metagRoot

F493959

General Info

Members	Datasets	Scaffolds	Average Seq Length
1438	702	1227	468

Family's Representative Sequence

Representative Sequence	3300037471\|Ga0395905_0077943\|Ga0395905_0077943_969_2522
Length	517
Sequence	MATSVNRLSDVHIGTAAMRLQALLPLGETRSWLPRILSATKDTAMNAPLPAAHLPRIEPRPXXXXMLQALKDRFGERCSTALAVREQHGRDESVFDVPPPDAVVFCESTEEVAFVVAQAAQHRVPVIPYGAGSSLEGHLLAVQGGVSIDLSRMNRILRVNPEDLTVTVQAGVTRKQLNDEIRHTGLFFPIDPGADASIGGMAATRASGTNAVRYGTMRENVLALTVVTASGELIHTGTRARKSSAGYDLTRLFVGSEGTLGVMTEITLRLYPLPEAISAAVCHFPTLDEAVNTTIEIIQMGVPIARCELLDANSVRAVNRHDKLGLKEAPMLLMEFHGSEAGVKEQASVVQAIAADHSGEGFQWATTPEERTRLWTARHHAYLSALQLKPGCRCVTTDTCVPISRLAECVSETIAEAEASGLPFFVVGHVGDGNFHVGYLLDPKLPAERELAERLSFQLVQRALKLEGTCTGEHGIGLHKMGFLVDEAGAGAVAMMRTLKRALDPHDIMNPGKIFEA

Samples

	Sample ID	Description	Type	Environment
1	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
2	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
3	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
4	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
5	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
6	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
7	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
8	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
9	2547132374	Acidovorax radicis N35	Isolate	Unclassified
10	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
11	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
12	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
13	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
14	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
15	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
16	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
17	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
18	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
19	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
20	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
21	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
22	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
23	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
24	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
25	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
26	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
27	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
28	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
29	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
30	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
31	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
32	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
33	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
34	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
35	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
36	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
37	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
38	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
39	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
40	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
41	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
42	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
43	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
44	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
45	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
46	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
47	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
48	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
49	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
50	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
51	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
52	2643221658	Variovorax sp. Root411	Isolate	Unclassified
53	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
54	2643221672	Variovorax sp. Root434	Isolate	Unclassified
55	2643221683	Variovorax sp. Root473	Isolate	Unclassified
56	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
57	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
58	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
59	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
60	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
61	2738541277	Variovorax sp. GV051	Isolate	Unclassified
62	2738541307	Variovorax sp. GV008	Isolate	Unclassified
63	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
64	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
65	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
66	2738543013	Variovorax sp. BT01	Isolate	Unclassified
67	2738543019	Variovorax sp. GV040	Isolate	Unclassified
68	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
69	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
70	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
71	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
72	2791355263	Rhizobium chutanense C5	Isolate	Nodule
73	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
74	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
75	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
76	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
77	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
78	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
79	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
80	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
81	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
82	2818991446	Variovorax sp. 1180	Isolate	Unclassified
83	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
84	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
85	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
86	2831864461	Roseateles noduli HZ7	Isolate	Nodule
87	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
88	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
89	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
90	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
91	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
92	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
93	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
94	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
95	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
96	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
97	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
98	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
99	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
100	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
101	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
102	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
103	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
104	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
105	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
106	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
107	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
108	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
109	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
110	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
111	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
112	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
113	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
114	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
115	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
116	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
117	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
118	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
119	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
120	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
121	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
122	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
123	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
124	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
125	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
126	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
127	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
128	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
129	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
130	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
131	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
132	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
133	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
134	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
135	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
136	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
137	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
138	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
139	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
140	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
141	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
142	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
143	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
144	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
145	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
146	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
147	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
148	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
149	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
150	2858950400	Achromobacter sp. K91	Isolate	Unclassified
151	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
152	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
153	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
154	2885198086	Variovorax sp. 679	Isolate	Unclassified
155	2885211737	Variovorax sp. 553	Isolate	Unclassified
156	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
157	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
158	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
159	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
160	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
161	2899924645	Variovorax sp. 369	Isolate	Unclassified
162	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
163	2904456579	Variovorax sp. 2002	Isolate	Unclassified
164	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
165	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
166	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
167	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
168	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
169	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
170	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
171	2928037797	Variovorax sp. 1126	Isolate	Unclassified
172	2928044640	Variovorax sp. 1128	Isolate	Unclassified
173	2928051484	Variovorax sp. 1133	Isolate	Unclassified
174	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
175	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
176	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
177	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
178	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
179	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
180	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
181	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
182	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
183	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
184	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
185	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
186	2941479691
187	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
188	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
189	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
190	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
191	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
192	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
193	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
194	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
195	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
196	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
197	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
198	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
199	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
200	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
201	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
202	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
203	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
204	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
205	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
206	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
207	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
208	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
209	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
210	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
211	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
212	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
213	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
214	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
215	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
216	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
217	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
218	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
219	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
220	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
221	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
222	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
223	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
224	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
225	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
226	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
227	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
228	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
229	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
230	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
231	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
232	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
233	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
234	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
235	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
236	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
237	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
238	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
239	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
240	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
241	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
242	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
243	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
244	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
245	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
246	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
247	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
248	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
249	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
250	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
251	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
252	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
253	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
254	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
255	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
256	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
257	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
258	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
259	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
260	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
261	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
262	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
263	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
264	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
265	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
266	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
267	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
268	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
269	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
270	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
271	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
272	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
273	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
274	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
275	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
276	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
277	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
278	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
279	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
280	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
281	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
282	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
283	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
284	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
285	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
286	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
287	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
288	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
289	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
290	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
291	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
292	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
293	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
294	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
295	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
296	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
297	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
298	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
299	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
300	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
301	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
302	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
303	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
304	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
305	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
306	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
307	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
308	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
309	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
310	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
311	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
312	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
313	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
314	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
315	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
316	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
317	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
318	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
319	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
320	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
321	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
322	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
323	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
324	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
325	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
326	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
327	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
328	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
329	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
330	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
331	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
332	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
333	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
334	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
335	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
336	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
337	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
338	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
339	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
340	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
341	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
342	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
343	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
344	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
345	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
346	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
347	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
348	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
349	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
350	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
351	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
352	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
353	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
354	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
355	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
356	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
357	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
358	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
359	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
360	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
361	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
362	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
363	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
364	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
365	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
366	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
367	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
368	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
369	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
370	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
371	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
372	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
373	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
374	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
375	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
376	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
377	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
378	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
379	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
380	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
381	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
382	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
383	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
384	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
385	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
386	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
387	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
388	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
433	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
435	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
439	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
440	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
441	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
442	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
443	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
444	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
445	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
446	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
447	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
448	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
449	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
450	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
451	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
452	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
453	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
454	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
455	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
456	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
457	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
458	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
459	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
460	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
461	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
462	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
463	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
464	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
465	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
466	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
467	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
468	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
469	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
470	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
471	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
472	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
473	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
474	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
475	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
476	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
477	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
478	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
479	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
480	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
481	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
482	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
483	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
484	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
485	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
486	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
487	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
488	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
489	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
490	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
491	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
492	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
493	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
494	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
495	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
496	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
497	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
498	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
499	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
500	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
501	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
502	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
503	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
504	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
505	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
506	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
507	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
508	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
509	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
510	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
511	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
512	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
513	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
514	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
515	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
516	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
517	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
518	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
519	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
520	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
521	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
522	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
523	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
524	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
525	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
526	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
527	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
528	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
529	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
530	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
531	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
532	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
533	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
534	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
535	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
536	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
537	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
538	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
539	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
540	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
541	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
542	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
543	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
544	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
545	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
546	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
547	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
548	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
549	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
550	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
551	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
552	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
553	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
554	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
555	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
556	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
557	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
558	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
559	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
560	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
561	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
562	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
563	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
564	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
565	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
566	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
567	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
568	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
569	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
570	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
571	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
572	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
573	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
574	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
575	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
576	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
577	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
578	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
579	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
580	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
581	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
582	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
583	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
584	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
585	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
586	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
587	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
588	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
589	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
590	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
591	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
592	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
593	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
594	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
595	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
596	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
597	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
598	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
599	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
600	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
601	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
602	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
603	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
604	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
605	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
606	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
607	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
608	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
609	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
610	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
611	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
612	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
613	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
614	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
615	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
616	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
617	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
618	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
619	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
620	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
621	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
622	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
623	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
624	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
625	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
626	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
627	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
628	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
629	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
630	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
631	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
632	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
633	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
634	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
635	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
636	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
637	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
638	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
639	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
640	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
641	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
642	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
643	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
644	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
645	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
646	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
647	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
648	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
649	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
650	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
651	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
652	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
653	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
654	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
655	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
656	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
657	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
658	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
659	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
660	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
661	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
662	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
663	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
664	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
665	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
666	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
667	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
668	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
669	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
670	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
671	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
672	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
673	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
674	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
675	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
676	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
677	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
678	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
679	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
680	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
681	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
682	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
683	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
684	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
685	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
686	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
687	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
688	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
689	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
690	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
691	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
692	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
693	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
694	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
695	8002392321	Alcaligenes faecalis Mc250	Isolate	Rhizosphere
696	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
697	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
698	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
699	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
700	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
701	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
702	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	85.12
Metatranscriptomes	0.21
Isolates	14.67

Biome Distribution

Category	Percentage (%)
Aerial Root	0.35
Bulb	0
Endosphere	21.97
Nodule	5.63
Rhizoplane	1.67
Rhizosphere	56.82
Stem	0
Stem Tuber	0
Unclassified	13.56

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10009107	3300001979	Bacteria	3903
2	JGI25155J39150_1000009	3300002704	Bacteria	224358
3	JGI25156J39149_1000009	3300002705	Bacteria	224379
4	JGI25156J39149_1001863	3300002705	Bacteria	8247
5	JGI25154J39366_1000024	3300002738	Bacteria	211372
6	JGI25154J39366_1003147	3300002738	Bacteria	3666
7	JGI25158J39367_1002323	3300002739	Bacteria	3118
8	JGI25157J39369_1000007	3300002741	Bacteria	224377
9	JGI25157J39369_1000038	3300002741	Bacteria	130270
10	JGI25152J39213_1000962	3300002773	Bacteria	14066
11	JGI25152J39213_1003723	3300002773	Bacteria	5102
12	JGI25152J39213_1005858	3300002773	Bacteria	3479
13	JGI25152J39213_1006912	3300002773	Bacteria	3000
14	JGI25150J39212_1000613	3300002774	Bacteria	13656
15	JGI25150J39212_1003584	3300002774	Bacteria	3616
16	JGI25150J39212_1006535	3300002774	Bacteria	2400
17	JGI25159J45721_1000252	3300002987	Bacteria	25308
18	JGI25159J45721_1004296	3300002987	Bacteria	4772
19	JGI25151J46595_10000306	3300003187	Bacteria	53632
20	JGI25151J46595_10003982	3300003187	Bacteria	7941
21	JGI25151J46595_10007645	3300003187	Bacteria	5275
22	JGI25153J46596_10000159	3300003215	Bacteria	68077
23	JGI25153J46596_10001459	3300003215	Bacteria	14117
24	JGI25153J46596_10007121	3300003215	Bacteria	5549
25	JGI25153J46596_10008722	3300003215	Bacteria	4804
26	JGI25153J46596_10019405	3300003215	Bacteria	2607
27	rootH1_10001412	3300003316	Bacteria	29441
28	rootL2_10002373	3300003322	Bacteria	27509
29	JGI25160J50197_1000131	3300003354	Bacteria	67778
30	JGI25160J50197_1006135	3300003354	Bacteria	4900
31	JGI25161J50226_1000009	3300003374	Bacteria	224699
32	JGI25161J50226_1001085	3300003374	Bacteria	9175
33	Ga0006562J51391_1056663	3300003578	Bacteria	5060
34	Ga0006562J51391_1056666	3300003578	Bacteria	2630
35	Ga0055539_1000775	3300003752	Bacteria	7681
36	Ga0055539_1001158	3300003752	Bacteria	5390
37	Ga0055533_1000026	3300003756	Bacteria	323407
38	Ga0055525_1000823	3300003759	Bacteria	9454
39	Ga0055535_1000056	3300003761	Bacteria	128204
40	Ga0055535_1000133	3300003761	Bacteria	79386
41	Ga0055542_1000003	3300003762	Bacteria	582721
42	Ga0055529_1000103	3300003763	Bacteria	127175
43	Ga0055526_1000722	3300003771	Bacteria	25003
44	Ga0055526_1001326	3300003771	Bacteria	17720
45	Ga0055537_1000020	3300003773	Bacteria	117325
46	Ga0055537_1000032	3300003773	Bacteria	98934
47	Ga0055524_1000047	3300003775	Bacteria	150887
48	Ga0055524_1000395	3300003775	Bacteria	37422
49	Ga0055524_1000441	3300003775	Bacteria	34575
50	Ga0055536_1000647	3300003781	Bacteria	23620
51	Ga0055536_1003742	3300003781	Bacteria	8053
52	Ga0055536_1008029	3300003781	Bacteria	4614
53	Ga0055536_1011688	3300003781	Bacteria	3333
54	Ga0055534_1000060	3300003784	Bacteria	83797
55	Ga0055534_1002183	3300003784	Bacteria	6988
56	Ga0055528_1000171	3300003790	Bacteria	54877
57	Ga0055528_1000310	3300003790	Bacteria	41194
58	Ga0055528_1000474	3300003790	Bacteria	32088
59	Ga0055528_1001275	3300003790	Bacteria	15847
60	Ga0055530_10001499	3300003791	Bacteria	16950
61	Ga0055530_10004907	3300003791	Bacteria	6637
62	Ga0055540_1000027	3300003792	Bacteria	187454
63	Ga0055540_1002051	3300003792	Bacteria	11136
64	Ga0055540_1002299	3300003792	Bacteria	10275
65	Ga0055540_1014274	3300003792	Bacteria	2374
66	Ga0055531_10000154	3300003794	Bacteria	79686
67	Ga0055531_10000574	3300003794	Bacteria	32094
68	Ga0055531_10001816	3300003794	Bacteria	15138
69	Ga0055531_10002146	3300003794	Bacteria	13489
70	Ga0055531_10003335	3300003794	Bacteria	10275
71	Ga0055531_10007228	3300003794	Bacteria	6104
72	Ga0058692_1001619	3300003856	Bacteria	8085
73	Ga0058692_1010363	3300003856	Bacteria	2305
74	Ga0055543_1000122	3300004625	Bacteria	65110
75	Ga0055543_1001847	3300004625	Bacteria	7734
76	Ga0065165_1000144	3300005262	Bacteria	124046
77	Ga0065165_1000409	3300005262	Bacteria	68773
78	Ga0065165_1001432	3300005262	Bacteria	25860
79	Ga0065707_10082206	3300005295	Bacteria	19149
80	Ga0070658_10056140	3300005327	Bacteria	3200
81	Ga0070658_10065926	3300005327	Bacteria	2957
82	Ga0070676_10022872	3300005328	Bacteria	3508
83	Ga0070676_10077872	3300005328	Bacteria	2005
84	Ga0070690_100000335	3300005330	Bacteria	24144
85	Ga0070690_100061046	3300005330	Bacteria	2428
86	Ga0070670_100003594	3300005331	Bacteria	12901
87	Ga0070670_100018243	3300005331	Bacteria	6021
88	Ga0070670_100027568	3300005331	Bacteria	4886
89	Ga0070670_100055007	3300005331	Bacteria	3416
90	Ga0070670_100217344	3300005331	Bacteria	1662
91	Ga0068869_100001158	3300005334	Bacteria	15429
92	Ga0068869_100008593	3300005334	Bacteria	6594
93	Ga0068869_100010924	3300005334	Bacteria	5943
94	Ga0068869_100087496	3300005334	Bacteria	2337
95	Ga0068869_100093492	3300005334	Bacteria	2266
96	Ga0068869_100113812	3300005334	Bacteria	2061
97	Ga0070666_10016220	3300005335	Bacteria	4764
98	Ga0070680_100001369	3300005336	Bacteria	17652
99	Ga0070680_100010602	3300005336	Bacteria	7110
100	Ga0070680_100031048	3300005336	Bacteria	4294
101	Ga0070682_100016894	3300005337	Bacteria	4247
102	Ga0068868_100000378	3300005338	Bacteria	30380
103	Ga0068868_100003190	3300005338	Bacteria	11407
104	Ga0068868_100005381	3300005338	Bacteria	8994
105	Ga0068868_100077566	3300005338	Bacteria	2658
106	Ga0068868_100126849	3300005338	Bacteria	2085
107	Ga0068868_100134164	3300005338	Bacteria	2028
108	Ga0068868_100163542	3300005338	Bacteria	1839
109	Ga0070660_100044318	3300005339	Bacteria	3402
110	Ga0070660_100080342	3300005339	Bacteria	2558
111	Ga0070689_100002150	3300005340	Bacteria	12769
112	Ga0070689_100117441	3300005340	Bacteria	2122
113	Ga0070691_10002488	3300005341	Bacteria	8194
114	Ga0070687_100000353	3300005343	Bacteria	15629
115	Ga0070661_100137040	3300005344	Bacteria	1842
116	Ga0070668_100013339	3300005347	Bacteria	6134
117	Ga0070668_100017133	3300005347	Bacteria	5422
118	Ga0070669_100006476	3300005353	Bacteria	8430
119	Ga0070669_100060722	3300005353	Bacteria	2777
120	Ga0070669_100132114	3300005353	Bacteria	1916
121	Ga0070675_100000556	3300005354	Bacteria	25668
122	Ga0070675_100009078	3300005354	Bacteria	7723
123	Ga0070675_100009690	3300005354	Bacteria	7500
124	Ga0070675_100031307	3300005354	Bacteria	4300
125	Ga0070675_100044376	3300005354	Bacteria	3635
126	Ga0070675_100090648	3300005354	Bacteria	2560
127	Ga0070671_100006922	3300005355	Bacteria	9082
128	Ga0070671_100014234	3300005355	Bacteria	6424
129	Ga0070671_100031666	3300005355	Bacteria	4371
130	Ga0070671_100049796	3300005355	Bacteria	3485
131	Ga0070674_100006711	3300005356	Bacteria	6735
132	Ga0070674_100014568	3300005356	Bacteria	4891
133	Ga0070673_100001332	3300005364	Bacteria	14386
134	Ga0070673_100038183	3300005364	Bacteria	3665
135	Ga0070673_100169845	3300005364	Bacteria	1861
136	Ga0070688_100034314	3300005365	Bacteria	3073
137	Ga0070659_100176389	3300005366	Bacteria	1752
138	Ga0070667_100005809	3300005367	Bacteria	10296
139	Ga0070667_100006878	3300005367	Bacteria	9451
140	Ga0070667_100009343	3300005367	Bacteria	8131
141	Ga0070667_100014368	3300005367	Bacteria	6542
142	Ga0070667_100049239	3300005367	Bacteria	3548
143	Ga0070713_100011527	3300005436	Bacteria	6440
144	Ga0070701_10000027	3300005438	Bacteria	38022
145	Ga0070705_100000061	3300005440	Bacteria	56772
146	Ga0070705_100019833	3300005440	Bacteria	3545
147	Ga0070700_100000386	3300005441	Bacteria	22650
148	Ga0070700_100002828	3300005441	Bacteria	8907
149	Ga0070700_100029359	3300005441	Bacteria	3278
150	Ga0070694_100000096	3300005444	Bacteria	42431
151	Ga0070663_100045287	3300005455	Bacteria	3107
152	Ga0070663_100139576	3300005455	Bacteria	1849
153	Ga0070678_100005119	3300005456	Bacteria	7527
154	Ga0070678_100010617	3300005456	Bacteria	5637
155	Ga0070678_100053361	3300005456	Bacteria	2939
156	Ga0070662_100009445	3300005457	Bacteria	6376
157	Ga0070662_100023744	3300005457	Bacteria	4216
158	Ga0070662_100035907	3300005457	Bacteria	3503
159	Ga0070662_100161014	3300005457	Bacteria	1755
160	Ga0070681_10032744	3300005458	Bacteria	5219
161	Ga0068867_100000004	3300005459	Bacteria	180739
162	Ga0068867_100001352	3300005459	Bacteria	16954
163	Ga0068867_100001399	3300005459	Bacteria	16670
164	Ga0068867_100014009	3300005459	Bacteria	5678
165	Ga0068867_100016457	3300005459	Bacteria	5251
166	Ga0068867_100055605	3300005459	Bacteria	2927
167	Ga0068867_100067174	3300005459	Bacteria	2672
168	Ga0070706_100001745	3300005467	Bacteria	22564
169	Ga0070706_100094707	3300005467	Bacteria	2771
170	Ga0070707_100183067	3300005468	Bacteria	2043
171	Ga0070679_100111316	3300005530	Bacteria	2724
172	Ga0070679_100255569	3300005530	Bacteria	1707
173	Ga0070684_100199022	3300005535	Bacteria	1824
174	Ga0070697_100061879	3300005536	Bacteria	3053
175	Ga0068853_100009402	3300005539	Bacteria	7880
176	Ga0068853_100059350	3300005539	Bacteria	3305
177	Ga0068853_100085915	3300005539	Bacteria	2758
178	Ga0068853_100136616	3300005539	Bacteria	2198
179	Ga0070672_100005974	3300005543	Bacteria	8125
180	Ga0070672_100006624	3300005543	Bacteria	7801
181	Ga0070672_100017355	3300005543	Bacteria	5178
182	Ga0070672_100142259	3300005543	Bacteria	1979
183	Ga0070686_100001578	3300005544	Bacteria	12805
184	Ga0070695_100000965	3300005545	Bacteria	15608
185	Ga0070695_100018012	3300005545	Bacteria	4287
186	Ga0070696_100000560	3300005546	Bacteria	23643
187	Ga0070696_100071100	3300005546	Bacteria	2448
188	Ga0070693_100000003	3300005547	Bacteria	95793
189	Ga0070665_100108586	3300005548	Bacteria	2777
190	Ga0070704_100000504	3300005549	Bacteria	18563
191	Ga0068855_100005492	3300005563	Bacteria	15467
192	Ga0068855_100017336	3300005563	Bacteria	8666
193	Ga0068855_100029094	3300005563	Bacteria	6606
194	Ga0068855_100036538	3300005563	Bacteria	5846
195	Ga0068855_100187460	3300005563	Bacteria	2336
196	Ga0068855_100360865	3300005563	Bacteria	1599
197	Ga0070664_100000906	3300005564	Bacteria	23107
198	Ga0070664_100093527	3300005564	Bacteria	2605
199	Ga0070664_100102731	3300005564	Bacteria	2487
200	Ga0068857_100011814	3300005577	Bacteria	7596
201	Ga0068857_100089880	3300005577	Bacteria	2748
202	Ga0068857_100107181	3300005577	Bacteria	2509
203	Ga0068854_100003450	3300005578	Bacteria	9865
204	Ga0068854_100062628	3300005578	Bacteria	2697
205	Ga0068856_100002420	3300005614	Bacteria	19200
206	Ga0068856_100005927	3300005614	Bacteria	12027
207	Ga0068856_100025867	3300005614	Bacteria	5724
208	Ga0070702_100000004	3300005615	Bacteria	70302
209	Ga0068852_100017950	3300005616	Bacteria	5565
210	Ga0068852_100033112	3300005616	Bacteria	4287
211	Ga0068852_100173584	3300005616	Bacteria	2022
212	Ga0068852_100234257	3300005616	Bacteria	1752
213	Ga0068859_100002292	3300005617	Bacteria	19424
214	Ga0068859_100009651	3300005617	Bacteria	9744
215	Ga0068859_100053138	3300005617	Bacteria	4073
216	Ga0068859_100061644	3300005617	Bacteria	3780
217	Ga0068864_100003888	3300005618	Bacteria	12299
218	Ga0068864_100021530	3300005618	Bacteria	5400
219	Ga0068864_100022099	3300005618	Bacteria	5332
220	Ga0068864_100023586	3300005618	Bacteria	5168
221	Ga0068864_100049786	3300005618	Bacteria	3605
222	Ga0068864_100102358	3300005618	Bacteria	2541
223	Ga0068866_10000342	3300005718	Bacteria	21994
224	Ga0068866_10003133	3300005718	Bacteria	6809
225	Ga0068866_10006760	3300005718	Bacteria	4783
226	Ga0068861_100001170	3300005719	Bacteria	16343
227	Ga0068861_100004049	3300005719	Bacteria	9815
228	Ga0068861_100012553	3300005719	Bacteria	5910
229	Ga0068861_100031453	3300005719	Bacteria	3899
230	Ga0068861_100053471	3300005719	Bacteria	3072
231	Ga0068861_100093153	3300005719	Bacteria	2382
232	Ga0068851_10040977	3300005834	Bacteria	2328
233	Ga0068851_10088257	3300005834	Bacteria	1630
234	Ga0068870_10010073	3300005840	Bacteria	4325
235	Ga0068863_100009638	3300005841	Bacteria	9421
236	Ga0068863_100043968	3300005841	Bacteria	4240
237	Ga0068858_100000225	3300005842	Bacteria	61439
238	Ga0068858_100002734	3300005842	Bacteria	17741
239	Ga0068858_100004355	3300005842	Bacteria	13888
240	Ga0068858_100025199	3300005842	Bacteria	5535
241	Ga0068858_100027701	3300005842	Bacteria	5265
242	Ga0068858_100029372	3300005842	Bacteria	5104
243	Ga0068860_100002098	3300005843	Bacteria	21009
244	Ga0068860_100006985	3300005843	Bacteria	11311
245	Ga0068860_100027157	3300005843	Bacteria	5515
246	Ga0068860_100035565	3300005843	Bacteria	4777
247	Ga0068862_100001419	3300005844	Bacteria	22189
248	Ga0068862_100006630	3300005844	Bacteria	9603
249	Ga0068862_100008365	3300005844	Bacteria	8563
250	Ga0068862_100023221	3300005844	Bacteria	5195
251	Ga0081539_10000188	3300005985	Bacteria	143987
252	Ga0075365_10003446	3300006038	Bacteria	8152
253	Ga0075365_10005200	3300006038	Bacteria	6998
254	Ga0075365_10019461	3300006038	Bacteria	4191
255	Ga0075365_10044964	3300006038	Bacteria	2895
256	Ga0075365_10159248	3300006038	Bacteria	1572
257	Ga0075368_10010989	3300006042	Bacteria	3286
258	Ga0075368_10052546	3300006042	Bacteria	1621
259	Ga0075363_100004847	3300006048	Bacteria	5942
260	Ga0075363_100010011	3300006048	Bacteria	4480
261	Ga0075363_100031689	3300006048	Bacteria	2742
262	Ga0075364_10014411	3300006051	Bacteria	4884
263	Ga0075364_10017517	3300006051	Bacteria	4476
264	Ga0075432_10002445	3300006058	Bacteria	6183
265	Ga0075362_10000264	3300006177	Bacteria	14621
266	Ga0075362_10001141	3300006177	Bacteria	8294
267	Ga0075362_10002208	3300006177	Bacteria	6465
268	Ga0075362_10003096	3300006177	Bacteria	5735
269	Ga0075362_10007288	3300006177	Bacteria	4180
270	Ga0075367_10003802	3300006178	Bacteria	7274
271	Ga0075367_10003888	3300006178	Bacteria	7200
272	Ga0075367_10004089	3300006178	Bacteria	7065
273	Ga0075367_10033830	3300006178	Bacteria	2948
274	Ga0075367_10082719	3300006178	Bacteria	1944
275	Ga0075369_10007638	3300006186	Bacteria	4130
276	Ga0075366_10002455	3300006195	Bacteria	9487
277	Ga0075366_10007955	3300006195	Bacteria	5868
278	Ga0075366_10008033	3300006195	Bacteria	5847
279	Ga0075366_10012869	3300006195	Bacteria	4756
280	Ga0075366_10014454	3300006195	Bacteria	4509
281	Ga0075366_10015232	3300006195	Bacteria	4403
282	Ga0075366_10017049	3300006195	Bacteria	4176
283	Ga0075366_10018429	3300006195	Bacteria	4030
284	Ga0075366_10037021	3300006195	Bacteria	2878
285	Ga0075366_10055478	3300006195	Bacteria	2353
286	Ga0097621_100000358	3300006237	Bacteria	31596
287	Ga0097621_100000574	3300006237	Bacteria	25858
288	Ga0097621_100019015	3300006237	Bacteria	5264
289	Ga0097621_100059369	3300006237	Bacteria	3131
290	Ga0075370_10002202	3300006353	Bacteria	8952
291	Ga0075370_10002908	3300006353	Bacteria	8042
292	Ga0075370_10003680	3300006353	Bacteria	7337
293	Ga0075370_10005549	3300006353	Bacteria	6285
294	Ga0075370_10005840	3300006353	Bacteria	6148
295	Ga0075370_10006962	3300006353	Bacteria	5732
296	Ga0075370_10011436	3300006353	Bacteria	4664
297	Ga0075370_10011497	3300006353	Bacteria	4654
298	Ga0075370_10017865	3300006353	Bacteria	3837
299	Ga0075370_10045161	3300006353	Bacteria	2491
300	Ga0075370_10074568	3300006353	Bacteria	1944
301	Ga0068871_100002217	3300006358	Bacteria	13190
302	Ga0068871_100003525	3300006358	Bacteria	10771
303	Ga0075430_100000969	3300006846	Bacteria	22599
304	Ga0075433_10002500	3300006852	Bacteria	13986
305	Ga0075434_100001724	3300006871	Bacteria	18761
306	Ga0075434_100002486	3300006871	Bacteria	16234
307	Ga0075429_100003380	3300006880	Bacteria	13608
308	Ga0075429_100186057	3300006880	Bacteria	1820
309	Ga0068865_100000417	3300006881	Bacteria	23766
310	Ga0068865_100001798	3300006881	Bacteria	12586
311	Ga0068865_100007870	3300006881	Bacteria	6577
312	Ga0068865_100040314	3300006881	Bacteria	3172
313	Ga0075436_100000142	3300006914	Bacteria	43453
314	Ga0097620_100002292	3300006931	Bacteria	19424
315	Ga0097620_100009651	3300006931	Bacteria	9744
316	Ga0097620_100053135	3300006931	Bacteria	4073
317	Ga0097620_100061644	3300006931	Bacteria	3780
318	Ga0099823_1000014	3300006944	Bacteria	89398
319	Ga0079104_1000029	3300006946	Bacteria	207648
320	Ga0099826_10002270	3300006948	Bacteria	12294
321	Ga0075435_100006910	3300007076	Bacteria	8051
322	Ga0075435_100090494	3300007076	Bacteria	2524
323	Ga0105244_10013122	3300009036	Bacteria	4856
324	Ga0105240_10016496	3300009093	Bacteria	9998
325	Ga0105240_10023679	3300009093	Bacteria	8112
326	Ga0105240_10045085	3300009093	Bacteria	5596
327	Ga0105240_10116112	3300009093	Bacteria	3230
328	Ga0105240_10134402	3300009093	Bacteria	2963
329	Ga0111539_10023302	3300009094	Bacteria	7605
330	Ga0105245_10001245	3300009098	Bacteria	22979
331	Ga0105245_10091706	3300009098	Bacteria	2797
332	Ga0105245_10173508	3300009098	Bacteria	2055
333	Ga0114129_10113900	3300009147	Bacteria	3729
334	Ga0105243_10000339	3300009148	Bacteria	51082
335	Ga0105243_10000806	3300009148	Bacteria	29861
336	Ga0105243_10003290	3300009148	Bacteria	13127
337	Ga0105243_10014392	3300009148	Bacteria	5988
338	Ga0105243_10017904	3300009148	Bacteria	5361
339	Ga0105243_10028796	3300009148	Bacteria	4267
340	Ga0105243_10037868	3300009148	Bacteria	3752
341	Ga0105241_10015808	3300009174	Bacteria	5529
342	Ga0105242_10000346	3300009176	Bacteria	37361
343	Ga0105242_10043018	3300009176	Bacteria	3652
344	Ga0105248_10001476	3300009177	Bacteria	26187
345	Ga0105248_10032848	3300009177	Bacteria	5798
346	Ga0105248_10053437	3300009177	Bacteria	4533
347	Ga0105237_10000080	3300009545	Bacteria	127788
348	Ga0105237_10007027	3300009545	Bacteria	12394
349	Ga0105237_10021585	3300009545	Bacteria	6619
350	Ga0105237_10063382	3300009545	Bacteria	3694
351	Ga0105238_10022002	3300009551	Bacteria	6497
352	Ga0105238_10093812	3300009551	Bacteria	2989
353	Ga0105249_10026578	3300009553	Bacteria	5218
354	Ga0105249_10220008	3300009553	Bacteria	1868
355	Ga0105239_10000116	3300010375	Bacteria	112811
356	Ga0105239_10008170	3300010375	Bacteria	11939
357	Ga0105239_10030894	3300010375	Bacteria	5893
358	Ga0105239_10169515	3300010375	Bacteria	2441
359	Ga0105246_10110710	3300011119	Bacteria	2017
360	Ga0157319_1000002	3300012497	Bacteria	410803
361	Ga0157371_10000187	3300013102	Bacteria	91186
362	Ga0157370_10000037	3300013104	Bacteria	136803
363	Ga0157370_10003156	3300013104	Bacteria	19526
364	Ga0157369_10011634	3300013105	Bacteria	9991
365	Ga0157369_10013030	3300013105	Bacteria	9418
366	Ga0157369_10013937	3300013105	Bacteria	9084
367	Ga0157369_10219052	3300013105	Bacteria	1993
368	Ga0157374_10116034	3300013296	Bacteria	2579
369	Ga0157378_10000192	3300013297	Bacteria	59014
370	Ga0157378_10058669	3300013297	Bacteria	3433
371	Ga0157378_10266685	3300013297	Bacteria	1645
372	Ga0163162_10008764	3300013306	Bacteria	9837
373	Ga0163162_10015161	3300013306	Bacteria	7527
374	Ga0163162_10087753	3300013306	Bacteria	3190
375	Ga0163162_10200628	3300013306	Bacteria	2123
376	Ga0157372_10394214	3300013307	Bacteria	1613
377	Ga0157375_10005490	3300013308	Bacteria	11026
378	Ga0157375_10020633	3300013308	Bacteria	6024
379	Ga0157375_10025537	3300013308	Bacteria	5491
380	Ga0157380_10007200	3300014326	Bacteria	7882
381	Ga0157380_10008588	3300014326	Bacteria	7302
382	Ga0157380_10015585	3300014326	Bacteria	5588
383	Ga0182008_10000210	3300014497	Bacteria	46115
384	Ga0182008_10020330	3300014497	Bacteria	3420
385	Ga0182008_10057268	3300014497	Bacteria	1924
386	Ga0157377_10000010	3300014745	Bacteria	380929
387	Ga0157379_10010838	3300014968	Bacteria	7950
388	Ga0157379_10023411	3300014968	Bacteria	5481
389	Ga0157379_10243186	3300014968	Bacteria	1632
390	Ga0157376_10017736	3300014969	Bacteria	5439
391	Ga0157376_10045560	3300014969	Bacteria	3612
392	Ga0157376_10093200	3300014969	Bacteria	2614
393	Ga0182006_1004900	3300015261	Bacteria	6486
394	Ga0182007_10007317	3300015262	Bacteria	4639
395	Ga0183362_10004	3300015683	Bacteria	569303
396	Ga0163161_10000062	3300017792	Bacteria	112177
397	Ga0206350_11147083	3300020080	Bacteria	2439
398	Ga0213872_10005396	3300021361	Bacteria	6590
399	Ga0213874_10019135	3300021377	Bacteria	1861
400	Ga0209435_100008	3300025206	Bacteria	503644
401	Ga0209674_100024	3300025226	Bacteria	535481
402	Ga0209672_100301	3300025228	Bacteria	33772
403	Ga0209147_100924	3300025229	Bacteria	13132
404	Ga0209563_100069	3300025230	Bacteria	253154
405	Ga0207427_101225	3300025231	Bacteria	9914
406	Ga0209258_100015	3300025242	Bacteria	706310
407	Ga0209258_100071	3300025242	Bacteria	278319
408	Ga0209258_100783	3300025242	Bacteria	19264
409	Ga0209258_104633	3300025242	Bacteria	2544
410	Ga0207425_1000134	3300025245	Bacteria	67717
411	Ga0207425_1000196	3300025245	Bacteria	48364
412	Ga0207425_1000639	3300025245	Bacteria	19666
413	Ga0207425_1002866	3300025245	Bacteria	5792
414	Ga0207425_1004751	3300025245	Bacteria	4002
415	Ga0209646_1000012	3300025246	Bacteria	573300
416	Ga0209646_1000029	3300025246	Bacteria	386414
417	Ga0209026_1000004	3300025250	Bacteria	949012
418	Ga0209026_1000016	3300025250	Bacteria	386457
419	Ga0209677_100092	3300025253	Bacteria	102482
420	Ga0209677_101513	3300025253	Bacteria	9963
421	Ga0209148_1000028	3300025254	Bacteria	582773
422	Ga0209148_1010500	3300025254	Bacteria	1754
423	Ga0209759_1000003	3300025256	Bacteria	792130
424	Ga0209759_1000016	3300025256	Bacteria	386414
425	Ga0209759_1001236	3300025256	Bacteria	15604
426	Ga0209759_1005341	3300025256	Bacteria	4526
427	Ga0209129_1000035	3300025258	Bacteria	329303
428	Ga0209129_1000205	3300025258	Bacteria	69454
429	Ga0209129_1000661	3300025258	Bacteria	22935
430	Ga0209129_1000724	3300025258	Bacteria	21244
431	Ga0209129_1001879	3300025258	Bacteria	11084
432	Ga0209129_1006823	3300025258	Bacteria	3570
433	Ga0209565_1000061	3300025263	Bacteria	185308
434	Ga0209565_1000144	3300025263	Bacteria	99074
435	Ga0209565_1000263	3300025263	Bacteria	55261
436	Ga0209565_1000814	3300025263	Bacteria	17819
437	Ga0209455_1000030	3300025272	Bacteria	533479
438	Ga0209455_1000625	3300025272	Bacteria	21935
439	Ga0209673_1000022	3300025273	Bacteria	413125
440	Ga0209673_1000136	3300025273	Bacteria	159975
441	Ga0209673_1000298	3300025273	Bacteria	91771
442	Ga0209673_1000396	3300025273	Bacteria	77797
443	Ga0209673_1000461	3300025273	Bacteria	68612
444	Ga0209673_1000557	3300025273	Bacteria	59948
445	Ga0209673_1003000	3300025273	Bacteria	10498
446	Ga0209673_1007842	3300025273	Bacteria	4839
447	Ga0209673_1017060	3300025273	Bacteria	2688
448	Ga0209673_1021251	3300025273	Bacteria	2276
449	Ga0209673_1022076	3300025273	Bacteria	2205
450	Ga0209130_1000014	3300025284	Bacteria	412039
451	Ga0209130_1000687	3300025284	Bacteria	30541
452	Ga0209130_1000777	3300025284	Bacteria	27552
453	Ga0209130_1000862	3300025284	Bacteria	24952
454	Ga0209130_1002988	3300025284	Bacteria	7666
455	Ga0209130_1009488	3300025284	Bacteria	2766
456	Ga0209130_1017006	3300025284	Bacteria	1744
457	Ga0209675_1000071	3300025291	Bacteria	168382
458	Ga0209675_1000105	3300025291	Bacteria	121013
459	Ga0209675_1000206	3300025291	Bacteria	62446
460	Ga0209675_1000578	3300025291	Bacteria	26456
461	Ga0209675_1000934	3300025291	Bacteria	18627
462	Ga0209675_1002639	3300025291	Bacteria	9063
463	Ga0209675_1004535	3300025291	Bacteria	6141
464	Ga0209675_1009351	3300025291	Bacteria	3474
465	Ga0209675_1012406	3300025291	Bacteria	2747
466	Ga0209676_1000013	3300025292	Bacteria	816080
467	Ga0209676_1000153	3300025292	Bacteria	166393
468	Ga0209676_1000167	3300025292	Bacteria	156470
469	Ga0209676_1000241	3300025292	Bacteria	117623
470	Ga0209676_1000496	3300025292	Bacteria	63126
471	Ga0209676_1014189	3300025292	Bacteria	3011
472	Ga0209676_1018775	3300025292	Bacteria	2402
473	Ga0209025_1000058	3300025294	Bacteria	311398
474	Ga0209025_1000410	3300025294	Bacteria	86076
475	Ga0209025_1001613	3300025294	Bacteria	28202
476	Ga0209025_1002078	3300025294	Bacteria	22720
477	Ga0209025_1004375	3300025294	Bacteria	12305
478	Ga0209025_1005585	3300025294	Bacteria	10177
479	Ga0209025_1009609	3300025294	Bacteria	6709
480	Ga0209564_1000024	3300025295	Bacteria	535041
481	Ga0209564_1000030	3300025295	Bacteria	503296
482	Ga0209564_1000110	3300025295	Bacteria	212842
483	Ga0209564_1000118	3300025295	Bacteria	205431
484	Ga0209564_1000123	3300025295	Bacteria	202487
485	Ga0209564_1000181	3300025295	Bacteria	151002
486	Ga0209564_1000247	3300025295	Bacteria	116628
487	Ga0209564_1000440	3300025295	Bacteria	71511
488	Ga0209564_1012536	3300025295	Bacteria	3687
489	Ga0209564_1022976	3300025295	Bacteria	2183
490	Ga0209758_1000039	3300025297	Bacteria	428951
491	Ga0209758_1000348	3300025297	Bacteria	84207
492	Ga0209758_1000558	3300025297	Bacteria	58712
493	Ga0209758_1001090	3300025297	Bacteria	35155
494	Ga0209758_1003861	3300025297	Bacteria	13136
495	Ga0209758_1006088	3300025297	Bacteria	8869
496	Ga0209758_1006742	3300025297	Bacteria	8079
497	Ga0209050_1000008	3300025298	Bacteria	1144179
498	Ga0209050_1000015	3300025298	Bacteria	759102
499	Ga0209050_1000266	3300025298	Bacteria	111792
500	Ga0209050_1000484	3300025298	Bacteria	69688
501	Ga0209050_1002084	3300025298	Bacteria	18319
502	Ga0209050_1003403	3300025298	Bacteria	11793
503	Ga0209050_1004398	3300025298	Bacteria	9548
504	Ga0209050_1022572	3300025298	Bacteria	2250
505	Ga0209256_1000039	3300025299	Bacteria	372337
506	Ga0209256_1000074	3300025299	Bacteria	236893
507	Ga0209256_1000082	3300025299	Bacteria	221491
508	Ga0209256_1000160	3300025299	Bacteria	138781
509	Ga0209256_1000236	3300025299	Bacteria	98648
510	Ga0209256_1000594	3300025299	Bacteria	50389
511	Ga0209256_1004560	3300025299	Bacteria	8599
512	Ga0209256_1016347	3300025299	Bacteria	2534
513	Ga0209256_1021222	3300025299	Bacteria	2003
514	Ga0207426_1000112	3300025302	Bacteria	231436
515	Ga0207426_1000121	3300025302	Bacteria	219007
516	Ga0207426_1000147	3300025302	Bacteria	190586
517	Ga0207426_1000242	3300025302	Bacteria	122839
518	Ga0207426_1004530	3300025302	Bacteria	6726
519	Ga0207426_1012649	3300025302	Bacteria	3163
520	Ga0209051_1000005	3300025303	Bacteria	1142353
521	Ga0209051_1000010	3300025303	Bacteria	641298
522	Ga0209051_1000081	3300025303	Bacteria	195619
523	Ga0209051_1000120	3300025303	Bacteria	147281
524	Ga0209051_1000390	3300025303	Bacteria	61886
525	Ga0209051_1000650	3300025303	Bacteria	39380
526	Ga0209051_1001437	3300025303	Bacteria	20303
527	Ga0209051_1002538	3300025303	Bacteria	12897
528	Ga0209051_1002733	3300025303	Bacteria	12248
529	Ga0209051_1008922	3300025303	Bacteria	5237
530	Ga0209257_1000015	3300025304	Bacteria	908141
531	Ga0209257_1000016	3300025304	Bacteria	908015
532	Ga0209257_1000026	3300025304	Bacteria	723225
533	Ga0209257_1000031	3300025304	Bacteria	688770
534	Ga0209257_1000393	3300025304	Bacteria	86777
535	Ga0209257_1000465	3300025304	Bacteria	73893
536	Ga0209257_1000565	3300025304	Bacteria	62766
537	Ga0209257_1005003	3300025304	Bacteria	9668
538	Ga0209257_1005433	3300025304	Bacteria	8949
539	Ga0207697_10008679	3300025315	Bacteria	4432
540	Ga0207656_10068225	3300025321	Bacteria	1575
541	Ga0207655_1002128	3300025728	Bacteria	16541
542	Ga0207682_10008870	3300025893	Bacteria	3977
543	Ga0207682_10020496	3300025893	Bacteria	2595
544	Ga0207642_10012280	3300025899	Bacteria	3088
545	Ga0207688_10087524	3300025901	Bacteria	1786
546	Ga0207680_10006999	3300025903	Bacteria	5474
547	Ga0207680_10041400	3300025903	Bacteria	2687
548	Ga0207647_10036448	3300025904	Bacteria	3125
549	Ga0207645_10025762	3300025907	Bacteria	3804
550	Ga0207645_10032923	3300025907	Bacteria	3332
551	Ga0207645_10034162	3300025907	Bacteria	3267
552	Ga0207645_10038381	3300025907	Bacteria	3071
553	Ga0207705_10044188	3300025909	Bacteria	3202
554	Ga0207705_10096455	3300025909	Bacteria	2171
555	Ga0207684_10011478	3300025910	Bacteria	7746
556	Ga0207654_10041383	3300025911	Bacteria	2601
557	Ga0207654_10074783	3300025911	Bacteria	2022
558	Ga0207654_10136350	3300025911	Bacteria	1559
559	Ga0207707_10000590	3300025912	Bacteria	36588
560	Ga0207707_10002308	3300025912	Bacteria	17195
561	Ga0207695_10005726	3300025913	Bacteria	16375
562	Ga0207695_10006409	3300025913	Bacteria	15283
563	Ga0207695_10077010	3300025913	Bacteria	3389
564	Ga0207671_10002929	3300025914	Bacteria	17590
565	Ga0207671_10042390	3300025914	Bacteria	3368
566	Ga0207671_10179262	3300025914	Bacteria	1648
567	Ga0207660_10035238	3300025917	Bacteria	3473
568	Ga0207662_10000653	3300025918	Bacteria	15703
569	Ga0207657_10036219	3300025919	Bacteria	4419
570	Ga0207657_10054371	3300025919	Bacteria	3462
571	Ga0207649_10148821	3300025920	Bacteria	1610
572	Ga0207646_10068288	3300025922	Bacteria	3174
573	Ga0207681_10000326	3300025923	Bacteria	34311
574	Ga0207681_10003754	3300025923	Bacteria	9440
575	Ga0207681_10070594	3300025923	Bacteria	2433
576	Ga0207694_10010043	3300025924	Bacteria	7134
577	Ga0207694_10021302	3300025924	Bacteria	4912
578	Ga0207694_10132886	3300025924	Bacteria	1996
579	Ga0207694_10173842	3300025924	Bacteria	1745
580	Ga0207650_10004536	3300025925	Bacteria	9496
581	Ga0207650_10006068	3300025925	Bacteria	8242
582	Ga0207650_10038608	3300025925	Bacteria	3488
583	Ga0207650_10060664	3300025925	Bacteria	2823
584	Ga0207659_10001095	3300025926	Bacteria	16049
585	Ga0207659_10010711	3300025926	Bacteria	5765
586	Ga0207659_10011221	3300025926	Bacteria	5655
587	Ga0207659_10057790	3300025926	Bacteria	2783
588	Ga0207659_10185168	3300025926	Bacteria	1653
589	Ga0207687_10000454	3300025927	Bacteria	27910
590	Ga0207700_10009142	3300025928	Bacteria	6172
591	Ga0207644_10004898	3300025931	Bacteria	8726
592	Ga0207644_10015669	3300025931	Bacteria	5093
593	Ga0207644_10017445	3300025931	Bacteria	4847
594	Ga0207690_10078835	3300025932	Bacteria	2294
595	Ga0207706_10022343	3300025933	Bacteria	5676
596	Ga0207706_10022909	3300025933	Bacteria	5606
597	Ga0207706_10030489	3300025933	Bacteria	4810
598	Ga0207706_10044630	3300025933	Bacteria	3929
599	Ga0207706_10116021	3300025933	Bacteria	2355
600	Ga0207686_10000806	3300025934	Bacteria	19237
601	Ga0207686_10001106	3300025934	Bacteria	15703
602	Ga0207686_10049577	3300025934	Bacteria	2607
603	Ga0207709_10000229	3300025935	Bacteria	70907
604	Ga0207709_10000297	3300025935	Bacteria	55386
605	Ga0207709_10000520	3300025935	Bacteria	33565
606	Ga0207709_10015061	3300025935	Bacteria	4283
607	Ga0207709_10043464	3300025935	Bacteria	2709
608	Ga0207670_10000590	3300025936	Bacteria	19930
609	Ga0207669_10006790	3300025937	Bacteria	5259
610	Ga0207669_10010231	3300025937	Bacteria	4509
611	Ga0207669_10029297	3300025937	Bacteria	3042
612	Ga0207704_10003413	3300025938	Bacteria	7216
613	Ga0207704_10004128	3300025938	Bacteria	6621
614	Ga0207704_10005361	3300025938	Bacteria	5908
615	Ga0207691_10012361	3300025940	Bacteria	8181
616	Ga0207691_10039535	3300025940	Bacteria	4364
617	Ga0207691_10067793	3300025940	Bacteria	3225
618	Ga0207691_10124641	3300025940	Bacteria	2280
619	Ga0207691_10136569	3300025940	Bacteria	2162
620	Ga0207691_10168258	3300025940	Bacteria	1920
621	Ga0207711_10001731	3300025941	Bacteria	20035
622	Ga0207711_10014562	3300025941	Bacteria	6538
623	Ga0207711_10051663	3300025941	Bacteria	3521
624	Ga0207711_10054315	3300025941	Bacteria	3437
625	Ga0207711_10107681	3300025941	Bacteria	2475
626	Ga0207689_10000103	3300025942	Bacteria	69244
627	Ga0207689_10004982	3300025942	Bacteria	11962
628	Ga0207689_10023781	3300025942	Bacteria	5140
629	Ga0207689_10154715	3300025942	Bacteria	1890
630	Ga0207667_10007221	3300025949	Bacteria	13405
631	Ga0207667_10057783	3300025949	Bacteria	4071
632	Ga0207667_10100675	3300025949	Bacteria	2981
633	Ga0207667_10130833	3300025949	Bacteria	2585
634	Ga0207651_10002842	3300025960	Bacteria	8337
635	Ga0207651_10006210	3300025960	Bacteria	6222
636	Ga0207651_10154358	3300025960	Bacteria	1791
637	Ga0207712_10008849	3300025961	Bacteria	6364
638	Ga0207712_10017423	3300025961	Bacteria	4664
639	Ga0207668_10013157	3300025972	Bacteria	5085
640	Ga0207668_10049231	3300025972	Bacteria	2896
641	Ga0207640_10003140	3300025981	Bacteria	8893
642	Ga0207640_10013727	3300025981	Bacteria	4649
643	Ga0207658_10001421	3300025986	Bacteria	18669
644	Ga0207658_10002120	3300025986	Bacteria	14748
645	Ga0207658_10004188	3300025986	Bacteria	10050
646	Ga0207677_10000533	3300026023	Bacteria	24049
647	Ga0207677_10002797	3300026023	Bacteria	9209
648	Ga0207677_10009333	3300026023	Bacteria	5519
649	Ga0207677_10020733	3300026023	Bacteria	3998
650	Ga0207677_10023512	3300026023	Bacteria	3810
651	Ga0207677_10030790	3300026023	Bacteria	3430
652	Ga0207703_10000898	3300026035	Bacteria	29129
653	Ga0207703_10001042	3300026035	Bacteria	26535
654	Ga0207703_10003821	3300026035	Bacteria	12516
655	Ga0207703_10013562	3300026035	Bacteria	6349
656	Ga0207703_10023150	3300026035	Bacteria	4878
657	Ga0207703_10042697	3300026035	Bacteria	3638
658	Ga0207639_10012399	3300026041	Bacteria	5936
659	Ga0207639_10057301	3300026041	Bacteria	2991
660	Ga0207639_10143878	3300026041	Bacteria	1990
661	Ga0207678_10062247	3300026067	Bacteria	3209
662	Ga0207708_10000048	3300026075	Bacteria	114754
663	Ga0207708_10028379	3300026075	Bacteria	4239
664	Ga0207708_10042002	3300026075	Bacteria	3486
665	Ga0207708_10046447	3300026075	Bacteria	3307
666	Ga0207702_10000253	3300026078	Bacteria	62073
667	Ga0207702_10087431	3300026078	Bacteria	2721
668	Ga0207702_10154553	3300026078	Bacteria	2090
669	Ga0207702_10292623	3300026078	Bacteria	1543
670	Ga0207641_10002703	3300026088	Bacteria	16185
671	Ga0207641_10023206	3300026088	Bacteria	5112
672	Ga0207641_10065641	3300026088	Bacteria	3105
673	Ga0207648_10000002	3300026089	Bacteria	307909
674	Ga0207648_10000425	3300026089	Bacteria	46432
675	Ga0207648_10001181	3300026089	Bacteria	29231
676	Ga0207648_10011180	3300026089	Bacteria	8464
677	Ga0207648_10011600	3300026089	Bacteria	8297
678	Ga0207648_10016034	3300026089	Bacteria	6865
679	Ga0207648_10016341	3300026089	Bacteria	6784
680	Ga0207648_10038654	3300026089	Bacteria	4199
681	Ga0207648_10045134	3300026089	Bacteria	3866
682	Ga0207676_10008075	3300026095	Bacteria	7481
683	Ga0207676_10039735	3300026095	Bacteria	3601
684	Ga0207676_10064063	3300026095	Bacteria	2921
685	Ga0207674_10019326	3300026116	Bacteria	7381
686	Ga0207674_10019462	3300026116	Bacteria	7351
687	Ga0207674_10035101	3300026116	Bacteria	5235
688	Ga0207674_10164399	3300026116	Bacteria	2173
689	Ga0207675_100000593	3300026118	Bacteria	35437
690	Ga0207675_100005687	3300026118	Bacteria	11928
691	Ga0207675_100006952	3300026118	Bacteria	10703
692	Ga0207675_100014779	3300026118	Bacteria	7283
693	Ga0207675_100030399	3300026118	Bacteria	5031
694	Ga0207675_100062636	3300026118	Bacteria	3474
695	Ga0207675_100078174	3300026118	Bacteria	3100
696	Ga0207675_100210979	3300026118	Bacteria	1867
697	Ga0207683_10044133	3300026121	Bacteria	3897
698	Ga0207683_10072909	3300026121	Bacteria	3037
699	Ga0207698_10012266	3300026142	Bacteria	5601
700	Ga0207698_10026145	3300026142	Bacteria	4126
701	Ga0207698_10034324	3300026142	Bacteria	3696
702	Ga0207698_10110228	3300026142	Bacteria	2305
703	Ga0207698_10150642	3300026142	Bacteria	2018
704	Ga0207698_10214676	3300026142	Bacteria	1734
705	Ga0209281_1000118	3300027111	Bacteria	208448
706	Ga0209389_1001256	3300027296	Bacteria	17621
707	Ga0209371_1000003	3300027312	Bacteria	1122971
708	Ga0209371_1019585	3300027312	Bacteria	1684
709	Ga0209967_1002166	3300027364	Bacteria	2545
710	Ga0210000_1000440	3300027462	Bacteria	5716
711	Ga0209995_1002476	3300027471	Bacteria	2919
712	Ga0209968_1003753	3300027526	Bacteria	2279
713	Ga0209999_1002964	3300027543	Bacteria	3013
714	Ga0209282_1000513	3300027666	Bacteria	18762
715	Ga0209971_1005687	3300027682	Bacteria	2956
716	Ga0209966_1000030	3300027695	Bacteria	63782
717	Ga0209813_10027025	3300027866	Bacteria	1663
718	Ga0209974_10004756	3300027876	Bacteria	4820
719	Ga0207428_10065058	3300027907	Bacteria	2878
720	Ga0268266_10004173	3300028379	Bacteria	13934
721	Ga0268265_10001097	3300028380	Bacteria	24045
722	Ga0268265_10002401	3300028380	Bacteria	14161
723	Ga0268265_10020819	3300028380	Bacteria	4584
724	Ga0268264_10001229	3300028381	Bacteria	24608
725	Ga0268264_10001548	3300028381	Bacteria	21322
726	Ga0268264_10041784	3300028381	Bacteria	3793
727	Ga0265334_10006125	3300028573	Bacteria	5209
728	Ga0265336_10000032	3300028666	Bacteria	167925
729	Ga0307517_10001027	3300028786	Bacteria	47444
730	Ga0307517_10072519	3300028786	Bacteria	3068
731	Ga0307517_10097003	3300028786	Bacteria	2357
732	Ga0307515_10000013	3300028794	Bacteria	568456
733	Ga0307515_10000291	3300028794	Bacteria	123206
734	Ga0307515_10000468	3300028794	Bacteria	96483
735	Ga0307515_10007405	3300028794	Bacteria	21695
736	Ga0307515_10009775	3300028794	Bacteria	18483
737	Ga0307515_10009957	3300028794	Bacteria	18302
738	Ga0307515_10016248	3300028794	Bacteria	13641
739	Ga0307515_10033526	3300028794	Bacteria	8446
740	Ga0307515_10035888	3300028794	Bacteria	8046
741	Ga0307515_10042814	3300028794	Bacteria	7067
742	Ga0307515_10071039	3300028794	Bacteria	4725
743	Ga0307515_10079392	3300028794	Bacteria	4299
744	Ga0307515_10218022	3300028794	Bacteria	1734
745	Ga0268256_1000004	3300030500	Bacteria	1122967
746	Ga0268256_1001869	3300030500	Bacteria	11660
747	Ga0307511_10046377	3300030521	Bacteria	3575
748	Ga0307512_10016074	3300030522	Bacteria	6916
749	Ga0307512_10036833	3300030522	Bacteria	4142
750	Ga0316179_1069163	3300030734	Bacteria	5435
751	Ga0316181_1134746	3300030744	Bacteria	3518
752	Ga0265330_10000368	3300031235	Bacteria	31833
753	Ga0265332_10000015	3300031238	Bacteria	243944
754	Ga0265332_10000394	3300031238	Bacteria	31776
755	Ga0265332_10009597	3300031238	Bacteria	4318
756	Ga0265340_10035534	3300031247	Bacteria	2474
757	Ga0265327_10001990	3300031251	Bacteria	23206
758	Ga0265327_10020917	3300031251	Bacteria	3968
759	Ga0265316_10117122	3300031344	Bacteria	2014
760	Ga0307513_10000025	3300031456	Bacteria	202918
761	Ga0307513_10000363	3300031456	Bacteria	66311
762	Ga0307513_10002171	3300031456	Bacteria	27453
763	Ga0307513_10003908	3300031456	Bacteria	20030
764	Ga0307513_10028067	3300031456	Bacteria	6445
765	Ga0307513_10051271	3300031456	Bacteria	4453
766	Ga0307513_10057168	3300031456	Bacteria	4158
767	Ga0307513_10168259	3300031456	Bacteria	2073
768	Ga0307509_10000993	3300031507	Bacteria	48743
769	Ga0307509_10052048	3300031507	Bacteria	4373
770	Ga0307509_10094138	3300031507	Bacteria	3055
771	Ga0307509_10136123	3300031507	Bacteria	2401
772	Ga0307408_100000039	3300031548	Bacteria	177825
773	Ga0307408_100000136	3300031548	Bacteria	81550
774	Ga0307408_100002831	3300031548	Bacteria	12032
775	Ga0307408_100057487	3300031548	Bacteria	2824
776	Ga0307408_100196009	3300031548	Bacteria	1631
777	Ga0307508_10000050	3300031616	Bacteria	135222
778	Ga0307508_10016037	3300031616	Bacteria	6824
779	Ga0307508_10050206	3300031616	Bacteria	3712
780	Ga0307508_10125152	3300031616	Bacteria	2173
781	Ga0307508_10173648	3300031616	Bacteria	1758
782	Ga0307514_10001315	3300031649	Bacteria	31822
783	Ga0307514_10002390	3300031649	Bacteria	19631
784	Ga0307514_10007570	3300031649	Bacteria	9358
785	Ga0307514_10010494	3300031649	Bacteria	7737
786	Ga0307514_10011020	3300031649	Bacteria	7542
787	Ga0307514_10047869	3300031649	Bacteria	3335
788	Ga0265314_10000292	3300031711	Bacteria	71982
789	Ga0265314_10003357	3300031711	Bacteria	15558
790	Ga0265314_10025572	3300031711	Bacteria	4450
791	Ga0265342_10010328	3300031712	Bacteria	6490
792	Ga0307516_10000116	3300031730	Bacteria	92895
793	Ga0307516_10000610	3300031730	Bacteria	48458
794	Ga0307516_10000614	3300031730	Bacteria	48089
795	Ga0307516_10006839	3300031730	Bacteria	13293
796	Ga0307516_10018396	3300031730	Bacteria	7260
797	Ga0307516_10037859	3300031730	Bacteria	4818
798	Ga0307405_10000330	3300031731	Bacteria	17558
799	Ga0307405_10011203	3300031731	Bacteria	4684
800	Ga0307405_10018066	3300031731	Bacteria	3882
801	Ga0307410_10008369	3300031852	Bacteria	5731
802	Ga0307410_10046788	3300031852	Bacteria	2888
803	Ga0307406_10000105	3300031901	Bacteria	48938
804	Ga0307406_10000527	3300031901	Bacteria	22031
805	Ga0307406_10001723	3300031901	Bacteria	12016
806	Ga0307406_10006552	3300031901	Bacteria	6434
807	Ga0307412_10002198	3300031911	Bacteria	10830
808	Ga0307412_10002581	3300031911	Bacteria	10065
809	Ga0307412_10029532	3300031911	Bacteria	3441
810	Ga0307412_10212633	3300031911	Bacteria	1477
811	Ga0307409_100003176	3300031995	Bacteria	8835
812	Ga0307409_100012029	3300031995	Bacteria	5493
813	Ga0307416_100006040	3300032002	Bacteria	7536
814	Ga0307416_100046332	3300032002	Bacteria	3430
815	Ga0307416_100084583	3300032002	Bacteria	2696
816	Ga0307414_10054800	3300032004	Bacteria	2788
817	Ga0307411_10001041	3300032005	Bacteria	10732
818	Ga0307411_10012343	3300032005	Bacteria	4658
819	Ga0307415_100042071	3300032126	Bacteria	3038
820	Ga0307510_10000129	3300033180	Bacteria	60839
821	Ga0307510_10036761	3300033180	Bacteria	5447
822	Ga0307510_10079965	3300033180	Bacteria	3182
823	Ga0373948_0002850	3300034817	Bacteria	2597
824	Ga0373936_0030494	3300035113	Bacteria	2126
825	Ga0373939_0000060	3300035114	Bacteria	37822
826	Ga0373954_0000013	3300035118	Bacteria	73606
827	Ga0373954_0034564	3300035118	Bacteria	2342
828	Ga0373957_0041144	3300035120	Bacteria	1740
829	Ga0373960_0005559	3300035121	Bacteria	2926
830	Ga0373955_0050186	3300035172	Bacteria	2268
831	Ga0373931_0000365	3300035691	Bacteria	18623
832	Ga0373931_0001114	3300035691	Bacteria	11409
833	Ga0373931_0004773	3300035691	Bacteria	6217
834	Ga0373931_0036301	3300035691	Bacteria	2569
835	Ga0373935_0020646	3300035692	Bacteria	4027
836	Ga0373935_0038687	3300035692	Bacteria	2987
837	Ga0373935_0062268	3300035692	Bacteria	2390
838	Ga0373927_0028309	3300035695	Bacteria	3655
839	Ga0373933_0009545	3300035724	Bacteria	5297
840	Ga0373947_0116600	3300035725	Bacteria	1693
841	Ga0373937_0000538	3300036401	Bacteria	33658
842	Ga0373937_0019093	3300036401	Bacteria	6134
843	Ga0373937_0032134	3300036401	Bacteria	4759
844	Ga0373937_0152848	3300036401	Bacteria	2162
845	Ga0373925_0004762	3300037068	Bacteria	10221
846	Ga0373925_0018650	3300037068	Bacteria	5044
847	Ga0373925_0046190	3300037068	Bacteria	3237
848	Ga0395900_0001014	3300037418	Bacteria	36216
849	Ga0395900_0011385	3300037418	Bacteria	9103
850	Ga0395900_0022729	3300037418	Bacteria	6419
851	Ga0395900_0058367	3300037418	Bacteria	3973
852	Ga0395900_0073078	3300037418	Bacteria	3525
853	Ga0395900_0087679	3300037418	Bacteria	3198
854	Ga0395898_0000872	3300037466	Bacteria	49248
855	Ga0395898_0033029	3300037466	Bacteria	5165
856	Ga0395898_0037432	3300037466	Bacteria	4813
857	Ga0395898_0096239	3300037466	Bacteria	2844
858	Ga0395905_0000078	3300037471	Bacteria	161593
859	Ga0395905_0000722	3300037471	Bacteria	43605
860	Ga0395905_0003675	3300037471	Bacteria	16264
861	Ga0395905_0003802	3300037471	Bacteria	15967
862	Ga0395905_0005213	3300037471	Bacteria	13305
863	Ga0395905_0005626	3300037471	Bacteria	12749
864	Ga0395905_0006556	3300037471	Bacteria	11693
865	Ga0395905_0006557	3300037471	Bacteria	11693
866	Ga0395905_0008575	3300037471	Bacteria	10074
867	Ga0395905_0019256	3300037471	Bacteria	6471
868	Ga0395905_0028089	3300037471	Bacteria	5304
869	Ga0395905_0036472	3300037471	Bacteria	4618
870	Ga0395905_0077930	3300037471	Bacteria	3105
871	Ga0395905_0077943	3300037471	Bacteria	3105
872	Ga0395905_0163954	3300037471	Bacteria	2088
873	Ga0395905_0212668	3300037471	Bacteria	1811
874	Ga0395901_0008025	3300038443	Bacteria	10661
875	Ga0395901_0020574	3300038443	Bacteria	6753
876	Ga0395901_0095896	3300038443	Bacteria	3108
877	Ga0436361_0059408	3300039447	Bacteria	15714
878	Ga0436361_1145342	3300039447	Bacteria	3895
879	Ga0436363_0562297	3300039450	Bacteria	4106
880	Ga0436363_0987900	3300039450	Bacteria	1672
881	Ga0439436_0000733	3300041404	Bacteria	8841
882	Ga0439453_0000447	3300041408	Bacteria	4490
883	Ga0451793_1833009	3300041452	Bacteria	1934
884	Ga0451843_1310142	3300041509	Bacteria	1877
885	Ga0439437_001738	3300042000	Bacteria	2307
886	Ga0439441_003365	3300042001	Bacteria	2353
887	Ga0439432_004969	3300042006	Bacteria	4814
888	Ga0439449_0001786	3300042007	Bacteria	8465
889	Ga0439449_0005068	3300042007	Bacteria	5067
890	Ga0439449_0011725	3300042007	Bacteria	3294
891	Ga0439449_0032199	3300042007	Bacteria	1954
892	Ga0439454_002412	3300042011	Bacteria	1967
893	Ga0439457_003988	3300042014	Bacteria	3924
894	Ga0439462_0001094	3300042015	Bacteria	5847
895	Ga0450911_000582	3300042115	Bacteria	11328
896	Ga0450917_000052	3300042120	Bacteria	6095
897	Ga0450891_000021	3300042129	Bacteria	11381
898	Ga0450898_002023	3300042134	Bacteria	2780
899	Ga0450906_006382	3300042145	Bacteria	2382
900	Ga0439446_0003344	3300042156	Bacteria	3969
901	Ga0439446_0011914	3300042156	Bacteria	2369
902	Ga0439434_0000327	3300042435	Bacteria	13478
903	Ga0439434_0004248	3300042435	Bacteria	4185
904	Ga0439435_0000043	3300042436	Bacteria	14055
905	Ga0439435_0000826	3300042436	Bacteria	5277
906	Ga0450918_000586	3300042531	Bacteria	7780
907	Ga0451577_0000194	3300042876	Bacteria	127614
908	Ga0451577_0009013	3300042876	Bacteria	9635
909	Ga0451577_0023295	3300042876	Bacteria	5647
910	Ga0451577_0024538	3300042876	Bacteria	5484
911	Ga0451577_0037553	3300042876	Bacteria	4359
912	Ga0451577_0066303	3300042876	Bacteria	3220
913	Ga0451577_0091296	3300042876	Bacteria	2718
914	Ga0451577_0151501	3300042876	Bacteria	2087
915	Ga0466969_0004466	3300044656	Bacteria	7447
916	Ga0466969_0006475	3300044656	Bacteria	6232
917	Ga0466972_0000714	3300044658	Bacteria	15905
918	Ga0466972_0036156	3300044658	Bacteria	2417
919	Ga0453683_0001483	3300044673	Bacteria	20077
920	Ga0453683_0002824	3300044673	Bacteria	13192
921	Ga0453683_0039154	3300044673	Bacteria	2980
922	Ga0466965_0034326	3300044683	Bacteria	2481
923	Ga0466965_0041124	3300044683	Bacteria	2277
924	Ga0466965_0048494	3300044683	Bacteria	2104
925	Ga0466966_0001199	3300044684	Bacteria	16629
926	Ga0466966_0002762	3300044684	Bacteria	11531
927	Ga0466961_0020296	3300044693	Bacteria	4274
928	Ga0466963_0026644	3300044694	Bacteria	3697
929	Ga0466963_0054104	3300044694	Bacteria	2667
930	Ga0466964_0005681	3300044706	Bacteria	4639
931	Ga0466964_0007917	3300044706	Bacteria	3980
932	Ga0453684_0000218	3300044712	Bacteria	250267
933	Ga0453684_0018778	3300044712	Bacteria	10582
934	Ga0453684_0030902	3300044712	Bacteria	7551
935	Ga0453684_0050672	3300044712	Bacteria	5457
936	Ga0453684_0295389	3300044712	Bacteria	1843
937	Ga0466971_0012479	3300044719	Bacteria	3725
938	Ga0466968_0019753	3300044735	Bacteria	2715
939	Ga0466970_0031229	3300044765	Bacteria	2813
940	Ga0466959_0000147	3300045049	Bacteria	46013
941	Ga0451576_0000643	3300045051	Bacteria	72224
942	Ga0451576_0004755	3300045051	Bacteria	17429
943	Ga0451576_0007423	3300045051	Bacteria	13110
944	Ga0451576_0012555	3300045051	Bacteria	9507
945	Ga0451576_0021874	3300045051	Bacteria	6944
946	Ga0451576_0039036	3300045051	Bacteria	5025
947	Ga0451576_0112667	3300045051	Bacteria	2831
948	Ga0451576_0121635	3300045051	Bacteria	2718
949	Ga0451576_0227614	3300045051	Bacteria	1947
950	Ga0466958_0074120	3300045836	Bacteria	2085
951	Ga0466967_0022160	3300045976	Bacteria	5176
952	Ga0466967_0248538	3300045976	Bacteria	1698
953	Ga0495592_0000421	3300046454	Bacteria	32129
954	Ga0495592_0120862	3300046454	Bacteria	1843
955	Ga0495603_0004362	3300046455	Bacteria	8440
956	Ga0495590_0002689	3300046457	Bacteria	7352
957	Ga0495638_0013349	3300046460	Bacteria	5598
958	Ga0495638_0018899	3300046460	Bacteria	4568
959	Ga0495650_0015476	3300046471	Bacteria	3910
960	Ga0495650_0016742	3300046471	Bacteria	3698
961	Ga0495580_0002345	3300046472	Bacteria	16524
962	Ga0495639_0005492	3300046475	Bacteria	5456
963	Ga0495607_0012415	3300046501	Bacteria	5626
964	Ga0495583_0000018	3300046506	Bacteria	306541
965	Ga0495606_0000870	3300046507	Bacteria	45205
966	Ga0495608_0132581	3300046511	Bacteria	1594
967	Ga0495610_0000185	3300046512	Bacteria	69793
968	Ga0495610_0008445	3300046512	Bacteria	6672
969	Ga0495610_0030719	3300046512	Bacteria	2811
970	Ga0495616_0001726	3300046513	Bacteria	14888
971	Ga0495620_0012976	3300046515	Bacteria	4281
972	Ga0495620_0036024	3300046515	Bacteria	2218
973	Ga0495630_0044545	3300046517	Bacteria	3316
974	Ga0495632_0002259	3300046519	Bacteria	14843
975	Ga0495632_0005894	3300046519	Bacteria	7998
976	Ga0495632_0012941	3300046519	Bacteria	4784
977	Ga0495632_0035132	3300046519	Bacteria	2560
978	Ga0495637_0013641	3300046520	Bacteria	3852
979	Ga0495666_0012336	3300046526	Bacteria	4260
980	Ga0495654_0000156	3300046530	Bacteria	68238
981	Ga0495654_0010145	3300046530	Bacteria	5135
982	Ga0495586_0001122	3300046535	Bacteria	15063
983	Ga0495621_0006348	3300046539	Bacteria	3446
984	Ga0495597_0006812	3300046542	Bacteria	5874
985	Ga0495633_0014094	3300046558	Bacteria	4191
986	Ga0495656_0000305	3300046615	Bacteria	17044
987	Ga0495668_0029784	3300046616	Bacteria	3084
988	Ga0495625_0000114	3300046660	Bacteria	123268
989	Ga0495625_0003005	3300046660	Bacteria	17395
990	Ga0495625_0013462	3300046660	Bacteria	6574
991	Ga0495625_0021861	3300046660	Bacteria	4913
992	Ga0495625_0033518	3300046660	Bacteria	3797
993	Ga0495625_0045299	3300046660	Bacteria	3180
994	Ga0495625_0094727	3300046660	Bacteria	2059
995	Ga0495659_0006114	3300046664	Bacteria	3806
996	Ga0495588_0002817	3300046674	Bacteria	7471
997	Ga0495588_0008579	3300046674	Bacteria	4695
998	Ga0495647_0001029	3300046681	Bacteria	8505
999	Ga0495658_0003766	3300046683	Bacteria	7506
1000	Ga0495658_0047382	3300046683	Bacteria	2420
1001	Ga0495669_0004995	3300046684	Bacteria	5514
1002	Ga0495669_0020238	3300046684	Bacteria	2878
1003	Ga0495624_0012670	3300046690	Bacteria	5759
1004	Ga0495670_0020283	3300046691	Bacteria	3276
1005	Ga0495649_0001395	3300046694	Bacteria	18238
1006	Ga0495649_0003876	3300046694	Bacteria	9896
1007	Ga0495589_0001942	3300046794	Bacteria	11710
1008	Ga0495660_0084522	3300046810	Bacteria	1659
1009	Ga0495636_0006890	3300047318	Bacteria	4470
1010	Ga0495676_0020117	3300047321	Bacteria	5866
1011	Ga0495676_0047148	3300047321	Bacteria	3488
1012	Ga0495687_005391	3300047443	Bacteria	8168
1013	Ga0495673_0019004	3300047469	Bacteria	3450
1014	Ga0495686_0008479	3300047472	Bacteria	7538
1015	Ga0495686_0009831	3300047472	Bacteria	6859
1016	Ga0495686_0045785	3300047472	Bacteria	2767
1017	Ga0495686_0101407	3300047472	Bacteria	1736
1018	Ga0495626_0014208	3300048091	Bacteria	4113
1019	Ga0496101_0004033	3300048904	Bacteria	9182
1020	Ga0496101_0026172	3300048904	Bacteria	4055
1021	Ga0496104_0004837	3300048907	Bacteria	11739
1022	Ga0496104_0047071	3300048907	Bacteria	4064
1023	Ga0496104_0111040	3300048907	Bacteria	2628
1024	Ga0496104_0124443	3300048907	Bacteria	2475
1025	Ga0496105_0085449	3300048908	Bacteria	2607
1026	Ga0496106_0081219	3300048909	Bacteria	2490
1027	Ga0496106_0100889	3300048909	Bacteria	2238
1028	Ga0496108_0051524	3300048911	Bacteria	3449
1029	Ga0496109_0076679	3300048912	Bacteria	3075
1030	Ga0496109_0087988	3300048912	Bacteria	2870
1031	Ga0496111_0000031	3300048914	Bacteria	56036
1032	Ga0496112_0007649	3300048915	Bacteria	9607
1033	Ga0496112_0054653	3300048915	Bacteria	3924
1034	Ga0496115_0111994	3300048918	Bacteria	2242
1035	Ga0496116_0000233	3300048919	Bacteria	102081
1036	Ga0496116_0001838	3300048919	Bacteria	22937
1037	Ga0496116_0061442	3300048919	Bacteria	2432
1038	Ga0496116_0071153	3300048919	Bacteria	2203
1039	Ga0496116_0083620	3300048919	Bacteria	1969
1040	Ga0496117_0000066	3300048920	Bacteria	253534
1041	Ga0496117_0003291	3300048920	Bacteria	18923
1042	Ga0496117_0022666	3300048920	Bacteria	5030
1043	Ga0496118_0005941	3300048921	Bacteria	13640
1044	Ga0496118_0008090	3300048921	Bacteria	10961
1045	Ga0496118_0031847	3300048921	Bacteria	4361
1046	Ga0496118_0039108	3300048921	Bacteria	3790
1047	Ga0496118_0082375	3300048921	Bacteria	2254
1048	Ga0496119_0006080	3300048922	Bacteria	11310
1049	Ga0496120_0000100	3300048923	Bacteria	143064
1050	Ga0496120_0005744	3300048923	Bacteria	9760
1051	Ga0496121_0000127	3300048924	Bacteria	168545
1052	Ga0496121_0004823	3300048924	Bacteria	17758
1053	Ga0496121_0012334	3300048924	Bacteria	9345
1054	Ga0496121_0035460	3300048924	Bacteria	4471
1055	Ga0496122_0000039	3300048925	Bacteria	295352
1056	Ga0496122_0000057	3300048925	Bacteria	253452
1057	Ga0496122_0000601	3300048925	Bacteria	74140
1058	Ga0496122_0000742	3300048925	Bacteria	63608
1059	Ga0496122_0013641	3300048925	Bacteria	7931
1060	Ga0496123_0000026	3300048926	Bacteria	318040
1061	Ga0496123_0000096	3300048926	Bacteria	173914
1062	Ga0496123_0001435	3300048926	Bacteria	33260
1063	Ga0496123_0001787	3300048926	Bacteria	28323
1064	Ga0496123_0003499	3300048926	Bacteria	17502
1065	Ga0496124_0002111	3300048927	Bacteria	26799
1066	Ga0496124_0031015	3300048927	Bacteria	4736
1067	Ga0496124_0049982	3300048927	Bacteria	3564
1068	Ga0496124_0076116	3300048927	Bacteria	2771
1069	Ga0496124_0089587	3300048927	Bacteria	2511
1070	Ga0496124_0101736	3300048927	Bacteria	2327
1071	Ga0496125_0000011	3300048928	Bacteria	655895
1072	Ga0496125_0019457	3300048928	Bacteria	6402
1073	Ga0496125_0044345	3300048928	Bacteria	3763
1074	Ga0496125_0047084	3300048928	Bacteria	3610
1075	Ga0496126_0001037	3300048929	Bacteria	46997
1076	Ga0496126_0060887	3300048929	Bacteria	3393
1077	Ga0495678_015466	3300049459	Bacteria	3509
1078	Ga0501032_0056103	3300049569	Bacteria	2648
1079	Ga0501036_0003954	3300049572	Bacteria	11915
1080	Ga0501038_0002348	3300049574	Bacteria	17640
1081	Ga0501039_0019229	3300049575	Bacteria	5239
1082	Ga0501040_0076331	3300049576	Bacteria	2317
1083	Ga0501041_0002453	3300049577	Bacteria	10533
1084	Ga0501041_0002474	3300049577	Bacteria	10497
1085	Ga0501042_0000735	3300049578	Bacteria	17775
1086	Ga0501042_0063486	3300049578	Bacteria	2640
1087	Ga0501043_0000071	3300049579	Bacteria	89105
1088	Ga0501043_0007575	3300049579	Bacteria	8605
1089	Ga0501043_0078756	3300049579	Bacteria	2590
1090	Ga0501046_0003675	3300049580	Bacteria	14058
1091	Ga0501046_0021372	3300049580	Bacteria	5341
1092	Ga0501047_0000087	3300049581	Bacteria	117516
1093	Ga0501047_0076810	3300049581	Bacteria	3214
1094	Ga0501047_0084129	3300049581	Bacteria	3058
1095	Ga0501048_0006091	3300049582	Bacteria	9186
1096	Ga0501048_0007279	3300049582	Bacteria	8392
1097	Ga0501068_0008869	3300049584	Bacteria	5611
1098	Ga0501069_0047020	3300049585	Bacteria	2395
1099	Ga0501070_0067300	3300049586	Bacteria	2966
1100	Ga0501071_0011145	3300049587	Bacteria	6045
1101	Ga0501072_0003337	3300049588	Bacteria	12073
1102	Ga0501072_0016771	3300049588	Bacteria	5624
1103	Ga0501074_0024589	3300049590	Bacteria	4377
1104	Ga0501075_0002051	3300049591	Bacteria	13334
1105	Ga0501075_0010015	3300049591	Bacteria	6649
1106	Ga0501076_0002867	3300049592	Bacteria	11935
1107	Ga0501076_0005493	3300049592	Bacteria	9129
1108	Ga0501077_0000443	3300049593	Bacteria	25079
1109	Ga0501198_000009	3300049649	Bacteria	122302
1110	Ga0501222_000001	3300049662	Bacteria	307689
1111	Ga0501235_002189	3300049669	Bacteria	4200
1112	Ga0501221_000042	3300049704	Bacteria	12944
1113	Ga0501229_000298	3300049706	Bacteria	5582
1114	Ga0501079_0000827	3300049741	Bacteria	21030
1115	Ga0501080_0018293	3300049742	Bacteria	6486
1116	Ga0501080_0077810	3300049742	Bacteria	3085
1117	Ga0501081_0000800	3300049743	Bacteria	18538
1118	Ga0501262_000069	3300049759	Bacteria	12515
1119	Ga0501267_000235	3300049764	Bacteria	3942
1120	Ga0501035_0013485	3300049822	Bacteria	7544
1121	Ga0501035_0025406	3300049822	Bacteria	5431
1122	Ga0501035_0060811	3300049822	Bacteria	3363
1123	Ga0501044_0000130	3300049823	Bacteria	92524
1124	Ga0501044_0080246	3300049823	Bacteria	3305
1125	Ga0501045_0000798	3300049824	Bacteria	20298
1126	Ga0501045_0015438	3300049824	Bacteria	5418
1127	Ga0501045_0026114	3300049824	Bacteria	4198
1128	nmdc:mga03683_2270_c1	3300050489	Bacteria	5934
1129	nmdc:mga03683_241_c1	3300050489	Bacteria	17051
1130	nmdc:mga03683_7364_c1	3300050489	Bacteria	3820
1131	nmdc:mga03n38_2034_c1	3300050490	Bacteria	6096
1132	nmdc:mga00v17_17_c1	3300050491	Bacteria	121949
1133	nmdc:mga00v17_2001_c2	3300050491	Bacteria	5088
1134	nmdc:mga0yw44_4108_c1	3300050492	Bacteria	6602
1135	nmdc:mga0yw44_650_c1	3300050492	Bacteria	12640
1136	nmdc:mga0k408_13242_c1	3300050493	Bacteria	4520
1137	nmdc:mga0k408_13841_c1	3300050493	Bacteria	2136
1138	nmdc:mga0k408_19065_c1	3300050493	Bacteria	3830
1139	nmdc:mga0k408_223_c2	3300050493	Bacteria	25073
1140	nmdc:mga0k408_412_c1	3300050493	Bacteria	23440
1141	nmdc:mga0k408_46067_c1	3300050493	Bacteria	2518
1142	nmdc:mga0k408_6089_c1	3300050493	Bacteria	6426
1143	nmdc:mga0k408_7613_c1	3300050493	Bacteria	5783
1144	nmdc:mga0k408_81567_c1	3300050493	Bacteria	1894
1145	nmdc:mga0k408_939_c1	3300050493	Bacteria	15986
1146	nmdc:mga06z11_1098_c1	3300050494	Bacteria	9870
1147	nmdc:mga06z11_5917_c1	3300050494	Bacteria	4942
1148	nmdc:mga06z11_60398_c1	3300050494	Bacteria	1973
1149	nmdc:mga04h51_2916_c1	3300050495	Bacteria	4107
1150	nmdc:mga07m45_11193_c2	3300050496	Bacteria	3577
1151	nmdc:mga07m45_11329_c1	3300050496	Bacteria	4683
1152	nmdc:mga07m45_1175_c1	3300050496	Bacteria	11788
1153	nmdc:mga07m45_1459_c1	3300050496	Bacteria	10851
1154	nmdc:mga07m45_1603_c1	3300050496	Bacteria	10418
1155	nmdc:mga07m45_183_c1	3300050496	Bacteria	24910
1156	nmdc:mga07m45_2479_c1	3300050496	Bacteria	8657
1157	nmdc:mga07m45_2571_c1	3300050496	Bacteria	8547
1158	nmdc:mga07m45_34917_c1	3300050496	Bacteria	2796
1159	nmdc:mga07m45_37376_c1	3300050496	Bacteria	2708
1160	nmdc:mga07m45_4586_c1	3300050496	Bacteria	6401
1161	nmdc:mga07m45_51852_c1	3300050496	Bacteria	2315
1162	nmdc:mga05p37_95357_c1	3300050507	Bacteria	3665
1163	nmdc:mga09592_16423_c1	3300050508	Bacteria	6055
1164	nmdc:mga09592_80054_c1	3300050508	Bacteria	2782
1165	nmdc:mga0qj67_3964_c1	3300050509	Bacteria	10711
1166	nmdc:mga0qj67_62404_c1	3300050509	Bacteria	2961
1167	nmdc:mga08y16_58967_c1	3300050511	Bacteria	4011
1168	nmdc:mga0n895_333_c1	3300050512	Bacteria	31507
1169	nmdc:mga0n895_9102_c1	3300050512	Bacteria	8665
1170	nmdc:mga0n895_91663_c1	3300050512	Bacteria	3042
1171	nmdc:mga0rr50_142506_c1	3300050513	Bacteria	1929
1172	nmdc:mga0rr50_569_c1	3300050513	Bacteria	19810
1173	nmdc:mga08x19_1192_c1	3300050514	Bacteria	16244
1174	nmdc:mga08x19_13996_c1	3300050514	Bacteria	4861
1175	nmdc:mga08x19_2254_c1	3300050514	Bacteria	11754
1176	nmdc:mga0a205_1994_c1	3300050515	Bacteria	17784
1177	nmdc:mga0sz30_700_c1	3300050516	Bacteria	12352
1178	Ga0495601_0053687	3300053077	Bacteria	2548
1179	Ga0495601_0088324	3300053077	Bacteria	1993
1180	Ga0500635_0000112	3300053080	Bacteria	49317
1181	Ga0500578_0000057	3300053086	Bacteria	120178
1182	Ga0500578_0116651	3300053086	Bacteria	1680
1183	Ga0500643_003044	3300053087	Bacteria	8274
1184	Ga0500651_0000079	3300053093	Bacteria	62532
1185	Ga0500651_0026046	3300053093	Bacteria	3672
1186	Ga0500650_0017181	3300053098	Bacteria	3119
1187	Ga0500569_004161	3300053109	Bacteria	3020
1188	Ga0500569_024694	3300053109	Bacteria	1629
1189	Ga0500571_001637	3300053110	Bacteria	10631
1190	Ga0500593_000655	3300053117	Bacteria	13189
1191	Ga0500607_000985	3300053121	Bacteria	27256
1192	Ga0500618_000049	3300053125	Bacteria	106110
1193	Ga0500618_000243	3300053125	Bacteria	43364
1194	Ga0500618_005224	3300053125	Bacteria	3989
1195	Ga0500642_0020485	3300053130	Bacteria	2600
1196	Ga0500652_003984	3300053131	Bacteria	4517
1197	Ga0500658_0000057	3300053134	Bacteria	55697
1198	Ga0500658_0002645	3300053134	Bacteria	6897
1199	Ga0500658_0004203	3300053134	Bacteria	5403
1200	Ga0500559_0000047	3300053136	Bacteria	95447
1201	Ga0500559_0003993	3300053136	Bacteria	7091
1202	Ga0500559_0020624	3300053136	Bacteria	2787
1203	Ga0500561_0000085	3300053137	Bacteria	18667
1204	Ga0500568_0012653	3300053139	Bacteria	3873
1205	Ga0500568_0038293	3300053139	Bacteria	1941
1206	Ga0500573_0037864	3300053140	Bacteria	2788
1207	Ga0500574_009530	3300053141	Bacteria	2113
1208	Ga0500590_011759	3300053148	Bacteria	4442
1209	Ga0500616_0022653	3300053153	Bacteria	3505
1210	Ga0500622_0000390	3300053156	Bacteria	42468
1211	Ga0500622_0000419	3300053156	Bacteria	40186
1212	Ga0500622_0000705	3300053156	Bacteria	29326
1213	Ga0500622_0001747	3300053156	Bacteria	16748
1214	Ga0500622_0002330	3300053156	Bacteria	13857
1215	Ga0500622_0008613	3300053156	Bacteria	5695
1216	Ga0500624_000408	3300053157	Bacteria	13252
1217	Ga0500634_0021102	3300053161	Bacteria	3526
1218	Ga0500638_000777	3300053162	Bacteria	8738
1219	Ga0500645_000425	3300053730	Bacteria	29203
1220	Ga0500645_009840	3300053730	Bacteria	3196
1221	Ga0501084_0018551	3300054114	Bacteria	5790
1222	Ga0590071_002214	3300059421	Bacteria	4943
1223	Ga0501082_0004447	3300060353	Bacteria	12239
1224	Ga0501082_0012824	3300060353	Bacteria	7204
1225	Ga0466962_0016569	3300061719	Bacteria	3553
1226	Ga0530510_0000991	3300061734	Bacteria	18832
1227	Ga0530510_0006620	3300061734	Bacteria	8079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300002739	JGI25158J39367_1002323	JGI25158J39367_10023233	415
2	3300042007	Ga0439449_0032199	Ga0439449_0032199_688_1935	415
3	3300046660	Ga0495625_0045299	Ga0495625_0045299_1890_3137	415
4	3300037466	Ga0395898_0096239	Ga0395898_0096239_294_1712	430
5	3300038443	Ga0395901_0008025	Ga0395901_0008025_5626_7044	430
6	3300025942	Ga0207689_10154715	Ga0207689_101547153	434
7	3300049586	Ga0501070_0067300	Ga0501070_0067300_27_1331	434
8	3300050496	nmdc:mga07m45_51852_c1	nmdc:mga07m45_51852_c1_26_1342	436
9	3300061719	Ga0466962_0016569	Ga0466962_0016569_19_1329	436
10	3300031730	Ga0307516_10000116	Ga0307516_1000011618	438
11	3300046512	Ga0495610_0030719	Ga0495610_0030719_68_1411	438
12	3300005563	Ga0068855_100187460	Ga0068855_1001874602	441
13	3300047472	Ga0495686_0045785	Ga0495686_0045785_1220_2635	441
14	3300005614	Ga0068856_100005927	Ga0068856_1000059278	442
15	3300026078	Ga0207702_10154553	Ga0207702_101545532	442
16	3300053125	Ga0500618_000049	Ga0500618_000049_13104_14480	443
17	3300005327	Ga0070658_10065926	Ga0070658_100659263	444
18	3300025909	Ga0207705_10044188	Ga0207705_100441883	444
19	3300046501	Ga0495607_0012415	Ga0495607_0012415_2290_3684	445
20	3300031251	Ga0265327_10020917	Ga0265327_100209173	447
21	3300044656	Ga0466969_0004466	Ga0466969_0004466_4342_5763	447
22	3300046471	Ga0495650_0016742	Ga0495650_0016742_1749_3167	447
23	3300048923	Ga0496120_0000100	Ga0496120_0000100_51885_53258	447
24	3300048925	Ga0496122_0000057	Ga0496122_0000057_51885_53258	447
25	3300048926	Ga0496123_0000096	Ga0496123_0000096_120657_122030	447
26	3300050489	nmdc:mga03683_2270_c1	nmdc:mga03683_2270_c1_2111_3484	447
27	3300050490	nmdc:mga03n38_2034_c1	nmdc:mga03n38_2034_c1_3206_4579	447
28	3300050491	nmdc:mga00v17_17_c1	nmdc:mga00v17_17_c1_70849_72222	447
29	3300050492	nmdc:mga0yw44_650_c1	nmdc:mga0yw44_650_c1_5487_6860	447
30	3300050516	nmdc:mga0sz30_700_c1	nmdc:mga0sz30_700_c1_1276_2649	447
31	3300005334	Ga0068869_100093492	Ga0068869_1000934922	449
32	3300028666	Ga0265336_10000032	Ga0265336_1000003268	450
33	3300046530	Ga0495654_0000156	Ga0495654_0000156_61832_63208	450
34	3300009098	Ga0105245_10173508	Ga0105245_101735082	451
35	3300025242	Ga0209258_100783	Ga0209258_10078310	451
36	3300044694	Ga0466963_0054104	Ga0466963_0054104_473_1828	451
37	3300044712	Ga0453684_0018778	Ga0453684_0018778_5311_6756	451
38	3300049669	Ga0501235_002189	Ga0501235_002189_2592_4016	451
39	3300005356	Ga0070674_100014568	Ga0070674_1000145684	452
40	3300005459	Ga0068867_100016457	Ga0068867_1000164573	452
41	3300005563	Ga0068855_100029094	Ga0068855_1000290946	452
42	3300009148	Ga0105243_10037868	Ga0105243_100378682	452
43	3300009176	Ga0105242_10043018	Ga0105242_100430183	452
44	3300009545	Ga0105237_10021585	Ga0105237_100215853	452
45	3300025937	Ga0207669_10010231	Ga0207669_100102312	452
46	3300044712	Ga0453684_0030902	Ga0453684_0030902_4717_6075	452
47	3300046660	Ga0495625_0013462	Ga0495625_0013462_5111_6496	452
48	3300047443	Ga0495687_005391	Ga0495687_005391_1761_3146	452
49	3300050493	nmdc:mga0k408_6089_c1	nmdc:mga0k408_6089_c1_2656_4020	452
50	3300050493	nmdc:mga0k408_939_c1	nmdc:mga0k408_939_c1_14611_15975	452
51	3300050494	nmdc:mga06z11_60398_c1	nmdc:mga06z11_60398_c1_350_1714	452
52	3300050495	nmdc:mga04h51_2916_c1	nmdc:mga04h51_2916_c1_14_1384	452
53	3300050496	nmdc:mga07m45_1175_c1	nmdc:mga07m45_1175_c1_2485_3849	452
54	iso_pu_bacteria	2643221568	2643853940	453
55	iso_pu_bacteria	2687453129	2687579338	453
56	iso_pu_bacteria	2775507049	2776914979	453
57	iso_pu_bacteria	2791355253	2793283068	453
58	3300025909	Ga0207705_10096455	Ga0207705_100964552	454
59	3300053093	Ga0500651_0026046	Ga0500651_0026046_991_2412	454
60	3300053136	Ga0500559_0000047	Ga0500559_0000047_1194_2615	454
61	3300053139	Ga0500568_0038293	Ga0500568_0038293_351_1772	454
62	iso_pu_bacteria	2510461069	2510840220	454
63	iso_pu_bacteria	2510917030	2511193769	454
64	iso_pu_bacteria	2513237085	2513578262	454
65	iso_pu_bacteria	2515154134	2515737984	454
66	iso_pu_bacteria	2516653085	2517080047	454
67	iso_pu_bacteria	2537561587	2537875081	454
68	iso_pu_bacteria	2554235003	2554244975	454
69	iso_pu_bacteria	2558860242	2559297192	454
70	iso_pu_bacteria	2582581298	2585226250	454
71	iso_pu_bacteria	2582581306	2585264663	454
72	iso_pu_bacteria	2582581865	2585386266	454
73	iso_pu_bacteria	2585427526	2585525708	454
74	iso_pu_bacteria	2585427528	2585537957	454
75	iso_pu_bacteria	2585427529	2585548830	454
76	iso_pu_bacteria	2585427593	2585835905	454
77	iso_pu_bacteria	2599185170	2599416238	454
78	iso_pu_bacteria	2599185210	2599606236	454
79	iso_pu_bacteria	2599185236	2599718417	454
80	iso_pu_bacteria	2643221693	2644520401	454
81	iso_pu_bacteria	2718218233	2720617817	454
82	iso_pu_bacteria	2738541333	2739032616	454
83	iso_pu_bacteria	2765235942	2766069321	454
84	iso_pu_bacteria	2791355263	2793340783	454
85	iso_pu_bacteria	2802429633	2806043595	454
86	iso_pu_bacteria	2802429634	2806050474	454
87	iso_pu_bacteria	2802429635	2806057291	454
88	iso_pu_bacteria	2802429636	2806064670	454
89	iso_pu_bacteria	2802429637	2806071937	454
90	iso_pu_bacteria	2808606387	2808988850	454
91	iso_pu_bacteria	2818991439	2819557575	454
92	iso_pu_bacteria	2818991461	2819683241	454
93	iso_pu_bacteria	2821123053	2821126744	454
94	iso_pu_bacteria	2838061910	2838062361	454
95	iso_pu_bacteria	2838068647	2838069267	454
96	iso_pu_bacteria	2838675328	2838679112	454
97	iso_pu_bacteria	2838680041	2838681833	454
98	iso_pu_bacteria	2838686498	2838687599	454
99	iso_pu_bacteria	2838694306	2838696405	454
100	iso_pu_bacteria	2838707686	2838710356	454
101	iso_pu_bacteria	2838714209	2838718066	454
102	iso_pu_bacteria	2838719591	2838723411	454
103	iso_pu_bacteria	2838724970	2838728780	454
104	iso_pu_bacteria	2838729681	2838733989	454
105	iso_pu_bacteria	2838736955	2838740352	454
106	iso_pu_bacteria	2838742623	2838746441	454
107	iso_pu_bacteria	2841840854	2841843524	454
108	iso_pu_bacteria	2841846520	2841851419	454
109	iso_pu_bacteria	2841851746	2841854148	454
110	iso_pu_bacteria	2841859092	2841863505	454
111	iso_pu_bacteria	2842077413	2842078530	454
112	iso_pu_bacteria	2842118031	2842118961	454
113	iso_pu_bacteria	2842124991	2842130003	454
114	iso_pu_bacteria	2842130223	2842133737	454
115	iso_pu_bacteria	2842140634	2842143244	454
116	iso_pu_bacteria	2842152218	2842155999	454
117	iso_pu_bacteria	2842156927	2842159485	454
118	iso_pu_bacteria	2842163707	2842163927	454
119	iso_pu_bacteria	2842170452	2842174311	454
120	iso_pu_bacteria	2842175837	2842179351	454
121	iso_pu_bacteria	2842180545	2842182945	454
122	iso_pu_bacteria	2842187318	2842190871	454
123	iso_pu_bacteria	2842211629	2842215186	454
124	iso_pu_bacteria	2842224351	2842228175	454
125	iso_pu_bacteria	2842229732	2842232656	454
126	iso_pu_bacteria	2842237096	2842239768	454
127	iso_pu_bacteria	2842243621	2842247100	454
128	iso_pu_bacteria	2842257432	2842259213	454
129	iso_pu_bacteria	2842264693	2842268517	454
130	iso_pu_bacteria	2842271015	2842272368	454
131	iso_pu_bacteria	2842291075	2842292192	454
132	iso_pu_bacteria	2842311132	2842316237	454
133	iso_pu_bacteria	2842363717	2842365833	454
134	iso_pu_bacteria	2842370503	2842372400	454
135	iso_pu_bacteria	2842377471	2842378589	454
136	iso_pu_bacteria	2842384541	2842385471	454
137	iso_pu_bacteria	2842422224	2842422458	454
138	iso_pu_bacteria	2842428310	2842432489	454
139	iso_pu_bacteria	2842434925	2842438793	454
140	iso_pu_bacteria	2842441272	2842445370	454
141	iso_pu_bacteria	2842447887	2842449619	454
142	iso_pu_bacteria	2842462802	2842466534	454
143	iso_pu_bacteria	2842469257	2842473408	454
144	iso_pu_bacteria	2842515876	2842520288	454
145	iso_pu_bacteria	2844454524	2844460594	454
146	iso_pu_bacteria	2857516855	2857518161	454
147	iso_pu_bacteria	2857531043	2857535472	454
148	iso_pu_bacteria	2899845264	2899850530	454
149	iso_pu_bacteria	2919114240	2919118296	454
150	iso_pu_bacteria	2926754445	2926758060	454
151	iso_pu_bacteria	2926760298	2926764160	454
152	iso_pu_bacteria	2933006813	2933011024	454
153	iso_pu_bacteria	2933011516	2933015980	454
154	iso_pu_bacteria	2933599457	2933599932	454
155	iso_pu_bacteria	2935894831	2935900591	454
156	iso_pu_bacteria	2936367885	2936374262	454
157	iso_pu_bacteria	2936375103	2936375232	454
158	iso_pu_bacteria	2978969890	2978970105	454
159	iso_pu_bacteria	2979089926	2979090742	454
160	iso_pu_bacteria	2979095461	2979096264	454
161	iso_pu_bacteria	2979100975	2979102617	454
162	iso_pu_bacteria	2984509177	2984509499	454
163	iso_pu_bacteria	2984518228	2984519802	454
164	iso_pu_bacteria	2984537506	2984537833	454
165	iso_pu_bacteria	2984587000	2984587134	454
166	iso_pu_bacteria	2984601300	2984604575	454
167	iso_pu_bacteria	650716007	650843619	454
168	iso_pu_bacteria	8003570095	8003574694	454
169	iso_pu_bacteria	8005307578	8005307798	454
170	iso_pu_bacteria	8005376324	8005379937	454
171	iso_pu_bacteria	8005497431	8005502142	454
172	iso_pu_bacteria	8005570704	8005574682	454
173	iso_pu_bacteria	8005668836	8005673565	454
174	iso_pu_bacteria	8023680758	8023687975	454
175	3300042876	Ga0451577_0151501	Ga0451577_0151501_220_1671	455
176	3300046691	Ga0495670_0020283	Ga0495670_0020283_1876_3243	455
177	3300048927	Ga0496124_0031015	Ga0496124_0031015_1180_2547	455
178	3300050493	nmdc:mga0k408_13841_c1	nmdc:mga0k408_13841_c1_19_1386	455
179	3300053156	Ga0500622_0000419	Ga0500622_0000419_19387_20754	455
180	iso_pu_bacteria	2585427594	2585846517	455
181	3300013105	Ga0157369_10011634	Ga0157369_100116345	456
182	3300031731	Ga0307405_10000330	Ga0307405_1000033012	456
183	3300031852	Ga0307410_10008369	Ga0307410_100083694	456
184	3300031901	Ga0307406_10001723	Ga0307406_100017232	456
185	3300031911	Ga0307412_10002581	Ga0307412_100025812	456
186	3300031995	Ga0307409_100012029	Ga0307409_1000120293	456
187	3300032002	Ga0307416_100084583	Ga0307416_1000845832	456
188	3300032005	Ga0307411_10012343	Ga0307411_100123434	456
189	3300039447	Ga0436361_1145342	Ga0436361_1145342_1054_2469	456
190	3300048919	Ga0496116_0000233	Ga0496116_0000233_88769_90142	456
191	3300048927	Ga0496124_0076116	Ga0496124_0076116_1257_2630	456
192	3300048929	Ga0496126_0001037	Ga0496126_0001037_32446_33819	456
193	3300049579	Ga0501043_0078756	Ga0501043_0078756_21_1400	456
194	3300002773	JGI25152J39213_1000962	JGI25152J39213_10009628	457
195	3300002773	JGI25152J39213_1006912	JGI25152J39213_10069122	457
196	3300002774	JGI25150J39212_1003584	JGI25150J39212_10035845	457
197	3300003187	JGI25151J46595_10000306	JGI25151J46595_1000030626	457
198	3300003215	JGI25153J46596_10000159	JGI25153J46596_100001596	457
199	3300003215	JGI25153J46596_10001459	JGI25153J46596_1000145914	457
200	3300003215	JGI25153J46596_10007121	JGI25153J46596_100071213	457
201	3300003215	JGI25153J46596_10019405	JGI25153J46596_100194053	457
202	3300003354	JGI25160J50197_1006135	JGI25160J50197_10061353	457
203	3300003374	JGI25161J50226_1001085	JGI25161J50226_10010853	457
204	3300003771	Ga0055526_1000722	Ga0055526_10007229	457
205	3300003771	Ga0055526_1001326	Ga0055526_100132613	457
206	3300003775	Ga0055524_1000395	Ga0055524_100039519	457
207	3300003790	Ga0055528_1000310	Ga0055528_100031022	457
208	3300003790	Ga0055528_1000474	Ga0055528_100047420	457
209	3300003856	Ga0058692_1001619	Ga0058692_10016192	457
210	3300003856	Ga0058692_1010363	Ga0058692_10103632	457
211	3300004625	Ga0055543_1001847	Ga0055543_10018472	457
212	3300006038	Ga0075365_10003446	Ga0075365_100034469	457
213	3300006038	Ga0075365_10044964	Ga0075365_100449642	457
214	3300006048	Ga0075363_100010011	Ga0075363_1000100112	457
215	3300006177	Ga0075362_10000264	Ga0075362_1000026418	457
216	3300006177	Ga0075362_10001141	Ga0075362_100011414	457
217	3300006178	Ga0075367_10003888	Ga0075367_100038883	457
218	3300006186	Ga0075369_10007638	Ga0075369_100076382	457
219	3300006195	Ga0075366_10002455	Ga0075366_100024555	457
220	3300006195	Ga0075366_10018429	Ga0075366_100184292	457
221	3300006353	Ga0075370_10002908	Ga0075370_100029083	457
222	3300006946	Ga0079104_1000029	Ga0079104_100002925	457
223	3300011119	Ga0105246_10110710	Ga0105246_101107102	457
224	3300013102	Ga0157371_10000187	Ga0157371_1000018754	457
225	3300013104	Ga0157370_10000037	Ga0157370_1000003794	457
226	3300025245	Ga0207425_1000134	Ga0207425_100013467	457
227	3300025245	Ga0207425_1002866	Ga0207425_10028666	457
228	3300025258	Ga0209129_1000205	Ga0209129_10002054	457
229	3300025258	Ga0209129_1000724	Ga0209129_100072410	457
230	3300025273	Ga0209673_1000022	Ga0209673_100002269	457
231	3300025273	Ga0209673_1000557	Ga0209673_100055743	457
232	3300025273	Ga0209673_1017060	Ga0209673_10170602	457
233	3300025284	Ga0209130_1009488	Ga0209130_10094883	457
234	3300025294	Ga0209025_1000058	Ga0209025_1000058112	457
235	3300025294	Ga0209025_1004375	Ga0209025_10043755	457
236	3300025295	Ga0209564_1000118	Ga0209564_1000118226	457
237	3300025295	Ga0209564_1000440	Ga0209564_100044038	457
238	3300025295	Ga0209564_1022976	Ga0209564_10229762	457
239	3300025297	Ga0209758_1000348	Ga0209758_100034866	457
240	3300025297	Ga0209758_1003861	Ga0209758_10038619	457
241	3300025297	Ga0209758_1006088	Ga0209758_10060884	457
242	3300025299	Ga0209256_1000160	Ga0209256_100016019	457
243	3300025299	Ga0209256_1004560	Ga0209256_10045608	457
244	3300025299	Ga0209256_1016347	Ga0209256_10163473	457
245	3300025302	Ga0207426_1000147	Ga0207426_100014784	457
246	3300025303	Ga0209051_1000390	Ga0209051_100039023	457
247	3300027111	Ga0209281_1000118	Ga0209281_100011824	457
248	3300027312	Ga0209371_1000003	Ga0209371_1000003397	457
249	3300027312	Ga0209371_1019585	Ga0209371_10195852	457
250	3300027866	Ga0209813_10027025	Ga0209813_100270252	457
251	3300028379	Ga0268266_10004173	Ga0268266_100041732	457
252	3300028794	Ga0307515_10009957	Ga0307515_100099576	457
253	3300030500	Ga0268256_1000004	Ga0268256_1000004654	457
254	3300030500	Ga0268256_1001869	Ga0268256_10018698	457
255	3300030744	Ga0316181_1134746	Ga0316181_11347462	457
256	3300031901	Ga0307406_10006552	Ga0307406_100065524	457
257	3300046460	Ga0495638_0018899	Ga0495638_0018899_915_2309	457
258	3300046512	Ga0495610_0000185	Ga0495610_0000185_31060_32436	457
259	3300046512	Ga0495610_0008445	Ga0495610_0008445_1954_3348	457
260	3300046515	Ga0495620_0012976	Ga0495620_0012976_1216_2610	457
261	3300046515	Ga0495620_0036024	Ga0495620_0036024_731_2107	457
262	3300046519	Ga0495632_0012941	Ga0495632_0012941_432_1826	457
263	3300046519	Ga0495632_0035132	Ga0495632_0035132_480_1874	457
264	3300046542	Ga0495597_0006812	Ga0495597_0006812_3282_4676	457
265	3300046558	Ga0495633_0014094	Ga0495633_0014094_2162_3541	457
266	3300046660	Ga0495625_0021861	Ga0495625_0021861_2470_3858	457
267	3300046660	Ga0495625_0094727	Ga0495625_0094727_285_1679	457
268	3300046674	Ga0495588_0002817	Ga0495588_0002817_2686_4092	457
269	3300046810	Ga0495660_0084522	Ga0495660_0084522_148_1542	457
270	3300047469	Ga0495673_0019004	Ga0495673_0019004_2051_3427	457
271	3300047472	Ga0495686_0008479	Ga0495686_0008479_2894_4288	457
272	3300047472	Ga0495686_0009831	Ga0495686_0009831_3502_4878	457
273	3300048091	Ga0495626_0014208	Ga0495626_0014208_2205_3599	457
274	3300048904	Ga0496101_0026172	Ga0496101_0026172_648_2027	457
275	3300048914	Ga0496111_0000031	Ga0496111_0000031_13233_14609	457
276	3300048919	Ga0496116_0071153	Ga0496116_0071153_783_2162	457
277	3300048920	Ga0496117_0000066	Ga0496117_0000066_200271_201677	457
278	3300048920	Ga0496117_0003291	Ga0496117_0003291_15516_16895	457
279	3300048921	Ga0496118_0005941	Ga0496118_0005941_7926_9305	457
280	3300048921	Ga0496118_0082375	Ga0496118_0082375_642_2048	457
281	3300048924	Ga0496121_0004823	Ga0496121_0004823_4600_5979	457
282	3300048924	Ga0496121_0012334	Ga0496121_0012334_422_1798	457
283	3300048925	Ga0496122_0000742	Ga0496122_0000742_26727_28103	457
284	3300048925	Ga0496122_0013641	Ga0496122_0013641_152_1531	457
285	3300048926	Ga0496123_0001787	Ga0496123_0001787_19055_20431	457
286	3300048926	Ga0496123_0003499	Ga0496123_0003499_13657_15036	457
287	3300048927	Ga0496124_0002111	Ga0496124_0002111_9877_11256	457
288	3300048927	Ga0496124_0089587	Ga0496124_0089587_797_2176	457
289	3300049459	Ga0495678_015466	Ga0495678_015466_390_1766	457
290	3300050489	nmdc:mga03683_241_c1	nmdc:mga03683_241_c1_14128_15504	457
291	3300050493	nmdc:mga0k408_13242_c1	nmdc:mga0k408_13242_c1_993_2369	457
292	3300050494	nmdc:mga06z11_1098_c1	nmdc:mga06z11_1098_c1_2737_4113	457
293	3300050496	nmdc:mga07m45_34917_c1	nmdc:mga07m45_34917_c1_670_2046	457
294	3300053086	Ga0500578_0116651	Ga0500578_0116651_138_1532	457
295	3300053109	Ga0500569_004161	Ga0500569_004161_1100_2494	457
296	3300053125	Ga0500618_000243	Ga0500618_000243_30023_31399	457
297	3300053125	Ga0500618_005224	Ga0500618_005224_996_2390	457
298	3300053134	Ga0500658_0004203	Ga0500658_0004203_2815_4209	457
299	3300053137	Ga0500561_0000085	Ga0500561_0000085_8456_9862	457
300	3300053156	Ga0500622_0000705	Ga0500622_0000705_2902_4278	457
301	3300053157	Ga0500624_000408	Ga0500624_000408_3452_4840	457
302	3300053161	Ga0500634_0021102	Ga0500634_0021102_242_1630	457
303	iso_pu_bacteria	2599185156	2599334495	457
304	iso_pu_bacteria	2842341865	2842342215	457
305	iso_pu_bacteria	2842922631	2842927184	457
306	3300028786	Ga0307517_10072519	Ga0307517_100725192	458
307	3300035692	Ga0373935_0020646	Ga0373935_0020646_2367_3788	458
308	3300049742	Ga0501080_0018293	Ga0501080_0018293_2400_3776	458
309	iso_pu_bacteria	2891048133	2891050888	459
310	3300031616	Ga0307508_10125152	Ga0307508_101251522	460
311	3300035118	Ga0373954_0034564	Ga0373954_0034564_91_1512	460
312	3300036401	Ga0373937_0152848	Ga0373937_0152848_40_1461	460
313	3300042876	Ga0451577_0024538	Ga0451577_0024538_2605_4020	460
314	3300045976	Ga0466967_0248538	Ga0466967_0248538_104_1519	460
315	3300053077	Ga0495601_0088324	Ga0495601_0088324_24_1445	460
316	iso_pu_bacteria	2643221585	2643934684	460
317	iso_pu_bacteria	2643221656	2644316170	460
318	3300005458	Ga0070681_10032744	Ga0070681_100327441	461
319	3300005564	Ga0070664_100093527	Ga0070664_1000935272	461
320	3300005577	Ga0068857_100107181	Ga0068857_1001071813	461
321	3300006177	Ga0075362_10007288	Ga0075362_100072883	461
322	3300006852	Ga0075433_10002500	Ga0075433_1000250012	461
323	3300006871	Ga0075434_100001724	Ga0075434_10000172411	461
324	3300007076	Ga0075435_100090494	Ga0075435_1000904942	461
325	3300009545	Ga0105237_10007027	Ga0105237_1000702710	461
326	3300010375	Ga0105239_10030894	Ga0105239_100308942	461
327	3300025914	Ga0207671_10042390	Ga0207671_100423903	461
328	3300025940	Ga0207691_10168258	Ga0207691_101682582	461
329	3300025949	Ga0207667_10130833	Ga0207667_101308332	461
330	3300027876	Ga0209974_10004756	Ga0209974_100047565	461
331	3300031711	Ga0265314_10025572	Ga0265314_100255723	461
332	3300031712	Ga0265342_10010328	Ga0265342_100103287	461
333	3300035172	Ga0373955_0050186	Ga0373955_0050186_663_2048	461
334	3300046511	Ga0495608_0132581	Ga0495608_0132581_42_1427	461
335	3300050512	nmdc:mga0n895_333_c1	nmdc:mga0n895_333_c1_16607_17995	461
336	3300050513	nmdc:mga0rr50_569_c1	nmdc:mga0rr50_569_c1_10550_11938	461
337	3300050514	nmdc:mga08x19_2254_c1	nmdc:mga08x19_2254_c1_9822_11210	461
338	3300050515	nmdc:mga0a205_1994_c1	nmdc:mga0a205_1994_c1_14076_15464	461
339	3300005330	Ga0070690_100000335	Ga0070690_10000033511	462
340	3300005334	Ga0068869_100001158	Ga0068869_10000115811	462
341	3300005334	Ga0068869_100113812	Ga0068869_1001138123	462
342	3300005336	Ga0070680_100001369	Ga0070680_1000013694	462
343	3300005337	Ga0070682_100016894	Ga0070682_1000168944	462
344	3300005338	Ga0068868_100000378	Ga0068868_10000037811	462
345	3300005340	Ga0070689_100002150	Ga0070689_1000021503	462
346	3300005340	Ga0070689_100117441	Ga0070689_1001174411	462
347	3300005341	Ga0070691_10002488	Ga0070691_100024883	462
348	3300005343	Ga0070687_100000353	Ga0070687_10000035315	462
349	3300005347	Ga0070668_100013339	Ga0070668_1000133395	462
350	3300005365	Ga0070688_100034314	Ga0070688_1000343144	462
351	3300005438	Ga0070701_10000027	Ga0070701_1000002716	462
352	3300005440	Ga0070705_100000061	Ga0070705_10000006119	462
353	3300005440	Ga0070705_100019833	Ga0070705_1000198333	462
354	3300005441	Ga0070700_100000386	Ga0070700_10000038611	462
355	3300005441	Ga0070700_100002828	Ga0070700_1000028286	462
356	3300005444	Ga0070694_100000096	Ga0070694_10000009616	462
357	3300005459	Ga0068867_100001352	Ga0068867_10000135212	462
358	3300005459	Ga0068867_100001399	Ga0068867_10000139910	462
359	3300005536	Ga0070697_100061879	Ga0070697_1000618791	462
360	3300005544	Ga0070686_100001578	Ga0070686_1000015787	462
361	3300005545	Ga0070695_100000965	Ga0070695_1000009659	462
362	3300005545	Ga0070695_100018012	Ga0070695_1000180123	462
363	3300005546	Ga0070696_100000560	Ga0070696_10000056016	462
364	3300005546	Ga0070696_100071100	Ga0070696_1000711003	462
365	3300005547	Ga0070693_100000003	Ga0070693_10000000357	462
366	3300005549	Ga0070704_100000504	Ga0070704_10000050414	462
367	3300005563	Ga0068855_100005492	Ga0068855_1000054924	462
368	3300005578	Ga0068854_100003450	Ga0068854_1000034507	462
369	3300005614	Ga0068856_100025867	Ga0068856_1000258676	462
370	3300005615	Ga0070702_100000004	Ga0070702_10000000453	462
371	3300005617	Ga0068859_100002292	Ga0068859_10000229214	462
372	3300005718	Ga0068866_10000342	Ga0068866_1000034221	462
373	3300005719	Ga0068861_100001170	Ga0068861_10000117011	462
374	3300005719	Ga0068861_100012553	Ga0068861_1000125535	462
375	3300005842	Ga0068858_100002734	Ga0068858_10000273412	462
376	3300005843	Ga0068860_100002098	Ga0068860_10000209811	462
377	3300005844	Ga0068862_100001419	Ga0068862_1000014197	462
378	3300005844	Ga0068862_100008365	Ga0068862_1000083656	462
379	3300005985	Ga0081539_10000188	Ga0081539_1000018861	462
380	3300006058	Ga0075432_10002445	Ga0075432_100024454	462
381	3300006237	Ga0097621_100000358	Ga0097621_10000035814	462
382	3300006237	Ga0097621_100000574	Ga0097621_10000057427	462
383	3300006358	Ga0068871_100002217	Ga0068871_1000022176	462
384	3300006358	Ga0068871_100003525	Ga0068871_1000035256	462
385	3300006846	Ga0075430_100000969	Ga0075430_10000096922	462
386	3300006871	Ga0075434_100002486	Ga0075434_10000248615	462
387	3300006881	Ga0068865_100000417	Ga0068865_10000041710	462
388	3300006881	Ga0068865_100007870	Ga0068865_1000078704	462
389	3300006914	Ga0075436_100000142	Ga0075436_10000014240	462
390	3300006931	Ga0097620_100002292	Ga0097620_10000229214	462
391	3300007076	Ga0075435_100006910	Ga0075435_1000069106	462
392	3300009094	Ga0111539_10023302	Ga0111539_100233023	462
393	3300009098	Ga0105245_10001245	Ga0105245_100012454	462
394	3300009148	Ga0105243_10000339	Ga0105243_1000033912	462
395	3300009174	Ga0105241_10015808	Ga0105241_100158082	462
396	3300009176	Ga0105242_10000346	Ga0105242_1000034627	462
397	3300013297	Ga0157378_10000192	Ga0157378_1000019253	462
398	3300014326	Ga0157380_10007200	Ga0157380_100072007	462
399	3300014326	Ga0157380_10008588	Ga0157380_100085884	462
400	3300014968	Ga0157379_10243186	Ga0157379_102431861	462
401	3300025904	Ga0207647_10036448	Ga0207647_100364483	462
402	3300025907	Ga0207645_10034162	Ga0207645_100341623	462
403	3300025911	Ga0207654_10074783	Ga0207654_100747832	462
404	3300025912	Ga0207707_10000590	Ga0207707_1000059037	462
405	3300025918	Ga0207662_10000653	Ga0207662_1000065315	462
406	3300025924	Ga0207694_10173842	Ga0207694_101738422	462
407	3300025927	Ga0207687_10000454	Ga0207687_1000045411	462
408	3300025933	Ga0207706_10116021	Ga0207706_101160213	462
409	3300025934	Ga0207686_10000806	Ga0207686_100008063	462
410	3300025935	Ga0207709_10000297	Ga0207709_1000029720	462
411	3300025936	Ga0207670_10000590	Ga0207670_1000059010	462
412	3300025938	Ga0207704_10004128	Ga0207704_100041284	462
413	3300025940	Ga0207691_10124641	Ga0207691_101246412	462
414	3300025942	Ga0207689_10000103	Ga0207689_1000010321	462
415	3300025949	Ga0207667_10007221	Ga0207667_1000722114	462
416	3300025961	Ga0207712_10008849	Ga0207712_100088492	462
417	3300025981	Ga0207640_10003140	Ga0207640_100031408	462
418	3300026023	Ga0207677_10000533	Ga0207677_100005337	462
419	3300026035	Ga0207703_10000898	Ga0207703_1000089823	462
420	3300026075	Ga0207708_10000048	Ga0207708_1000004871	462
421	3300026075	Ga0207708_10042002	Ga0207708_100420024	462
422	3300026078	Ga0207702_10087431	Ga0207702_100874313	462
423	3300026089	Ga0207648_10001181	Ga0207648_1000118121	462
424	3300026089	Ga0207648_10011600	Ga0207648_100116006	462
425	3300026118	Ga0207675_100000593	Ga0207675_10000059330	462
426	3300026118	Ga0207675_100006952	Ga0207675_10000695211	462
427	3300027364	Ga0209967_1002166	Ga0209967_10021663	462
428	3300027462	Ga0210000_1000440	Ga0210000_10004405	462
429	3300027471	Ga0209995_1002476	Ga0209995_10024763	462
430	3300027543	Ga0209999_1002964	Ga0209999_10029643	462
431	3300027907	Ga0207428_10065058	Ga0207428_100650583	462
432	3300028380	Ga0268265_10001097	Ga0268265_100010979	462
433	3300028380	Ga0268265_10002401	Ga0268265_1000240114	462
434	3300028381	Ga0268264_10001229	Ga0268264_1000122919	462
435	3300028786	Ga0307517_10097003	Ga0307517_100970032	462
436	3300035113	Ga0373936_0030494	Ga0373936_0030494_719_2110	462
437	3300035118	Ga0373954_0000013	Ga0373954_0000013_66222_67613	462
438	3300035120	Ga0373957_0041144	Ga0373957_0041144_264_1658	462
439	3300035691	Ga0373931_0036301	Ga0373931_0036301_167_1558	462
440	3300035692	Ga0373935_0038687	Ga0373935_0038687_286_1677	462
441	3300035692	Ga0373935_0062268	Ga0373935_0062268_226_1617	462
442	3300035724	Ga0373933_0009545	Ga0373933_0009545_617_2008	462
443	3300035725	Ga0373947_0116600	Ga0373947_0116600_184_1575	462
444	3300036401	Ga0373937_0000538	Ga0373937_0000538_869_2260	462
445	3300037068	Ga0373925_0046190	Ga0373925_0046190_286_1677	462
446	3300039450	Ga0436363_0987900	Ga0436363_0987900_153_1544	462
447	3300041408	Ga0439453_0000447	Ga0439453_0000447_1616_3007	462
448	3300042001	Ga0439441_003365	Ga0439441_003365_666_2057	462
449	3300042435	Ga0439434_0000327	Ga0439434_0000327_5270_6664	462
450	3300042436	Ga0439435_0000043	Ga0439435_0000043_8605_9999	462
451	3300042436	Ga0439435_0000826	Ga0439435_0000826_322_1713	462
452	3300045051	Ga0451576_0007423	Ga0451576_0007423_8494_9888	462
453	3300046455	Ga0495603_0004362	Ga0495603_0004362_2528_3919	462
454	3300046472	Ga0495580_0002345	Ga0495580_0002345_314_1705	462
455	3300046517	Ga0495630_0044545	Ga0495630_0044545_706_2097	462
456	3300046526	Ga0495666_0012336	Ga0495666_0012336_2574_3965	462
457	3300046535	Ga0495586_0001122	Ga0495586_0001122_5194_6585	462
458	3300046664	Ga0495659_0006114	Ga0495659_0006114_866_2257	462
459	3300046674	Ga0495588_0008579	Ga0495588_0008579_2481_3872	462
460	3300046681	Ga0495647_0001029	Ga0495647_0001029_2363_3754	462
461	3300046683	Ga0495658_0003766	Ga0495658_0003766_6059_7450	462
462	3300046684	Ga0495669_0004995	Ga0495669_0004995_2660_4051	462
463	3300047321	Ga0495676_0047148	Ga0495676_0047148_1948_3339	462
464	3300049569	Ga0501032_0056103	Ga0501032_0056103_97_1485	462
465	3300049572	Ga0501036_0003954	Ga0501036_0003954_14_1402	462
466	3300049574	Ga0501038_0002348	Ga0501038_0002348_16129_17517	462
467	3300049575	Ga0501039_0019229	Ga0501039_0019229_97_1485	462
468	3300049576	Ga0501040_0076331	Ga0501040_0076331_444_1832	462
469	3300049577	Ga0501041_0002453	Ga0501041_0002453_6009_7397	462
470	3300049578	Ga0501042_0000735	Ga0501042_0000735_6126_7514	462
471	3300049579	Ga0501043_0007575	Ga0501043_0007575_5916_7304	462
472	3300049580	Ga0501046_0021372	Ga0501046_0021372_3465_4853	462
473	3300049582	Ga0501048_0006091	Ga0501048_0006091_283_1671	462
474	3300049584	Ga0501068_0008869	Ga0501068_0008869_4212_5600	462
475	3300049585	Ga0501069_0047020	Ga0501069_0047020_790_2181	462
476	3300049587	Ga0501071_0011145	Ga0501071_0011145_825_2213	462
477	3300049588	Ga0501072_0003337	Ga0501072_0003337_484_1872	462
478	3300049590	Ga0501074_0024589	Ga0501074_0024589_1486_2874	462
479	3300049591	Ga0501075_0002051	Ga0501075_0002051_5708_7096	462
480	3300049592	Ga0501076_0002867	Ga0501076_0002867_6695_8083	462
481	3300049593	Ga0501077_0000443	Ga0501077_0000443_9456_10844	462
482	3300049741	Ga0501079_0000827	Ga0501079_0000827_9212_10600	462
483	3300049742	Ga0501080_0077810	Ga0501080_0077810_1686_3074	462
484	3300049743	Ga0501081_0000800	Ga0501081_0000800_125_1513	462
485	3300049822	Ga0501035_0013485	Ga0501035_0013485_3467_4855	462
486	3300049823	Ga0501044_0080246	Ga0501044_0080246_498_1886	462
487	3300049824	Ga0501045_0000798	Ga0501045_0000798_18794_20182	462
488	3300050507	nmdc:mga05p37_95357_c1	nmdc:mga05p37_95357_c1_1344_2735	462
489	3300050508	nmdc:mga09592_80054_c1	nmdc:mga09592_80054_c1_886_2280	462
490	3300050509	nmdc:mga0qj67_3964_c1	nmdc:mga0qj67_3964_c1_3569_4963	462
491	3300050511	nmdc:mga08y16_58967_c1	nmdc:mga08y16_58967_c1_940_2334	462
492	3300050512	nmdc:mga0n895_9102_c1	nmdc:mga0n895_9102_c1_1361_2752	462
493	3300050512	nmdc:mga0n895_91663_c1	nmdc:mga0n895_91663_c1_803_2194	462
494	3300050513	nmdc:mga0rr50_142506_c1	nmdc:mga0rr50_142506_c1_208_1599	462
495	3300050514	nmdc:mga08x19_1192_c1	nmdc:mga08x19_1192_c1_8256_9647	462
496	3300050514	nmdc:mga08x19_13996_c1	nmdc:mga08x19_13996_c1_492_1883	462
497	3300060353	Ga0501082_0004447	Ga0501082_0004447_10321_11709	462
498	3300061734	Ga0530510_0006620	Ga0530510_0006620_6570_7958	462
499	iso_pu_bacteria	2643221646	2644255543	462
500	iso_pu_bacteria	2738541337	2739054005	462
501	iso_pu_bacteria	2887375801	2887378399	462
502	3300005328	Ga0070676_10022872	Ga0070676_100228722	463
503	3300005328	Ga0070676_10077872	Ga0070676_100778722	463
504	3300005330	Ga0070690_100061046	Ga0070690_1000610462	463
505	3300005334	Ga0068869_100008593	Ga0068869_1000085935	463
506	3300005338	Ga0068868_100126849	Ga0068868_1001268491	463
507	3300005347	Ga0070668_100017133	Ga0070668_1000171332	463
508	3300005353	Ga0070669_100006476	Ga0070669_1000064765	463
509	3300005367	Ga0070667_100014368	Ga0070667_1000143685	463
510	3300005456	Ga0070678_100053361	Ga0070678_1000533612	463
511	3300005457	Ga0070662_100023744	Ga0070662_1000237443	463
512	3300005459	Ga0068867_100014009	Ga0068867_1000140095	463
513	3300005617	Ga0068859_100061644	Ga0068859_1000616442	463
514	3300005618	Ga0068864_100023586	Ga0068864_1000235865	463
515	3300005718	Ga0068866_10006760	Ga0068866_100067604	463
516	3300005719	Ga0068861_100004049	Ga0068861_1000040492	463
517	3300005841	Ga0068863_100043968	Ga0068863_1000439683	463
518	3300005842	Ga0068858_100004355	Ga0068858_1000043553	463
519	3300005843	Ga0068860_100006985	Ga0068860_1000069855	463
520	3300005844	Ga0068862_100023221	Ga0068862_1000232215	463
521	3300006195	Ga0075366_10008033	Ga0075366_100080336	463
522	3300006931	Ga0097620_100061644	Ga0097620_1000616442	463
523	3300009553	Ga0105249_10026578	Ga0105249_100265785	463
524	3300013306	Ga0163162_10015161	Ga0163162_100151613	463
525	3300013308	Ga0157375_10005490	Ga0157375_100054902	463
526	3300014326	Ga0157380_10015585	Ga0157380_100155855	463
527	3300014968	Ga0157379_10010838	Ga0157379_100108383	463
528	3300025899	Ga0207642_10012280	Ga0207642_100122802	463
529	3300025907	Ga0207645_10032923	Ga0207645_100329233	463
530	3300025923	Ga0207681_10000326	Ga0207681_1000032617	463
531	3300025926	Ga0207659_10011221	Ga0207659_100112212	463
532	3300025933	Ga0207706_10022343	Ga0207706_100223435	463
533	3300025937	Ga0207669_10029297	Ga0207669_100292972	463
534	3300025938	Ga0207704_10005361	Ga0207704_100053612	463
535	3300025942	Ga0207689_10004982	Ga0207689_100049824	463
536	3300025961	Ga0207712_10017423	Ga0207712_100174233	463
537	3300025972	Ga0207668_10013157	Ga0207668_100131573	463
538	3300025986	Ga0207658_10002120	Ga0207658_100021204	463
539	3300026023	Ga0207677_10023512	Ga0207677_100235124	463
540	3300026035	Ga0207703_10001042	Ga0207703_1000104227	463
541	3300026075	Ga0207708_10028379	Ga0207708_100283792	463
542	3300026089	Ga0207648_10016034	Ga0207648_100160345	463
543	3300026089	Ga0207648_10045134	Ga0207648_100451342	463
544	3300026095	Ga0207676_10039735	Ga0207676_100397352	463
545	3300026118	Ga0207675_100005687	Ga0207675_1000056879	463
546	3300026121	Ga0207683_10072909	Ga0207683_100729092	463
547	3300026142	Ga0207698_10034324	Ga0207698_100343242	463
548	3300028380	Ga0268265_10020819	Ga0268265_100208194	463
549	3300028381	Ga0268264_10001548	Ga0268264_1000154810	463
550	3300031456	Ga0307513_10000025	Ga0307513_1000002564	463
551	3300050493	nmdc:mga0k408_223_c2	nmdc:mga0k408_223_c2_4181_5614	463
552	iso_pu_bacteria	2643221544	2643744674	463
553	iso_pu_bacteria	2643221639	2644219036	463
554	3300005577	Ga0068857_100089880	Ga0068857_1000898803	464
555	3300021361	Ga0213872_10005396	Ga0213872_100053964	464
556	3300026116	Ga0207674_10164399	Ga0207674_101643992	464
557	3300039447	Ga0436361_0059408	Ga0436361_0059408_12300_13724	464
558	3300046460	Ga0495638_0013349	Ga0495638_0013349_633_2027	464
559	3300053110	Ga0500571_001637	Ga0500571_001637_3792_5186	464
560	3300053134	Ga0500658_0002645	Ga0500658_0002645_2476_3870	464
561	3300053141	Ga0500574_009530	Ga0500574_009530_21_1415	464
562	3300053162	Ga0500638_000777	Ga0500638_000777_2125_3519	464
563	3300053730	Ga0500645_009840	Ga0500645_009840_1208_2629	464
564	3300005543	Ga0070672_100142259	Ga0070672_1001422592	465
565	3300013105	Ga0157369_10013030	Ga0157369_100130303	465
566	3300025940	Ga0207691_10136569	Ga0207691_101365692	465
567	3300025972	Ga0207668_10049231	Ga0207668_100492311	465
568	3300028794	Ga0307515_10218022	Ga0307515_102180222	465
569	3300033180	Ga0307510_10079965	Ga0307510_100799652	465
570	3300037471	Ga0395905_0003802	Ga0395905_0003802_9856_11253	465
571	3300046539	Ga0495621_0006348	Ga0495621_0006348_1433_2854	465
572	iso_pu_bacteria	2599185292	2599906178	465
573	iso_pu_bacteria	2643221569	2643861960	465
574	iso_pu_bacteria	2643221594	2643980996	465
575	iso_pu_bacteria	2643221621	2644122460	465
576	iso_pu_bacteria	2739367655	2739613324	465
577	iso_pu_bacteria	2808606395	2809031678	465
578	iso_pu_bacteria	2857537821	2857540780	465
579	iso_pu_bacteria	2857542790	2857546775	465
580	iso_pu_bacteria	2858950400	2858956498	465
581	iso_pu_bacteria	2881927736	2881930752	465
582	iso_pu_bacteria	2941479691	2941482318	465
583	iso_pu_bacteria	8002392321	8002394899	465
584	3300003794	Ga0055531_10000154	Ga0055531_1000015445	466
585	3300005262	Ga0065165_1000409	Ga0065165_100040941	466
586	3300006353	Ga0075370_10003680	Ga0075370_100036804	466
587	3300006353	Ga0075370_10011436	Ga0075370_100114361	466
588	3300025303	Ga0209051_1002538	Ga0209051_10025387	466
589	3300025304	Ga0209257_1000016	Ga0209257_1000016851	466
590	3300025304	Ga0209257_1005433	Ga0209257_10054339	466
591	3300028794	Ga0307515_10033526	Ga0307515_100335269	466
592	3300034817	Ga0373948_0002850	Ga0373948_0002850_118_1524	466
593	3300035114	Ga0373939_0000060	Ga0373939_0000060_25825_27231	466
594	3300035121	Ga0373960_0005559	Ga0373960_0005559_44_1450	466
595	3300035691	Ga0373931_0000365	Ga0373931_0000365_3276_4682	466
596	3300037471	Ga0395905_0005626	Ga0395905_0005626_4264_5667	466
597	3300037471	Ga0395905_0008575	Ga0395905_0008575_5464_6867	466
598	3300044658	Ga0466972_0036156	Ga0466972_0036156_522_1931	466
599	3300045051	Ga0451576_0039036	Ga0451576_0039036_846_2333	466
600	3300046690	Ga0495624_0012670	Ga0495624_0012670_711_2159	466
601	3300047321	Ga0495676_0020117	Ga0495676_0020117_3295_4743	466
602	3300049704	Ga0501221_000042	Ga0501221_000042_8636_10042	466
603	3300049706	Ga0501229_000298	Ga0501229_000298_1310_2716	466
604	3300049764	Ga0501267_000235	Ga0501267_000235_1428_2834	466
605	3300049824	Ga0501045_0026114	Ga0501045_0026114_2566_3966	466
606	3300050496	nmdc:mga07m45_1459_c1	nmdc:mga07m45_1459_c1_4044_5450	466
607	3300053153	Ga0500616_0022653	Ga0500616_0022653_1948_3351	466
608	iso_pu_bacteria	2831864461	2831864785	466
609	iso_pu_bacteria	2886848708	2886851129	466
610	3300003187	JGI25151J46595_10007645	JGI25151J46595_100076452	467
611	3300003316	rootH1_10001412	rootH1_100014125	467
612	3300005336	Ga0070680_100031048	Ga0070680_1000310484	467
613	3300025912	Ga0207707_10002308	Ga0207707_100023087	467
614	3300028794	Ga0307515_10007405	Ga0307515_1000740511	467
615	3300031548	Ga0307408_100000039	Ga0307408_10000003958	467
616	3300037418	Ga0395900_0001014	Ga0395900_0001014_18305_19714	467
617	3300037466	Ga0395898_0000872	Ga0395898_0000872_44589_45998	467
618	3300042000	Ga0439437_001738	Ga0439437_001738_489_1898	467
619	3300042120	Ga0450917_000052	Ga0450917_000052_4159_5568	467
620	3300042129	Ga0450891_000021	Ga0450891_000021_8167_9576	467
621	3300042876	Ga0451577_0009013	Ga0451577_0009013_3441_4880	467
622	3300053136	Ga0500559_0003993	Ga0500559_0003993_1986_3401	467
623	3300053140	Ga0500573_0037864	Ga0500573_0037864_1220_2635	467
624	iso_pu_bacteria	2643221660	2644339463	467
625	3300005262	Ga0065165_1000144	Ga0065165_100014428	468
626	3300005262	Ga0065165_1001432	Ga0065165_10014329	468
627	3300005436	Ga0070713_100011527	Ga0070713_1000115274	468
628	3300020080	Ga0206350_11147083	Ga0206350_111470833	468
629	3300025273	Ga0209673_1007842	Ga0209673_10078424	468
630	3300025291	Ga0209675_1000934	Ga0209675_10009346	468
631	3300025295	Ga0209564_1000030	Ga0209564_1000030348	468
632	3300025302	Ga0207426_1004530	Ga0207426_10045307	468
633	3300025303	Ga0209051_1002733	Ga0209051_10027332	468
634	3300025928	Ga0207700_10009142	Ga0207700_100091424	468
635	3300053156	Ga0500622_0002330	Ga0500622_0002330_6070_7488	468
636	3300053156	Ga0500622_0008613	Ga0500622_0008613_2321_3739	468
637	3300059421	Ga0590071_002214	Ga0590071_002214_3390_4850	468
638	iso_pu_bacteria	2585428057	2587726067	468
639	iso_pu_bacteria	2585428058	2587735797	468
640	iso_pu_bacteria	2585428062	2587756490	468
641	iso_pu_bacteria	2588253510	2588290394	468
642	iso_pu_bacteria	2643221592	2643967703	468
643	iso_pu_bacteria	2643221625	2644140525	468
644	iso_pu_bacteria	2643221648	2644273492	468
645	iso_pu_bacteria	2643221654	2644305275	468
646	3300005355	Ga0070671_100014234	Ga0070671_1000142342	469
647	3300005459	Ga0068867_100055605	Ga0068867_1000556051	469
648	3300005618	Ga0068864_100022099	Ga0068864_1000220994	469
649	3300005844	Ga0068862_100006630	Ga0068862_10000663010	469
650	3300006051	Ga0075364_10017517	Ga0075364_100175172	469
651	3300009177	Ga0105248_10001476	Ga0105248_1000147617	469
652	3300025242	Ga0209258_104633	Ga0209258_1046332	469
653	3300025272	Ga0209455_1000625	Ga0209455_100062516	469
654	3300025292	Ga0209676_1018775	Ga0209676_10187751	469
655	3300025298	Ga0209050_1003403	Ga0209050_10034032	469
656	3300025924	Ga0207694_10132886	Ga0207694_101328862	469
657	3300025941	Ga0207711_10054315	Ga0207711_100543152	469
658	3300026095	Ga0207676_10064063	Ga0207676_100640632	469
659	3300031649	Ga0307514_10002390	Ga0307514_100023905	469
660	3300031911	Ga0307412_10002198	Ga0307412_100021987	469
661	3300037418	Ga0395900_0022729	Ga0395900_0022729_3118_4545	469
662	3300044684	Ga0466966_0002762	Ga0466966_0002762_2427_3839	469
663	3300044694	Ga0466963_0026644	Ga0466963_0026644_1184_2596	469
664	3300044706	Ga0466964_0007917	Ga0466964_0007917_1114_2526	469
665	3300045049	Ga0466959_0000147	Ga0466959_0000147_37657_39069	469
666	3300045836	Ga0466958_0074120	Ga0466958_0074120_420_1832	469
667	3300045976	Ga0466967_0022160	Ga0466967_0022160_335_1747	469
668	3300048907	Ga0496104_0047071	Ga0496104_0047071_2382_3797	469
669	3300048908	Ga0496105_0085449	Ga0496105_0085449_11_1555	469
670	3300048911	Ga0496108_0051524	Ga0496108_0051524_107_1522	469
671	3300048912	Ga0496109_0076679	Ga0496109_0076679_295_1710	469
672	3300048915	Ga0496112_0007649	Ga0496112_0007649_7193_8608	469
673	3300048919	Ga0496116_0001838	Ga0496116_0001838_20228_21637	469
674	3300048919	Ga0496116_0083620	Ga0496116_0083620_229_1638	469
675	3300048921	Ga0496118_0008090	Ga0496118_0008090_5413_6822	469
676	3300048921	Ga0496118_0039108	Ga0496118_0039108_1242_2651	469
677	3300048922	Ga0496119_0006080	Ga0496119_0006080_9467_10876	469
678	3300048923	Ga0496120_0005744	Ga0496120_0005744_6200_7609	469
679	3300048924	Ga0496121_0000127	Ga0496121_0000127_88415_89824	469
680	3300048925	Ga0496122_0000601	Ga0496122_0000601_16332_17741	469
681	3300048926	Ga0496123_0001435	Ga0496123_0001435_23896_25305	469
682	3300048927	Ga0496124_0049982	Ga0496124_0049982_1721_3130	469
683	3300048928	Ga0496125_0000011	Ga0496125_0000011_520992_522401	469
684	3300048928	Ga0496125_0047084	Ga0496125_0047084_1330_2739	469
685	3300048929	Ga0496126_0060887	Ga0496126_0060887_241_1650	469
686	3300049822	Ga0501035_0025406	Ga0501035_0025406_3967_5376	469
687	3300049823	Ga0501044_0000130	Ga0501044_0000130_68188_69597	469
688	3300050491	nmdc:mga00v17_2001_c2	nmdc:mga00v17_2001_c2_2864_4279	469
689	iso_pu_bacteria	2511231002	2511244189	469
690	iso_pu_bacteria	2671180139	2671693031	469
691	iso_pu_bacteria	2928115317	2928116632	469
692	3300002705	JGI25156J39149_1001863	JGI25156J39149_10018636	470
693	3300002738	JGI25154J39366_1003147	JGI25154J39366_10031473	470
694	3300002741	JGI25157J39369_1000038	JGI25157J39369_10000383	470
695	3300003322	rootL2_10002373	rootL2_1000237322	470
696	3300003752	Ga0055539_1000775	Ga0055539_10007754	470
697	3300003752	Ga0055539_1001158	Ga0055539_10011583	470
698	3300003756	Ga0055533_1000026	Ga0055533_1000026211	470
699	3300003759	Ga0055525_1000823	Ga0055525_10008236	470
700	3300003761	Ga0055535_1000056	Ga0055535_1000056113	470
701	3300003763	Ga0055529_1000103	Ga0055529_1000103100	470
702	3300003775	Ga0055524_1000441	Ga0055524_100044126	470
703	3300003794	Ga0055531_10007228	Ga0055531_100072282	470
704	3300005295	Ga0065707_10082206	Ga0065707_1008220611	470
705	3300005327	Ga0070658_10056140	Ga0070658_100561401	470
706	3300005339	Ga0070660_100044318	Ga0070660_1000443182	470
707	3300005339	Ga0070660_100080342	Ga0070660_1000803422	470
708	3300005563	Ga0068855_100036538	Ga0068855_1000365383	470
709	3300005577	Ga0068857_100011814	Ga0068857_1000118146	470
710	3300005614	Ga0068856_100002420	Ga0068856_10000242016	470
711	3300005617	Ga0068859_100053138	Ga0068859_1000531382	470
712	3300005843	Ga0068860_100027157	Ga0068860_1000271571	470
713	3300006195	Ga0075366_10012869	Ga0075366_100128691	470
714	3300006195	Ga0075366_10037021	Ga0075366_100370213	470
715	3300006353	Ga0075370_10002202	Ga0075370_100022026	470
716	3300006353	Ga0075370_10045161	Ga0075370_100451613	470
717	3300006931	Ga0097620_100053135	Ga0097620_1000531355	470
718	3300009093	Ga0105240_10045085	Ga0105240_100450856	470
719	3300009093	Ga0105240_10116112	Ga0105240_101161122	470
720	3300009545	Ga0105237_10063382	Ga0105237_100633824	470
721	3300009551	Ga0105238_10093812	Ga0105238_100938122	470
722	3300010375	Ga0105239_10008170	Ga0105239_100081706	470
723	3300012497	Ga0157319_1000002	Ga0157319_100000285	470
724	3300013297	Ga0157378_10058669	Ga0157378_100586692	470
725	3300025226	Ga0209674_100024	Ga0209674_10002490	470
726	3300025230	Ga0209563_100069	Ga0209563_10006990	470
727	3300025231	Ga0207427_101225	Ga0207427_1012257	470
728	3300025242	Ga0209258_100071	Ga0209258_10007110	470
729	3300025246	Ga0209646_1000012	Ga0209646_1000012416	470
730	3300025250	Ga0209026_1000004	Ga0209026_1000004204	470
731	3300025253	Ga0209677_100092	Ga0209677_10009212	470
732	3300025253	Ga0209677_101513	Ga0209677_1015133	470
733	3300025254	Ga0209148_1010500	Ga0209148_10105002	470
734	3300025256	Ga0209759_1000003	Ga0209759_1000003524	470
735	3300025256	Ga0209759_1001236	Ga0209759_10012367	470
736	3300025256	Ga0209759_1005341	Ga0209759_10053414	470
737	3300025272	Ga0209455_1000030	Ga0209455_1000030261	470
738	3300025299	Ga0209256_1000236	Ga0209256_100023644	470
739	3300025303	Ga0209051_1008922	Ga0209051_10089224	470
740	3300025304	Ga0209257_1000465	Ga0209257_100046569	470
741	3300025911	Ga0207654_10041383	Ga0207654_100413833	470
742	3300025913	Ga0207695_10005726	Ga0207695_1000572611	470
743	3300025913	Ga0207695_10077010	Ga0207695_100770102	470
744	3300025914	Ga0207671_10179262	Ga0207671_101792622	470
745	3300025919	Ga0207657_10036219	Ga0207657_100362193	470
746	3300025919	Ga0207657_10054371	Ga0207657_100543712	470
747	3300025924	Ga0207694_10010043	Ga0207694_100100434	470
748	3300025949	Ga0207667_10057783	Ga0207667_100577832	470
749	3300025960	Ga0207651_10006210	Ga0207651_100062102	470
750	3300025981	Ga0207640_10013727	Ga0207640_100137272	470
751	3300026078	Ga0207702_10000253	Ga0207702_1000025322	470
752	3300026116	Ga0207674_10019326	Ga0207674_100193263	470
753	3300026118	Ga0207675_100014779	Ga0207675_1000147794	470
754	3300028381	Ga0268264_10041784	Ga0268264_100417843	470
755	3300028794	Ga0307515_10000013	Ga0307515_10000013311	470
756	3300028794	Ga0307515_10000291	Ga0307515_100002917	470
757	3300030521	Ga0307511_10046377	Ga0307511_100463775	470
758	3300031548	Ga0307408_100057487	Ga0307408_1000574873	470
759	3300031730	Ga0307516_10000614	Ga0307516_100006149	470
760	3300031730	Ga0307516_10018396	Ga0307516_100183963	470
761	3300035691	Ga0373931_0004773	Ga0373931_0004773_3385_4800	470
762	3300035695	Ga0373927_0028309	Ga0373927_0028309_353_1810	470
763	3300036401	Ga0373937_0019093	Ga0373937_0019093_1507_2922	470
764	3300037068	Ga0373925_0004762	Ga0373925_0004762_4900_6357	470
765	3300042011	Ga0439454_002412	Ga0439454_002412_313_1800	470
766	3300044656	Ga0466969_0006475	Ga0466969_0006475_2452_3867	470
767	3300044693	Ga0466961_0020296	Ga0466961_0020296_1484_2899	470
768	3300044706	Ga0466964_0005681	Ga0466964_0005681_1918_3333	470
769	3300044712	Ga0453684_0050672	Ga0453684_0050672_3153_4568	470
770	3300044719	Ga0466971_0012479	Ga0466971_0012479_2075_3490	470
771	3300044735	Ga0466968_0019753	Ga0466968_0019753_1190_2605	470
772	3300044765	Ga0466970_0031229	Ga0466970_0031229_571_1986	470
773	3300045051	Ga0451576_0012555	Ga0451576_0012555_1068_2483	470
774	3300046506	Ga0495583_0000018	Ga0495583_0000018_38244_39659	470
775	3300046507	Ga0495606_0000870	Ga0495606_0000870_37728_39143	470
776	3300046660	Ga0495625_0033518	Ga0495625_0033518_2180_3595	470
777	3300046684	Ga0495669_0020238	Ga0495669_0020238_1190_2605	470
778	3300046694	Ga0495649_0001395	Ga0495649_0001395_11745_13160	470
779	3300046794	Ga0495589_0001942	Ga0495589_0001942_7463_8878	470
780	3300048907	Ga0496104_0124443	Ga0496104_0124443_844_2355	470
781	3300049577	Ga0501041_0002474	Ga0501041_0002474_5382_6794	470
782	3300049578	Ga0501042_0063486	Ga0501042_0063486_148_1560	470
783	3300049581	Ga0501047_0084129	Ga0501047_0084129_1618_3033	470
784	3300049588	Ga0501072_0016771	Ga0501072_0016771_3571_4983	470
785	3300049591	Ga0501075_0010015	Ga0501075_0010015_4500_5912	470
786	3300049592	Ga0501076_0005493	Ga0501076_0005493_3212_4624	470
787	3300050493	nmdc:mga0k408_19065_c1	nmdc:mga0k408_19065_c1_1543_2961	470
788	3300050493	nmdc:mga0k408_412_c1	nmdc:mga0k408_412_c1_15509_16924	470
789	3300050496	nmdc:mga07m45_4586_c1	nmdc:mga07m45_4586_c1_2290_3708	470
790	3300053080	Ga0500635_0000112	Ga0500635_0000112_45343_46758	470
791	3300054114	Ga0501084_0018551	Ga0501084_0018551_2984_4396	470
792	3300060353	Ga0501082_0012824	Ga0501082_0012824_981_2393	470
793	3300061734	Ga0530510_0000991	Ga0530510_0000991_12440_13852	470
794	iso_pu_bacteria	2513020051	2513231740	470
795	iso_pu_bacteria	2547132374	2548500773	470
796	iso_pu_bacteria	2599185214	2599621471	470
797	iso_pu_bacteria	2599185226	2599670845	470
798	iso_pu_bacteria	2599185227	2599679335	470
799	iso_pu_bacteria	2599185229	2599690982	470
800	iso_pu_bacteria	2643221570	2643864258	470
801	iso_pu_bacteria	2643221596	2643992554	470
802	iso_pu_bacteria	2643221609	2644057901	470
803	iso_pu_bacteria	2643221611	2644072937	470
804	iso_pu_bacteria	2643221628	2644163478	470
805	iso_pu_bacteria	2643221652	2644292046	470
806	iso_pu_bacteria	2643221658	2644327309	470
807	iso_pu_bacteria	2643221672	2644401915	470
808	iso_pu_bacteria	2643221683	2644465673	470
809	iso_pu_bacteria	2643221717	2644646675	470
810	iso_pu_bacteria	2738541277	2738722695	470
811	iso_pu_bacteria	2738541307	2738883610	470
812	iso_pu_bacteria	2738543012	2739242174	470
813	iso_pu_bacteria	2738543013	2739247580	470
814	iso_pu_bacteria	2738543019	2739283266	470
815	iso_pu_bacteria	2816332133	2816470209	470
816	iso_pu_bacteria	2818991446	2819597637	470
817	iso_pu_bacteria	2831265667	2831268629	470
818	iso_pu_bacteria	2838054893	2838058059	470
819	iso_pu_bacteria	2842677519	2842682263	470
820	iso_pu_bacteria	2842718218	2842720419	470
821	iso_pu_bacteria	2842733646	2842737229	470
822	iso_pu_bacteria	2842747753	2842750467	470
823	iso_pu_bacteria	2881101125	2881104567	470
824	iso_pu_bacteria	2885192300	2885194954	470
825	iso_pu_bacteria	2885198086	2885204211	470
826	iso_pu_bacteria	2885211737	2885217455	470
827	iso_pu_bacteria	2894023352	2894027491	470
828	iso_pu_bacteria	2899924645	2899929057	470
829	iso_pu_bacteria	2904449895	2904451382	470
830	iso_pu_bacteria	2904456579	2904458244	470
831	iso_pu_bacteria	2904479285	2904481396	470
832	iso_pu_bacteria	2904541872	2904543031	470
833	iso_pu_bacteria	2919462493	2919466626	470
834	iso_pu_bacteria	2919704043	2919708215	470
835	iso_pu_bacteria	2928037797	2928040509	470
836	iso_pu_bacteria	2928044640	2928046742	470
837	iso_pu_bacteria	2928051484	2928058069	470
838	iso_pu_bacteria	2928064002	2928067591	470
839	iso_pu_bacteria	2928070936	2928072129	470
840	iso_pu_bacteria	2928084124	2928085339	470
841	iso_pu_bacteria	2929160207	2929160260	470
842	iso_pu_bacteria	2929520902	2929526138	470
843	iso_pu_bacteria	2945909444	2945915290	470
844	iso_pu_bacteria	2945945610	2945950691	470
845	iso_pu_bacteria	2945972063	2945974680	470
846	iso_pu_bacteria	2945984333	2945989300	470
847	iso_pu_bacteria	2954767861	2954769881	470
848	iso_pu_bacteria	2974320154	2974321401	470
849	iso_pu_bacteria	2990710928	2990714859	470
850	3300005353	Ga0070669_100132114	Ga0070669_1001321142	471
851	3300005441	Ga0070700_100029359	Ga0070700_1000293592	471
852	3300005459	Ga0068867_100000004	Ga0068867_100000004153	471
853	3300005539	Ga0068853_100059350	Ga0068853_1000593503	471
854	3300005718	Ga0068866_10003133	Ga0068866_100031331	471
855	3300005719	Ga0068861_100053471	Ga0068861_1000534712	471
856	3300005842	Ga0068858_100025199	Ga0068858_1000251992	471
857	3300005843	Ga0068860_100035565	Ga0068860_1000355653	471
858	3300006881	Ga0068865_100001798	Ga0068865_1000017985	471
859	3300009148	Ga0105243_10003290	Ga0105243_100032906	471
860	3300009148	Ga0105243_10014392	Ga0105243_100143924	471
861	3300009553	Ga0105249_10220008	Ga0105249_102200081	471
862	3300013297	Ga0157378_10266685	Ga0157378_102666851	471
863	3300013306	Ga0163162_10008764	Ga0163162_100087644	471
864	3300014745	Ga0157377_10000010	Ga0157377_10000010213	471
865	3300025923	Ga0207681_10070594	Ga0207681_100705942	471
866	3300025935	Ga0207709_10015061	Ga0207709_100150614	471
867	3300025938	Ga0207704_10003413	Ga0207704_100034132	471
868	3300026035	Ga0207703_10042697	Ga0207703_100426972	471
869	3300026075	Ga0207708_10046447	Ga0207708_100464472	471
870	3300026089	Ga0207648_10000002	Ga0207648_10000002150	471
871	3300026089	Ga0207648_10000425	Ga0207648_100004259	471
872	3300026118	Ga0207675_100078174	Ga0207675_1000781742	471
873	3300027526	Ga0209968_1003753	Ga0209968_10037532	471
874	3300027695	Ga0209966_1000030	Ga0209966_100003032	471
875	3300042134	Ga0450898_002023	Ga0450898_002023_692_2110	471
876	3300042876	Ga0451577_0037553	Ga0451577_0037553_2401_3819	471
877	3300002773	JGI25152J39213_1005858	JGI25152J39213_10058584	472
878	3300002774	JGI25150J39212_1006535	JGI25150J39212_10065352	472
879	3300003215	JGI25153J46596_10008722	JGI25153J46596_100087225	472
880	3300003794	Ga0055531_10001816	Ga0055531_100018162	472
881	3300005331	Ga0070670_100003594	Ga0070670_1000035944	472
882	3300005331	Ga0070670_100018243	Ga0070670_1000182434	472
883	3300005331	Ga0070670_100027568	Ga0070670_1000275684	472
884	3300005331	Ga0070670_100055007	Ga0070670_1000550073	472
885	3300005331	Ga0070670_100217344	Ga0070670_1002173441	472
886	3300005334	Ga0068869_100010924	Ga0068869_1000109242	472
887	3300005334	Ga0068869_100087496	Ga0068869_1000874962	472
888	3300005335	Ga0070666_10016220	Ga0070666_100162204	472
889	3300005336	Ga0070680_100010602	Ga0070680_1000106023	472
890	3300005338	Ga0068868_100003190	Ga0068868_1000031909	472
891	3300005338	Ga0068868_100005381	Ga0068868_1000053812	472
892	3300005338	Ga0068868_100077566	Ga0068868_1000775661	472
893	3300005338	Ga0068868_100134164	Ga0068868_1001341642	472
894	3300005338	Ga0068868_100163542	Ga0068868_1001635422	472
895	3300005344	Ga0070661_100137040	Ga0070661_1001370402	472
896	3300005353	Ga0070669_100060722	Ga0070669_1000607222	472
897	3300005354	Ga0070675_100000556	Ga0070675_10000055616	472
898	3300005354	Ga0070675_100009078	Ga0070675_1000090782	472
899	3300005354	Ga0070675_100009690	Ga0070675_1000096905	472
900	3300005354	Ga0070675_100031307	Ga0070675_1000313075	472
901	3300005354	Ga0070675_100044376	Ga0070675_1000443764	472
902	3300005354	Ga0070675_100090648	Ga0070675_1000906482	472
903	3300005355	Ga0070671_100006922	Ga0070671_1000069228	472
904	3300005355	Ga0070671_100031666	Ga0070671_1000316663	472
905	3300005355	Ga0070671_100049796	Ga0070671_1000497962	472
906	3300005356	Ga0070674_100006711	Ga0070674_1000067114	472
907	3300005364	Ga0070673_100001332	Ga0070673_1000013323	472
908	3300005364	Ga0070673_100038183	Ga0070673_1000381833	472
909	3300005364	Ga0070673_100169845	Ga0070673_1001698452	472
910	3300005366	Ga0070659_100176389	Ga0070659_1001763891	472
911	3300005367	Ga0070667_100006878	Ga0070667_1000068784	472
912	3300005367	Ga0070667_100009343	Ga0070667_1000093434	472
913	3300005367	Ga0070667_100049239	Ga0070667_1000492391	472
914	3300005455	Ga0070663_100045287	Ga0070663_1000452874	472
915	3300005455	Ga0070663_100139576	Ga0070663_1001395761	472
916	3300005456	Ga0070678_100005119	Ga0070678_1000051197	472
917	3300005456	Ga0070678_100010617	Ga0070678_1000106173	472
918	3300005457	Ga0070662_100009445	Ga0070662_1000094453	472
919	3300005457	Ga0070662_100035907	Ga0070662_1000359072	472
920	3300005459	Ga0068867_100067174	Ga0068867_1000671742	472
921	3300005467	Ga0070706_100001745	Ga0070706_1000017454	472
922	3300005467	Ga0070706_100094707	Ga0070706_1000947073	472
923	3300005468	Ga0070707_100183067	Ga0070707_1001830672	472
924	3300005530	Ga0070679_100111316	Ga0070679_1001113161	472
925	3300005535	Ga0070684_100199022	Ga0070684_1001990221	472
926	3300005539	Ga0068853_100085915	Ga0068853_1000859153	472
927	3300005539	Ga0068853_100136616	Ga0068853_1001366162	472
928	3300005543	Ga0070672_100005974	Ga0070672_1000059746	472
929	3300005543	Ga0070672_100006624	Ga0070672_1000066244	472
930	3300005543	Ga0070672_100017355	Ga0070672_1000173554	472
931	3300005548	Ga0070665_100108586	Ga0070665_1001085863	472
932	3300005563	Ga0068855_100360865	Ga0068855_1003608651	472
933	3300005564	Ga0070664_100102731	Ga0070664_1001027312	472
934	3300005578	Ga0068854_100062628	Ga0068854_1000626282	472
935	3300005616	Ga0068852_100017950	Ga0068852_1000179505	472
936	3300005616	Ga0068852_100033112	Ga0068852_1000331124	472
937	3300005616	Ga0068852_100173584	Ga0068852_1001735841	472
938	3300005616	Ga0068852_100234257	Ga0068852_1002342571	472
939	3300005617	Ga0068859_100009651	Ga0068859_1000096513	472
940	3300005618	Ga0068864_100003888	Ga0068864_1000038889	472
941	3300005618	Ga0068864_100021530	Ga0068864_1000215302	472
942	3300005618	Ga0068864_100049786	Ga0068864_1000497864	472
943	3300005618	Ga0068864_100102358	Ga0068864_1001023582	472
944	3300005719	Ga0068861_100031453	Ga0068861_1000314532	472
945	3300005719	Ga0068861_100093153	Ga0068861_1000931532	472
946	3300005834	Ga0068851_10040977	Ga0068851_100409771	472
947	3300005834	Ga0068851_10088257	Ga0068851_100882571	472
948	3300005840	Ga0068870_10010073	Ga0068870_100100734	472
949	3300005841	Ga0068863_100009638	Ga0068863_10000963810	472
950	3300005842	Ga0068858_100000225	Ga0068858_10000022549	472
951	3300005842	Ga0068858_100027701	Ga0068858_1000277015	472
952	3300005842	Ga0068858_100029372	Ga0068858_1000293725	472
953	3300006042	Ga0075368_10010989	Ga0075368_100109891	472
954	3300006042	Ga0075368_10052546	Ga0075368_100525461	472
955	3300006048	Ga0075363_100004847	Ga0075363_1000048473	472
956	3300006051	Ga0075364_10014411	Ga0075364_100144114	472
957	3300006178	Ga0075367_10003802	Ga0075367_100038024	472
958	3300006178	Ga0075367_10004089	Ga0075367_100040894	472
959	3300006178	Ga0075367_10033830	Ga0075367_100338302	472
960	3300006178	Ga0075367_10082719	Ga0075367_100827192	472
961	3300006195	Ga0075366_10007955	Ga0075366_100079553	472
962	3300006195	Ga0075366_10014454	Ga0075366_100144542	472
963	3300006195	Ga0075366_10017049	Ga0075366_100170492	472
964	3300006237	Ga0097621_100019015	Ga0097621_1000190152	472
965	3300006237	Ga0097621_100059369	Ga0097621_1000593692	472
966	3300006353	Ga0075370_10006962	Ga0075370_100069625	472
967	3300006353	Ga0075370_10011497	Ga0075370_100114972	472
968	3300006353	Ga0075370_10017865	Ga0075370_100178651	472
969	3300006880	Ga0075429_100003380	Ga0075429_10000338012	472
970	3300006881	Ga0068865_100040314	Ga0068865_1000403142	472
971	3300006931	Ga0097620_100009651	Ga0097620_1000096513	472
972	3300006944	Ga0099823_1000014	Ga0099823_100001428	472
973	3300009093	Ga0105240_10016496	Ga0105240_100164963	472
974	3300009093	Ga0105240_10134402	Ga0105240_101344022	472
975	3300009098	Ga0105245_10091706	Ga0105245_100917061	472
976	3300009147	Ga0114129_10113900	Ga0114129_101139002	472
977	3300009177	Ga0105248_10032848	Ga0105248_100328482	472
978	3300009545	Ga0105237_10000080	Ga0105237_10000080102	472
979	3300009551	Ga0105238_10022002	Ga0105238_100220025	472
980	3300010375	Ga0105239_10000116	Ga0105239_100001165	472
981	3300013105	Ga0157369_10219052	Ga0157369_102190522	472
982	3300013296	Ga0157374_10116034	Ga0157374_101160341	472
983	3300013306	Ga0163162_10087753	Ga0163162_100877533	472
984	3300013306	Ga0163162_10200628	Ga0163162_102006282	472
985	3300013307	Ga0157372_10394214	Ga0157372_103942141	472
986	3300013308	Ga0157375_10020633	Ga0157375_100206336	472
987	3300013308	Ga0157375_10025537	Ga0157375_100255376	472
988	3300014968	Ga0157379_10023411	Ga0157379_100234116	472
989	3300014969	Ga0157376_10045560	Ga0157376_100455603	472
990	3300014969	Ga0157376_10093200	Ga0157376_100932002	472
991	3300021377	Ga0213874_10019135	Ga0213874_100191352	472
992	3300025245	Ga0207425_1000196	Ga0207425_10001962	472
993	3300025258	Ga0209129_1000035	Ga0209129_10000353	472
994	3300025273	Ga0209673_1022076	Ga0209673_10220761	472
995	3300025295	Ga0209564_1000024	Ga0209564_1000024197	472
996	3300025297	Ga0209758_1000558	Ga0209758_100055831	472
997	3300025297	Ga0209758_1001090	Ga0209758_10010901	472
998	3300025298	Ga0209050_1000266	Ga0209050_10002662	472
999	3300025298	Ga0209050_1004398	Ga0209050_10043982	472
1000	3300025299	Ga0209256_1000594	Ga0209256_100059414	472
1001	3300025299	Ga0209256_1021222	Ga0209256_10212222	472
1002	3300025304	Ga0209257_1000393	Ga0209257_100039351	472
1003	3300025315	Ga0207697_10008679	Ga0207697_100086792	472
1004	3300025321	Ga0207656_10068225	Ga0207656_100682251	472
1005	3300025893	Ga0207682_10008870	Ga0207682_100088703	472
1006	3300025893	Ga0207682_10020496	Ga0207682_100204962	472
1007	3300025901	Ga0207688_10087524	Ga0207688_100875241	472
1008	3300025903	Ga0207680_10006999	Ga0207680_100069992	472
1009	3300025907	Ga0207645_10038381	Ga0207645_100383812	472
1010	3300025910	Ga0207684_10011478	Ga0207684_100114784	472
1011	3300025913	Ga0207695_10006409	Ga0207695_100064094	472
1012	3300025914	Ga0207671_10002929	Ga0207671_1000292912	472
1013	3300025917	Ga0207660_10035238	Ga0207660_100352383	472
1014	3300025920	Ga0207649_10148821	Ga0207649_101488211	472
1015	3300025922	Ga0207646_10068288	Ga0207646_100682883	472
1016	3300025924	Ga0207694_10021302	Ga0207694_100213024	472
1017	3300025925	Ga0207650_10004536	Ga0207650_100045367	472
1018	3300025925	Ga0207650_10006068	Ga0207650_100060685	472
1019	3300025925	Ga0207650_10038608	Ga0207650_100386082	472
1020	3300025925	Ga0207650_10060664	Ga0207650_100606643	472
1021	3300025926	Ga0207659_10001095	Ga0207659_1000109513	472
1022	3300025926	Ga0207659_10010711	Ga0207659_100107114	472
1023	3300025926	Ga0207659_10057790	Ga0207659_100577902	472
1024	3300025931	Ga0207644_10004898	Ga0207644_100048982	472
1025	3300025931	Ga0207644_10015669	Ga0207644_100156693	472
1026	3300025931	Ga0207644_10017445	Ga0207644_100174453	472
1027	3300025932	Ga0207690_10078835	Ga0207690_100788351	472
1028	3300025933	Ga0207706_10022909	Ga0207706_100229093	472
1029	3300025933	Ga0207706_10030489	Ga0207706_100304894	472
1030	3300025934	Ga0207686_10049577	Ga0207686_100495771	472
1031	3300025937	Ga0207669_10006790	Ga0207669_100067903	472
1032	3300025940	Ga0207691_10012361	Ga0207691_100123615	472
1033	3300025941	Ga0207711_10001731	Ga0207711_1000173119	472
1034	3300025941	Ga0207711_10014562	Ga0207711_100145625	472
1035	3300025941	Ga0207711_10051663	Ga0207711_100516633	472
1036	3300025941	Ga0207711_10107681	Ga0207711_101076812	472
1037	3300025942	Ga0207689_10023781	Ga0207689_100237814	472
1038	3300025960	Ga0207651_10002842	Ga0207651_100028427	472
1039	3300025960	Ga0207651_10154358	Ga0207651_101543581	472
1040	3300025986	Ga0207658_10001421	Ga0207658_1000142114	472
1041	3300025986	Ga0207658_10004188	Ga0207658_100041889	472
1042	3300026023	Ga0207677_10002797	Ga0207677_100027974	472
1043	3300026023	Ga0207677_10009333	Ga0207677_100093332	472
1044	3300026023	Ga0207677_10020733	Ga0207677_100207332	472
1045	3300026023	Ga0207677_10030790	Ga0207677_100307903	472
1046	3300026035	Ga0207703_10003821	Ga0207703_100038219	472
1047	3300026035	Ga0207703_10013562	Ga0207703_100135625	472
1048	3300026035	Ga0207703_10023150	Ga0207703_100231503	472
1049	3300026041	Ga0207639_10012399	Ga0207639_100123994	472
1050	3300026041	Ga0207639_10057301	Ga0207639_100573012	472
1051	3300026041	Ga0207639_10143878	Ga0207639_101438782	472
1052	3300026067	Ga0207678_10062247	Ga0207678_100622471	472
1053	3300026078	Ga0207702_10292623	Ga0207702_102926231	472
1054	3300026088	Ga0207641_10002703	Ga0207641_100027033	472
1055	3300026088	Ga0207641_10023206	Ga0207641_100232062	472
1056	3300026088	Ga0207641_10065641	Ga0207641_100656413	472
1057	3300026089	Ga0207648_10011180	Ga0207648_100111804	472
1058	3300026089	Ga0207648_10016341	Ga0207648_100163414	472
1059	3300026089	Ga0207648_10038654	Ga0207648_100386543	472
1060	3300026095	Ga0207676_10008075	Ga0207676_100080753	472
1061	3300026116	Ga0207674_10019462	Ga0207674_100194629	472
1062	3300026116	Ga0207674_10035101	Ga0207674_100351014	472
1063	3300026118	Ga0207675_100030399	Ga0207675_1000303993	472
1064	3300026118	Ga0207675_100062636	Ga0207675_1000626363	472
1065	3300026118	Ga0207675_100210979	Ga0207675_1002109792	472
1066	3300026121	Ga0207683_10044133	Ga0207683_100441332	472
1067	3300026142	Ga0207698_10012266	Ga0207698_100122665	472
1068	3300026142	Ga0207698_10026145	Ga0207698_100261454	472
1069	3300026142	Ga0207698_10110228	Ga0207698_101102281	472
1070	3300026142	Ga0207698_10150642	Ga0207698_101506422	472
1071	3300026142	Ga0207698_10214676	Ga0207698_102146761	472
1072	3300027296	Ga0209389_1001256	Ga0209389_10012568	472
1073	3300028786	Ga0307517_10001027	Ga0307517_1000102728	472
1074	3300028794	Ga0307515_10009775	Ga0307515_1000977517	472
1075	3300028794	Ga0307515_10035888	Ga0307515_100358882	472
1076	3300028794	Ga0307515_10042814	Ga0307515_100428144	472
1077	3300028794	Ga0307515_10071039	Ga0307515_100710393	472
1078	3300030522	Ga0307512_10016074	Ga0307512_100160744	472
1079	3300030522	Ga0307512_10036833	Ga0307512_100368334	472
1080	3300031456	Ga0307513_10002171	Ga0307513_1000217114	472
1081	3300031456	Ga0307513_10003908	Ga0307513_1000390812	472
1082	3300031456	Ga0307513_10051271	Ga0307513_100512712	472
1083	3300031456	Ga0307513_10168259	Ga0307513_101682591	472
1084	3300031507	Ga0307509_10000993	Ga0307509_1000099328	472
1085	3300031507	Ga0307509_10052048	Ga0307509_100520482	472
1086	3300031507	Ga0307509_10094138	Ga0307509_100941381	472
1087	3300031507	Ga0307509_10136123	Ga0307509_101361232	472
1088	3300031548	Ga0307408_100196009	Ga0307408_1001960091	472
1089	3300031616	Ga0307508_10000050	Ga0307508_1000005085	472
1090	3300031616	Ga0307508_10016037	Ga0307508_100160375	472
1091	3300031616	Ga0307508_10050206	Ga0307508_100502061	472
1092	3300031616	Ga0307508_10173648	Ga0307508_101736482	472
1093	3300031649	Ga0307514_10007570	Ga0307514_100075705	472
1094	3300031649	Ga0307514_10011020	Ga0307514_100110202	472
1095	3300031649	Ga0307514_10047869	Ga0307514_100478692	472
1096	3300031730	Ga0307516_10000610	Ga0307516_1000061041	472
1097	3300031730	Ga0307516_10037859	Ga0307516_100378592	472
1098	3300031731	Ga0307405_10011203	Ga0307405_100112034	472
1099	3300031852	Ga0307410_10046788	Ga0307410_100467883	472
1100	3300031995	Ga0307409_100003176	Ga0307409_1000031764	472
1101	3300032002	Ga0307416_100006040	Ga0307416_1000060406	472
1102	3300032126	Ga0307415_100042071	Ga0307415_1000420711	472
1103	3300033180	Ga0307510_10000129	Ga0307510_100001293	472
1104	3300033180	Ga0307510_10036761	Ga0307510_100367613	472
1105	3300035691	Ga0373931_0001114	Ga0373931_0001114_5275_6696	472
1106	3300036401	Ga0373937_0032134	Ga0373937_0032134_145_1566	472
1107	3300037068	Ga0373925_0018650	Ga0373925_0018650_731_2152	472
1108	3300037471	Ga0395905_0005213	Ga0395905_0005213_2107_3558	472
1109	3300037471	Ga0395905_0006556	Ga0395905_0006556_4671_6092	472
1110	3300037471	Ga0395905_0077943	Ga0395905_0077943_969_2522	472
1111	3300039450	Ga0436363_0562297	Ga0436363_0562297_851_2272	472
1112	3300041452	Ga0451793_1833009	Ga0451793_1833009_369_1790	472
1113	3300041509	Ga0451843_1310142	Ga0451843_1310142_395_1816	472
1114	3300042876	Ga0451577_0000194	Ga0451577_0000194_12877_14298	472
1115	3300044658	Ga0466972_0000714	Ga0466972_0000714_3736_5157	472
1116	3300044673	Ga0453683_0039154	Ga0453683_0039154_311_1732	472
1117	3300044683	Ga0466965_0034326	Ga0466965_0034326_681_2102	472
1118	3300044683	Ga0466965_0041124	Ga0466965_0041124_479_1900	472
1119	3300044683	Ga0466965_0048494	Ga0466965_0048494_420_1841	472
1120	3300044712	Ga0453684_0000218	Ga0453684_0000218_144387_145808	472
1121	3300045051	Ga0451576_0112667	Ga0451576_0112667_766_2187	472
1122	3300045051	Ga0451576_0121635	Ga0451576_0121635_956_2377	472
1123	3300045051	Ga0451576_0227614	Ga0451576_0227614_178_1599	472
1124	3300046454	Ga0495592_0000421	Ga0495592_0000421_3316_4737	472
1125	3300046454	Ga0495592_0120862	Ga0495592_0120862_219_1640	472
1126	3300046471	Ga0495650_0015476	Ga0495650_0015476_1391_2824	472
1127	3300046519	Ga0495632_0002259	Ga0495632_0002259_11579_13027	472
1128	3300046519	Ga0495632_0005894	Ga0495632_0005894_1423_2844	472
1129	3300046660	Ga0495625_0003005	Ga0495625_0003005_8945_10366	472
1130	3300046683	Ga0495658_0047382	Ga0495658_0047382_23_1444	472
1131	3300046694	Ga0495649_0003876	Ga0495649_0003876_3408_4856	472
1132	3300047472	Ga0495686_0101407	Ga0495686_0101407_29_1450	472
1133	3300048907	Ga0496104_0111040	Ga0496104_0111040_428_1873	472
1134	3300048909	Ga0496106_0081219	Ga0496106_0081219_671_2092	472
1135	3300048909	Ga0496106_0100889	Ga0496106_0100889_144_1565	472
1136	3300048912	Ga0496109_0087988	Ga0496109_0087988_335_1756	472
1137	3300048915	Ga0496112_0054653	Ga0496112_0054653_436_1857	472
1138	3300048918	Ga0496115_0111994	Ga0496115_0111994_447_1868	472
1139	3300048921	Ga0496118_0031847	Ga0496118_0031847_855_2309	472
1140	3300048928	Ga0496125_0044345	Ga0496125_0044345_37_1491	472
1141	3300049579	Ga0501043_0000071	Ga0501043_0000071_58993_60414	472
1142	3300049580	Ga0501046_0003675	Ga0501046_0003675_10255_11676	472
1143	3300049581	Ga0501047_0000087	Ga0501047_0000087_56924_58345	472
1144	3300049582	Ga0501048_0007279	Ga0501048_0007279_5846_7267	472
1145	3300049649	Ga0501198_000009	Ga0501198_000009_4136_5626	472
1146	3300049662	Ga0501222_000001	Ga0501222_000001_179333_180823	472
1147	3300049822	Ga0501035_0060811	Ga0501035_0060811_943_2364	472
1148	3300049824	Ga0501045_0015438	Ga0501045_0015438_1525_2946	472
1149	3300050489	nmdc:mga03683_7364_c1	nmdc:mga03683_7364_c1_761_2194	472
1150	3300050492	nmdc:mga0yw44_4108_c1	nmdc:mga0yw44_4108_c1_1719_3152	472
1151	3300050493	nmdc:mga0k408_46067_c1	nmdc:mga0k408_46067_c1_683_2113	472
1152	3300050493	nmdc:mga0k408_81567_c1	nmdc:mga0k408_81567_c1_185_1609	472
1153	3300050494	nmdc:mga06z11_5917_c1	nmdc:mga06z11_5917_c1_2351_3784	472
1154	3300050496	nmdc:mga07m45_11193_c2	nmdc:mga07m45_11193_c2_255_1676	472
1155	3300050496	nmdc:mga07m45_183_c1	nmdc:mga07m45_183_c1_4319_5752	472
1156	3300050496	nmdc:mga07m45_2479_c1	nmdc:mga07m45_2479_c1_1619_3043	472
1157	3300050508	nmdc:mga09592_16423_c1	nmdc:mga09592_16423_c1_2845_4269	472
1158	3300050509	nmdc:mga0qj67_62404_c1	nmdc:mga0qj67_62404_c1_791_2215	472
1159	3300053077	Ga0495601_0053687	Ga0495601_0053687_564_1985	472
1160	3300053086	Ga0500578_0000057	Ga0500578_0000057_41655_43076	472
1161	3300053098	Ga0500650_0017181	Ga0500650_0017181_1454_2875	472
1162	3300053109	Ga0500569_024694	Ga0500569_024694_132_1553	472
1163	3300053130	Ga0500642_0020485	Ga0500642_0020485_1145_2566	472
1164	3300053131	Ga0500652_003984	Ga0500652_003984_524_1945	472
1165	3300053148	Ga0500590_011759	Ga0500590_011759_1649_3070	472
1166	3300053156	Ga0500622_0000390	Ga0500622_0000390_36775_38196	472
1167	3300053156	Ga0500622_0001747	Ga0500622_0001747_1225_2646	472
1168	3300002704	JGI25155J39150_1000009	JGI25155J39150_100000943	473
1169	3300002705	JGI25156J39149_1000009	JGI25156J39149_1000009177	473
1170	3300002738	JGI25154J39366_1000024	JGI25154J39366_1000024177	473
1171	3300002741	JGI25157J39369_1000007	JGI25157J39369_1000007177	473
1172	3300002987	JGI25159J45721_1000252	JGI25159J45721_100025216	473
1173	3300002987	JGI25159J45721_1004296	JGI25159J45721_10042961	473
1174	3300003354	JGI25160J50197_1000131	JGI25160J50197_100013127	473
1175	3300003374	JGI25161J50226_1000009	JGI25161J50226_100000945	473
1176	3300003773	Ga0055537_1000020	Ga0055537_1000020108	473
1177	3300003775	Ga0055524_1000047	Ga0055524_1000047137	473
1178	3300003781	Ga0055536_1003742	Ga0055536_10037427	473
1179	3300003784	Ga0055534_1002183	Ga0055534_10021835	473
1180	3300003790	Ga0055528_1001275	Ga0055528_100127510	473
1181	3300003791	Ga0055530_10001499	Ga0055530_1000149912	473
1182	3300003792	Ga0055540_1000027	Ga0055540_10000277	473
1183	3300003794	Ga0055531_10002146	Ga0055531_100021469	473
1184	3300004625	Ga0055543_1000122	Ga0055543_100012268	473
1185	3300006353	Ga0075370_10074568	Ga0075370_100745682	473
1186	3300025206	Ga0209435_100008	Ga0209435_10000884	473
1187	3300025245	Ga0207425_1004751	Ga0207425_10047511	473
1188	3300025246	Ga0209646_1000029	Ga0209646_1000029194	473
1189	3300025250	Ga0209026_1000016	Ga0209026_1000016194	473
1190	3300025256	Ga0209759_1000016	Ga0209759_1000016194	473
1191	3300025263	Ga0209565_1000061	Ga0209565_1000061117	473
1192	3300025273	Ga0209673_1000298	Ga0209673_100029879	473
1193	3300025284	Ga0209130_1000014	Ga0209130_1000014182	473
1194	3300025284	Ga0209130_1000862	Ga0209130_10008626	473
1195	3300025291	Ga0209675_1000105	Ga0209675_100010587	473
1196	3300025291	Ga0209675_1002639	Ga0209675_10026394	473
1197	3300025292	Ga0209676_1000013	Ga0209676_1000013581	473
1198	3300025292	Ga0209676_1000153	Ga0209676_1000153151	473
1199	3300025292	Ga0209676_1014189	Ga0209676_10141892	473
1200	3300025294	Ga0209025_1001613	Ga0209025_100161328	473
1201	3300025294	Ga0209025_1009609	Ga0209025_10096097	473
1202	3300025295	Ga0209564_1000181	Ga0209564_1000181115	473
1203	3300025295	Ga0209564_1000247	Ga0209564_100024726	473
1204	3300025295	Ga0209564_1012536	Ga0209564_10125361	473
1205	3300025297	Ga0209758_1006742	Ga0209758_10067429	473
1206	3300025298	Ga0209050_1000008	Ga0209050_1000008581	473
1207	3300025298	Ga0209050_1002084	Ga0209050_100208417	473
1208	3300025298	Ga0209050_1022572	Ga0209050_10225722	473
1209	3300025299	Ga0209256_1000039	Ga0209256_1000039180	473
1210	3300025302	Ga0207426_1000242	Ga0207426_100024269	473
1211	3300025302	Ga0207426_1012649	Ga0207426_10126492	473
1212	3300025303	Ga0209051_1000005	Ga0209051_1000005581	473
1213	3300025304	Ga0209257_1000031	Ga0209257_1000031171	473
1214	3300031456	Ga0307513_10000363	Ga0307513_1000036354	473
1215	3300031456	Ga0307513_10057168	Ga0307513_100571683	473
1216	3300031548	Ga0307408_100002831	Ga0307408_10000283111	473
1217	3300031730	Ga0307516_10006839	Ga0307516_100068396	473
1218	3300042876	Ga0451577_0066303	Ga0451577_0066303_1758_3179	473
1219	3300042876	Ga0451577_0091296	Ga0451577_0091296_158_1579	473
1220	3300045051	Ga0451576_0021874	Ga0451576_0021874_3904_5325	473
1221	3300053117	Ga0500593_000655	Ga0500593_000655_272_1696	473
1222	3300053730	Ga0500645_000425	Ga0500645_000425_7153_8577	473
1223	3300001979	JGI24740J21852_10009107	JGI24740J21852_100091074	474
1224	3300002773	JGI25152J39213_1003723	JGI25152J39213_10037235	474
1225	3300002774	JGI25150J39212_1000613	JGI25150J39212_100061310	474
1226	3300003187	JGI25151J46595_10003982	JGI25151J46595_100039822	474
1227	3300003578	Ga0006562J51391_1056663	Ga0006562J51391_10566631	474
1228	3300003578	Ga0006562J51391_1056666	Ga0006562J51391_10566662	474
1229	3300003761	Ga0055535_1000133	Ga0055535_100013335	474
1230	3300003762	Ga0055542_1000003	Ga0055542_1000003413	474
1231	3300003773	Ga0055537_1000032	Ga0055537_100003239	474
1232	3300003781	Ga0055536_1000647	Ga0055536_10006475	474
1233	3300003781	Ga0055536_1008029	Ga0055536_10080295	474
1234	3300003781	Ga0055536_1011688	Ga0055536_10116883	474
1235	3300003784	Ga0055534_1000060	Ga0055534_100006054	474
1236	3300003790	Ga0055528_1000171	Ga0055528_10001715	474
1237	3300003791	Ga0055530_10004907	Ga0055530_100049075	474
1238	3300003792	Ga0055540_1002051	Ga0055540_10020512	474
1239	3300003792	Ga0055540_1002299	Ga0055540_100229914	474
1240	3300003792	Ga0055540_1014274	Ga0055540_10142743	474
1241	3300003794	Ga0055531_10000574	Ga0055531_100005742	474
1242	3300003794	Ga0055531_10003335	Ga0055531_100033352	474
1243	3300005367	Ga0070667_100005809	Ga0070667_1000058093	474
1244	3300005457	Ga0070662_100161014	Ga0070662_1001610142	474
1245	3300005530	Ga0070679_100255569	Ga0070679_1002555692	474
1246	3300005539	Ga0068853_100009402	Ga0068853_1000094022	474
1247	3300005563	Ga0068855_100017336	Ga0068855_1000173365	474
1248	3300005564	Ga0070664_100000906	Ga0070664_10000090625	474
1249	3300006038	Ga0075365_10005200	Ga0075365_100052004	474
1250	3300006038	Ga0075365_10019461	Ga0075365_100194612	474
1251	3300006038	Ga0075365_10159248	Ga0075365_101592481	474
1252	3300006048	Ga0075363_100031689	Ga0075363_1000316891	474
1253	3300006177	Ga0075362_10002208	Ga0075362_100022082	474
1254	3300006177	Ga0075362_10003096	Ga0075362_100030967	474
1255	3300006195	Ga0075366_10015232	Ga0075366_100152323	474
1256	3300006195	Ga0075366_10055478	Ga0075366_100554781	474
1257	3300006353	Ga0075370_10005549	Ga0075370_100055494	474
1258	3300006353	Ga0075370_10005840	Ga0075370_100058402	474
1259	3300006880	Ga0075429_100186057	Ga0075429_1001860572	474
1260	3300006948	Ga0099826_10002270	Ga0099826_100022704	474
1261	3300009036	Ga0105244_10013122	Ga0105244_100131227	474
1262	3300009093	Ga0105240_10023679	Ga0105240_100236793	474
1263	3300009148	Ga0105243_10000806	Ga0105243_1000080619	474
1264	3300009148	Ga0105243_10017904	Ga0105243_100179042	474
1265	3300009148	Ga0105243_10028796	Ga0105243_100287966	474
1266	3300009177	Ga0105248_10053437	Ga0105248_100534372	474
1267	3300010375	Ga0105239_10169515	Ga0105239_101695151	474
1268	3300013104	Ga0157370_10003156	Ga0157370_100031568	474
1269	3300013105	Ga0157369_10013937	Ga0157369_100139378	474
1270	3300014497	Ga0182008_10000210	Ga0182008_1000021031	474
1271	3300014497	Ga0182008_10020330	Ga0182008_100203302	474
1272	3300014497	Ga0182008_10057268	Ga0182008_100572682	474
1273	3300014969	Ga0157376_10017736	Ga0157376_100177364	474
1274	3300015261	Ga0182006_1004900	Ga0182006_10049002	474
1275	3300015262	Ga0182007_10007317	Ga0182007_100073178	474
1276	3300015683	Ga0183362_10004	Ga0183362_10004300	474
1277	3300017792	Ga0163161_10000062	Ga0163161_1000006272	474
1278	3300025228	Ga0209672_100301	Ga0209672_10030130	474
1279	3300025229	Ga0209147_100924	Ga0209147_1009248	474
1280	3300025242	Ga0209258_100015	Ga0209258_100015532	474
1281	3300025245	Ga0207425_1000639	Ga0207425_100063912	474
1282	3300025254	Ga0209148_1000028	Ga0209148_1000028137	474
1283	3300025258	Ga0209129_1000661	Ga0209129_10006615	474
1284	3300025258	Ga0209129_1001879	Ga0209129_10018792	474
1285	3300025258	Ga0209129_1006823	Ga0209129_10068233	474
1286	3300025263	Ga0209565_1000144	Ga0209565_100014470	474
1287	3300025263	Ga0209565_1000263	Ga0209565_100026325	474
1288	3300025263	Ga0209565_1000814	Ga0209565_10008148	474
1289	3300025273	Ga0209673_1000136	Ga0209673_100013640	474
1290	3300025273	Ga0209673_1000396	Ga0209673_100039659	474
1291	3300025273	Ga0209673_1000461	Ga0209673_100046143	474
1292	3300025273	Ga0209673_1003000	Ga0209673_100300013	474
1293	3300025273	Ga0209673_1021251	Ga0209673_10212512	474
1294	3300025284	Ga0209130_1000687	Ga0209130_100068725	474
1295	3300025284	Ga0209130_1000777	Ga0209130_100077723	474
1296	3300025284	Ga0209130_1002988	Ga0209130_10029882	474
1297	3300025284	Ga0209130_1017006	Ga0209130_10170061	474
1298	3300025291	Ga0209675_1000071	Ga0209675_100007140	474
1299	3300025291	Ga0209675_1000206	Ga0209675_100020642	474
1300	3300025291	Ga0209675_1000578	Ga0209675_100057819	474
1301	3300025291	Ga0209675_1004535	Ga0209675_10045352	474
1302	3300025291	Ga0209675_1009351	Ga0209675_10093513	474
1303	3300025291	Ga0209675_1012406	Ga0209675_10124063	474
1304	3300025292	Ga0209676_1000167	Ga0209676_100016724	474
1305	3300025292	Ga0209676_1000241	Ga0209676_100024151	474
1306	3300025292	Ga0209676_1000496	Ga0209676_100049656	474
1307	3300025294	Ga0209025_1000410	Ga0209025_100041067	474
1308	3300025294	Ga0209025_1002078	Ga0209025_10020782	474
1309	3300025294	Ga0209025_1005585	Ga0209025_10055858	474
1310	3300025295	Ga0209564_1000110	Ga0209564_1000110143	474
1311	3300025295	Ga0209564_1000123	Ga0209564_1000123111	474
1312	3300025297	Ga0209758_1000039	Ga0209758_1000039143	474
1313	3300025298	Ga0209050_1000015	Ga0209050_1000015575	474
1314	3300025298	Ga0209050_1000484	Ga0209050_100048410	474
1315	3300025299	Ga0209256_1000074	Ga0209256_1000074143	474
1316	3300025299	Ga0209256_1000082	Ga0209256_1000082129	474
1317	3300025302	Ga0207426_1000112	Ga0207426_100011272	474
1318	3300025302	Ga0207426_1000121	Ga0207426_1000121142	474
1319	3300025303	Ga0209051_1000010	Ga0209051_1000010575	474
1320	3300025303	Ga0209051_1000081	Ga0209051_1000081138	474
1321	3300025303	Ga0209051_1000120	Ga0209051_1000120105	474
1322	3300025303	Ga0209051_1000650	Ga0209051_10006505	474
1323	3300025303	Ga0209051_1001437	Ga0209051_100143714	474
1324	3300025304	Ga0209257_1000015	Ga0209257_1000015113	474
1325	3300025304	Ga0209257_1000026	Ga0209257_1000026102	474
1326	3300025304	Ga0209257_1000565	Ga0209257_100056555	474
1327	3300025304	Ga0209257_1005003	Ga0209257_10050032	474
1328	3300025728	Ga0207655_1002128	Ga0207655_10021285	474
1329	3300025903	Ga0207680_10041400	Ga0207680_100414002	474
1330	3300025907	Ga0207645_10025762	Ga0207645_100257623	474
1331	3300025911	Ga0207654_10136350	Ga0207654_101363501	474
1332	3300025923	Ga0207681_10003754	Ga0207681_100037548	474
1333	3300025926	Ga0207659_10185168	Ga0207659_101851682	474
1334	3300025933	Ga0207706_10044630	Ga0207706_100446305	474
1335	3300025934	Ga0207686_10001106	Ga0207686_100011068	474
1336	3300025935	Ga0207709_10000229	Ga0207709_1000022960	474
1337	3300025935	Ga0207709_10000520	Ga0207709_1000052025	474
1338	3300025935	Ga0207709_10043464	Ga0207709_100434643	474
1339	3300025940	Ga0207691_10039535	Ga0207691_100395357	474
1340	3300025940	Ga0207691_10067793	Ga0207691_100677932	474
1341	3300025949	Ga0207667_10100675	Ga0207667_101006752	474
1342	3300027666	Ga0209282_1000513	Ga0209282_10005137	474
1343	3300027682	Ga0209971_1005687	Ga0209971_10056872	474
1344	3300028573	Ga0265334_10006125	Ga0265334_100061254	474
1345	3300028794	Ga0307515_10000468	Ga0307515_1000046888	474
1346	3300028794	Ga0307515_10016248	Ga0307515_1001624812	474
1347	3300028794	Ga0307515_10079392	Ga0307515_100793924	474
1348	3300030734	Ga0316179_1069163	Ga0316179_10691634	474
1349	3300031235	Ga0265330_10000368	Ga0265330_1000036816	474
1350	3300031238	Ga0265332_10000015	Ga0265332_1000001582	474
1351	3300031238	Ga0265332_10000394	Ga0265332_100003949	474
1352	3300031238	Ga0265332_10009597	Ga0265332_100095975	474
1353	3300031247	Ga0265340_10035534	Ga0265340_100355341	474
1354	3300031251	Ga0265327_10001990	Ga0265327_1000199020	474
1355	3300031344	Ga0265316_10117122	Ga0265316_101171223	474
1356	3300031456	Ga0307513_10028067	Ga0307513_100280676	474
1357	3300031548	Ga0307408_100000136	Ga0307408_10000013661	474
1358	3300031649	Ga0307514_10001315	Ga0307514_100013153	474
1359	3300031649	Ga0307514_10010494	Ga0307514_100104942	474
1360	3300031711	Ga0265314_10000292	Ga0265314_100002929	474
1361	3300031711	Ga0265314_10003357	Ga0265314_1000335712	474
1362	3300031731	Ga0307405_10018066	Ga0307405_100180663	474
1363	3300031901	Ga0307406_10000105	Ga0307406_1000010543	474
1364	3300031901	Ga0307406_10000527	Ga0307406_1000052714	474
1365	3300031911	Ga0307412_10029532	Ga0307412_100295322	474
1366	3300031911	Ga0307412_10212633	Ga0307412_102126331	474
1367	3300032002	Ga0307416_100046332	Ga0307416_1000463322	474
1368	3300032004	Ga0307414_10054800	Ga0307414_100548004	474
1369	3300032005	Ga0307411_10001041	Ga0307411_1000104110	474
1370	3300037418	Ga0395900_0011385	Ga0395900_0011385_4165_5589	474
1371	3300037418	Ga0395900_0058367	Ga0395900_0058367_1310_2734	474
1372	3300037418	Ga0395900_0073078	Ga0395900_0073078_255_1679	474
1373	3300037418	Ga0395900_0087679	Ga0395900_0087679_309_1733	474
1374	3300037466	Ga0395898_0033029	Ga0395898_0033029_2159_3583	474
1375	3300037466	Ga0395898_0037432	Ga0395898_0037432_784_2208	474
1376	3300037471	Ga0395905_0000078	Ga0395905_0000078_122931_124355	474
1377	3300037471	Ga0395905_0000722	Ga0395905_0000722_18854_20278	474
1378	3300037471	Ga0395905_0003675	Ga0395905_0003675_230_1657	474
1379	3300037471	Ga0395905_0006557	Ga0395905_0006557_2530_3960	474
1380	3300037471	Ga0395905_0019256	Ga0395905_0019256_3538_4962	474
1381	3300037471	Ga0395905_0028089	Ga0395905_0028089_2002_3426	474
1382	3300037471	Ga0395905_0036472	Ga0395905_0036472_1660_3090	474
1383	3300037471	Ga0395905_0077930	Ga0395905_0077930_323_1747	474
1384	3300037471	Ga0395905_0163954	Ga0395905_0163954_128_1552	474
1385	3300037471	Ga0395905_0212668	Ga0395905_0212668_302_1726	474
1386	3300038443	Ga0395901_0020574	Ga0395901_0020574_3972_5396	474
1387	3300038443	Ga0395901_0095896	Ga0395901_0095896_210_1634	474
1388	3300041404	Ga0439436_0000733	Ga0439436_0000733_262_1686	474
1389	3300042006	Ga0439432_004969	Ga0439432_004969_1945_3369	474
1390	3300042007	Ga0439449_0001786	Ga0439449_0001786_1061_2485	474
1391	3300042007	Ga0439449_0005068	Ga0439449_0005068_1183_2607	474
1392	3300042007	Ga0439449_0011725	Ga0439449_0011725_402_1826	474
1393	3300042014	Ga0439457_003988	Ga0439457_003988_164_1588	474
1394	3300042015	Ga0439462_0001094	Ga0439462_0001094_2841_4265	474
1395	3300042115	Ga0450911_000582	Ga0450911_000582_7565_8989	474
1396	3300042145	Ga0450906_006382	Ga0450906_006382_704_2128	474
1397	3300042156	Ga0439446_0003344	Ga0439446_0003344_296_1720	474
1398	3300042156	Ga0439446_0011914	Ga0439446_0011914_661_2085	474
1399	3300042435	Ga0439434_0004248	Ga0439434_0004248_1769_3193	474
1400	3300042531	Ga0450918_000586	Ga0450918_000586_5245_6669	474
1401	3300042876	Ga0451577_0023295	Ga0451577_0023295_2028_3452	474
1402	3300044673	Ga0453683_0001483	Ga0453683_0001483_15490_16914	474
1403	3300044673	Ga0453683_0002824	Ga0453683_0002824_6067_7491	474
1404	3300044684	Ga0466966_0001199	Ga0466966_0001199_5523_6947	474
1405	3300044712	Ga0453684_0295389	Ga0453684_0295389_288_1712	474
1406	3300045051	Ga0451576_0000643	Ga0451576_0000643_12706_14133	474
1407	3300045051	Ga0451576_0004755	Ga0451576_0004755_2437_3861	474
1408	3300046457	Ga0495590_0002689	Ga0495590_0002689_4662_6092	474
1409	3300046475	Ga0495639_0005492	Ga0495639_0005492_368_1792	474
1410	3300046513	Ga0495616_0001726	Ga0495616_0001726_7542_8966	474
1411	3300046520	Ga0495637_0013641	Ga0495637_0013641_713_2137	474
1412	3300046530	Ga0495654_0010145	Ga0495654_0010145_2210_3634	474
1413	3300046615	Ga0495656_0000305	Ga0495656_0000305_5795_7219	474
1414	3300046616	Ga0495668_0029784	Ga0495668_0029784_543_1967	474
1415	3300046660	Ga0495625_0000114	Ga0495625_0000114_33961_35385	474
1416	3300047318	Ga0495636_0006890	Ga0495636_0006890_2940_4364	474
1417	3300048904	Ga0496101_0004033	Ga0496101_0004033_4878_6302	474
1418	3300048907	Ga0496104_0004837	Ga0496104_0004837_7417_8841	474
1419	3300048919	Ga0496116_0061442	Ga0496116_0061442_160_1584	474
1420	3300048920	Ga0496117_0022666	Ga0496117_0022666_1720_3144	474
1421	3300048924	Ga0496121_0035460	Ga0496121_0035460_2580_4004	474
1422	3300048925	Ga0496122_0000039	Ga0496122_0000039_213602_215026	474
1423	3300048926	Ga0496123_0000026	Ga0496123_0000026_213698_215122	474
1424	3300048927	Ga0496124_0101736	Ga0496124_0101736_501_1925	474
1425	3300048928	Ga0496125_0019457	Ga0496125_0019457_2005_3429	474
1426	3300049581	Ga0501047_0076810	Ga0501047_0076810_541_1965	474
1427	3300049759	Ga0501262_000069	Ga0501262_000069_1694_3118	474
1428	3300050493	nmdc:mga0k408_7613_c1	nmdc:mga0k408_7613_c1_3637_5061	474
1429	3300050496	nmdc:mga07m45_11329_c1	nmdc:mga07m45_11329_c1_228_1652	474
1430	3300050496	nmdc:mga07m45_1603_c1	nmdc:mga07m45_1603_c1_8944_10368	474
1431	3300050496	nmdc:mga07m45_2571_c1	nmdc:mga07m45_2571_c1_2398_3822	474
1432	3300050496	nmdc:mga07m45_37376_c1	nmdc:mga07m45_37376_c1_1249_2673	474
1433	3300053087	Ga0500643_003044	Ga0500643_003044_193_1617	474
1434	3300053093	Ga0500651_0000079	Ga0500651_0000079_49266_50690	474
1435	3300053121	Ga0500607_000985	Ga0500607_000985_3035_4459	474
1436	3300053134	Ga0500658_0000057	Ga0500658_0000057_10285_11709	474
1437	3300053136	Ga0500559_0020624	Ga0500559_0020624_379_1809	474
1438	3300053139	Ga0500568_0012653	Ga0500568_0012653_1961_3385	474

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02913

FAD-oxidase_C

FAD linked oxidases, C-terminal domain

273

514

0.99 PF01565

FAD_binding_4

FAD binding domain

100

237

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8jdo-assembly1.cif.gz_A	crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid	0.9596	19	472
8jds-assembly1.cif.gz_A	crystal structure of mldhd in complex with pyruvate	0.9591	19	472
8jdx-assembly1.cif.gz_A	crystal structure of mldhd in complex with 2-ketoisovaleric acid	0.9577	19	472
8jdu-assembly1.cif.gz_A	crystal structure of mldhd in complex with 2-ketovaleric acid	0.9576	19	472
8jdt-assembly1.cif.gz_A	crystal structure of mldhd in complex with 2-ketobutanoic acid	0.957	19	472

ID	Description	Score	Start	End	Superfamily
af_Q86WU2_267_377_3.30.70.2190	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9887	232	342	3.30.70.2190
af_Q7TPJ4_275_344_3.30.70.2190	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9841	252	320	3.30.70.2190
af_Q8I4K2_111_228_3.30.465.10	Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3;	0.9825	116	229	3.30.465.10
af_Q86WU2_267_377_3.30.70.2190	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.98	232	342	3.30.70.2190
af_Q7TNG8_361_443_3.30.70.2740	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9753	351	431	3.30.70.2740

ID	Description	Score	Start	End	GO Terms
AF-A0A521LG04-F1-model_v4	D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4)	0.981	106	474	GO:0004458 GO:0008720 GO:0071949 GO:1903457
AF-A0A453BLV3-F1-model_v4	FAD-binding PCMH-type domain-containing protein	0.979	158	397	GO:0004458 GO:0005739 GO:0008720 GO:0071949 GO:1903457
AF-A0A3D3DJM2-F1-model_v4	D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4)	0.9787	21	385	GO:0004458 GO:0008720 GO:0071949 GO:1903457
AF-A0A662Y4S8-F1-model_v4	D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4)	0.9785	16	472	GO:0004458 GO:0005739 GO:0008720 GO:0071949 GO:1903457
AF-A0A521LG04-F1-model_v4	D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4)	0.9784	106	474	GO:0004458 GO:0008720 GO:0071949 GO:1903457

Feature Viewer

pLDDT	pTM	Quality
89.56	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F493959

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02913

FAD-oxidase_C

FAD linked oxidases, C-terminal domain

273

514

0.99

PF01565

FAD_binding_4

FAD binding domain

100

237

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map