195792 172
650 3300025919 Ga0207657_10673050 Ga0207657_106730501 172
651 3300025921 Ga0207652_10094714 Ga0207652_100947143 172
652 3300025932 Ga0207690_10178822 Ga0207690_101788222 172
653 3300025949 Ga0207667_10028642 Ga0207667_100286423 172
654 3300025949 Ga0207667_10137141 Ga0207667_101371413 172
655 3300025981 Ga0207640_11153974 Ga0207640_111539742 172
656 3300026075 Ga0207708_10000079 Ga0207708_1000007969 172
657 3300026116 Ga0207674_11228733 Ga0207674_112287331 172
658 3300026142 Ga0207698_10200205 Ga0207698_102002052 172
659 3300031691 Ga0316579_10138496 Ga0316579_101384962 172
660 3300031727 Ga0316576_10006868 Ga0316576_100068682 172
661 3300031728 Ga0316578_10000847 Ga0316578_100008479 172
662 3300032168 Ga0316593_10083840 Ga0316593_100838402 172
663 3300035398 Ga0316574_0011597 Ga0316574_0011597_906_1427 172
664 3300036647 Ga0316582_0394555 Ga0316582_0394555_315_836 172
665 3300036712 Ga0316584_0026290 Ga0316584_0026290_2193_2714 172
666 3300037312 Ga0395899_0282397 Ga0395899_0282397_139_663 172
667 3300037418 Ga0395900_0136094 Ga0395900_0136094_734_1258 172
668 3300037418 Ga0395900_0273082 Ga0395900_0273082_427_954 172
669 3300037466 Ga0395898_0052591 Ga0395898_0052591_580_1104 172
670 3300037466 Ga0395898_0149465 Ga0395898_0149465_828_1355 172
671 3300038443 Ga0395901_0071769 Ga0395901_0071769_1238_1765 172
672 3300039062 Ga0400483_180869 Ga0400483_180869_190_708 172
673 3300044684 Ga0466966_0066424 Ga0466966_0066424_109_633 172
674 3300044684 Ga0466966_0126542 Ga0466966_0126542_467_991 172
675 3300044684 Ga0466966_0182261 Ga0466966_0182261_574_1101 172
676 3300044693 Ga0466961_0112809 Ga0466961_0112809_481_1008 172
677 3300044694 Ga0466963_0072668 Ga0466963_0072668_70_588 172
678 3300044706 Ga0466964_0007124 Ga0466964_0007124_3033_3551 172
679 3300044719 Ga0466971_0003697 Ga0466971_0003697_372_896 172
680 3300044765 Ga0466970_0242430 Ga0466970_0242430_355_882 172
681 3300044901 Ga0466960_0455075 Ga0466960_0455075_53_577 172
682 3300045049 Ga0466959_0065780 Ga0466959_0065780_969_1496 172
683 3300045049 Ga0466959_0101880 Ga0466959_0101880_913_1437 172
684 3300045836 Ga0466958_0148430 Ga0466958_0148430_683_1210 172
685 3300045976 Ga0466967_0003568 Ga0466967_0003568_6428_6946 172
686 3300049569 Ga0501032_0172242 Ga0501032_0172242_743_1267 172
687 3300049569 Ga0501032_0248127 Ga0501032_0248127_539_1096 172
688 3300049571 Ga0501034_0012389 Ga0501034_0012389_4854_5378 172
689 3300049572 Ga0501036_0003988 Ga0501036_0003988_927_1451 172
690 3300049572 Ga0501036_0005800 Ga0501036_0005800_5106_5663 172
691 3300049573 Ga0501037_0040461 Ga0501037_0040461_2118_2642 172
692 3300049574 Ga0501038_0011612 Ga0501038_0011612_3421_3945 172
693 3300049575 Ga0501039_0145977 Ga0501039_0145977_924_1448 172
694 3300049575 Ga0501039_0323408 Ga0501039_0323408_366_923 172
695 3300049578 Ga0501042_0014432 Ga0501042_0014432_2339_2896 172
696 3300049578 Ga0501042_0067894 Ga0501042_0067894_1243_1767 172
697 3300049579 Ga0501043_0004811 Ga0501043_0004811_6146_6670 172
698 3300049581 Ga0501047_0134926 Ga0501047_0134926_587_1111 172
699 3300049582 Ga0501048_0033844 Ga0501048_0033844_3028_3552 172
700 3300049586 Ga0501070_0001739 Ga0501070_0001739_2353_2877 172
701 3300049586 Ga0501070_0125781 Ga0501070_0125781_87_611 172
702 3300049588 Ga0501072_0007372 Ga0501072_0007372_6649_7206 172
703 3300049589 Ga0501073_0036440 Ga0501073_0036440_1123_1647 172
704 3300049590 Ga0501074_0005637 Ga0501074_0005637_375_899 172
705 3300049742 Ga0501080_0052200 Ga0501080_0052200_838_1395 172
706 3300049822 Ga0501035_0175592 Ga0501035_0175592_401_958 172
707 3300049823 Ga0501044_0078049 Ga0501044_0078049_1898_2422 172
708 3300049823 Ga0501044_1466643 Ga0501044_1466643_11_535 172
709 3300049824 Ga0501045_0057095 Ga0501045_0057095_176_733 172
710 3300050491 nmdc:mga00v17_349589_c1 nmdc:mga00v17_349589_c1_127_654 172
711 3300050492 nmdc:mga0yw44_80156_c1 nmdc:mga0yw44_80156_c1_1073_1597 172
712 3300050510 nmdc:mga06r32_62849_c1 nmdc:mga06r32_62849_c1_2627_3145 172
713 3300059424 Ga0590075_023586 Ga0590075_023586_792_1316 172
714 3300059510 Ga0587090_078938 Ga0587090_078938_67_591 172
715 3300061719 Ga0466962_0050276 Ga0466962_0050276_844_1368 172
716 iso_pu_bacteria 2643221561 2643828177 172
717 iso_pu_bacteria 2643221696 2644531266 172
718 3300005335 Ga0070666_10004975 Ga0070666_100049754 173
719 3300005347 Ga0070668_100152106 Ga0070668_1001521062 173
720 3300005354 Ga0070675_100706953 Ga0070675_1007069532 173
721 3300005355 Ga0070671_100065944 Ga0070671_1000659443 173
722 3300005356 Ga0070674_100564144 Ga0070674_1005641441 173
723 3300005367 Ga0070667_100004070 Ga0070667_1000040704 173
724 3300005367 Ga0070667_100152181 Ga0070667_1001521812 173
725 3300005441 Ga0070700_100729470 Ga0070700_1007294702 173
726 3300005543 Ga0070672_100922743 Ga0070672_1009227432 173
727 3300005548 Ga0070665_100000754 Ga0070665_10000075431 173
728 3300005841 Ga0068863_100024453 Ga0068863_1000244536 173
729 3300005842 Ga0068858_100014693 Ga0068858_1000146938 173
730 3300005843 Ga0068860_100000134 Ga0068860_10000013427 173
731 3300009093 Ga0105240_11031374 Ga0105240_110313741 173
732 3300010375 Ga0105239_10251546 Ga0105239_102515463 173
733 3300020069 Ga0197907_10338604 Ga0197907_103386041 173
734 3300025903 Ga0207680_10003699 Ga0207680_100036997 173
735 3300025904 Ga0207647_10350905 Ga0207647_103509051 173
736 3300025920 Ga0207649_10913919 Ga0207649_109139191 173
737 3300025929 Ga0207664_10125472 Ga0207664_101254722 173
738 3300025931 Ga0207644_10097663 Ga0207644_100976632 173
739 3300025934 Ga0207686_10868050 Ga0207686_108680501 173
740 3300025986 Ga0207658_10035711 Ga0207658_100357111 173
741 3300025986 Ga0207658_10191433 Ga0207658_101914332 173
742 3300026035 Ga0207703_10036141 Ga0207703_100361412 173
743 3300026088 Ga0207641_10255119 Ga0207641_102551192 173
744 3300026121 Ga0207683_10353678 Ga0207683_103536782 173
745 3300028379 Ga0268266_10007568 Ga0268266_100075689 173
746 3300028381 Ga0268264_10000206 Ga0268264_1000020692 173
747 3300031727 Ga0316576_10019948 Ga0316576_100199483 173
748 3300031728 Ga0316578_10015874 Ga0316578_100158743 173
749 3300032137 Ga0316585_10043168 Ga0316585_100431682 173
750 3300032139 Ga0316580_10112688 Ga0316580_101126881 173
751 3300033541 Ga0316596_1006402 Ga0316596_10064022 173
752 3300036647 Ga0316582_0261372 Ga0316582_0261372_85_609 173
753 3300036712 Ga0316584_0056317 Ga0316584_0056317_1111_1635 173
754 3300041452 Ga0451793_1664778 Ga0451793_1664778_212_739 173
755 3300041456 Ga0451795_0232519 Ga0451795_0232519_51_578 173
756 3300041491 Ga0451833_0792302 Ga0451833_0792302_43_570 173
757 3300044684 Ga0466966_0014054 Ga0466966_0014054_2636_3160 173
758 3300044684 Ga0466966_0099549 Ga0466966_0099549_1153_1677 173
759 3300044693 Ga0466961_0094509 Ga0466961_0094509_917_1441 173
760 3300044693 Ga0466961_0211703 Ga0466961_0211703_323_847 173
761 3300044694 Ga0466963_0337801 Ga0466963_0337801_55_579 173
762 3300044694 Ga0466963_0371587 Ga0466963_0371587_205_729 173
763 3300044706 Ga0466964_0022666 Ga0466964_0022666_500_1024 173
764 3300044706 Ga0466964_0472335 Ga0466964_0472335_74_598 173
765 3300044719 Ga0466971_0413739 Ga0466971_0413739_51_575 173
766 3300045836 Ga0466958_0011282 Ga0466958_0011282_1544_2068 173
767 3300045836 Ga0466958_0094333 Ga0466958_0094333_908_1432 173
768 3300045976 Ga0466967_0344713 Ga0466967_0344713_192_716 173
769 3300045976 Ga0466967_1313871 Ga0466967_1313871_29_553 173
770 3300046529 Ga0495652_0311245 Ga0495652_0311245_367_891 173
771 3300048904 Ga0496101_0201491 Ga0496101_0201491_232_756 173
772 3300048905 Ga0496102_0710582 Ga0496102_0710582_83_607 173
773 3300048911 Ga0496108_0165443 Ga0496108_0165443_390_914 173
774 3300048913 Ga0496110_0313688 Ga0496110_0313688_541_1065 173
775 3300048917 Ga0496114_0275360 Ga0496114_0275360_201_725 173
776 3300048918 Ga0496115_0547118 Ga0496115_0547118_175_699 173
777 3300049575 Ga0501039_0064427 Ga0501039_0064427_970_1494 173
778 3300049576 Ga0501040_0112194 Ga0501040_0112194_1145_1669 173
779 3300049577 Ga0501041_0238582 Ga0501041_0238582_305_829 173
780 3300049580 Ga0501046_0091598 Ga0501046_0091598_836_1360 173
781 3300049581 Ga0501047_0021831 Ga0501047_0021831_1119_1643 173
782 3300049583 Ga0501067_0001635 Ga0501067_0001635_7157_7684 173
783 3300049583 Ga0501067_0073593 Ga0501067_0073593_359_907 173
784 3300049584 Ga0501068_0148853 Ga0501068_0148853_513_1040 173
785 3300049591 Ga0501075_0353985 Ga0501075_0353985_82_606 173
786 3300049823 Ga0501044_0011917 Ga0501044_0011917_2495_3019 173
787 iso_pu_bacteria 2643221604 2644034022 173
788 iso_pu_bacteria 2643221617 2644099547 173
789 iso_pu_bacteria 2643221620 2644116260 173
790 iso_pu_bacteria 2738541305 2738871631 173
791 iso_pu_bacteria 2811994874 2812333923 173
792 iso_pu_bacteria 2857481737 2857483529 173
793 iso_pu_bacteria 8054609563 8054612424 173
794 3300005435 Ga0070714_100000525 Ga0070714_1000005258 174
795 3300005616 Ga0068852_100263270 Ga0068852_1002632702 174
796 3300005937 Ga0081455_10000134 Ga0081455_1000013464 174
797 3300005937 Ga0081455_10002407 Ga0081455_100024074 174
798 3300006038 Ga0075365_10494291 Ga0075365_104942911 174
799 3300006844 Ga0075428_100013282 Ga0075428_1000132826 174
800 3300006846 Ga0075430_100098568 Ga0075430_1000985682 174
801 3300006846 Ga0075430_100128130 Ga0075430_1001281302 174
802 3300006847 Ga0075431_100002532 Ga0075431_10000253215 174
803 3300006847 Ga0075431_100039232 Ga0075431_1000392322 174
804 3300006880 Ga0075429_100007033 Ga0075429_1000070333 174
805 3300006946 Ga0079104_1004462 Ga0079104_10044627 174
806 3300009094 Ga0111539_10192655 Ga0111539_101926552 174
807 3300009147 Ga0114129_10078312 Ga0114129_100783122 174
808 3300009177 Ga0105248_10729754 Ga0105248_107297541 174
809 3300009545 Ga0105237_10293689 Ga0105237_102936892 174
810 3300009551 Ga0105238_10103133 Ga0105238_101031332 174
811 3300013104 Ga0157370_10104374 Ga0157370_101043743 174
812 3300013296 Ga0157374_10307896 Ga0157374_103078962 174
813 3300013297 Ga0157378_10247535 Ga0157378_102475352 174
814 3300013307 Ga0157372_10000057 Ga0157372_10000057110 174
815 3300013307 Ga0157372_11031498 Ga0157372_110314982 174
816 3300025909 Ga0207705_10563486 Ga0207705_105634862 174
817 3300025913 Ga0207695_10714084 Ga0207695_107140841 174
818 3300025924 Ga0207694_10077535 Ga0207694_100775352 174
819 3300025927 Ga0207687_10215980 Ga0207687_102159802 174
820 3300025927 Ga0207687_10827763 Ga0207687_108277632 174
821 3300025929 Ga0207664_10000047 Ga0207664_100000478 174
822 3300025940 Ga0207691_10609752 Ga0207691_106097522 174
823 3300027907 Ga0207428_10032991 Ga0207428_100329912 174
824 3300030733 Ga0314311_1058424 Ga0314311_10584241 174
825 3300031665 Ga0316575_10000007 Ga0316575_1000000761 174
826 3300031727 Ga0316576_10000924 Ga0316576_1000092412 174
827 3300031728 Ga0316578_10023055 Ga0316578_100230553 174
828 3300032168 Ga0316593_10101654 Ga0316593_101016542 174
829 3300035398 Ga0316574_0009181 Ga0316574_0009181_3459_3983 174
830 3300036712 Ga0316584_0085295 Ga0316584_0085295_993_1517 174
831 3300037853 Ga0436364_0627922 Ga0436364_0627922_572_1117 174
832 3300041494 Ga0451837_1753042 Ga0451837_1753042_32_562 174
833 3300044683 Ga0466965_0151038 Ga0466965_0151038_560_1099 174
834 3300044901 Ga0466960_0071805 Ga0466960_0071805_382_921 174
835 3300045049 Ga0466959_0821819 Ga0466959_0821819_19_558 174
836 3300046522 Ga0495643_0327822 Ga0495643_0327822_130_678 174
837 3300048908 Ga0496105_0571702 Ga0496105_0571702_38_589 174
838 3300048916 Ga0496113_0721055 Ga0496113_0721055_258_785 174
839 3300048917 Ga0496114_0158228 Ga0496114_0158228_60_599 174
840 3300048917 Ga0496114_0191105 Ga0496114_0191105_143_691 174
841 3300048925 Ga0496122_0073701 Ga0496122_0073701_573_1106 174
842 3300048926 Ga0496123_0043590 Ga0496123_0043590_2529_3062 174
843 3300049568 Ga0501031_0330207 Ga0501031_0330207_43_579 174
844 3300049569 Ga0501032_0017506 Ga0501032_0017506_618_1154 174
845 3300049571 Ga0501034_0089184 Ga0501034_0089184_1536_2072 174
846 3300049572 Ga0501036_0013945 Ga0501036_0013945_2063_2599 174
847 3300049573 Ga0501037_0028153 Ga0501037_0028153_2798_3334 174
848 3300049574 Ga0501038_0030042 Ga0501038_0030042_4026_4562 174
849 3300049575 Ga0501039_0007694 Ga0501039_0007694_5689_6225 174
850 3300049578 Ga0501042_0016724 Ga0501042_0016724_3661_4197 174
851 3300049579 Ga0501043_0042257 Ga0501043_0042257_1268_1804 174
852 3300049584 Ga0501068_0178277 Ga0501068_0178277_262_798 174
853 3300049587 Ga0501071_0011824 Ga0501071_0011824_3349_3885 174
854 3300049588 Ga0501072_0006559 Ga0501072_0006559_6149_6685 174
855 3300049592 Ga0501076_0030665 Ga0501076_0030665_2050_2586 174
856 3300049593 Ga0501077_0025215 Ga0501077_0025215_250_786 174
857 3300049742 Ga0501080_0291213 Ga0501080_0291213_789_1325 174
858 3300049743 Ga0501081_0033526 Ga0501081_0033526_928_1464 174
859 3300049822 Ga0501035_0099200 Ga0501035_0099200_1288_1824 174
860 3300049824 Ga0501045_0028523 Ga0501045_0028523_2015_2551 174
861 3300050492 nmdc:mga0yw44_459492_c1 nmdc:mga0yw44_459492_c1_275_808 174
862 3300050507 nmdc:mga05p37_1355_c1 nmdc:mga05p37_1355_c1_6139_6663 174
863 3300050508 nmdc:mga09592_1246_c1 nmdc:mga09592_1246_c1_13141_13665 174
864 3300050509 nmdc:mga0qj67_63851_c1 nmdc:mga0qj67_63851_c1_1813_2337 174
865 3300050509 nmdc:mga0qj67_9421_c1 nmdc:mga0qj67_9421_c1_6421_6945 174
866 3300050510 nmdc:mga06r32_13884_c1 nmdc:mga06r32_13884_c1_671_1195 174
867 3300050510 nmdc:mga06r32_761_c1 nmdc:mga06r32_761_c1_6383_6907 174
868 3300050511 nmdc:mga08y16_39322_c1 nmdc:mga08y16_39322_c1_2013_2537 174
869 3300054114 Ga0501084_0024881 Ga0501084_0024881_4076_4612 174
870 3300060353 Ga0501082_0036004 Ga0501082_0036004_2864_3400 174
871 3300061734 Ga0530510_0079212 Ga0530510_0079212_1604_2140 174
872 iso_pu_bacteria 2643221576 2643893252 174
873 iso_pu_bacteria 2643221590 2643961689 174
874 iso_pu_bacteria 2855386786 2855387519 174
875 iso_pu_bacteria 2984576629 2984579186 174
876 iso_pu_bacteria 2990256926 2990259921 174
877 3300005356 Ga0070674_100105070 Ga0070674_1001050702 175
878 3300005456 Ga0070678_100379920 Ga0070678_1003799202 175
879 3300009177 Ga0105248_10766577 Ga0105248_107665772 175
880 3300010375 Ga0105239_12307704 Ga0105239_123077041 175
881 3300013306 Ga0163162_10345938 Ga0163162_103459382 175
882 3300025901 Ga0207688_10509919 Ga0207688_105099191 175
883 3300025904 Ga0207647_10053815 Ga0207647_100538153 175
884 3300025912 Ga0207707_11005839 Ga0207707_110058391 175
885 3300025917 Ga0207660_10218830 Ga0207660_102188302 175
886 3300025937 Ga0207669_10130485 Ga0207669_101304852 175
887 3300025972 Ga0207668_10409262 Ga0207668_104092621 175
888 3300026121 Ga0207683_10161393 Ga0207683_101613932 175
889 3300026142 Ga0207698_11135470 Ga0207698_111354702 175
890 3300028379 Ga0268266_10587352 Ga0268266_105873522 175
891 3300037312 Ga0395899_0012950 Ga0395899_0012950_4112_4660 175
892 3300037418 Ga0395900_0078843 Ga0395900_0078843_2748_3296 175
893 3300037466 Ga0395898_0053847 Ga0395898_0053847_614_1162 175
894 3300041458 Ga0451798_0836924 Ga0451798_0836924_126_677 175
895 3300041459 Ga0451800_0033403 Ga0451800_0033403_278_814 175
896 3300041494 Ga0451837_0625810 Ga0451837_0625810_677_1213 175
897 3300041512 Ga0451853_1725959 Ga0451853_1725959_404_940 175
898 3300044656 Ga0466969_0021281 Ga0466969_0021281_1627_2175 175
899 3300044683 Ga0466965_0339895 Ga0466965_0339895_151_690 175
900 3300044683 Ga0466965_0387016 Ga0466965_0387016_151_699 175
901 3300044684 Ga0466966_0050102 Ga0466966_0050102_1899_2447 175
902 3300044693 Ga0466961_0011228 Ga0466961_0011228_581_1129 175
903 3300044842 Ga0466957_0192294 Ga0466957_0192294_135_683 175
904 3300045049 Ga0466959_0749684 Ga0466959_0749684_83_631 175
905 3300045976 Ga0466967_0318478 Ga0466967_0318478_147_695 175
906 3300045976 Ga0466967_0669662 Ga0466967_0669662_235_771 175
907 3300046515 Ga0495620_0062145 Ga0495620_0062145_168_701 175
908 3300048903 Ga0496100_0402301 Ga0496100_0402301_393_929 175
909 3300048908 Ga0496105_0214530 Ga0496105_0214530_820_1356 175
910 3300048913 Ga0496110_0106140 Ga0496110_0106140_1909_2445 175
911 3300048918 Ga0496115_0028842 Ga0496115_0028842_1122_1658 175
912 3300048929 Ga0496126_0144272 Ga0496126_0144272_190_726 175
913 3300049586 Ga0501070_0161322 Ga0501070_0161322_1095_1631 175
914 3300061719 Ga0466962_0045609 Ga0466962_0045609_459_1007 175
915 iso_pu_bacteria 2643221641 2644231364 175
916 3300005468 Ga0070707_100091317 Ga0070707_1000913172 176
917 3300005471 Ga0070698_100073014 Ga0070698_1000730142 176
918 3300013105 Ga0157369_11435316 Ga0157369_114353162 176
919 3300013105 Ga0157369_11811647 Ga0157369_118116471 176
920 3300013307 Ga0157372_10831065 Ga0157372_108310652 176
921 3300032002 Ga0307416_100763407 Ga0307416_1007634072 176
922 3300037853 Ga0436364_1394950 Ga0436364_1394950_12_554 176
923 3300041404 Ga0439436_0044236 Ga0439436_0044236_104_643 176
924 3300041407 Ga0439447_024330 Ga0439447_024330_352_891 176
925 3300041413 Ga0439465_0052509 Ga0439465_0052509_757_1296 176
926 3300042156 Ga0439446_0070043 Ga0439446_0070043_154_693 176
927 3300042184 Ga0450908_014888 Ga0450908_014888_597_1136 176
928 3300042435 Ga0439434_0003171 Ga0439434_0003171_2053_2592 176
929 3300042435 Ga0439434_0153358 Ga0439434_0153358_113_652 176
930 3300045976 Ga0466967_0070979 Ga0466967_0070979_1228_1764 176
931 3300049589 Ga0501073_0103600 Ga0501073_0103600_448_981 176
932 3300049590 Ga0501074_0191414 Ga0501074_0191414_110_643 176
933 3300049590 Ga0501074_0419878 Ga0501074_0419878_250_789 176
934 3300054114 Ga0501084_0328073 Ga0501084_0328073_550_1086 176
935 3300005329 Ga0070683_100309195 Ga0070683_1003091952 177
936 3300005333 Ga0070677_10286521 Ga0070677_102865212 177
937 3300005347 Ga0070668_100203316 Ga0070668_1002033161 177
938 3300005355 Ga0070671_100328830 Ga0070671_1003288302 177
939 3300005366 Ga0070659_100693867 Ga0070659_1006938671 177
940 3300005435 Ga0070714_100017121 Ga0070714_1000171213 177
941 3300005456 Ga0070678_100533608 Ga0070678_1005336082 177
942 3300005456 Ga0070678_100606373 Ga0070678_1006063732 177
943 3300005548 Ga0070665_100001179 Ga0070665_10000117917 177
944 3300005615 Ga0070702_100134723 Ga0070702_1001347232 177
945 3300005616 Ga0068852_100464073 Ga0068852_1004640732 177
946 3300005718 Ga0068866_10206463 Ga0068866_102064631 177
947 3300005840 Ga0068870_10398846 Ga0068870_103988462 177
948 3300005843 Ga0068860_100000357 Ga0068860_1000003575 177
949 3300006038 Ga0075365_10002919 Ga0075365_100029193 177
950 3300006038 Ga0075365_10108600 Ga0075365_101086002 177
951 3300006038 Ga0075365_10168331 Ga0075365_101683312 177
952 3300006038 Ga0075365_10193863 Ga0075365_101938632 177
953 3300006038 Ga0075365_10305257 Ga0075365_103052572 177
954 3300006038 Ga0075365_10356304 Ga0075365_103563042 177
955 3300006038 Ga0075365_10360204 Ga0075365_103602042 177
956 3300006038 Ga0075365_10380748 Ga0075365_103807482 177
957 3300006038 Ga0075365_10392102 Ga0075365_103921022 177
958 3300006038 Ga0075365_10411627 Ga0075365_104116272 177
959 3300006042 Ga0075368_10021578 Ga0075368_100215782 177
960 3300006042 Ga0075368_10053871 Ga0075368_100538712 177
961 3300006042 Ga0075368_10173081 Ga0075368_101730812 177
962 3300006048 Ga0075363_100014711 Ga0075363_1000147113 177
963 3300006048 Ga0075363_100045195 Ga0075363_1000451952 177
964 3300006048 Ga0075363_100138596 Ga0075363_1001385962 177
965 3300006048 Ga0075363_100313741 Ga0075363_1003137412 177
966 3300006051 Ga0075364_10004748 Ga0075364_1000474811 177
967 3300006051 Ga0075364_10077439 Ga0075364_100774392 177
968 3300006051 Ga0075364_10133631 Ga0075364_101336312 177
969 3300006051 Ga0075364_10190898 Ga0075364_101908981 177
970 3300006051 Ga0075364_10196313 Ga0075364_101963132 177
971 3300006051 Ga0075364_10569083 Ga0075364_105690832 177
972 3300006177 Ga0075362_10013735 Ga0075362_100137353 177
973 3300006178 Ga0075367_10011121 Ga0075367_100111212 177
974 3300006178 Ga0075367_10106317 Ga0075367_101063172 177
975 3300006178 Ga0075367_10180950 Ga0075367_101809502 177
976 3300006178 Ga0075367_10225088 Ga0075367_102250882 177
977 3300006178 Ga0075367_10375296 Ga0075367_103752962 177
978 3300006353 Ga0075370_10016140 Ga0075370_100161404 177
979 3300006353 Ga0075370_10168154 Ga0075370_101681542 177
980 3300006353 Ga0075370_10509462 Ga0075370_105094622 177
981 3300009148 Ga0105243_10335091 Ga0105243_103350912 177
982 3300009553 Ga0105249_10324550 Ga0105249_103245502 177
983 3300014325 Ga0163163_10154683 Ga0163163_101546832 177
984 3300014326 Ga0157380_10183016 Ga0157380_101830162 177
985 3300014326 Ga0157380_11365402 Ga0157380_113654022 177
986 3300014745 Ga0157377_10041633 Ga0157377_100416332 177
987 3300014968 Ga0157379_10458368 Ga0157379_104583682 177
988 3300014968 Ga0157379_11361857 Ga0157379_113618572 177
989 3300014969 Ga0157376_10739258 Ga0157376_107392581 177
990 3300017792 Ga0163161_10385792 Ga0163161_103857922 177
991 3300017792 Ga0163161_10390200 Ga0163161_103902002 177
992 3300025907 Ga0207645_10077321 Ga0207645_100773212 177
993 3300025908 Ga0207643_10210658 Ga0207643_102106582 177
994 3300025918 Ga0207662_10230374 Ga0207662_102303741 177
995 3300025923 Ga0207681_10312614 Ga0207681_103126142 177
996 3300025929 Ga0207664_10028755 Ga0207664_100287553 177
997 3300025931 Ga0207644_10401217 Ga0207644_104012172 177
998 3300025932 Ga0207690_10397311 Ga0207690_103973112 177
999 3300025935 Ga0207709_10359428 Ga0207709_103594282 177
1000 3300025937 Ga0207669_10434741 Ga0207669_104347412 177
1001 3300025938 Ga0207704_10506687 Ga0207704_105066871 177
1002 3300025941 Ga0207711_10355511 Ga0207711_103555112 177
1003 3300025961 Ga0207712_10555396 Ga0207712_105553961 177
1004 3300026116 Ga0207674_10522338 Ga0207674_105223382 177
1005 3300026118 Ga0207675_100557654 Ga0207675_1005576541 177
1006 3300026121 Ga0207683_10924848 Ga0207683_109248482 177
1007 3300027866 Ga0209813_10028595 Ga0209813_100285952 177
1008 3300027866 Ga0209813_10078227 Ga0209813_100782272 177
1009 3300028379 Ga0268266_10001751 Ga0268266_1000175121 177
1010 3300028381 Ga0268264_10000242 Ga0268264_1000024293 177
1011 3300028381 Ga0268264_11424082 Ga0268264_114240821 177
1012 3300031731 Ga0307405_10627765 Ga0307405_106277651 177
1013 3300031852 Ga0307410_10018609 Ga0307410_100186093 177
1014 3300031852 Ga0307410_10873506 Ga0307410_108735062 177
1015 3300031901 Ga0307406_10029929 Ga0307406_100299293 177
1016 3300031901 Ga0307406_10163516 Ga0307406_101635162 177
1017 3300031901 Ga0307406_10813959 Ga0307406_108139592 177
1018 3300031903 Ga0307407_10054629 Ga0307407_100546292 177
1019 3300031995 Ga0307409_100025490 Ga0307409_1000254902 177
1020 3300031995 Ga0307409_100564308 Ga0307409_1005643082 177
1021 3300031995 Ga0307409_100604793 Ga0307409_1006047932 177
1022 3300031995 Ga0307409_100909318 Ga0307409_1009093182 177
1023 3300032002 Ga0307416_101317125 Ga0307416_1013171252 177
1024 3300032005 Ga0307411_10047739 Ga0307411_100477393 177
1025 3300032126 Ga0307415_100012020 Ga0307415_1000120203 177
1026 3300032126 Ga0307415_100251065 Ga0307415_1002510652 177
1027 3300032126 Ga0307415_101446913 Ga0307415_1014469132 177
1028 3300037312 Ga0395899_0134696 Ga0395899_0134696_1045_1584 177
1029 3300037418 Ga0395900_0038706 Ga0395900_0038706_4072_4611 177
1030 3300037418 Ga0395900_0077838 Ga0395900_0077838_857_1396 177
1031 3300037466 Ga0395898_0125694 Ga0395898_0125694_93_632 177
1032 3300037466 Ga0395898_0448767 Ga0395898_0448767_133_672 177
1033 3300037466 Ga0395898_0777704 Ga0395898_0777704_99_638 177
1034 3300037466 Ga0395898_0914131 Ga0395898_0914131_219_761 177
1035 3300037471 Ga0395905_0390723 Ga0395905_0390723_257_796 177
1036 3300038443 Ga0395901_0243234 Ga0395901_0243234_479_1018 177
1037 3300041505 Ga0451849_0090656 Ga0451849_0090656_73_612 177
1038 3300041512 Ga0451853_2569345 Ga0451853_2569345_479_1018 177
1039 3300042146 Ga0450907_013349 Ga0450907_013349_651_1223 177
1040 3300044658 Ga0466972_0019445 Ga0466972_0019445_2755_3309 177
1041 3300044658 Ga0466972_0063472 Ga0466972_0063472_875_1414 177
1042 3300044658 Ga0466972_0085237 Ga0466972_0085237_539_1093 177
1043 3300044683 Ga0466965_0057761 Ga0466965_0057761_1112_1666 177
1044 3300044683 Ga0466965_0076284 Ga0466965_0076284_131_685 177
1045 3300044683 Ga0466965_0147481 Ga0466965_0147481_513_1067 177
1046 3300044683 Ga0466965_0530697 Ga0466965_0530697_93_632 177
1047 3300044684 Ga0466966_0054227 Ga0466966_0054227_899_1471 177
1048 3300044684 Ga0466966_0279087 Ga0466966_0279087_430_984 177
1049 3300044693 Ga0466961_0048947 Ga0466961_0048947_1016_1570 177
1050 3300044706 Ga0466964_0060508 Ga0466964_0060508_813_1385 177
1051 3300044719 Ga0466971_0015494 Ga0466971_0015494_688_1260 177
1052 3300044735 Ga0466968_0056596 Ga0466968_0056596_362_910 177
1053 3300044765 Ga0466970_0029005 Ga0466970_0029005_721_1275 177
1054 3300044765 Ga0466970_0034202 Ga0466970_0034202_317_871 177
1055 3300044765 Ga0466970_0047773 Ga0466970_0047773_1506_2060 177
1056 3300044765 Ga0466970_0064300 Ga0466970_0064300_1138_1710 177
1057 3300044765 Ga0466970_0067318 Ga0466970_0067318_193_732 177
1058 3300044765 Ga0466970_0219028 Ga0466970_0219028_87_626 177
1059 3300044765 Ga0466970_0275576 Ga0466970_0275576_26_580 177
1060 3300044842 Ga0466957_0020399 Ga0466957_0020399_1834_2406 177
1061 3300044901 Ga0466960_0005943 Ga0466960_0005943_2436_2984 177
1062 3300044901 Ga0466960_0015763 Ga0466960_0015763_1765_2304 177
1063 3300044901 Ga0466960_0048446 Ga0466960_0048446_618_1157 177
1064 3300044901 Ga0466960_0053519 Ga0466960_0053519_1130_1684 177
1065 3300044901 Ga0466960_0201598 Ga0466960_0201598_131_703 177
1066 3300044901 Ga0466960_0450161 Ga0466960_0450161_12_566 177
1067 3300045049 Ga0466959_0160452 Ga0466959_0160452_382_954 177
1068 3300045049 Ga0466959_0478407 Ga0466959_0478407_81_620 177
1069 3300045976 Ga0466967_0124421 Ga0466967_0124421_1731_2285 177
1070 3300045976 Ga0466967_0702254 Ga0466967_0702254_300_857 177
1071 3300045976 Ga0466967_0840288 Ga0466967_0840288_250_789 177
1072 3300046461 Ga0495641_0188925 Ga0495641_0188925_189_728 177
1073 3300048905 Ga0496102_0784897 Ga0496102_0784897_216_755 177
1074 3300048906 Ga0496103_0135482 Ga0496103_0135482_549_1103 177
1075 3300048911 Ga0496108_0316807 Ga0496108_0316807_57_596 177
1076 3300048913 Ga0496110_0424569 Ga0496110_0424569_128_667 177
1077 3300048913 Ga0496110_0460576 Ga0496110_0460576_399_938 177
1078 3300048913 Ga0496110_0523794 Ga0496110_0523794_239_781 177
1079 3300048915 Ga0496112_1084025 Ga0496112_1084025_139_672 177
1080 3300048927 Ga0496124_0207769 Ga0496124_0207769_475_1014 177
1081 3300049162 Ga0501307_014333 Ga0501307_014333_266_805 177
1082 3300049527 Ga0501311_013934 Ga0501311_013934_326_865 177
1083 3300049527 Ga0501311_037643 Ga0501311_037643_87_626 177
1084 3300049532 Ga0501316_009947 Ga0501316_009947_322_861 177
1085 3300049533 Ga0501317_019743 Ga0501317_019743_49_588 177
1086 3300049537 Ga0501321_033306 Ga0501321_033306_117_656 177
1087 3300049541 Ga0501325_007861 Ga0501325_007861_264_803 177
1088 3300049568 Ga0501031_0433463 Ga0501031_0433463_101_652 177
1089 3300049569 Ga0501032_0003214 Ga0501032_0003214_2446_2994 177
1090 3300049570 Ga0501033_0003357 Ga0501033_0003357_3727_4275 177
1091 3300049570 Ga0501033_0101778 Ga0501033_0101778_768_1316 177
1092 3300049570 Ga0501033_0505017 Ga0501033_0505017_234_782 177
1093 3300049571 Ga0501034_0123667 Ga0501034_0123667_797_1345 177
1094 3300049572 Ga0501036_0054602 Ga0501036_0054602_817_1365 177
1095 3300049572 Ga0501036_0061660 Ga0501036_0061660_990_1538 177
1096 3300049572 Ga0501036_0588375 Ga0501036_0588375_198_737 177
1097 3300049573 Ga0501037_0010219 Ga0501037_0010219_5038_5586 177
1098 3300049573 Ga0501037_0390543 Ga0501037_0390543_310_858 177
1099 3300049573 Ga0501037_0429767 Ga0501037_0429767_313_855 177
1100 3300049574 Ga0501038_0000864 Ga0501038_0000864_810_1358 177
1101 3300049574 Ga0501038_0006843 Ga0501038_0006843_1399_1947 177
1102 3300049574 Ga0501038_0069746 Ga0501038_0069746_1577_2128 177
1103 3300049575 Ga0501039_0014673 Ga0501039_0014673_5389_5937 177
1104 3300049575 Ga0501039_0120818 Ga0501039_0120818_974_1516 177
1105 3300049578 Ga0501042_0100534 Ga0501042_0100534_1248_1796 177
1106 3300049579 Ga0501043_0058990 Ga0501043_0058990_44_592 177
1107 3300049580 Ga0501046_0000184 Ga0501046_0000184_50089_50637 177
1108 3300049580 Ga0501046_0006246 Ga0501046_0006246_849_1397 177
1109 3300049580 Ga0501046_0195025 Ga0501046_0195025_427_975 177
1110 3300049581 Ga0501047_0057617 Ga0501047_0057617_893_1441 177
1111 3300049581 Ga0501047_0132208 Ga0501047_0132208_428_976 177
1112 3300049582 Ga0501048_0099412 Ga0501048_0099412_1394_1942 177
1113 3300049582 Ga0501048_0391346 Ga0501048_0391346_69_617 177
1114 3300049583 Ga0501067_0027893 Ga0501067_0027893_2151_2690 177
1115 3300049583 Ga0501067_0034472 Ga0501067_0034472_865_1404 177
1116 3300049584 Ga0501068_0069927 Ga0501068_0069927_556_1095 177
1117 3300049586 Ga0501070_0029069 Ga0501070_0029069_2466_3005 177
1118 3300049586 Ga0501070_0058424 Ga0501070_0058424_1900_2448 177
1119 3300049586 Ga0501070_0501239 Ga0501070_0501239_301_855 177
1120 3300049587 Ga0501071_0190442 Ga0501071_0190442_850_1389 177
1121 3300049588 Ga0501072_0144978 Ga0501072_0144978_170_709 177
1122 3300049589 Ga0501073_0120884 Ga0501073_0120884_878_1426 177
1123 3300049590 Ga0501074_0152295 Ga0501074_0152295_684_1232 177
1124 3300049591 Ga0501075_0538764 Ga0501075_0538764_79_624 177
1125 3300049592 Ga0501076_0278885 Ga0501076_0278885_618_1157 177
1126 3300049592 Ga0501076_0803567 Ga0501076_0803567_24_569 177
1127 3300049593 Ga0501077_0297006 Ga0501077_0297006_410_949 177
1128 3300049655 Ga0501208_026952 Ga0501208_026952_127_666 177
1129 3300049742 Ga0501080_0046788 Ga0501080_0046788_1505_2053 177
1130 3300049743 Ga0501081_0788843 Ga0501081_0788843_41_580 177
1131 3300049822 Ga0501035_0001566 Ga0501035_0001566_4315_4863 177
1132 3300049822 Ga0501035_0065902 Ga0501035_0065902_1774_2322 177
1133 3300049823 Ga0501044_0020750 Ga0501044_0020750_5637_6185 177
1134 3300049823 Ga0501044_0086636 Ga0501044_0086636_1021_1569 177
1135 3300049851 Ga0501212_013754 Ga0501212_013754_466_1005 177
1136 3300050489 nmdc:mga03683_195812_c1 nmdc:mga03683_195812_c1_94_630 177
1137 3300050489 nmdc:mga03683_32256_c1 nmdc:mga03683_32256_c1_55_612 177
1138 3300050490 nmdc:mga03n38_45567_c1 nmdc:mga03n38_45567_c1_129_665 177
1139 3300050490 nmdc:mga03n38_458984_c1 nmdc:mga03n38_458984_c1_141_677 177
1140 3300050491 nmdc:mga00v17_15733_c1 nmdc:mga00v17_15733_c1_2300_2839 177
1141 3300050491 nmdc:mga00v17_299355_c1 nmdc:mga00v17_299355_c1_139_678 177
1142 3300050491 nmdc:mga00v17_419978_c1 nmdc:mga00v17_419978_c1_25_564 177
1143 3300050491 nmdc:mga00v17_791720_c1 nmdc:mga00v17_791720_c1_45_584 177
1144 3300050491 nmdc:mga00v17_81024_c1 nmdc:mga00v17_81024_c1_1395_1931 177
1145 3300050491 nmdc:mga00v17_81537_c1 nmdc:mga00v17_81537_c1_125_661 177
1146 3300050491 nmdc:mga00v17_9684_c1 nmdc:mga00v17_9684_c1_697_1236 177
1147 3300050492 nmdc:mga0yw44_109982_c1 nmdc:mga0yw44_109982_c1_426_965 177
1148 3300050492 nmdc:mga0yw44_36854_c1 nmdc:mga0yw44_36854_c1_1994_2533 177
1149 3300050492 nmdc:mga0yw44_54651_c1 nmdc:mga0yw44_54651_c1_1861_2400 177
1150 3300050492 nmdc:mga0yw44_630921_c1 nmdc:mga0yw44_630921_c1_35_574 177
1151 3300050492 nmdc:mga0yw44_682783_c1 nmdc:mga0yw44_682783_c1_16_555 177
1152 3300050492 nmdc:mga0yw44_90654_c1 nmdc:mga0yw44_90654_c1_806_1345 177
1153 3300050492 nmdc:mga0yw44_9901_c1 nmdc:mga0yw44_9901_c1_688_1245 177
1154 3300050494 nmdc:mga06z11_139870_c1 nmdc:mga06z11_139870_c1_405_944 177
1155 3300050494 nmdc:mga06z11_5409_c1 nmdc:mga06z11_5409_c1_2045_2584 177
1156 3300050495 nmdc:mga04h51_33975_c1 nmdc:mga04h51_33975_c1_469_1008 177
1157 3300050496 nmdc:mga07m45_15705_c1 nmdc:mga07m45_15705_c1_3429_3965 177
1158 3300050496 nmdc:mga07m45_542540_c1 nmdc:mga07m45_542540_c1_19_558 177
1159 3300050496 nmdc:mga07m45_8666_c1 nmdc:mga07m45_8666_c1_182_739 177
1160 3300053088 Ga0500644_0181817 Ga0500644_0181817_17_556 177
1161 3300053140 Ga0500573_0007226 Ga0500573_0007226_563_1102 177
1162 3300053140 Ga0500573_0249319 Ga0500573_0249319_130_669 177
1163 3300059504 Ga0587082_083115 Ga0587082_083115_120_656 177
1164 3300059512 Ga0587092_008238 Ga0587092_008238_188_724 177
1165 3300060353 Ga0501082_0682436 Ga0501082_0682436_324_866 177
1166 iso_pu_bacteria 2643221615 2644090029 177
1167 iso_pu_bacteria 2643221657 2644319874 177
1168 3300001990 JGI24737J22298_10039812 JGI24737J22298_100398122 178
1169 3300002067 JGI24735J21928_10014015 JGI24735J21928_100140152 178
1170 3300005327 Ga0070658_10136667 Ga0070658_101366672 178
1171 3300005327 Ga0070658_10548451 Ga0070658_105484512 178
1172 3300005329 Ga0070683_100000365 Ga0070683_10000036511 178
1173 3300005329 Ga0070683_100064383 Ga0070683_1000643833 178
1174 3300005329 Ga0070683_100123383 Ga0070683_1001233831 178
1175 3300005329 Ga0070683_100362731 Ga0070683_1003627312 178
1176 3300005331 Ga0070670_101247016 Ga0070670_1012470161 178
1177 3300005335 Ga0070666_10377334 Ga0070666_103773341 178
1178 3300005336 Ga0070680_100178696 Ga0070680_1001786962 178
1179 3300005336 Ga0070680_100472595 Ga0070680_1004725951 178
1180 3300005337 Ga0070682_100000691 Ga0070682_10000069118 178
1181 3300005337 Ga0070682_100285508 Ga0070682_1002855081 178
1182 3300005337 Ga0070682_100723362 Ga0070682_1007233621 178
1183 3300005339 Ga0070660_100036967 Ga0070660_1000369674 178
1184 3300005339 Ga0070660_100075006 Ga0070660_1000750062 178
1185 3300005339 Ga0070660_100092060 Ga0070660_1000920602 178
1186 3300005343 Ga0070687_100542988 Ga0070687_1005429881 178
1187 3300005344 Ga0070661_100306210 Ga0070661_1003062101 178
1188 3300005354 Ga0070675_100539854 Ga0070675_1005398542 178
1189 3300005366 Ga0070659_100077895 Ga0070659_1000778951 178
1190 3300005438 Ga0070701_10231625 Ga0070701_102316251 178
1191 3300005441 Ga0070700_100029490 Ga0070700_1000294904 178
1192 3300005441 Ga0070700_100869067 Ga0070700_1008690671 178
1193 3300005458 Ga0070681_10499355 Ga0070681_104993552 178
1194 3300005466 Ga0070685_10911513 Ga0070685_109115131 178
1195 3300005530 Ga0070679_100021008 Ga0070679_1000210084 178
1196 3300005530 Ga0070679_100464907 Ga0070679_1004649071 178
1197 3300005535 Ga0070684_100001882 Ga0070684_1000018822 178
1198 3300005535 Ga0070684_100286592 Ga0070684_1002865922 178
1199 3300005535 Ga0070684_100296259 Ga0070684_1002962592 178
1200 3300005535 Ga0070684_101159535 Ga0070684_1011595351 178
1201 3300005539 Ga0068853_100617944 Ga0068853_1006179442 178
1202 3300005547 Ga0070693_100653955 Ga0070693_1006539551 178
1203 3300005548 Ga0070665_100046768 Ga0070665_1000467682 178
1204 3300005563 Ga0068855_100502218 Ga0068855_1005022182 178
1205 3300005563 Ga0068855_101229225 Ga0068855_1012292252 178
1206 3300005564 Ga0070664_100277545 Ga0070664_1002775452 178
1207 3300005564 Ga0070664_100801291 Ga0070664_1008012912 178
1208 3300005577 Ga0068857_100261440 Ga0068857_1002614402 178
1209 3300005614 Ga0068856_100299868 Ga0068856_1002998682 178
1210 3300005615 Ga0070702_100111487 Ga0070702_1001114872 178
1211 3300005615 Ga0070702_100144866 Ga0070702_1001448662 178
1212 3300005615 Ga0070702_100478267 Ga0070702_1004782671 178
1213 3300005616 Ga0068852_100553847 Ga0068852_1005538472 178
1214 3300005616 Ga0068852_100757280 Ga0068852_1007572802 178
1215 3300005618 Ga0068864_100364413 Ga0068864_1003644132 178
1216 3300005618 Ga0068864_100369193 Ga0068864_1003691932 178
1217 3300005841 Ga0068863_101277253 Ga0068863_1012772532 178
1218 3300005842 Ga0068858_100192931 Ga0068858_1001929312 178
1219 3300005843 Ga0068860_100035215 Ga0068860_1000352152 178
1220 3300005844 Ga0068862_100358991 Ga0068862_1003589912 178
1221 3300006038 Ga0075365_10014332 Ga0075365_100143324 178
1222 3300006038 Ga0075365_10299598 Ga0075365_102995982 178
1223 3300006051 Ga0075364_10114445 Ga0075364_101144451 178
1224 3300006178 Ga0075367_10287834 Ga0075367_102878342 178
1225 3300006237 Ga0097621_100748040 Ga0097621_1007480402 178
1226 3300006881 Ga0068865_100178735 Ga0068865_1001787351 178
1227 3300006881 Ga0068865_100568036 Ga0068865_1005680361 178
1228 3300006881 Ga0068865_101203455 Ga0068865_1012034551 178
1229 3300009094 Ga0111539_10433252 Ga0111539_104332521 178
1230 3300009094 Ga0111539_10797349 Ga0111539_107973491 178
1231 3300009098 Ga0105245_10022603 Ga0105245_100226034 178
1232 3300009098 Ga0105245_10289780 Ga0105245_102897802 178
1233 3300009148 Ga0105243_11043437 Ga0105243_110434372 178
1234 3300009177 Ga0105248_10291296 Ga0105248_102912962 178
1235 3300009551 Ga0105238_10676940 Ga0105238_106769402 178
1236 3300009553 Ga0105249_10291186 Ga0105249_102911862 178
1237 3300009553 Ga0105249_11076932 Ga0105249_110769322 178
1238 3300009553 Ga0105249_11202759 Ga0105249_112027591 178
1239 3300010375 Ga0105239_10001015 Ga0105239_1000101515 178
1240 3300011119 Ga0105246_10004416 Ga0105246_100044166 178
1241 3300011119 Ga0105246_10221352 Ga0105246_102213522 178
1242 3300013105 Ga0157369_10698767 Ga0157369_106987672 178
1243 3300013105 Ga0157369_10705463 Ga0157369_107054632 178
1244 3300013105 Ga0157369_11231529 Ga0157369_112315292 178
1245 3300013296 Ga0157374_10679102 Ga0157374_106791022 178
1246 3300013296 Ga0157374_10975343 Ga0157374_109753432 178
1247 3300013306 Ga0163162_10024096 Ga0163162_100240964 178
1248 3300013307 Ga0157372_10055250 Ga0157372_100552502 178
1249 3300013308 Ga0157375_10118462 Ga0157375_101184624 178
1250 3300013308 Ga0157375_10507635 Ga0157375_105076352 178
1251 3300013308 Ga0157375_10542033 Ga0157375_105420331 178
1252 3300013308 Ga0157375_10648325 Ga0157375_106483252 178
1253 3300013308 Ga0157375_10812438 Ga0157375_108124381 178
1254 3300014325 Ga0163163_10035901 Ga0163163_100359014 178
1255 3300014326 Ga0157380_10749040 Ga0157380_107490402 178
1256 3300014745 Ga0157377_10054023 Ga0157377_100540232 178
1257 3300014968 Ga0157379_10138434 Ga0157379_101384342 178
1258 3300014969 Ga0157376_10276376 Ga0157376_102763762 178
1259 3300020082 Ga0206353_10048937 Ga0206353_100489372 178
1260 3300020082 Ga0206353_12028049 Ga0206353_120280492 178
1261 3300025899 Ga0207642_10356126 Ga0207642_103561262 178
1262 3300025903 Ga0207680_10351374 Ga0207680_103513742 178
1263 3300025904 Ga0207647_10013238 Ga0207647_100132383 178
1264 3300025909 Ga0207705_10204329 Ga0207705_102043292 178
1265 3300025912 Ga0207707_10268036 Ga0207707_102680362 178
1266 3300025917 Ga0207660_10209143 Ga0207660_102091432 178
1267 3300025918 Ga0207662_10376770 Ga0207662_103767702 178
1268 3300025919 Ga0207657_10002812 Ga0207657_1000281211 178
1269 3300025919 Ga0207657_10083103 Ga0207657_100831032 178
1270 3300025919 Ga0207657_10176377 Ga0207657_101763772 178
1271 3300025920 Ga0207649_10356406 Ga0207649_103564062 178
1272 3300025921 Ga0207652_10407918 Ga0207652_104079182 178
1273 3300025925 Ga0207650_11007270 Ga0207650_110072702 178
1274 3300025927 Ga0207687_10230513 Ga0207687_102305131 178
1275 3300025927 Ga0207687_10762621 Ga0207687_107626212 178
1276 3300025932 Ga0207690_10011953 Ga0207690_100119533 178
1277 3300025933 Ga0207706_10352499 Ga0207706_103524992 178
1278 3300025933 Ga0207706_10517766 Ga0207706_105177662 178
1279 3300025934 Ga0207686_10895839 Ga0207686_108958392 178
1280 3300025938 Ga0207704_10214671 Ga0207704_102146712 178
1281 3300025938 Ga0207704_10391223 Ga0207704_103912232 178
1282 3300025940 Ga0207691_10731712 Ga0207691_107317122 178
1283 3300025944 Ga0207661_10009201 Ga0207661_100092014 178
1284 3300025944 Ga0207661_10028385 Ga0207661_100283852 178
1285 3300025944 Ga0207661_10115631 Ga0207661_101156312 178
1286 3300025944 Ga0207661_10123240 Ga0207661_101232402 178
1287 3300025944 Ga0207661_10291045 Ga0207661_102910452 178
1288 3300025945 Ga0207679_10523521 Ga0207679_105235212 178
1289 3300025945 Ga0207679_10930204 Ga0207679_109302042 178
1290 3300025949 Ga0207667_10437785 Ga0207667_104377852 178
1291 3300025949 Ga0207667_10473467 Ga0207667_104734671 178
1292 3300025960 Ga0207651_10698226 Ga0207651_106982262 178
1293 3300025961 Ga0207712_10506564 Ga0207712_105065642 178
1294 3300025972 Ga0207668_10825338 Ga0207668_108253381 178
1295 3300025986 Ga0207658_10180024 Ga0207658_101800242 178
1296 3300026035 Ga0207703_10169521 Ga0207703_101695212 178
1297 3300026075 Ga0207708_10040962 Ga0207708_100409623 178
1298 3300026075 Ga0207708_10510073 Ga0207708_105100732 178
1299 3300026078 Ga0207702_10382876 Ga0207702_103828762 178
1300 3300026078 Ga0207702_10652121 Ga0207702_106521212 178
1301 3300026088 Ga0207641_10327985 Ga0207641_103279851 178
1302 3300026089 Ga0207648_10445173 Ga0207648_104451731 178
1303 3300026095 Ga0207676_10146583 Ga0207676_101465832 178
1304 3300026095 Ga0207676_11758912 Ga0207676_117589121 178
1305 3300026116 Ga0207674_10001716 Ga0207674_1000171617 178
1306 3300026116 Ga0207674_10384360 Ga0207674_103843602 178
1307 3300026118 Ga0207675_100098146 Ga0207675_1000981462 178
1308 3300026118 Ga0207675_101455614 Ga0207675_1014556141 178
1309 3300026121 Ga0207683_10228233 Ga0207683_102282332 178
1310 3300026121 Ga0207683_10572914 Ga0207683_105729141 178
1311 3300026121 Ga0207683_10642792 Ga0207683_106427922 178
1312 3300026142 Ga0207698_10308285 Ga0207698_103082852 178
1313 3300026142 Ga0207698_10467452 Ga0207698_104674522 178
1314 3300028379 Ga0268266_10129425 Ga0268266_101294251 178
1315 3300028379 Ga0268266_11240430 Ga0268266_112404301 178
1316 3300031731 Ga0307405_11078688 Ga0307405_110786881 178
1317 3300031852 Ga0307410_11052973 Ga0307410_110529731 178
1318 3300031903 Ga0307407_10513707 Ga0307407_105137072 178
1319 3300031995 Ga0307409_100163826 Ga0307409_1001638262 178
1320 3300032002 Ga0307416_100289792 Ga0307416_1002897922 178
1321 3300032002 Ga0307416_100298953 Ga0307416_1002989532 178
1322 3300032002 Ga0307416_100931022 Ga0307416_1009310222 178
1323 3300032004 Ga0307414_11037519 Ga0307414_110375191 178
1324 3300032005 Ga0307411_10177666 Ga0307411_101776661 178
1325 3300032005 Ga0307411_11503052 Ga0307411_115030521 178
1326 3300032126 Ga0307415_100893650 Ga0307415_1008936502 178
1327 3300037068 Ga0373925_0793567 Ga0373925_0793567_164_700 178
1328 3300037418 Ga0395900_0336551 Ga0395900_0336551_406_948 178
1329 3300037466 Ga0395898_0206428 Ga0395898_0206428_139_675 178
1330 3300037466 Ga0395898_0852734 Ga0395898_0852734_187_729 178
1331 3300038443 Ga0395901_0068803 Ga0395901_0068803_1277_1819 178
1332 3300041453 Ga0451797_0028926 Ga0451797_0028926_220_777 178
1333 3300041494 Ga0451837_1708515 Ga0451837_1708515_369_926 178
1334 3300041509 Ga0451843_0361191 Ga0451843_0361191_1550_2098 178
1335 3300044683 Ga0466965_0018835 Ga0466965_0018835_2630_3169 178
1336 3300044693 Ga0466961_0007878 Ga0466961_0007878_972_1511 178
1337 3300044694 Ga0466963_0061308 Ga0466963_0061308_676_1215 178
1338 3300044694 Ga0466963_0095941 Ga0466963_0095941_970_1509 178
1339 3300044694 Ga0466963_0145586 Ga0466963_0145586_314_853 178
1340 3300044706 Ga0466964_0008788 Ga0466964_0008788_1880_2416 178
1341 3300044706 Ga0466964_0110209 Ga0466964_0110209_485_1024 178
1342 3300044719 Ga0466971_0016810 Ga0466971_0016810_149_688 178
1343 3300044765 Ga0466970_0106065 Ga0466970_0106065_233_772 178
1344 3300044765 Ga0466970_0217235 Ga0466970_0217235_170_745 178
1345 3300044842 Ga0466957_0008751 Ga0466957_0008751_4392_4931 178
1346 3300045051 Ga0451576_0078337 Ga0451576_0078337_1805_2341 178
1347 3300045836 Ga0466958_0015072 Ga0466958_0015072_2115_2654 178
1348 3300045976 Ga0466967_0012807 Ga0466967_0012807_1636_2172 178
1349 3300045976 Ga0466967_0017900 Ga0466967_0017900_1620_2156 178
1350 3300045976 Ga0466967_0210814 Ga0466967_0210814_285_824 178
1351 3300045976 Ga0466967_0274753 Ga0466967_0274753_344_883 178
1352 3300046455 Ga0495603_0285320 Ga0495603_0285320_273_809 178
1353 3300046461 Ga0495641_0180517 Ga0495641_0180517_144_686 178
1354 3300046463 Ga0495653_0438095 Ga0495653_0438095_42_578 178
1355 3300046473 Ga0495582_0117253 Ga0495582_0117253_644_1180 178
1356 3300046533 Ga0495640_0361636 Ga0495640_0361636_269_805 178
1357 3300046675 Ga0495657_0389247 Ga0495657_0389247_72_614 178
1358 3300046683 Ga0495658_0165255 Ga0495658_0165255_444_980 178
1359 3300046683 Ga0495658_0769110 Ga0495658_0769110_15_560 178
1360 3300047315 Ga0495581_0259901 Ga0495581_0259901_40_576 178
1361 3300047321 Ga0495676_0205561 Ga0495676_0205561_810_1346 178
1362 3300048903 Ga0496100_0041042 Ga0496100_0041042_380_922 178
1363 3300048904 Ga0496101_0220649 Ga0496101_0220649_560_1102 178
1364 3300048904 Ga0496101_0476207 Ga0496101_0476207_208_750 178
1365 3300048904 Ga0496101_0500546 Ga0496101_0500546_136_672 178
1366 3300048905 Ga0496102_0010787 Ga0496102_0010787_6265_6801 178
1367 3300048905 Ga0496102_0020875 Ga0496102_0020875_2097_2639 178
1368 3300048905 Ga0496102_0048158 Ga0496102_0048158_1008_1550 178
1369 3300048906 Ga0496103_0031373 Ga0496103_0031373_638_1180 178
1370 3300048906 Ga0496103_0300100 Ga0496103_0300100_314_850 178
1371 3300048907 Ga0496104_0003968 Ga0496104_0003968_2939_3481 178
1372 3300048907 Ga0496104_0371784 Ga0496104_0371784_161_703 178
1373 3300048908 Ga0496105_0034871 Ga0496105_0034871_555_1097 178
1374 3300048908 Ga0496105_0236394 Ga0496105_0236394_501_1043 178
1375 3300048908 Ga0496105_0714554 Ga0496105_0714554_203_745 178
1376 3300048909 Ga0496106_0005256 Ga0496106_0005256_4228_4770 178
1377 3300048909 Ga0496106_0214568 Ga0496106_0214568_359_895 178
1378 3300048910 Ga0496107_0033655 Ga0496107_0033655_837_1379 178
1379 3300048910 Ga0496107_0068600 Ga0496107_0068600_594_1136 178
1380 3300048910 Ga0496107_0237785 Ga0496107_0237785_780_1316 178
1381 3300048910 Ga0496107_0260980 Ga0496107_0260980_678_1214 178
1382 3300048911 Ga0496108_0075928 Ga0496108_0075928_890_1426 178
1383 3300048911 Ga0496108_0138501 Ga0496108_0138501_1530_2072 178
1384 3300048911 Ga0496108_0164702 Ga0496108_0164702_210_761 178
1385 3300048911 Ga0496108_0242846 Ga0496108_0242846_642_1184 178
1386 3300048911 Ga0496108_0411259 Ga0496108_0411259_495_1031 178
1387 3300048912 Ga0496109_0022687 Ga0496109_0022687_172_714 178
1388 3300048912 Ga0496109_0037024 Ga0496109_0037024_3707_4249 178
1389 3300048912 Ga0496109_0056118 Ga0496109_0056118_741_1277 178
1390 3300048912 Ga0496109_0104460 Ga0496109_0104460_406_948 178
1391 3300048912 Ga0496109_0619268 Ga0496109_0619268_309_860 178
1392 3300048913 Ga0496110_0004744 Ga0496110_0004744_312_848 178
1393 3300048913 Ga0496110_0584076 Ga0496110_0584076_156_707 178
1394 3300048914 Ga0496111_0002165 Ga0496111_0002165_5450_5986 178
1395 3300048914 Ga0496111_0059883 Ga0496111_0059883_47_589 178
1396 3300048914 Ga0496111_0062761 Ga0496111_0062761_1458_2000 178
1397 3300048915 Ga0496112_0245759 Ga0496112_0245759_457_999 178
1398 3300048916 Ga0496113_0171879 Ga0496113_0171879_400_942 178
1399 3300048916 Ga0496113_0245176 Ga0496113_0245176_700_1242 178
1400 3300048916 Ga0496113_0317635 Ga0496113_0317635_444_986 178
1401 3300048916 Ga0496113_0397949 Ga0496113_0397949_35_571 178
1402 3300048917 Ga0496114_0005860 Ga0496114_0005860_6446_6988 178
1403 3300048917 Ga0496114_0039311 Ga0496114_0039311_2425_2967 178
1404 3300048917 Ga0496114_0175911 Ga0496114_0175911_982_1524 178
1405 3300048917 Ga0496114_0520071 Ga0496114_0520071_302_838 178
1406 3300048917 Ga0496114_0692920 Ga0496114_0692920_112_654 178
1407 3300048918 Ga0496115_0004879 Ga0496115_0004879_4894_5436 178
1408 3300048918 Ga0496115_0745479 Ga0496115_0745479_169_711 178
1409 3300049529 Ga0501313_036081 Ga0501313_036081_39_587 178
1410 3300049570 Ga0501033_0238310 Ga0501033_0238310_467_1075 178
1411 3300049571 Ga0501034_0518674 Ga0501034_0518674_431_985 178
1412 3300049572 Ga0501036_0257750 Ga0501036_0257750_23_631 178
1413 3300049572 Ga0501036_0611847 Ga0501036_0611847_277_825 178
1414 3300049575 Ga0501039_0073757 Ga0501039_0073757_1523_2131 178
1415 3300049577 Ga0501041_0154409 Ga0501041_0154409_401_949 178
1416 3300049579 Ga0501043_0358383 Ga0501043_0358383_474_1010 178
1417 3300049583 Ga0501067_0000461 Ga0501067_0000461_7818_8354 178
1418 3300049583 Ga0501067_0001018 Ga0501067_0001018_7363_7899 178
1419 3300049584 Ga0501068_0001742 Ga0501068_0001742_4626_5162 178
1420 3300049584 Ga0501068_0001917 Ga0501068_0001917_8997_9533 178
1421 3300049585 Ga0501069_0020666 Ga0501069_0020666_1729_2268 178
1422 3300049585 Ga0501069_0109083 Ga0501069_0109083_633_1169 178
1423 3300049585 Ga0501069_0381276 Ga0501069_0381276_48_587 178
1424 3300049586 Ga0501070_0001031 Ga0501070_0001031_10348_10884 178
1425 3300049586 Ga0501070_0001455 Ga0501070_0001455_3868_4407 178
1426 3300049586 Ga0501070_0023464 Ga0501070_0023464_1290_1826 178
1427 3300049586 Ga0501070_0049113 Ga0501070_0049113_2096_2632 178
1428 3300049587 Ga0501071_0005032 Ga0501071_0005032_4323_4877 178
1429 3300049587 Ga0501071_0101472 Ga0501071_0101472_396_932 178
1430 3300049587 Ga0501071_0395694 Ga0501071_0395694_435_971 178
1431 3300049588 Ga0501072_0002112 Ga0501072_0002112_14178_14714 178
1432 3300049589 Ga0501073_0003609 Ga0501073_0003609_8883_9419 178
1433 3300049590 Ga0501074_0001017 Ga0501074_0001017_13988_14524 178
1434 3300049590 Ga0501074_0001632 Ga0501074_0001632_7287_7823 178
1435 3300049590 Ga0501074_0047572 Ga0501074_0047572_745_1284 178
1436 3300049592 Ga0501076_0043320 Ga0501076_0043320_213_767 178
1437 3300049705 Ga0501225_0039936 Ga0501225_0039936_43_597 178
1438 3300049741 Ga0501079_0023792 Ga0501079_0023792_2077_2613 178
1439 3300049741 Ga0501079_0075822 Ga0501079_0075822_411_947 178
1440 3300049742 Ga0501080_0015715 Ga0501080_0015715_152_688 178
1441 3300049743 Ga0501081_0755919 Ga0501081_0755919_19_555 178
1442 3300049744 Ga0501083_0086481 Ga0501083_0086481_615_1151 178
1443 3300049822 Ga0501035_0322368 Ga0501035_0322368_500_1108 178
1444 3300050489 nmdc:mga03683_270669_c1 nmdc:mga03683_270669_c1_52_591 178
1445 3300050491 nmdc:mga00v17_54712_c1 nmdc:mga00v17_54712_c1_826_1380 178
1446 3300050492 nmdc:mga0yw44_242251_c1 nmdc:mga0yw44_242251_c1_416_952 178
1447 3300050492 nmdc:mga0yw44_301251_c1 nmdc:mga0yw44_301251_c1_250_795 178
1448 3300050492 nmdc:mga0yw44_651134_c1 nmdc:mga0yw44_651134_c1_77_631 178
1449 3300050511 nmdc:mga08y16_773279_c1 nmdc:mga08y16_773279_c1_64_612 178
1450 3300050511 nmdc:mga08y16_964155_c1 nmdc:mga08y16_964155_c1_64_606 178
1451 3300053077 Ga0495601_0756780 Ga0495601_0756780_37_579 178
1452 3300053084 Ga0495595_0020577 Ga0495595_0020577_1246_1788 178
1453 3300053085 Ga0495619_0203486 Ga0495619_0203486_200_736 178
1454 3300053104 Ga0500556_0001337 Ga0500556_0001337_1134_1691 178
1455 3300053117 Ga0500593_001021 Ga0500593_001021_1116_1673 178
1456 3300054114 Ga0501084_0033676 Ga0501084_0033676_1096_1632 178
1457 3300054114 Ga0501084_0672554 Ga0501084_0672554_282_833 178
1458 3300059514 Ga0587095_025250 Ga0587095_025250_18_554 178
1459 3300060353 Ga0501082_0024494 Ga0501082_0024494_38_592 178
1460 3300061734 Ga0530510_0376749 Ga0530510_0376749_472_1014 178
1461 iso_pu_bacteria 2739367898 2740166684 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10369

ALS_ss_C

Small subunit of acetolactate synthase

85

158

0.99

PF01842

ACT

ACT domain

4

70

0.98

PF22629

AHAS-like_ACT

AHAS-like ACT domain

6

73

0.98

PF13710

ACT_5

ACT domain

12

74

0.97

PF13291

ACT_4

ACT domain

2

75

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.9413 3 159
2pc6-assembly1.cif.gz_A crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea 0.9402 1 161
2f1f-assembly1.cif.gz_A crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli 0.9385 2 162
6vz8-assembly1.cif.gz_S arabidopsis thaliana acetohydroxyacid synthase complex with valine bound 0.936 1 159
6vz8-assembly1.cif.gz_S arabidopsis thaliana acetohydroxyacid synthase complex with valine bound 0.9304 1 159
ID Description Score Start End Superfamily
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9999 85 162 3.30.70.1150
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9858 85 157 3.30.70.1150
af_Q57625_89_166_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9811 85 160 3.30.70.1150
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9749 85 162 3.30.70.1150
2fgdA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9481 82 157 3.30.70.1150
ID Description Score Start End GO Terms
AF-N0CX38-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9964 2 162 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A0Q6JW44-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9938 2 164 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A1Q9S5D7-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9924 2 162 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A839RJF9-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9891 2 165 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A2U2RHT7-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9888 3 162 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610

Feature Viewer

pLDDT pTM Quality
87.93 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map