F493797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1417 | 618 | 2834 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_101512712|Ga0070680_1015127121 |
| Length | 109 |
| Sequence | MKKAAKKTTAPVARAYHYDVIVSPIVTEKSTAASEFNKVMFNVHLDATKEDIKASVEALFNVKVSKVNTLRRLGKIKRFRNTVGKLSDTKKAIITLAEGQSIDLSSGVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 158 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 165 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 166 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 167 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 168 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300023304 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 | Metatranscriptome | Rhizosphere |
| 170 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 171 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 172 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 173 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 254 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 255 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 256 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 257 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 258 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 263 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 264 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 265 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 266 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 267 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 269 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 270 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 271 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 273 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 274 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 283 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 284 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 285 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 286 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 288 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 289 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 290 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 291 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 292 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 293 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 298 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 301 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 307 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 309 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 310 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 313 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 317 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 318 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 319 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 320 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 322 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 323 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 324 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 325 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 326 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 327 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 328 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 329 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 330 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 331 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 332 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 333 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 334 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 335 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 336 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 337 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 338 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 341 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 342 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 343 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 344 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 345 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 346 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 347 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 348 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 349 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 350 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 351 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 352 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 353 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 354 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 355 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 356 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 357 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 358 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 359 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 360 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 361 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 418 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 419 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 420 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 421 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 422 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 425 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 426 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 427 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 428 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 429 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 430 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 431 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 432 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 433 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 434 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 435 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 436 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 437 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 438 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 439 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 440 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 441 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 447 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 488 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 489 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 490 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 491 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 492 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 493 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 498 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 502 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 503 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 504 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 505 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 506 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 507 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 518 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 521 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 523 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 524 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 525 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 526 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 528 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 529 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 530 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 531 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 532 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 533 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 535 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 536 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 537 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 538 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 539 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 540 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 541 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 542 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 543 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 544 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 545 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 546 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 547 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 548 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 549 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 550 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 551 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 553 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 554 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 579 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 580 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 581 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 582 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 583 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 584 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 585 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 586 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 587 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 588 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 589 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 590 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 591 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 592 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 593 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 594 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 595 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 596 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 597 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 598 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 599 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 600 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 601 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 602 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 603 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 604 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 605 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 606 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 607 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 608 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 609 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 610 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 611 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 612 | 2922425934 | |||
| 613 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 614 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 615 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 616 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 617 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 618 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.38 |
| Metatranscriptomes | 5.93 |
| Isolates | 2.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.63 |
| Nodule | 0.78 |
| Rhizoplane | 6.14 |
| Rhizosphere | 77.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_101512712 | 3300005336 | Bacteria | 581 |
| 2 | JGI24741J21665_1000040 | 3300001915 | Bacteria | 30851 |
| 3 | JGI24747J21853_1041351 | 3300001978 | Bacteria | 547 |
| 4 | JGI24740J21852_10001488 | 3300001979 | Bacteria | 10769 |
| 5 | JGI24740J21852_10127217 | 3300001979 | Bacteria | 636 |
| 6 | JGI24739J22299_10009835 | 3300001989 | Bacteria | 3555 |
| 7 | JGI24739J22299_10122518 | 3300001989 | Bacteria | 776 |
| 8 | JGI24739J22299_10146276 | 3300001989 | Bacteria | 699 |
| 9 | JGI24737J22298_10002296 | 3300001990 | Bacteria | 6798 |
| 10 | JGI24737J22298_10002957 | 3300001990 | Bacteria | 6024 |
| 11 | JGI24743J22301_10019644 | 3300001991 | Bacteria | 1284 |
| 12 | JGI24735J21928_10003641 | 3300002067 | Bacteria | 5227 |
| 13 | JGI24750J21931_1006031 | 3300002070 | Bacteria | 1500 |
| 14 | JGI24745J21846_1025676 | 3300002073 | Bacteria | 701 |
| 15 | JGI24738J21930_10001475 | 3300002075 | Bacteria | 6532 |
| 16 | JGI24738J21930_10006269 | 3300002075 | Bacteria | 2803 |
| 17 | JGI24749J21850_1030226 | 3300002076 | Bacteria | 777 |
| 18 | JGI24751J29686_10003449 | 3300002459 | Bacteria | 3183 |
| 19 | JGI24751J29686_10015322 | 3300002459 | Bacteria | 1581 |
| 20 | JGI25165J46597_1011340 | 3300003214 | Bacteria | 1275 |
| 21 | JGI25153J46596_10082871 | 3300003215 | Bacteria | 794 |
| 22 | rootH2_10016380 | 3300003320 | Bacteria | 1635 |
| 23 | JGI25404J52841_10035096 | 3300003659 | Bacteria | 1068 |
| 24 | Ga0055539_1021913 | 3300003752 | Bacteria | 757 |
| 25 | JGI25405J52794_10006513 | 3300003911 | Bacteria | 2134 |
| 26 | Ga0058863_11772060 | 3300004799 | Bacteria | 625 |
| 27 | Ga0058863_11874628 | 3300004799 | Bacteria | 752 |
| 28 | Ga0070658_10013737 | 3300005327 | Bacteria | 6498 |
| 29 | Ga0070658_10018691 | 3300005327 | Bacteria | 5551 |
| 30 | Ga0070658_10417429 | 3300005327 | Bacteria | 1154 |
| 31 | Ga0070658_10993116 | 3300005327 | Bacteria | 730 |
| 32 | Ga0070676_10598008 | 3300005328 | Bacteria | 795 |
| 33 | Ga0070683_100014681 | 3300005329 | Bacteria | 6861 |
| 34 | Ga0070683_101643452 | 3300005329 | Bacteria | 618 |
| 35 | Ga0070690_100007778 | 3300005330 | Bacteria | 6144 |
| 36 | Ga0070670_100000376 | 3300005331 | Bacteria | 37212 |
| 37 | Ga0070677_10080667 | 3300005333 | Bacteria | 1391 |
| 38 | Ga0068869_100022833 | 3300005334 | Bacteria | 4314 |
| 39 | Ga0070666_10004644 | 3300005335 | Bacteria | 8386 |
| 40 | Ga0070680_100085545 | 3300005336 | Bacteria | 2605 |
| 41 | Ga0070680_100098147 | 3300005336 | Bacteria | 2429 |
| 42 | Ga0070680_100310121 | 3300005336 | Bacteria | 1339 |
| 43 | Ga0070680_100664914 | 3300005336 | Bacteria | 896 |
| 44 | Ga0070680_101082953 | 3300005336 | Bacteria | 692 |
| 45 | Ga0070680_101587842 | 3300005336 | Bacteria | 567 |
| 46 | Ga0070682_100002069 | 3300005337 | Bacteria | 11170 |
| 47 | Ga0070682_100463941 | 3300005337 | Bacteria | 973 |
| 48 | Ga0068868_100202434 | 3300005338 | Bacteria | 1655 |
| 49 | Ga0070660_100000686 | 3300005339 | Bacteria | 22383 |
| 50 | Ga0070660_100662344 | 3300005339 | Bacteria | 874 |
| 51 | Ga0070660_100839069 | 3300005339 | Bacteria | 774 |
| 52 | Ga0070660_101161486 | 3300005339 | Bacteria | 654 |
| 53 | Ga0070689_100000122 | 3300005340 | Bacteria | 44668 |
| 54 | Ga0070691_10000490 | 3300005341 | Bacteria | 14859 |
| 55 | Ga0070691_10862610 | 3300005341 | Bacteria | 556 |
| 56 | Ga0070687_100016035 | 3300005343 | Bacteria | 3404 |
| 57 | Ga0070661_100000385 | 3300005344 | Bacteria | 34633 |
| 58 | Ga0070661_100303958 | 3300005344 | Bacteria | 1242 |
| 59 | Ga0070692_10001302 | 3300005345 | Bacteria | 8967 |
| 60 | Ga0070668_100005991 | 3300005347 | Bacteria | 9018 |
| 61 | Ga0070668_100088347 | 3300005347 | Bacteria | 2440 |
| 62 | Ga0070668_100390585 | 3300005347 | Bacteria | 1186 |
| 63 | Ga0070669_100002082 | 3300005353 | Bacteria | 14453 |
| 64 | Ga0070675_100016237 | 3300005354 | Bacteria | 5907 |
| 65 | Ga0070675_101384211 | 3300005354 | Bacteria | 649 |
| 66 | Ga0070671_100001283 | 3300005355 | Bacteria | 18858 |
| 67 | Ga0070674_100000649 | 3300005356 | Bacteria | 17518 |
| 68 | Ga0070674_100148607 | 3300005356 | Bacteria | 1766 |
| 69 | Ga0070674_100607101 | 3300005356 | Bacteria | 925 |
| 70 | Ga0070673_100002163 | 3300005364 | Bacteria | 11899 |
| 71 | Ga0070688_100000217 | 3300005365 | Bacteria | 30556 |
| 72 | Ga0070688_101153306 | 3300005365 | Bacteria | 621 |
| 73 | Ga0070659_100003485 | 3300005366 | Bacteria | 11201 |
| 74 | Ga0070659_100165834 | 3300005366 | Bacteria | 1807 |
| 75 | Ga0070667_100003614 | 3300005367 | Bacteria | 13156 |
| 76 | Ga0070667_102074007 | 3300005367 | Bacteria | 536 |
| 77 | Ga0070703_10015462 | 3300005406 | Bacteria | 2183 |
| 78 | Ga0070709_10001232 | 3300005434 | Bacteria | 14032 |
| 79 | Ga0070709_10002316 | 3300005434 | Bacteria | 10332 |
| 80 | Ga0070709_10010455 | 3300005434 | Bacteria | 5143 |
| 81 | Ga0070709_10022452 | 3300005434 | Bacteria | 3691 |
| 82 | Ga0070709_10938746 | 3300005434 | Bacteria | 686 |
| 83 | Ga0070714_100009083 | 3300005435 | Bacteria | 7794 |
| 84 | Ga0070714_100017244 | 3300005435 | Bacteria | 5847 |
| 85 | Ga0070714_100025578 | 3300005435 | Bacteria | 4872 |
| 86 | Ga0070714_100026711 | 3300005435 | Bacteria | 4773 |
| 87 | Ga0070714_100142833 | 3300005435 | Bacteria | 2150 |
| 88 | Ga0070714_100177932 | 3300005435 | Bacteria | 1934 |
| 89 | Ga0070714_100207603 | 3300005435 | Bacteria | 1794 |
| 90 | Ga0070714_100562434 | 3300005435 | Bacteria | 1092 |
| 91 | Ga0070714_101608588 | 3300005435 | Bacteria | 635 |
| 92 | Ga0070713_100036694 | 3300005436 | Bacteria | 3957 |
| 93 | Ga0070713_100056912 | 3300005436 | Bacteria | 3253 |
| 94 | Ga0070713_100061311 | 3300005436 | Bacteria | 3146 |
| 95 | Ga0070713_100095838 | 3300005436 | Bacteria | 2560 |
| 96 | Ga0070713_100111867 | 3300005436 | Bacteria | 2382 |
| 97 | Ga0070713_100610599 | 3300005436 | Bacteria | 1037 |
| 98 | Ga0070713_100645737 | 3300005436 | Bacteria | 1007 |
| 99 | Ga0070713_100734475 | 3300005436 | Bacteria | 944 |
| 100 | Ga0070713_101400825 | 3300005436 | Bacteria | 678 |
| 101 | Ga0070713_101869425 | 3300005436 | Bacteria | 583 |
| 102 | Ga0070710_10005644 | 3300005437 | Bacteria | 5958 |
| 103 | Ga0070710_10019970 | 3300005437 | Bacteria | 3470 |
| 104 | Ga0070710_10058672 | 3300005437 | Bacteria | 2183 |
| 105 | Ga0070710_10186643 | 3300005437 | Bacteria | 1301 |
| 106 | Ga0070710_10236423 | 3300005437 | Bacteria | 1169 |
| 107 | Ga0070710_10318422 | 3300005437 | Bacteria | 1020 |
| 108 | Ga0070710_10470708 | 3300005437 | Bacteria | 855 |
| 109 | Ga0070710_11123421 | 3300005437 | Bacteria | 578 |
| 110 | Ga0070701_10000897 | 3300005438 | Bacteria | 10740 |
| 111 | Ga0070711_100000834 | 3300005439 | Bacteria | 16154 |
| 112 | Ga0070711_100004304 | 3300005439 | Bacteria | 8381 |
| 113 | Ga0070711_100009870 | 3300005439 | Bacteria | 5888 |
| 114 | Ga0070711_100155124 | 3300005439 | Bacteria | 1730 |
| 115 | Ga0070711_100159576 | 3300005439 | Bacteria | 1708 |
| 116 | Ga0070711_100663258 | 3300005439 | Bacteria | 875 |
| 117 | Ga0070711_101839668 | 3300005439 | Bacteria | 531 |
| 118 | Ga0070705_100022646 | 3300005440 | Bacteria | 3360 |
| 119 | Ga0070705_100266449 | 3300005440 | Bacteria | 1211 |
| 120 | Ga0070700_100002377 | 3300005441 | Bacteria | 9585 |
| 121 | Ga0070700_100217734 | 3300005441 | Bacteria | 1351 |
| 122 | Ga0070700_100387488 | 3300005441 | Bacteria | 1047 |
| 123 | Ga0070700_100845120 | 3300005441 | Bacteria | 741 |
| 124 | Ga0070700_101711775 | 3300005441 | Bacteria | 540 |
| 125 | Ga0070694_100000195 | 3300005444 | Bacteria | 32086 |
| 126 | Ga0070663_100000352 | 3300005455 | Bacteria | 24139 |
| 127 | Ga0070663_100074211 | 3300005455 | Bacteria | 2483 |
| 128 | Ga0070663_100573677 | 3300005455 | Bacteria | 946 |
| 129 | Ga0070678_100001146 | 3300005456 | Bacteria | 14002 |
| 130 | Ga0070678_100497827 | 3300005456 | Bacteria | 1075 |
| 131 | Ga0070662_100000412 | 3300005457 | Bacteria | 25384 |
| 132 | Ga0070662_100501700 | 3300005457 | Bacteria | 1012 |
| 133 | Ga0070662_101006609 | 3300005457 | Bacteria | 713 |
| 134 | Ga0070662_101760863 | 3300005457 | Bacteria | 535 |
| 135 | Ga0070662_101984517 | 3300005457 | Bacteria | 503 |
| 136 | Ga0070681_10329459 | 3300005458 | Bacteria | 1436 |
| 137 | Ga0070681_10715142 | 3300005458 | Bacteria | 918 |
| 138 | Ga0070681_11170398 | 3300005458 | Bacteria | 691 |
| 139 | Ga0070681_11611799 | 3300005458 | Bacteria | 574 |
| 140 | Ga0068867_100008499 | 3300005459 | Bacteria | 7247 |
| 141 | Ga0068867_100077308 | 3300005459 | Bacteria | 2501 |
| 142 | Ga0070685_10058987 | 3300005466 | Bacteria | 2239 |
| 143 | Ga0070685_10665402 | 3300005466 | Bacteria | 756 |
| 144 | Ga0070707_100127155 | 3300005468 | Bacteria | 2476 |
| 145 | Ga0070698_100118731 | 3300005471 | Bacteria | 2605 |
| 146 | Ga0070698_100482324 | 3300005471 | Bacteria | 1177 |
| 147 | Ga0070699_100160319 | 3300005518 | Bacteria | 1990 |
| 148 | Ga0070679_100040109 | 3300005530 | Bacteria | 4658 |
| 149 | Ga0070679_100288276 | 3300005530 | Bacteria | 1593 |
| 150 | Ga0070684_100047080 | 3300005535 | Bacteria | 3737 |
| 151 | Ga0070684_100061861 | 3300005535 | Bacteria | 3278 |
| 152 | Ga0070684_100356712 | 3300005535 | Bacteria | 1345 |
| 153 | Ga0070684_100886686 | 3300005535 | Bacteria | 836 |
| 154 | Ga0070684_100919194 | 3300005535 | Bacteria | 820 |
| 155 | Ga0070697_100000391 | 3300005536 | Bacteria | 34002 |
| 156 | Ga0070697_100077313 | 3300005536 | Bacteria | 2737 |
| 157 | Ga0070697_101553947 | 3300005536 | Bacteria | 592 |
| 158 | Ga0068853_100001082 | 3300005539 | Bacteria | 19264 |
| 159 | Ga0068853_100345112 | 3300005539 | Bacteria | 1384 |
| 160 | Ga0068853_101848518 | 3300005539 | Bacteria | 585 |
| 161 | Ga0070672_100035019 | 3300005543 | Bacteria | 3813 |
| 162 | Ga0070686_100001391 | 3300005544 | Bacteria | 13661 |
| 163 | Ga0070695_100000238 | 3300005545 | Bacteria | 27265 |
| 164 | Ga0070695_100385596 | 3300005545 | Bacteria | 1058 |
| 165 | Ga0070696_100000815 | 3300005546 | Bacteria | 20059 |
| 166 | Ga0070696_100031634 | 3300005546 | Bacteria | 3628 |
| 167 | Ga0070696_100523824 | 3300005546 | Bacteria | 946 |
| 168 | Ga0070693_100000455 | 3300005547 | Bacteria | 18375 |
| 169 | Ga0070693_100579599 | 3300005547 | Bacteria | 807 |
| 170 | Ga0070693_100721973 | 3300005547 | Bacteria | 731 |
| 171 | Ga0070665_100022864 | 3300005548 | Bacteria | 6294 |
| 172 | Ga0070665_100548593 | 3300005548 | Bacteria | 1168 |
| 173 | Ga0070704_100000124 | 3300005549 | Bacteria | 27978 |
| 174 | Ga0070704_100746471 | 3300005549 | Bacteria | 871 |
| 175 | Ga0068855_100002691 | 3300005563 | Bacteria | 21916 |
| 176 | Ga0068855_100220819 | 3300005563 | Bacteria | 2125 |
| 177 | Ga0068855_100351567 | 3300005563 | Bacteria | 1623 |
| 178 | Ga0068855_100464716 | 3300005563 | Bacteria | 1379 |
| 179 | Ga0068855_100722076 | 3300005563 | Bacteria | 1065 |
| 180 | Ga0070664_100002450 | 3300005564 | Bacteria | 14942 |
| 181 | Ga0070664_100013985 | 3300005564 | Bacteria | 6544 |
| 182 | Ga0070664_100963839 | 3300005564 | Bacteria | 801 |
| 183 | Ga0070664_101879664 | 3300005564 | Bacteria | 568 |
| 184 | Ga0068857_100008457 | 3300005577 | Bacteria | 8896 |
| 185 | Ga0068857_100149759 | 3300005577 | Bacteria | 2113 |
| 186 | Ga0068857_101190118 | 3300005577 | Bacteria | 738 |
| 187 | Ga0068857_101263112 | 3300005577 | Bacteria | 716 |
| 188 | Ga0068854_100007856 | 3300005578 | Bacteria | 6824 |
| 189 | Ga0068854_100405940 | 3300005578 | Bacteria | 1128 |
| 190 | Ga0068854_100596484 | 3300005578 | Bacteria | 942 |
| 191 | Ga0068854_100770040 | 3300005578 | Bacteria | 836 |
| 192 | Ga0068854_101112579 | 3300005578 | Bacteria | 704 |
| 193 | Ga0068856_100001924 | 3300005614 | Bacteria | 21647 |
| 194 | Ga0068856_100005122 | 3300005614 | Bacteria | 12946 |
| 195 | Ga0068856_101512037 | 3300005614 | Bacteria | 685 |
| 196 | Ga0070702_100000018 | 3300005615 | Bacteria | 47204 |
| 197 | Ga0070702_100315096 | 3300005615 | Bacteria | 1088 |
| 198 | Ga0070702_100375110 | 3300005615 | Bacteria | 1010 |
| 199 | Ga0068852_100010938 | 3300005616 | Bacteria | 6801 |
| 200 | Ga0068852_100225709 | 3300005616 | Bacteria | 1783 |
| 201 | Ga0068852_100271636 | 3300005616 | Bacteria | 1631 |
| 202 | Ga0068859_100131708 | 3300005617 | Bacteria | 2572 |
| 203 | Ga0068859_100254511 | 3300005617 | Bacteria | 1847 |
| 204 | Ga0068859_101714941 | 3300005617 | Bacteria | 694 |
| 205 | Ga0068864_100002243 | 3300005618 | Bacteria | 15978 |
| 206 | Ga0068864_100847013 | 3300005618 | Bacteria | 901 |
| 207 | Ga0068864_101603329 | 3300005618 | Bacteria | 655 |
| 208 | Ga0068866_10001983 | 3300005718 | Bacteria | 8531 |
| 209 | Ga0068866_10472774 | 3300005718 | Bacteria | 824 |
| 210 | Ga0068866_10579931 | 3300005718 | Bacteria | 754 |
| 211 | Ga0068861_100000942 | 3300005719 | Bacteria | 17675 |
| 212 | Ga0068851_10055130 | 3300005834 | Bacteria | 2025 |
| 213 | Ga0068851_10281205 | 3300005834 | Bacteria | 951 |
| 214 | Ga0068870_10379278 | 3300005840 | Bacteria | 915 |
| 215 | Ga0068863_100007838 | 3300005841 | Bacteria | 10440 |
| 216 | Ga0068863_100237421 | 3300005841 | Bacteria | 1759 |
| 217 | Ga0068858_100019589 | 3300005842 | Bacteria | 6325 |
| 218 | Ga0068858_100270677 | 3300005842 | Bacteria | 1616 |
| 219 | Ga0068860_100000598 | 3300005843 | Bacteria | 43069 |
| 220 | Ga0068860_100088076 | 3300005843 | Bacteria | 2955 |
| 221 | Ga0068862_100008039 | 3300005844 | Bacteria | 8730 |
| 222 | Ga0068862_100688014 | 3300005844 | Bacteria | 990 |
| 223 | Ga0081455_10021909 | 3300005937 | Bacteria | 5985 |
| 224 | Ga0081455_10288863 | 3300005937 | Bacteria | 1181 |
| 225 | Ga0081538_10006855 | 3300005981 | Bacteria | 9922 |
| 226 | Ga0081538_10029536 | 3300005981 | Bacteria | 3743 |
| 227 | Ga0081540_1015691 | 3300005983 | Bacteria | 4782 |
| 228 | Ga0081540_1017063 | 3300005983 | Bacteria | 4513 |
| 229 | Ga0081540_1053318 | 3300005983 | Bacteria | 1984 |
| 230 | Ga0081540_1065878 | 3300005983 | Bacteria | 1701 |
| 231 | Ga0070717_10003669 | 3300006028 | Bacteria | 11020 |
| 232 | Ga0070717_10027908 | 3300006028 | Bacteria | 4513 |
| 233 | Ga0070717_10102080 | 3300006028 | Bacteria | 2436 |
| 234 | Ga0070717_10381156 | 3300006028 | Bacteria | 1264 |
| 235 | Ga0075365_10013851 | 3300006038 | Bacteria | 4838 |
| 236 | Ga0075365_10452214 | 3300006038 | Bacteria | 907 |
| 237 | Ga0075365_10749770 | 3300006038 | Bacteria | 689 |
| 238 | Ga0075368_10218801 | 3300006042 | Bacteria | 809 |
| 239 | Ga0075368_10282307 | 3300006042 | Bacteria | 714 |
| 240 | Ga0075363_100113521 | 3300006048 | Bacteria | 1508 |
| 241 | Ga0075364_10052785 | 3300006051 | Bacteria | 2657 |
| 242 | Ga0075364_10057357 | 3300006051 | Bacteria | 2551 |
| 243 | Ga0075364_10095261 | 3300006051 | Bacteria | 1979 |
| 244 | Ga0075364_10220551 | 3300006051 | Bacteria | 1287 |
| 245 | Ga0070715_10001643 | 3300006163 | Bacteria | 6622 |
| 246 | Ga0070715_10312847 | 3300006163 | Bacteria | 845 |
| 247 | Ga0070715_10321955 | 3300006163 | Bacteria | 835 |
| 248 | Ga0070716_100001603 | 3300006173 | Bacteria | 10188 |
| 249 | Ga0070716_100026432 | 3300006173 | Bacteria | 3108 |
| 250 | Ga0070716_100079986 | 3300006173 | Bacteria | 1947 |
| 251 | Ga0070716_100226032 | 3300006173 | Bacteria | 1260 |
| 252 | Ga0070716_100397026 | 3300006173 | Bacteria | 990 |
| 253 | Ga0070716_100477478 | 3300006173 | Bacteria | 915 |
| 254 | Ga0070716_101460067 | 3300006173 | Bacteria | 558 |
| 255 | Ga0070712_100027843 | 3300006175 | Bacteria | 3776 |
| 256 | Ga0070712_100052247 | 3300006175 | Bacteria | 2849 |
| 257 | Ga0070712_100058664 | 3300006175 | Bacteria | 2708 |
| 258 | Ga0070712_100058938 | 3300006175 | Bacteria | 2702 |
| 259 | Ga0070712_100201784 | 3300006175 | Bacteria | 1563 |
| 260 | Ga0070712_100412647 | 3300006175 | Bacteria | 1117 |
| 261 | Ga0070712_100515983 | 3300006175 | Bacteria | 1003 |
| 262 | Ga0070712_101410515 | 3300006175 | Bacteria | 608 |
| 263 | Ga0075362_10035975 | 3300006177 | Bacteria | 2164 |
| 264 | Ga0075362_10049062 | 3300006177 | Bacteria | 1885 |
| 265 | Ga0075362_10101966 | 3300006177 | Bacteria | 1343 |
| 266 | Ga0075367_10111670 | 3300006178 | Bacteria | 1678 |
| 267 | Ga0075367_10134243 | 3300006178 | Bacteria | 1531 |
| 268 | Ga0075366_10359251 | 3300006195 | Bacteria | 895 |
| 269 | Ga0075366_10627287 | 3300006195 | Bacteria | 667 |
| 270 | Ga0097621_100107158 | 3300006237 | Bacteria | 2358 |
| 271 | Ga0097621_100165361 | 3300006237 | Bacteria | 1904 |
| 272 | Ga0097621_102073454 | 3300006237 | Bacteria | 544 |
| 273 | Ga0075370_10243707 | 3300006353 | Bacteria | 1064 |
| 274 | Ga0068871_100022307 | 3300006358 | Bacteria | 4881 |
| 275 | Ga0068871_100286866 | 3300006358 | Bacteria | 1441 |
| 276 | Ga0068871_100486469 | 3300006358 | Bacteria | 1111 |
| 277 | Ga0068871_100682814 | 3300006358 | Bacteria | 940 |
| 278 | Ga0075428_100054274 | 3300006844 | Bacteria | 4392 |
| 279 | Ga0075428_100237574 | 3300006844 | Bacteria | 1966 |
| 280 | Ga0075428_101096435 | 3300006844 | Bacteria | 841 |
| 281 | Ga0075430_100103604 | 3300006846 | Bacteria | 2375 |
| 282 | Ga0075431_100003503 | 3300006847 | Bacteria | 15211 |
| 283 | Ga0075433_10023032 | 3300006852 | Bacteria | 5237 |
| 284 | Ga0075434_100025071 | 3300006871 | Bacteria | 5834 |
| 285 | Ga0075434_100036662 | 3300006871 | Bacteria | 4851 |
| 286 | Ga0075434_100215192 | 3300006871 | Bacteria | 1941 |
| 287 | Ga0075434_102159013 | 3300006871 | Bacteria | 561 |
| 288 | Ga0075434_102196873 | 3300006871 | Bacteria | 556 |
| 289 | Ga0075429_100024809 | 3300006880 | Bacteria | 5205 |
| 290 | Ga0075429_101174029 | 3300006880 | Bacteria | 670 |
| 291 | Ga0068865_100096538 | 3300006881 | Bacteria | 2155 |
| 292 | Ga0068865_101186464 | 3300006881 | Bacteria | 675 |
| 293 | Ga0075436_100008941 | 3300006914 | Bacteria | 6857 |
| 294 | Ga0097620_100131716 | 3300006931 | Bacteria | 2572 |
| 295 | Ga0097620_100254508 | 3300006931 | Bacteria | 1847 |
| 296 | Ga0097620_101715029 | 3300006931 | Bacteria | 694 |
| 297 | Ga0075435_100085522 | 3300007076 | Bacteria | 2596 |
| 298 | Ga0075435_100102268 | 3300007076 | Bacteria | 2375 |
| 299 | Ga0075435_100897708 | 3300007076 | Bacteria | 773 |
| 300 | Ga0099795_10003174 | 3300007788 | Bacteria | 4033 |
| 301 | Ga0105251_10110631 | 3300009011 | Bacteria | 1251 |
| 302 | Ga0105250_10008602 | 3300009092 | Bacteria | 4327 |
| 303 | Ga0105250_10188339 | 3300009092 | Bacteria | 868 |
| 304 | Ga0105240_10230206 | 3300009093 | Bacteria | 2154 |
| 305 | Ga0105240_10263935 | 3300009093 | Bacteria | 1985 |
| 306 | Ga0105240_10304110 | 3300009093 | Bacteria | 1823 |
| 307 | Ga0105240_10504075 | 3300009093 | Bacteria | 1345 |
| 308 | Ga0105240_11509248 | 3300009093 | Bacteria | 704 |
| 309 | Ga0111539_10100865 | 3300009094 | Bacteria | 3389 |
| 310 | Ga0111539_10428106 | 3300009094 | Bacteria | 1541 |
| 311 | Ga0111539_10658944 | 3300009094 | Bacteria | 1219 |
| 312 | Ga0105245_10000718 | 3300009098 | Bacteria | 29853 |
| 313 | Ga0105247_10001104 | 3300009101 | Bacteria | 20096 |
| 314 | Ga0105247_10035209 | 3300009101 | Bacteria | 3051 |
| 315 | Ga0105247_10603522 | 3300009101 | Bacteria | 814 |
| 316 | Ga0114129_10401684 | 3300009147 | Bacteria | 1806 |
| 317 | Ga0114129_11726057 | 3300009147 | Bacteria | 763 |
| 318 | Ga0114129_12202468 | 3300009147 | Bacteria | 663 |
| 319 | Ga0105243_10001752 | 3300009148 | Bacteria | 18680 |
| 320 | Ga0105243_10362714 | 3300009148 | Bacteria | 1334 |
| 321 | Ga0105241_10001866 | 3300009174 | Bacteria | 15988 |
| 322 | Ga0105241_10088557 | 3300009174 | Bacteria | 2438 |
| 323 | Ga0105241_10177796 | 3300009174 | Bacteria | 1763 |
| 324 | Ga0105241_10256780 | 3300009174 | Bacteria | 1484 |
| 325 | Ga0105242_10010515 | 3300009176 | Bacteria | 7104 |
| 326 | Ga0105242_11411010 | 3300009176 | Bacteria | 724 |
| 327 | Ga0105242_11845975 | 3300009176 | Bacteria | 644 |
| 328 | Ga0105248_10002832 | 3300009177 | Bacteria | 19248 |
| 329 | Ga0105237_10001618 | 3300009545 | Bacteria | 29243 |
| 330 | Ga0105237_10394223 | 3300009545 | Bacteria | 1389 |
| 331 | Ga0105237_10757616 | 3300009545 | Bacteria | 977 |
| 332 | Ga0105237_10997033 | 3300009545 | Bacteria | 844 |
| 333 | Ga0105237_11842462 | 3300009545 | Bacteria | 613 |
| 334 | Ga0105238_10007984 | 3300009551 | Bacteria | 10588 |
| 335 | Ga0105238_10437534 | 3300009551 | Bacteria | 1304 |
| 336 | Ga0105238_10718602 | 3300009551 | Bacteria | 1011 |
| 337 | Ga0105249_10000814 | 3300009553 | Bacteria | 28107 |
| 338 | Ga0105249_10354541 | 3300009553 | Bacteria | 1487 |
| 339 | Ga0105249_10378887 | 3300009553 | Bacteria | 1440 |
| 340 | Ga0105249_10713244 | 3300009553 | Bacteria | 1064 |
| 341 | Ga0099796_10002269 | 3300010159 | Bacteria | 4177 |
| 342 | Ga0105239_10120316 | 3300010375 | Bacteria | 2915 |
| 343 | Ga0105239_10143574 | 3300010375 | Bacteria | 2661 |
| 344 | Ga0105239_10239229 | 3300010375 | Bacteria | 2038 |
| 345 | Ga0105239_10296034 | 3300010375 | Bacteria | 1822 |
| 346 | Ga0105239_10601978 | 3300010375 | Bacteria | 1254 |
| 347 | Ga0105239_12790328 | 3300010375 | Bacteria | 570 |
| 348 | Ga0105239_12945183 | 3300010375 | Bacteria | 555 |
| 349 | Ga0105246_10002439 | 3300011119 | Bacteria | 11222 |
| 350 | Ga0105246_10045899 | 3300011119 | Bacteria | 2978 |
| 351 | Ga0105246_10120687 | 3300011119 | Bacteria | 1942 |
| 352 | Ga0105246_10630391 | 3300011119 | Bacteria | 930 |
| 353 | Ga0105246_12574566 | 3300011119 | Bacteria | 502 |
| 354 | Ga0157327_1033127 | 3300012512 | Bacteria | 656 |
| 355 | Ga0157373_10019849 | 3300013100 | Bacteria | 4890 |
| 356 | Ga0157373_10027237 | 3300013100 | Bacteria | 4123 |
| 357 | Ga0157373_11308834 | 3300013100 | Bacteria | 549 |
| 358 | Ga0157371_10056437 | 3300013102 | Bacteria | 2786 |
| 359 | Ga0157371_10347917 | 3300013102 | Bacteria | 1079 |
| 360 | Ga0157371_10638770 | 3300013102 | Bacteria | 794 |
| 361 | Ga0157370_10017001 | 3300013104 | Bacteria | 7351 |
| 362 | Ga0157370_10461414 | 3300013104 | Bacteria | 1168 |
| 363 | Ga0157370_10555656 | 3300013104 | Bacteria | 1052 |
| 364 | Ga0157369_10164535 | 3300013105 | Bacteria | 2340 |
| 365 | Ga0157369_10197436 | 3300013105 | Bacteria | 2112 |
| 366 | Ga0157369_10312994 | 3300013105 | Bacteria | 1632 |
| 367 | Ga0157369_10765468 | 3300013105 | Bacteria | 993 |
| 368 | Ga0157369_11138607 | 3300013105 | Bacteria | 797 |
| 369 | Ga0157369_11463227 | 3300013105 | Bacteria | 695 |
| 370 | Ga0157369_12136507 | 3300013105 | Bacteria | 568 |
| 371 | Ga0157374_10012339 | 3300013296 | Bacteria | 7433 |
| 372 | Ga0157374_11221540 | 3300013296 | Bacteria | 773 |
| 373 | Ga0157378_10000470 | 3300013297 | Bacteria | 38483 |
| 374 | Ga0157378_11432213 | 3300013297 | Bacteria | 734 |
| 375 | Ga0163162_10004532 | 3300013306 | Bacteria | 13382 |
| 376 | Ga0163162_11073919 | 3300013306 | Bacteria | 912 |
| 377 | Ga0163162_11470543 | 3300013306 | Bacteria | 776 |
| 378 | Ga0163162_12543142 | 3300013306 | Bacteria | 589 |
| 379 | Ga0163162_12605215 | 3300013306 | Bacteria | 582 |
| 380 | Ga0157372_10001215 | 3300013307 | Bacteria | 27865 |
| 381 | Ga0157372_10297910 | 3300013307 | Bacteria | 1876 |
| 382 | Ga0157372_11055098 | 3300013307 | Bacteria | 941 |
| 383 | Ga0157372_11378347 | 3300013307 | Bacteria | 813 |
| 384 | Ga0157372_11623209 | 3300013307 | Bacteria | 744 |
| 385 | Ga0157372_12129590 | 3300013307 | Bacteria | 644 |
| 386 | Ga0157375_10012604 | 3300013308 | Bacteria | 7503 |
| 387 | Ga0157375_11913853 | 3300013308 | Bacteria | 704 |
| 388 | Ga0157375_13287897 | 3300013308 | Bacteria | 539 |
| 389 | Ga0163163_10002129 | 3300014325 | Bacteria | 16714 |
| 390 | Ga0163163_10005311 | 3300014325 | Bacteria | 11124 |
| 391 | Ga0163163_12084633 | 3300014325 | Bacteria | 627 |
| 392 | Ga0157380_10008515 | 3300014326 | Bacteria | 7329 |
| 393 | Ga0157380_10027055 | 3300014326 | Bacteria | 4358 |
| 394 | Ga0157380_11594359 | 3300014326 | Bacteria | 708 |
| 395 | Ga0182008_10222662 | 3300014497 | Bacteria | 966 |
| 396 | Ga0182008_10365970 | 3300014497 | Bacteria | 768 |
| 397 | Ga0157377_10006965 | 3300014745 | Bacteria | 5428 |
| 398 | Ga0157379_10001927 | 3300014968 | Bacteria | 17169 |
| 399 | Ga0157379_10552180 | 3300014968 | Bacteria | 1072 |
| 400 | Ga0157379_11730006 | 3300014968 | Bacteria | 613 |
| 401 | Ga0157376_10000606 | 3300014969 | Bacteria | 23175 |
| 402 | Ga0157376_10743776 | 3300014969 | Bacteria | 989 |
| 403 | Ga0163161_10002394 | 3300017792 | Bacteria | 13438 |
| 404 | Ga0163161_10573970 | 3300017792 | Bacteria | 927 |
| 405 | Ga0206356_11853575 | 3300020070 | Bacteria | 897 |
| 406 | Ga0206349_1277602 | 3300020075 | Bacteria | 1001 |
| 407 | Ga0206355_1403799 | 3300020076 | Bacteria | 1190 |
| 408 | Ga0206352_10097269 | 3300020078 | Bacteria | 589 |
| 409 | Ga0206352_11227367 | 3300020078 | Bacteria | 518 |
| 410 | Ga0206350_10960778 | 3300020080 | Bacteria | 819 |
| 411 | Ga0206353_10857624 | 3300020082 | Bacteria | 1191 |
| 412 | Ga0154015_1108290 | 3300020610 | Bacteria | 599 |
| 413 | Ga0154015_1214890 | 3300020610 | Bacteria | 1033 |
| 414 | Ga0213873_10106683 | 3300021358 | Bacteria | 810 |
| 415 | Ga0213873_10313968 | 3300021358 | Bacteria | 508 |
| 416 | Ga0213872_10023323 | 3300021361 | Bacteria | 2847 |
| 417 | Ga0213872_10307143 | 3300021361 | Bacteria | 657 |
| 418 | Ga0213874_10001821 | 3300021377 | Bacteria | 4469 |
| 419 | Ga0213874_10009960 | 3300021377 | Bacteria | 2367 |
| 420 | Ga0213874_10010979 | 3300021377 | Bacteria | 2283 |
| 421 | Ga0213874_10220157 | 3300021377 | Bacteria | 690 |
| 422 | Ga0213874_10264446 | 3300021377 | Bacteria | 638 |
| 423 | Ga0213874_10275691 | 3300021377 | Bacteria | 627 |
| 424 | Ga0213874_10354152 | 3300021377 | Bacteria | 563 |
| 425 | Ga0213876_10002961 | 3300021384 | Bacteria | 9840 |
| 426 | Ga0213876_10004772 | 3300021384 | Bacteria | 7531 |
| 427 | Ga0213875_10000089 | 3300021388 | Bacteria | 105772 |
| 428 | Ga0213875_10059627 | 3300021388 | Bacteria | 1786 |
| 429 | Ga0213871_10016747 | 3300021441 | Bacteria | 1771 |
| 430 | Ga0213871_10155626 | 3300021441 | Bacteria | 697 |
| 431 | Ga0224712_10002117 | 3300022467 | Bacteria | 4832 |
| 432 | Ga0224712_10050101 | 3300022467 | Bacteria | 1621 |
| 433 | Ga0256714_113971 | 3300023304 | Bacteria | 616 |
| 434 | Ga0256744_130108 | 3300023309 | Bacteria | 789 |
| 435 | Ga0256743_128847 | 3300023436 | Bacteria | 579 |
| 436 | Ga0256720_139806 | 3300023438 | Bacteria | 784 |
| 437 | Ga0209677_100816 | 3300025253 | Bacteria | 15575 |
| 438 | Ga0209148_1004162 | 3300025254 | Bacteria | 3638 |
| 439 | Ga0209148_1008955 | 3300025254 | Bacteria | 1982 |
| 440 | Ga0209233_1003250 | 3300025261 | Bacteria | 5762 |
| 441 | Ga0209455_1009081 | 3300025272 | Bacteria | 2639 |
| 442 | Ga0209455_1038588 | 3300025272 | Bacteria | 743 |
| 443 | Ga0209758_1040129 | 3300025297 | Bacteria | 1770 |
| 444 | Ga0207697_10057185 | 3300025315 | Bacteria | 1619 |
| 445 | Ga0207656_10012084 | 3300025321 | Bacteria | 3278 |
| 446 | Ga0207656_10173122 | 3300025321 | Bacteria | 1033 |
| 447 | Ga0207696_1128942 | 3300025711 | Bacteria | 680 |
| 448 | Ga0207713_1157248 | 3300025735 | Bacteria | 728 |
| 449 | Ga0207653_10032934 | 3300025885 | Bacteria | 1678 |
| 450 | Ga0207682_10132490 | 3300025893 | Bacteria | 1113 |
| 451 | Ga0207692_10002601 | 3300025898 | Bacteria | 6941 |
| 452 | Ga0207692_10039674 | 3300025898 | Bacteria | 2318 |
| 453 | Ga0207692_10075631 | 3300025898 | Bacteria | 1787 |
| 454 | Ga0207642_10091188 | 3300025899 | Bacteria | 1505 |
| 455 | Ga0207642_10845179 | 3300025899 | Bacteria | 584 |
| 456 | Ga0207710_10003497 | 3300025900 | Bacteria | 6990 |
| 457 | Ga0207688_10002614 | 3300025901 | Bacteria | 9749 |
| 458 | Ga0207688_10044664 | 3300025901 | Bacteria | 2469 |
| 459 | Ga0207680_10006344 | 3300025903 | Bacteria | 5711 |
| 460 | Ga0207647_10001956 | 3300025904 | Bacteria | 15734 |
| 461 | Ga0207647_10027406 | 3300025904 | Bacteria | 3714 |
| 462 | Ga0207685_10005152 | 3300025905 | Bacteria | 3415 |
| 463 | Ga0207685_10019197 | 3300025905 | Bacteria | 2249 |
| 464 | Ga0207685_10075667 | 3300025905 | Bacteria | 1378 |
| 465 | Ga0207685_10103277 | 3300025905 | Bacteria | 1222 |
| 466 | Ga0207685_10228851 | 3300025905 | Bacteria | 888 |
| 467 | Ga0207699_10000692 | 3300025906 | Bacteria | 16128 |
| 468 | Ga0207699_10008214 | 3300025906 | Bacteria | 5139 |
| 469 | Ga0207699_10028433 | 3300025906 | Bacteria | 3107 |
| 470 | Ga0207699_10062019 | 3300025906 | Bacteria | 2252 |
| 471 | Ga0207699_10421039 | 3300025906 | Bacteria | 954 |
| 472 | Ga0207699_10731373 | 3300025906 | Bacteria | 725 |
| 473 | Ga0207699_11028083 | 3300025906 | Unclassified | 609 |
| 474 | Ga0207699_11057182 | 3300025906 | Bacteria | 601 |
| 475 | Ga0207643_10116032 | 3300025908 | Bacteria | 1581 |
| 476 | Ga0207705_10093610 | 3300025909 | Bacteria | 2203 |
| 477 | Ga0207705_10244702 | 3300025909 | Bacteria | 1367 |
| 478 | Ga0207705_10348126 | 3300025909 | Bacteria | 1141 |
| 479 | Ga0207705_10933880 | 3300025909 | Bacteria | 671 |
| 480 | Ga0207705_11096131 | 3300025909 | Bacteria | 613 |
| 481 | Ga0207654_10003285 | 3300025911 | Bacteria | 8172 |
| 482 | Ga0207654_10185216 | 3300025911 | Bacteria | 1361 |
| 483 | Ga0207654_10534960 | 3300025911 | Bacteria | 831 |
| 484 | Ga0207707_10074687 | 3300025912 | Bacteria | 2957 |
| 485 | Ga0207707_10298153 | 3300025912 | Bacteria | 1394 |
| 486 | Ga0207707_10734408 | 3300025912 | Bacteria | 827 |
| 487 | Ga0207695_10056587 | 3300025913 | Bacteria | 4080 |
| 488 | Ga0207695_10104513 | 3300025913 | Bacteria | 2821 |
| 489 | Ga0207695_10228101 | 3300025913 | Bacteria | 1768 |
| 490 | Ga0207695_10284481 | 3300025913 | Bacteria | 1547 |
| 491 | Ga0207695_10930390 | 3300025913 | Bacteria | 749 |
| 492 | Ga0207671_10057494 | 3300025914 | Bacteria | 2883 |
| 493 | Ga0207671_10120775 | 3300025914 | Bacteria | 2003 |
| 494 | Ga0207671_10332555 | 3300025914 | Bacteria | 1203 |
| 495 | Ga0207671_10659429 | 3300025914 | Bacteria | 833 |
| 496 | Ga0207693_10000493 | 3300025915 | Bacteria | 35669 |
| 497 | Ga0207693_10008270 | 3300025915 | Bacteria | 8519 |
| 498 | Ga0207693_10030071 | 3300025915 | Bacteria | 4288 |
| 499 | Ga0207693_10059279 | 3300025915 | Bacteria | 2998 |
| 500 | Ga0207693_10112539 | 3300025915 | Bacteria | 2135 |
| 501 | Ga0207693_10159520 | 3300025915 | Bacteria | 1774 |
| 502 | Ga0207693_10635016 | 3300025915 | Bacteria | 830 |
| 503 | Ga0207693_10705887 | 3300025915 | Bacteria | 781 |
| 504 | Ga0207693_11179653 | 3300025915 | Bacteria | 578 |
| 505 | Ga0207663_10001067 | 3300025916 | Bacteria | 12565 |
| 506 | Ga0207663_10012076 | 3300025916 | Bacteria | 4657 |
| 507 | Ga0207663_10466318 | 3300025916 | Bacteria | 976 |
| 508 | Ga0207663_10961543 | 3300025916 | Bacteria | 684 |
| 509 | Ga0207663_10967373 | 3300025916 | Bacteria | 682 |
| 510 | Ga0207660_10644243 | 3300025917 | Bacteria | 864 |
| 511 | Ga0207660_11115557 | 3300025917 | Bacteria | 643 |
| 512 | Ga0207660_11293772 | 3300025917 | Bacteria | 592 |
| 513 | Ga0207662_10002067 | 3300025918 | Bacteria | 9951 |
| 514 | Ga0207657_10000282 | 3300025919 | Bacteria | 54101 |
| 515 | Ga0207657_10051869 | 3300025919 | Bacteria | 3564 |
| 516 | Ga0207657_10620448 | 3300025919 | Bacteria | 843 |
| 517 | Ga0207657_11124284 | 3300025919 | Bacteria | 600 |
| 518 | Ga0207649_10017750 | 3300025920 | Bacteria | 4034 |
| 519 | Ga0207649_10239309 | 3300025920 | Bacteria | 1302 |
| 520 | Ga0207652_10104736 | 3300025921 | Bacteria | 2502 |
| 521 | Ga0207652_10179342 | 3300025921 | Bacteria | 1903 |
| 522 | Ga0207652_10298273 | 3300025921 | Bacteria | 1454 |
| 523 | Ga0207646_10920567 | 3300025922 | Bacteria | 775 |
| 524 | Ga0207646_10983489 | 3300025922 | Bacteria | 746 |
| 525 | Ga0207681_10015153 | 3300025923 | Bacteria | 4807 |
| 526 | Ga0207694_10006423 | 3300025924 | Bacteria | 8959 |
| 527 | Ga0207694_10137335 | 3300025924 | Bacteria | 1964 |
| 528 | Ga0207694_10234115 | 3300025924 | Bacteria | 1500 |
| 529 | Ga0207650_10069986 | 3300025925 | Bacteria | 2636 |
| 530 | Ga0207659_10005250 | 3300025926 | Bacteria | 7843 |
| 531 | Ga0207659_11051182 | 3300025926 | Bacteria | 701 |
| 532 | Ga0207687_10008551 | 3300025927 | Bacteria | 6694 |
| 533 | Ga0207700_10014261 | 3300025928 | Bacteria | 5201 |
| 534 | Ga0207700_10071645 | 3300025928 | Bacteria | 2669 |
| 535 | Ga0207700_10104591 | 3300025928 | Bacteria | 2265 |
| 536 | Ga0207700_10574500 | 3300025928 | Bacteria | 1002 |
| 537 | Ga0207700_10580562 | 3300025928 | Bacteria | 997 |
| 538 | Ga0207700_10669401 | 3300025928 | Bacteria | 926 |
| 539 | Ga0207700_10929541 | 3300025928 | Bacteria | 778 |
| 540 | Ga0207700_11315927 | 3300025928 | Bacteria | 644 |
| 541 | Ga0207700_11901970 | 3300025928 | Bacteria | 521 |
| 542 | Ga0207664_10012756 | 3300025929 | Bacteria | 6015 |
| 543 | Ga0207664_10023422 | 3300025929 | Bacteria | 4626 |
| 544 | Ga0207664_10054900 | 3300025929 | Bacteria | 3159 |
| 545 | Ga0207664_10086181 | 3300025929 | Bacteria | 2565 |
| 546 | Ga0207664_10125208 | 3300025929 | Bacteria | 2157 |
| 547 | Ga0207664_10303495 | 3300025929 | Bacteria | 1405 |
| 548 | Ga0207664_10503883 | 3300025929 | Bacteria | 1084 |
| 549 | Ga0207644_10048201 | 3300025931 | Bacteria | 3044 |
| 550 | Ga0207690_10003444 | 3300025932 | Bacteria | 9444 |
| 551 | Ga0207690_10019766 | 3300025932 | Bacteria | 4153 |
| 552 | Ga0207706_10000270 | 3300025933 | Bacteria | 56584 |
| 553 | Ga0207706_10008316 | 3300025933 | Bacteria | 9567 |
| 554 | Ga0207706_10200935 | 3300025933 | Bacteria | 1748 |
| 555 | Ga0207706_10302615 | 3300025933 | Bacteria | 1393 |
| 556 | Ga0207709_10048849 | 3300025935 | Bacteria | 2580 |
| 557 | Ga0207709_10120230 | 3300025935 | Bacteria | 1772 |
| 558 | Ga0207709_11104993 | 3300025935 | Bacteria | 651 |
| 559 | Ga0207670_10092363 | 3300025936 | Bacteria | 2142 |
| 560 | Ga0207669_10002208 | 3300025937 | Bacteria | 8271 |
| 561 | Ga0207669_10129680 | 3300025937 | Bacteria | 1730 |
| 562 | Ga0207669_10292009 | 3300025937 | Bacteria | 1235 |
| 563 | Ga0207704_10395404 | 3300025938 | Bacteria | 1089 |
| 564 | Ga0207704_11004593 | 3300025938 | Bacteria | 706 |
| 565 | Ga0207665_10001538 | 3300025939 | Bacteria | 15513 |
| 566 | Ga0207665_10010112 | 3300025939 | Bacteria | 6196 |
| 567 | Ga0207665_10070979 | 3300025939 | Bacteria | 2377 |
| 568 | Ga0207665_10103792 | 3300025939 | Bacteria | 1989 |
| 569 | Ga0207665_10368058 | 3300025939 | Bacteria | 1088 |
| 570 | Ga0207665_10501814 | 3300025939 | Bacteria | 937 |
| 571 | Ga0207665_10578776 | 3300025939 | Bacteria | 875 |
| 572 | Ga0207665_11010106 | 3300025939 | Bacteria | 662 |
| 573 | Ga0207691_10053192 | 3300025940 | Bacteria | 3697 |
| 574 | Ga0207711_10137545 | 3300025941 | Bacteria | 2195 |
| 575 | Ga0207711_10543545 | 3300025941 | Bacteria | 1084 |
| 576 | Ga0207689_10885848 | 3300025942 | Bacteria | 753 |
| 577 | Ga0207661_10025741 | 3300025944 | Bacteria | 4476 |
| 578 | Ga0207661_10050770 | 3300025944 | Bacteria | 3306 |
| 579 | Ga0207661_10148369 | 3300025944 | Bacteria | 2025 |
| 580 | Ga0207661_10847999 | 3300025944 | Bacteria | 841 |
| 581 | Ga0207661_12008276 | 3300025944 | Bacteria | 524 |
| 582 | Ga0207679_10004166 | 3300025945 | Bacteria | 8986 |
| 583 | Ga0207679_10371865 | 3300025945 | Bacteria | 1251 |
| 584 | Ga0207679_10841364 | 3300025945 | Bacteria | 838 |
| 585 | Ga0207667_10011595 | 3300025949 | Bacteria | 10234 |
| 586 | Ga0207667_10186152 | 3300025949 | Bacteria | 2131 |
| 587 | Ga0207667_10309951 | 3300025949 | Bacteria | 1612 |
| 588 | Ga0207651_10004358 | 3300025960 | Bacteria | 7116 |
| 589 | Ga0207712_10047767 | 3300025961 | Bacteria | 2974 |
| 590 | Ga0207712_10738205 | 3300025961 | Bacteria | 862 |
| 591 | Ga0207668_10006213 | 3300025972 | Bacteria | 7052 |
| 592 | Ga0207668_10039960 | 3300025972 | Bacteria | 3162 |
| 593 | Ga0207668_11612398 | 3300025972 | Bacteria | 586 |
| 594 | Ga0207640_10002653 | 3300025981 | Bacteria | 9576 |
| 595 | Ga0207640_10003639 | 3300025981 | Bacteria | 8314 |
| 596 | Ga0207640_10209176 | 3300025981 | Bacteria | 1485 |
| 597 | Ga0207658_10023872 | 3300025986 | Bacteria | 4272 |
| 598 | Ga0207658_11557595 | 3300025986 | Bacteria | 604 |
| 599 | Ga0207677_10103809 | 3300026023 | Bacteria | 2099 |
| 600 | Ga0207677_11197635 | 3300026023 | Bacteria | 695 |
| 601 | Ga0207703_10433391 | 3300026035 | Bacteria | 1225 |
| 602 | Ga0207703_10688729 | 3300026035 | Bacteria | 971 |
| 603 | Ga0207703_10776479 | 3300026035 | Bacteria | 914 |
| 604 | Ga0207639_10000784 | 3300026041 | Bacteria | 21626 |
| 605 | Ga0207639_10017244 | 3300026041 | Bacteria | 5119 |
| 606 | Ga0207678_10000159 | 3300026067 | Bacteria | 56028 |
| 607 | Ga0207678_10000477 | 3300026067 | Bacteria | 36336 |
| 608 | Ga0207678_10476999 | 3300026067 | Bacteria | 1086 |
| 609 | Ga0207708_10000337 | 3300026075 | Bacteria | 36962 |
| 610 | Ga0207708_10282110 | 3300026075 | Bacteria | 1346 |
| 611 | Ga0207708_10441466 | 3300026075 | Bacteria | 1082 |
| 612 | Ga0207702_10007687 | 3300026078 | Bacteria | 9165 |
| 613 | Ga0207702_10046306 | 3300026078 | Bacteria | 3661 |
| 614 | Ga0207702_10458876 | 3300026078 | Bacteria | 1237 |
| 615 | Ga0207641_10017486 | 3300026088 | Bacteria | 5870 |
| 616 | Ga0207641_11062543 | 3300026088 | Bacteria | 807 |
| 617 | Ga0207648_10102108 | 3300026089 | Bacteria | 2513 |
| 618 | Ga0207648_10363858 | 3300026089 | Bacteria | 1305 |
| 619 | Ga0207676_10825727 | 3300026095 | Bacteria | 905 |
| 620 | Ga0207674_10018829 | 3300026116 | Bacteria | 7490 |
| 621 | Ga0207674_10030575 | 3300026116 | Bacteria | 5660 |
| 622 | Ga0207674_10621991 | 3300026116 | Bacteria | 1043 |
| 623 | Ga0207675_100001292 | 3300026118 | Bacteria | 25099 |
| 624 | Ga0207675_100149393 | 3300026118 | Bacteria | 2223 |
| 625 | Ga0207675_101393715 | 3300026118 | Bacteria | 722 |
| 626 | Ga0207683_10001738 | 3300026121 | Bacteria | 19398 |
| 627 | Ga0207683_10353704 | 3300026121 | Bacteria | 1348 |
| 628 | Ga0207683_10966376 | 3300026121 | Bacteria | 791 |
| 629 | Ga0207683_11094234 | 3300026121 | Bacteria | 739 |
| 630 | Ga0207698_10021538 | 3300026142 | Bacteria | 4461 |
| 631 | Ga0207698_10768882 | 3300026142 | Bacteria | 963 |
| 632 | Ga0207698_11455564 | 3300026142 | Bacteria | 700 |
| 633 | Ga0209179_1003967 | 3300027512 | Bacteria | 2191 |
| 634 | Ga0209966_1085348 | 3300027695 | Bacteria | 703 |
| 635 | Ga0209998_10038761 | 3300027717 | Bacteria | 1076 |
| 636 | Ga0209998_10125883 | 3300027717 | Bacteria | 648 |
| 637 | Ga0207428_10008303 | 3300027907 | Bacteria | 9386 |
| 638 | Ga0207428_10670860 | 3300027907 | Bacteria | 743 |
| 639 | Ga0268266_10206194 | 3300028379 | Bacteria | 1801 |
| 640 | Ga0268266_10630747 | 3300028379 | Bacteria | 1031 |
| 641 | Ga0268265_10612294 | 3300028380 | Bacteria | 1042 |
| 642 | Ga0268264_10000377 | 3300028381 | Bacteria | 65413 |
| 643 | Ga0268264_10015446 | 3300028381 | Bacteria | 6262 |
| 644 | Ga0268264_10910854 | 3300028381 | Bacteria | 883 |
| 645 | Ga0307515_10248135 | 3300028794 | Bacteria | 1538 |
| 646 | Ga0311000_100475 | 3300029272 | Bacteria | 638 |
| 647 | Ga0311004_113545 | 3300029276 | Bacteria | 667 |
| 648 | Ga0311001_1079354 | 3300029277 | Bacteria | 5162 |
| 649 | Ga0310981_1002449 | 3300029285 | Bacteria | 2299 |
| 650 | Ga0307511_10057801 | 3300030521 | Bacteria | 3009 |
| 651 | Ga0265340_10045595 | 3300031247 | Bacteria | 2141 |
| 652 | Ga0265339_10011362 | 3300031249 | Bacteria | 5484 |
| 653 | Ga0265327_10069811 | 3300031251 | Bacteria | 1762 |
| 654 | Ga0307513_10340634 | 3300031456 | Bacteria | 1250 |
| 655 | Ga0307509_10276688 | 3300031507 | Bacteria | 1442 |
| 656 | Ga0307408_100016009 | 3300031548 | Bacteria | 5000 |
| 657 | Ga0307408_100092650 | 3300031548 | Bacteria | 2284 |
| 658 | Ga0307408_100395387 | 3300031548 | Bacteria | 1185 |
| 659 | Ga0307408_100681236 | 3300031548 | Bacteria | 922 |
| 660 | Ga0307408_102164597 | 3300031548 | Bacteria | 537 |
| 661 | Ga0307508_10000378 | 3300031616 | Bacteria | 53801 |
| 662 | Ga0307508_10014201 | 3300031616 | Bacteria | 7263 |
| 663 | Ga0310105_121407 | 3300031666 | Bacteria | 503 |
| 664 | Ga0316579_10240025 | 3300031691 | Bacteria | 877 |
| 665 | Ga0265314_10636688 | 3300031711 | Unclassified | 545 |
| 666 | Ga0316576_10978254 | 3300031727 | Bacteria | 604 |
| 667 | Ga0307516_10019779 | 3300031730 | Bacteria | 6965 |
| 668 | Ga0307405_10020264 | 3300031731 | Bacteria | 3712 |
| 669 | Ga0307405_10610613 | 3300031731 | Bacteria | 891 |
| 670 | Ga0307405_10828608 | 3300031731 | Bacteria | 777 |
| 671 | Ga0307405_11844834 | 3300031731 | Bacteria | 538 |
| 672 | Ga0316577_10382766 | 3300031733 | Bacteria | 799 |
| 673 | Ga0307413_11016513 | 3300031824 | Bacteria | 711 |
| 674 | Ga0307410_10088334 | 3300031852 | Bacteria | 2194 |
| 675 | Ga0307410_10159678 | 3300031852 | Bacteria | 1687 |
| 676 | Ga0307410_10384358 | 3300031852 | Bacteria | 1130 |
| 677 | Ga0307410_10678337 | 3300031852 | Bacteria | 867 |
| 678 | Ga0307410_11601175 | 3300031852 | Bacteria | 575 |
| 679 | Ga0307410_11820968 | 3300031852 | Bacteria | 541 |
| 680 | Ga0326468_10002343 | 3300031889 | Bacteria | 1579 |
| 681 | Ga0307406_10173110 | 3300031901 | Bacteria | 1564 |
| 682 | Ga0307406_10326285 | 3300031901 | Bacteria | 1189 |
| 683 | Ga0307406_10608954 | 3300031901 | Bacteria | 902 |
| 684 | Ga0307406_10802626 | 3300031901 | Bacteria | 794 |
| 685 | Ga0307407_10126458 | 3300031903 | Bacteria | 1629 |
| 686 | Ga0307407_10545266 | 3300031903 | Bacteria | 856 |
| 687 | Ga0307412_10001095 | 3300031911 | Bacteria | 15519 |
| 688 | Ga0307412_10102836 | 3300031911 | Bacteria | 2024 |
| 689 | Ga0307412_11036061 | 3300031911 | Bacteria | 727 |
| 690 | Ga0307409_100004876 | 3300031995 | Bacteria | 7628 |
| 691 | Ga0307409_100837912 | 3300031995 | Bacteria | 929 |
| 692 | Ga0307409_101915378 | 3300031995 | Bacteria | 622 |
| 693 | Ga0307416_100036609 | 3300032002 | Bacteria | 3765 |
| 694 | Ga0307416_100057739 | 3300032002 | Bacteria | 3142 |
| 695 | Ga0307416_100419408 | 3300032002 | Bacteria | 1382 |
| 696 | Ga0307416_100824435 | 3300032002 | Bacteria | 1024 |
| 697 | Ga0307414_10054953 | 3300032004 | Bacteria | 2785 |
| 698 | Ga0307411_10077414 | 3300032005 | Bacteria | 2276 |
| 699 | Ga0307411_10528563 | 3300032005 | Bacteria | 1002 |
| 700 | Ga0307411_11376330 | 3300032005 | Bacteria | 645 |
| 701 | Ga0307415_100292801 | 3300032126 | Bacteria | 1345 |
| 702 | Ga0307415_101649487 | 3300032126 | Bacteria | 617 |
| 703 | Ga0316583_10263990 | 3300032133 | Bacteria | 596 |
| 704 | Ga0307507_10070872 | 3300033179 | Bacteria | 3157 |
| 705 | Ga0307510_10243235 | 3300033180 | Bacteria | 1292 |
| 706 | Ga0316596_1037368 | 3300033541 | Bacteria | 1270 |
| 707 | Ga0316215_1002459 | 3300033544 | Bacteria | 1751 |
| 708 | Ga0373950_0005337 | 3300034818 | Bacteria | 1917 |
| 709 | Ga0373958_0005093 | 3300034819 | Bacteria | 1979 |
| 710 | Ga0373959_0030593 | 3300034820 | Bacteria | 1085 |
| 711 | Ga0373938_0003982 | 3300034957 | Bacteria | 2442 |
| 712 | Ga0373926_0003147 | 3300035083 | Bacteria | 5299 |
| 713 | Ga0373926_0005778 | 3300035083 | Bacteria | 4089 |
| 714 | Ga0373928_0006912 | 3300035084 | Bacteria | 2186 |
| 715 | Ga0373940_0072756 | 3300035088 | Bacteria | 1004 |
| 716 | Ga0373944_0445889 | 3300035089 | Bacteria | 504 |
| 717 | Ga0373949_0011140 | 3300035090 | Bacteria | 1978 |
| 718 | Ga0373952_0016138 | 3300035092 | Bacteria | 1514 |
| 719 | Ga0373932_0062532 | 3300035112 | Bacteria | 1135 |
| 720 | Ga0373936_0010464 | 3300035113 | Bacteria | 3500 |
| 721 | Ga0373936_0015906 | 3300035113 | Bacteria | 2887 |
| 722 | Ga0373936_0341737 | 3300035113 | Bacteria | 681 |
| 723 | Ga0373939_0010461 | 3300035114 | Bacteria | 2321 |
| 724 | Ga0373941_0044026 | 3300035115 | Bacteria | 1391 |
| 725 | Ga0373945_0012687 | 3300035116 | Bacteria | 2802 |
| 726 | Ga0373945_0171395 | 3300035116 | Bacteria | 889 |
| 727 | Ga0373953_0099066 | 3300035117 | Bacteria | 1225 |
| 728 | Ga0373953_0106539 | 3300035117 | Bacteria | 1183 |
| 729 | Ga0373954_0006766 | 3300035118 | Bacteria | 5002 |
| 730 | Ga0373956_0012723 | 3300035119 | Bacteria | 3493 |
| 731 | Ga0373957_0106937 | 3300035120 | Bacteria | 1124 |
| 732 | Ga0373957_0168239 | 3300035120 | Bacteria | 905 |
| 733 | Ga0373960_0001622 | 3300035121 | Bacteria | 5029 |
| 734 | Ga0373943_0010548 | 3300035170 | Bacteria | 4141 |
| 735 | Ga0373943_0017321 | 3300035170 | Bacteria | 3296 |
| 736 | Ga0373943_0124534 | 3300035170 | Bacteria | 1373 |
| 737 | Ga0373946_0019180 | 3300035171 | Bacteria | 2633 |
| 738 | Ga0373946_0359825 | 3300035171 | Bacteria | 729 |
| 739 | Ga0373955_0020793 | 3300035172 | Bacteria | 3303 |
| 740 | Ga0373955_0126635 | 3300035172 | Bacteria | 1488 |
| 741 | Ga0373942_0152487 | 3300035207 | Bacteria | 743 |
| 742 | Ga0373962_0126509 | 3300035242 | Bacteria | 819 |
| 743 | Ga0373924_0014731 | 3300035410 | Bacteria | 2958 |
| 744 | Ga0373924_0201528 | 3300035410 | Bacteria | 878 |
| 745 | Ga0373931_0030144 | 3300035691 | Bacteria | 2791 |
| 746 | Ga0373931_0062360 | 3300035691 | Bacteria | 2012 |
| 747 | Ga0373931_0823862 | 3300035691 | Bacteria | 620 |
| 748 | Ga0373935_0012257 | 3300035692 | Bacteria | 5156 |
| 749 | Ga0373935_0053250 | 3300035692 | Bacteria | 2574 |
| 750 | Ga0373935_0286934 | 3300035692 | Bacteria | 1160 |
| 751 | Ga0373927_0004904 | 3300035695 | Bacteria | 9294 |
| 752 | Ga0373927_0222869 | 3300035695 | Bacteria | 1238 |
| 753 | Ga0373927_0333387 | 3300035695 | Bacteria | 999 |
| 754 | Ga0373933_0010736 | 3300035724 | Bacteria | 5025 |
| 755 | Ga0373933_0196707 | 3300035724 | Bacteria | 1289 |
| 756 | Ga0373933_0875935 | 3300035724 | Bacteria | 591 |
| 757 | Ga0373947_0009798 | 3300035725 | Bacteria | 5497 |
| 758 | Ga0373947_0034111 | 3300035725 | Bacteria | 3009 |
| 759 | Ga0373947_0398099 | 3300035725 | Bacteria | 928 |
| 760 | Ga0373947_0871454 | 3300035725 | Bacteria | 615 |
| 761 | Ga0310104_00193 | 3300036242 | Bacteria | 3346 |
| 762 | Ga0373937_0031089 | 3300036401 | Bacteria | 4835 |
| 763 | Ga0373937_0050692 | 3300036401 | Bacteria | 3802 |
| 764 | Ga0373937_0425070 | 3300036401 | Bacteria | 1261 |
| 765 | Ga0316582_0181961 | 3300036647 | Bacteria | 1430 |
| 766 | Ga0373925_0024722 | 3300037068 | Bacteria | 4386 |
| 767 | Ga0373925_0039116 | 3300037068 | Bacteria | 3508 |
| 768 | Ga0373925_0586461 | 3300037068 | Bacteria | 918 |
| 769 | Ga0373925_0685520 | 3300037068 | Bacteria | 845 |
| 770 | Ga0395899_0072585 | 3300037312 | Bacteria | 2518 |
| 771 | Ga0395899_0204290 | 3300037312 | Bacteria | 1376 |
| 772 | Ga0395899_0701927 | 3300037312 | Bacteria | 634 |
| 773 | Ga0395900_0238023 | 3300037418 | Bacteria | 1827 |
| 774 | Ga0395900_0343977 | 3300037418 | Bacteria | 1466 |
| 775 | Ga0395900_0369151 | 3300037418 | Bacteria | 1405 |
| 776 | Ga0395900_0493002 | 3300037418 | Bacteria | 1176 |
| 777 | Ga0395898_0007760 | 3300037466 | Bacteria | 11394 |
| 778 | Ga0395898_0055115 | 3300037466 | Bacteria | 3878 |
| 779 | Ga0395898_0064043 | 3300037466 | Bacteria | 3567 |
| 780 | Ga0395898_0294093 | 3300037466 | Bacteria | 1549 |
| 781 | Ga0395898_0917040 | 3300037466 | Bacteria | 814 |
| 782 | Ga0395898_1122328 | 3300037466 | Bacteria | 719 |
| 783 | Ga0395905_0002506 | 3300037471 | Bacteria | 20297 |
| 784 | Ga0395905_0112513 | 3300037471 | Bacteria | 2557 |
| 785 | Ga0395905_0217669 | 3300037471 | Bacteria | 1788 |
| 786 | Ga0436364_0089033 | 3300037853 | Bacteria | 2364 |
| 787 | Ga0436364_0333324 | 3300037853 | Bacteria | 10396 |
| 788 | Ga0436364_0335675 | 3300037853 | Bacteria | 1232 |
| 789 | Ga0436364_0508030 | 3300037853 | Bacteria | 1342 |
| 790 | Ga0436364_0554121 | 3300037853 | Bacteria | 902 |
| 791 | Ga0436364_1191222 | 3300037853 | Bacteria | 1265 |
| 792 | Ga0436364_1352603 | 3300037853 | Bacteria | 2275 |
| 793 | Ga0395901_0002674 | 3300038443 | Bacteria | 17986 |
| 794 | Ga0395901_0132044 | 3300038443 | Bacteria | 2624 |
| 795 | Ga0395901_0318811 | 3300038443 | Bacteria | 1609 |
| 796 | Ga0395901_0408662 | 3300038443 | Bacteria | 1394 |
| 797 | Ga0395901_0637417 | 3300038443 | Bacteria | 1070 |
| 798 | Ga0395901_1012464 | 3300038443 | Bacteria | 806 |
| 799 | Ga0242420_011095 | 3300038996 | Bacteria | 1506 |
| 800 | Ga0436365_0368899 | 3300039437 | Bacteria | 1973 |
| 801 | Ga0436365_0870893 | 3300039437 | Bacteria | 2017 |
| 802 | Ga0436365_1010396 | 3300039437 | Bacteria | 801 |
| 803 | Ga0436365_1047672 | 3300039437 | Bacteria | 1074 |
| 804 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 805 | Ga0436365_1350477 | 3300039437 | Bacteria | 523 |
| 806 | Ga0436365_1529438 | 3300039437 | Bacteria | 926 |
| 807 | Ga0436365_1760276 | 3300039437 | Bacteria | 874 |
| 808 | Ga0436365_1870318 | 3300039437 | Bacteria | 5247 |
| 809 | Ga0436365_1902820 | 3300039437 | Bacteria | 1335 |
| 810 | Ga0436360_0409482 | 3300039438 | Bacteria | 1423 |
| 811 | Ga0436360_0777771 | 3300039438 | Bacteria | 1037 |
| 812 | Ga0436360_0885775 | 3300039438 | Bacteria | 829 |
| 813 | Ga0436360_0888847 | 3300039438 | Bacteria | 573 |
| 814 | Ga0436360_1268636 | 3300039438 | Bacteria | 533 |
| 815 | Ga0436361_0317849 | 3300039447 | Bacteria | 1007 |
| 816 | Ga0436361_0427976 | 3300039447 | Bacteria | 1496 |
| 817 | Ga0436361_0763086 | 3300039447 | Bacteria | 801 |
| 818 | Ga0436361_0963669 | 3300039447 | Bacteria | 3298 |
| 819 | Ga0436363_0131403 | 3300039450 | Bacteria | 1132 |
| 820 | Ga0436363_0242717 | 3300039450 | Bacteria | 589 |
| 821 | Ga0436363_0312775 | 3300039450 | Bacteria | 1035 |
| 822 | Ga0436363_0880899 | 3300039450 | Bacteria | 6318 |
| 823 | Ga0436363_1014283 | 3300039450 | Bacteria | 1082 |
| 824 | Ga0436363_1046285 | 3300039450 | Bacteria | 10399 |
| 825 | Ga0436363_1113612 | 3300039450 | Bacteria | 631 |
| 826 | Ga0436363_1387407 | 3300039450 | Bacteria | 1077 |
| 827 | Ga0436363_1575848 | 3300039450 | Bacteria | 1027 |
| 828 | Ga0436363_1627336 | 3300039450 | Bacteria | 720 |
| 829 | Ga0436362_0002334 | 3300039453 | Bacteria | 939 |
| 830 | Ga0436362_0607333 | 3300039453 | Bacteria | 833 |
| 831 | Ga0436362_0793870 | 3300039453 | Bacteria | 1297 |
| 832 | Ga0436362_0982213 | 3300039453 | Bacteria | 745 |
| 833 | Ga0436362_1142159 | 3300039453 | Bacteria | 1204 |
| 834 | Ga0439439_0132040 | 3300041406 | Bacteria | 702 |
| 835 | Ga0439465_0053801 | 3300041413 | Bacteria | 1323 |
| 836 | Ga0439465_0127160 | 3300041413 | Bacteria | 897 |
| 837 | Ga0451794_34969 | 3300041446 | Bacteria | 594 |
| 838 | Ga0451798_0606664 | 3300041458 | Bacteria | 500 |
| 839 | Ga0451807_2208106 | 3300041486 | Bacteria | 579 |
| 840 | Ga0451837_0342915 | 3300041494 | Bacteria | 1221 |
| 841 | Ga0451855_0769345 | 3300041511 | Bacteria | 513 |
| 842 | Ga0451853_3344493 | 3300041512 | Bacteria | 740 |
| 843 | Ga0439431_0094769 | 3300041997 | Bacteria | 816 |
| 844 | Ga0439432_128392 | 3300042006 | Bacteria | 749 |
| 845 | Ga0439457_151757 | 3300042014 | Bacteria | 558 |
| 846 | Ga0450900_053254 | 3300042136 | Bacteria | 623 |
| 847 | Ga0450903_051975 | 3300042138 | Bacteria | 599 |
| 848 | Ga0439459_0018016 | 3300042438 | Bacteria | 1323 |
| 849 | Ga0450901_002715 | 3300042533 | Bacteria | 1880 |
| 850 | Ga0466969_0217487 | 3300044656 | Bacteria | 869 |
| 851 | Ga0466969_0511409 | 3300044656 | Bacteria | 548 |
| 852 | Ga0466965_0333684 | 3300044683 | Bacteria | 828 |
| 853 | Ga0466966_0037447 | 3300044684 | Bacteria | 3128 |
| 854 | Ga0466966_0038631 | 3300044684 | Bacteria | 3076 |
| 855 | Ga0466966_0063022 | 3300044684 | Bacteria | 2337 |
| 856 | Ga0466961_0017735 | 3300044693 | Bacteria | 4574 |
| 857 | Ga0466961_0058522 | 3300044693 | Bacteria | 2452 |
| 858 | Ga0466963_0016197 | 3300044694 | Bacteria | 4633 |
| 859 | Ga0466963_0037303 | 3300044694 | Bacteria | 3172 |
| 860 | Ga0466963_0070352 | 3300044694 | Bacteria | 2353 |
| 861 | Ga0466963_0354875 | 3300044694 | Bacteria | 1033 |
| 862 | Ga0466963_0358283 | 3300044694 | Bacteria | 1027 |
| 863 | Ga0466963_0543930 | 3300044694 | Bacteria | 820 |
| 864 | Ga0466964_0475103 | 3300044706 | Bacteria | 667 |
| 865 | Ga0466971_0080841 | 3300044719 | Bacteria | 1482 |
| 866 | Ga0466971_0675604 | 3300044719 | Bacteria | 518 |
| 867 | Ga0466968_0060841 | 3300044735 | Bacteria | 1628 |
| 868 | Ga0466970_0122687 | 3300044765 | Bacteria | 1424 |
| 869 | Ga0466970_0201450 | 3300044765 | Bacteria | 1107 |
| 870 | Ga0466970_0506738 | 3300044765 | Bacteria | 695 |
| 871 | Ga0466957_0014805 | 3300044842 | Bacteria | 4545 |
| 872 | Ga0466957_0075585 | 3300044842 | Bacteria | 2090 |
| 873 | Ga0466957_0318692 | 3300044842 | Bacteria | 1048 |
| 874 | Ga0466957_0935663 | 3300044842 | Bacteria | 620 |
| 875 | Ga0466960_0051465 | 3300044901 | Bacteria | 1990 |
| 876 | Ga0466960_0958273 | 3300044901 | Bacteria | 524 |
| 877 | Ga0466959_0098844 | 3300045049 | Bacteria | 2090 |
| 878 | Ga0466959_0744194 | 3300045049 | Bacteria | 656 |
| 879 | Ga0466967_0011664 | 3300045976 | Bacteria | 6675 |
| 880 | Ga0466967_0056204 | 3300045976 | Bacteria | 3469 |
| 881 | Ga0466967_0096571 | 3300045976 | Bacteria | 2696 |
| 882 | Ga0466967_0434220 | 3300045976 | Bacteria | 1281 |
| 883 | Ga0466967_0471064 | 3300045976 | Bacteria | 1229 |
| 884 | Ga0466967_1078797 | 3300045976 | Bacteria | 800 |
| 885 | Ga0495617_093369 | 3300046452 | Bacteria | 981 |
| 886 | Ga0495603_0011756 | 3300046455 | Bacteria | 5297 |
| 887 | Ga0495603_0725840 | 3300046455 | Bacteria | 568 |
| 888 | Ga0495629_0026319 | 3300046459 | Bacteria | 4133 |
| 889 | Ga0495629_0589356 | 3300046459 | Bacteria | 744 |
| 890 | Ga0495641_0210957 | 3300046461 | Bacteria | 871 |
| 891 | Ga0495651_0353235 | 3300046462 | Bacteria | 971 |
| 892 | Ga0495651_0361100 | 3300046462 | Bacteria | 957 |
| 893 | Ga0495650_0056786 | 3300046471 | Bacteria | 1587 |
| 894 | Ga0495580_0111434 | 3300046472 | Bacteria | 1900 |
| 895 | Ga0495580_0791263 | 3300046472 | Bacteria | 615 |
| 896 | Ga0495582_0016883 | 3300046473 | Bacteria | 3997 |
| 897 | Ga0495639_0026164 | 3300046475 | Bacteria | 2577 |
| 898 | Ga0495662_0031478 | 3300046476 | Bacteria | 2562 |
| 899 | Ga0495664_0018921 | 3300046477 | Bacteria | 3953 |
| 900 | Ga0495584_0038672 | 3300046491 | Bacteria | 2411 |
| 901 | Ga0495606_0055089 | 3300046507 | Bacteria | 2573 |
| 902 | Ga0495608_0912010 | 3300046511 | Bacteria | 514 |
| 903 | Ga0495618_0043838 | 3300046514 | Bacteria | 2822 |
| 904 | Ga0495618_0926569 | 3300046514 | Bacteria | 502 |
| 905 | Ga0495630_0095907 | 3300046517 | Bacteria | 2242 |
| 906 | Ga0495630_0170546 | 3300046517 | Bacteria | 1658 |
| 907 | Ga0495630_0274888 | 3300046517 | Bacteria | 1287 |
| 908 | Ga0495666_0087221 | 3300046526 | Bacteria | 1474 |
| 909 | Ga0495652_0204382 | 3300046529 | Bacteria | 1496 |
| 910 | Ga0495652_0526129 | 3300046529 | Bacteria | 816 |
| 911 | Ga0495665_0039396 | 3300046531 | Bacteria | 2517 |
| 912 | Ga0495665_0168192 | 3300046531 | Bacteria | 1142 |
| 913 | Ga0495640_0019304 | 3300046533 | Bacteria | 5035 |
| 914 | Ga0495640_0127966 | 3300046533 | Bacteria | 1646 |
| 915 | Ga0495586_0136518 | 3300046535 | Bacteria | 1375 |
| 916 | Ga0495586_0158041 | 3300046535 | Bacteria | 1278 |
| 917 | Ga0495587_0239915 | 3300046536 | Bacteria | 1020 |
| 918 | Ga0495597_0068164 | 3300046542 | Bacteria | 1538 |
| 919 | Ga0495645_0003533 | 3300046543 | Bacteria | 10576 |
| 920 | Ga0495622_0204243 | 3300046557 | Bacteria | 879 |
| 921 | Ga0495622_0452756 | 3300046557 | Bacteria | 550 |
| 922 | Ga0495667_0108852 | 3300046559 | Bacteria | 1790 |
| 923 | Ga0495667_0319903 | 3300046559 | Bacteria | 982 |
| 924 | Ga0495656_0482666 | 3300046615 | Bacteria | 656 |
| 925 | Ga0495668_0426247 | 3300046616 | Bacteria | 730 |
| 926 | Ga0495668_0430953 | 3300046616 | Bacteria | 725 |
| 927 | Ga0495634_0015564 | 3300046642 | Bacteria | 5459 |
| 928 | Ga0495634_0209436 | 3300046642 | Bacteria | 1208 |
| 929 | Ga0495625_0265563 | 3300046660 | Bacteria | 1109 |
| 930 | Ga0495625_0747054 | 3300046660 | Bacteria | 574 |
| 931 | Ga0495635_0099960 | 3300046663 | Bacteria | 1982 |
| 932 | Ga0495635_0260117 | 3300046663 | Bacteria | 1169 |
| 933 | Ga0495635_0810117 | 3300046663 | Bacteria | 603 |
| 934 | Ga0495657_0732641 | 3300046675 | Bacteria | 567 |
| 935 | Ga0495657_0864147 | 3300046675 | Bacteria | 515 |
| 936 | Ga0495599_0154630 | 3300046678 | Bacteria | 1419 |
| 937 | Ga0495599_0165274 | 3300046678 | Bacteria | 1367 |
| 938 | Ga0495623_0224284 | 3300046679 | Bacteria | 1069 |
| 939 | Ga0495623_0315983 | 3300046679 | Bacteria | 859 |
| 940 | Ga0495646_0054443 | 3300046680 | Bacteria | 2406 |
| 941 | Ga0495646_0560632 | 3300046680 | Bacteria | 583 |
| 942 | Ga0495647_0005756 | 3300046681 | Bacteria | 4074 |
| 943 | Ga0495658_0398360 | 3300046683 | Bacteria | 877 |
| 944 | Ga0495613_0078402 | 3300046689 | Bacteria | 2403 |
| 945 | Ga0495624_0051066 | 3300046690 | Bacteria | 2618 |
| 946 | Ga0495624_0186772 | 3300046690 | Bacteria | 1261 |
| 947 | Ga0495600_0144763 | 3300046809 | Bacteria | 1541 |
| 948 | Ga0495581_0033672 | 3300047315 | Bacteria | 2966 |
| 949 | Ga0495604_0190355 | 3300047317 | Bacteria | 1430 |
| 950 | Ga0495604_0317839 | 3300047317 | Bacteria | 1041 |
| 951 | Ga0495604_0453169 | 3300047317 | Bacteria | 838 |
| 952 | Ga0495604_0644638 | 3300047317 | Bacteria | 676 |
| 953 | Ga0495674_0010137 | 3300047319 | Bacteria | 8927 |
| 954 | Ga0495676_0156541 | 3300047321 | Bacteria | 1616 |
| 955 | Ga0495680_0263931 | 3300047322 | Bacteria | 1217 |
| 956 | Ga0495680_0366455 | 3300047322 | Bacteria | 1000 |
| 957 | Ga0495680_0474417 | 3300047322 | Bacteria | 853 |
| 958 | Ga0495680_0621850 | 3300047322 | Bacteria | 720 |
| 959 | Ga0495675_0033574 | 3300047444 | Bacteria | 3275 |
| 960 | Ga0495675_0852003 | 3300047444 | Unclassified | 502 |
| 961 | Ga0495684_0016236 | 3300047471 | Bacteria | 5733 |
| 962 | Ga0495684_0526279 | 3300047471 | Bacteria | 809 |
| 963 | Ga0495686_0247696 | 3300047472 | Bacteria | 1002 |
| 964 | Ga0495593_0035110 | 3300047673 | Bacteria | 2723 |
| 965 | Ga0495602_0073140 | 3300048088 | Bacteria | 2919 |
| 966 | Ga0495615_0245224 | 3300048090 | Bacteria | 566 |
| 967 | Ga0496100_0017720 | 3300048903 | Bacteria | 4210 |
| 968 | Ga0496100_0086615 | 3300048903 | Bacteria | 2128 |
| 969 | Ga0496100_0088497 | 3300048903 | Bacteria | 2108 |
| 970 | Ga0496100_0252106 | 3300048903 | Bacteria | 1306 |
| 971 | Ga0496100_0427167 | 3300048903 | Bacteria | 1013 |
| 972 | Ga0496100_0849411 | 3300048903 | Bacteria | 716 |
| 973 | Ga0496101_0010556 | 3300048904 | Bacteria | 6102 |
| 974 | Ga0496101_0142858 | 3300048904 | Bacteria | 1825 |
| 975 | Ga0496101_0146063 | 3300048904 | Bacteria | 1806 |
| 976 | Ga0496101_0322108 | 3300048904 | Bacteria | 1213 |
| 977 | Ga0496101_0501719 | 3300048904 | Bacteria | 959 |
| 978 | Ga0496101_1047976 | 3300048904 | Bacteria | 641 |
| 979 | Ga0496101_1537642 | 3300048904 | Bacteria | 518 |
| 980 | Ga0496102_0021341 | 3300048905 | Bacteria | 5727 |
| 981 | Ga0496102_0269233 | 3300048905 | Bacteria | 1606 |
| 982 | Ga0496102_0276267 | 3300048905 | Bacteria | 1583 |
| 983 | Ga0496102_0641575 | 3300048905 | Bacteria | 985 |
| 984 | Ga0496102_1387868 | 3300048905 | Bacteria | 621 |
| 985 | Ga0496103_0067933 | 3300048906 | Bacteria | 2227 |
| 986 | Ga0496103_0112317 | 3300048906 | Bacteria | 1731 |
| 987 | Ga0496103_0172850 | 3300048906 | Bacteria | 1388 |
| 988 | Ga0496104_0001364 | 3300048907 | Bacteria | 21131 |
| 989 | Ga0496104_0044527 | 3300048907 | Bacteria | 4169 |
| 990 | Ga0496104_0044528 | 3300048907 | Bacteria | 4169 |
| 991 | Ga0496104_0108172 | 3300048907 | Bacteria | 2664 |
| 992 | Ga0496104_0274478 | 3300048907 | Bacteria | 1598 |
| 993 | Ga0496105_0004404 | 3300048908 | Bacteria | 10600 |
| 994 | Ga0496105_0005504 | 3300048908 | Bacteria | 9611 |
| 995 | Ga0496105_0148751 | 3300048908 | Bacteria | 1925 |
| 996 | Ga0496105_0615649 | 3300048908 | Bacteria | 841 |
| 997 | Ga0496106_0049371 | 3300048909 | Bacteria | 3169 |
| 998 | Ga0496106_0074612 | 3300048909 | Bacteria | 2597 |
| 999 | Ga0496106_0255760 | 3300048909 | Bacteria | 1401 |
| 1000 | Ga0496106_0784058 | 3300048909 | Bacteria | 756 |
| 1001 | Ga0496107_0111293 | 3300048910 | Bacteria | 2013 |
| 1002 | Ga0496107_0296518 | 3300048910 | Bacteria | 1203 |
| 1003 | Ga0496107_0336293 | 3300048910 | Bacteria | 1123 |
| 1004 | Ga0496107_0450946 | 3300048910 | Bacteria | 955 |
| 1005 | Ga0496107_0687808 | 3300048910 | Bacteria | 753 |
| 1006 | Ga0496108_0001133 | 3300048911 | Bacteria | 20819 |
| 1007 | Ga0496108_0032633 | 3300048911 | Bacteria | 4325 |
| 1008 | Ga0496108_0085334 | 3300048911 | Bacteria | 2680 |
| 1009 | Ga0496108_0224656 | 3300048911 | Bacteria | 1632 |
| 1010 | Ga0496108_0517813 | 3300048911 | Bacteria | 1041 |
| 1011 | Ga0496108_0668902 | 3300048911 | Bacteria | 902 |
| 1012 | Ga0496109_0000583 | 3300048912 | Bacteria | 30510 |
| 1013 | Ga0496109_0005439 | 3300048912 | Bacteria | 10654 |
| 1014 | Ga0496109_0042827 | 3300048912 | Bacteria | 4103 |
| 1015 | Ga0496109_0138169 | 3300048912 | Bacteria | 2278 |
| 1016 | Ga0496109_0557498 | 3300048912 | Bacteria | 1081 |
| 1017 | Ga0496110_0010849 | 3300048913 | Bacteria | 7430 |
| 1018 | Ga0496110_0112064 | 3300048913 | Bacteria | 2453 |
| 1019 | Ga0496110_0181086 | 3300048913 | Bacteria | 1913 |
| 1020 | Ga0496110_0430482 | 3300048913 | Bacteria | 1203 |
| 1021 | Ga0496110_0766449 | 3300048913 | Bacteria | 868 |
| 1022 | Ga0496110_1855276 | 3300048913 | Bacteria | 513 |
| 1023 | Ga0496111_0009370 | 3300048914 | Bacteria | 6529 |
| 1024 | Ga0496111_0074867 | 3300048914 | Bacteria | 2466 |
| 1025 | Ga0496111_0100084 | 3300048914 | Bacteria | 2129 |
| 1026 | Ga0496111_0397434 | 3300048914 | Bacteria | 1019 |
| 1027 | Ga0496111_0783833 | 3300048914 | Bacteria | 690 |
| 1028 | Ga0496112_0000884 | 3300048915 | Bacteria | 21517 |
| 1029 | Ga0496112_0056643 | 3300048915 | Bacteria | 3858 |
| 1030 | Ga0496112_0059398 | 3300048915 | Bacteria | 3767 |
| 1031 | Ga0496112_0262667 | 3300048915 | Bacteria | 1676 |
| 1032 | Ga0496112_0301262 | 3300048915 | Bacteria | 1548 |
| 1033 | Ga0496112_0865970 | 3300048915 | Bacteria | 826 |
| 1034 | Ga0496112_0959312 | 3300048915 | Bacteria | 776 |
| 1035 | Ga0496112_1903594 | 3300048915 | Bacteria | 506 |
| 1036 | Ga0496113_0000351 | 3300048916 | Bacteria | 22021 |
| 1037 | Ga0496113_0004259 | 3300048916 | Bacteria | 8765 |
| 1038 | Ga0496113_0014431 | 3300048916 | Bacteria | 5389 |
| 1039 | Ga0496113_0480557 | 3300048916 | Bacteria | 998 |
| 1040 | Ga0496114_0159980 | 3300048917 | Bacteria | 1957 |
| 1041 | Ga0496114_0325387 | 3300048917 | Bacteria | 1359 |
| 1042 | Ga0496114_0526862 | 3300048917 | Bacteria | 1045 |
| 1043 | Ga0496114_0727902 | 3300048917 | Bacteria | 868 |
| 1044 | Ga0496115_0004536 | 3300048918 | Bacteria | 10046 |
| 1045 | Ga0496115_0117368 | 3300048918 | Bacteria | 2189 |
| 1046 | Ga0496115_0208195 | 3300048918 | Bacteria | 1615 |
| 1047 | Ga0496115_0307943 | 3300048918 | Bacteria | 1297 |
| 1048 | Ga0496115_0774600 | 3300048918 | Bacteria | 748 |
| 1049 | Ga0496115_1004222 | 3300048918 | Bacteria | 637 |
| 1050 | Ga0496116_0104480 | 3300048919 | Bacteria | 1683 |
| 1051 | Ga0496116_0224902 | 3300048919 | Bacteria | 957 |
| 1052 | Ga0496117_0071108 | 3300048920 | Bacteria | 2333 |
| 1053 | Ga0496117_0079014 | 3300048920 | Bacteria | 2169 |
| 1054 | Ga0496117_0126021 | 3300048920 | Bacteria | 1562 |
| 1055 | Ga0496117_0280736 | 3300048920 | Bacteria | 892 |
| 1056 | Ga0496118_0024920 | 3300048921 | Bacteria | 5148 |
| 1057 | Ga0496118_0029731 | 3300048921 | Bacteria | 4576 |
| 1058 | Ga0496118_0073065 | 3300048921 | Bacteria | 2459 |
| 1059 | Ga0496118_0524006 | 3300048921 | Bacteria | 584 |
| 1060 | Ga0496118_0560981 | 3300048921 | Bacteria | 555 |
| 1061 | Ga0496119_0004353 | 3300048922 | Bacteria | 14129 |
| 1062 | Ga0496119_0015798 | 3300048922 | Bacteria | 5783 |
| 1063 | Ga0496119_0047286 | 3300048922 | Bacteria | 2678 |
| 1064 | Ga0496119_0186852 | 3300048922 | Bacteria | 1083 |
| 1065 | Ga0496119_0240910 | 3300048922 | Bacteria | 916 |
| 1066 | Ga0496119_0295542 | 3300048922 | Bacteria | 800 |
| 1067 | Ga0496119_0381273 | 3300048922 | Bacteria | 676 |
| 1068 | Ga0496120_0058656 | 3300048923 | Bacteria | 2161 |
| 1069 | Ga0496120_0072566 | 3300048923 | Bacteria | 1886 |
| 1070 | Ga0496120_0227045 | 3300048923 | Bacteria | 889 |
| 1071 | Ga0496121_0003703 | 3300048924 | Bacteria | 21450 |
| 1072 | Ga0496121_0035490 | 3300048924 | Bacteria | 4468 |
| 1073 | Ga0496121_0076984 | 3300048924 | Bacteria | 2658 |
| 1074 | Ga0496121_0273289 | 3300048924 | Bacteria | 1160 |
| 1075 | Ga0496121_0396206 | 3300048924 | Bacteria | 906 |
| 1076 | Ga0496121_0414452 | 3300048924 | Bacteria | 878 |
| 1077 | Ga0496122_0049328 | 3300048925 | Bacteria | 3225 |
| 1078 | Ga0496122_0133672 | 3300048925 | Bacteria | 1569 |
| 1079 | Ga0496122_0620340 | 3300048925 | Bacteria | 502 |
| 1080 | Ga0496123_0023041 | 3300048926 | Bacteria | 4779 |
| 1081 | Ga0496123_0443489 | 3300048926 | Bacteria | 580 |
| 1082 | Ga0496124_0037995 | 3300048927 | Bacteria | 4182 |
| 1083 | Ga0496124_0201142 | 3300048927 | Bacteria | 1515 |
| 1084 | Ga0496124_0280696 | 3300048927 | Bacteria | 1214 |
| 1085 | Ga0496124_0639254 | 3300048927 | Bacteria | 685 |
| 1086 | Ga0496125_0017448 | 3300048928 | Bacteria | 6842 |
| 1087 | Ga0496125_0187364 | 3300048928 | Bacteria | 1370 |
| 1088 | Ga0496125_0228180 | 3300048928 | Bacteria | 1193 |
| 1089 | Ga0496126_0052029 | 3300048929 | Bacteria | 3725 |
| 1090 | Ga0496126_0062525 | 3300048929 | Bacteria | 3340 |
| 1091 | Ga0496126_0076397 | 3300048929 | Bacteria | 2971 |
| 1092 | Ga0496126_0088438 | 3300048929 | Bacteria | 2728 |
| 1093 | Ga0496126_0110380 | 3300048929 | Bacteria | 2396 |
| 1094 | Ga0496126_0157561 | 3300048929 | Bacteria | 1942 |
| 1095 | Ga0496126_0185973 | 3300048929 | Bacteria | 1762 |
| 1096 | Ga0496126_0552488 | 3300048929 | Bacteria | 913 |
| 1097 | Ga0501306_005013 | 3300049127 | Bacteria | 1502 |
| 1098 | Ga0501309_018091 | 3300049129 | Bacteria | 971 |
| 1099 | Ga0501310_000913 | 3300049130 | Bacteria | 2631 |
| 1100 | Ga0501304_015606 | 3300049160 | Bacteria | 713 |
| 1101 | Ga0501307_051215 | 3300049162 | Bacteria | 621 |
| 1102 | Ga0501307_069927 | 3300049162 | Bacteria | 558 |
| 1103 | Ga0501295_087541 | 3300049518 | Bacteria | 716 |
| 1104 | Ga0501311_058550 | 3300049527 | Bacteria | 618 |
| 1105 | Ga0501311_058695 | 3300049527 | Bacteria | 617 |
| 1106 | Ga0501312_002347 | 3300049528 | Bacteria | 2034 |
| 1107 | Ga0501313_012946 | 3300049529 | Bacteria | 976 |
| 1108 | Ga0501314_004633 | 3300049530 | Bacteria | 1147 |
| 1109 | Ga0501315_000284 | 3300049531 | Bacteria | 3262 |
| 1110 | Ga0501316_001152 | 3300049532 | Bacteria | 2158 |
| 1111 | Ga0501317_000192 | 3300049533 | Bacteria | 3649 |
| 1112 | Ga0501318_000037 | 3300049534 | Bacteria | 5323 |
| 1113 | Ga0501320_007213 | 3300049536 | Bacteria | 1064 |
| 1114 | Ga0501320_033205 | 3300049536 | Bacteria | 650 |
| 1115 | Ga0501323_009389 | 3300049539 | Bacteria | 1152 |
| 1116 | Ga0501324_025965 | 3300049540 | Bacteria | 620 |
| 1117 | Ga0501329_01320 | 3300049545 | Bacteria | 1070 |
| 1118 | Ga0501331_07283 | 3300049547 | Bacteria | 656 |
| 1119 | Ga0501332_19326 | 3300049548 | Bacteria | 502 |
| 1120 | Ga0501335_019758 | 3300049551 | Bacteria | 713 |
| 1121 | Ga0501031_0058878 | 3300049568 | Bacteria | 2503 |
| 1122 | Ga0501031_0189582 | 3300049568 | Bacteria | 1343 |
| 1123 | Ga0501031_0245821 | 3300049568 | Bacteria | 1163 |
| 1124 | Ga0501031_0336341 | 3300049568 | Bacteria | 978 |
| 1125 | Ga0501031_0384727 | 3300049568 | Bacteria | 908 |
| 1126 | Ga0501032_0102312 | 3300049569 | Bacteria | 1898 |
| 1127 | Ga0501032_0196587 | 3300049569 | Bacteria | 1317 |
| 1128 | Ga0501032_0510860 | 3300049569 | Bacteria | 767 |
| 1129 | Ga0501033_0003899 | 3300049570 | Bacteria | 12129 |
| 1130 | Ga0501033_0077789 | 3300049570 | Bacteria | 2434 |
| 1131 | Ga0501033_0087576 | 3300049570 | Bacteria | 2279 |
| 1132 | Ga0501033_0329421 | 3300049570 | Bacteria | 1072 |
| 1133 | Ga0501033_0561852 | 3300049570 | Bacteria | 785 |
| 1134 | Ga0501034_0009013 | 3300049571 | Bacteria | 10479 |
| 1135 | Ga0501034_0045501 | 3300049571 | Bacteria | 4434 |
| 1136 | Ga0501034_0046023 | 3300049571 | Bacteria | 4408 |
| 1137 | Ga0501034_0072791 | 3300049571 | Bacteria | 3445 |
| 1138 | Ga0501034_0215781 | 3300049571 | Bacteria | 1872 |
| 1139 | Ga0501034_0280847 | 3300049571 | Bacteria | 1604 |
| 1140 | Ga0501034_0296749 | 3300049571 | Bacteria | 1553 |
| 1141 | Ga0501034_0660737 | 3300049571 | Bacteria | 946 |
| 1142 | Ga0501034_0789867 | 3300049571 | Bacteria | 843 |
| 1143 | Ga0501034_1100999 | 3300049571 | Bacteria | 675 |
| 1144 | Ga0501034_1586763 | 3300049571 | Bacteria | 527 |
| 1145 | Ga0501036_0042790 | 3300049572 | Bacteria | 3834 |
| 1146 | Ga0501036_0156089 | 3300049572 | Bacteria | 1924 |
| 1147 | Ga0501036_0373840 | 3300049572 | Bacteria | 1190 |
| 1148 | Ga0501036_0761878 | 3300049572 | Bacteria | 798 |
| 1149 | Ga0501036_1036998 | 3300049572 | Bacteria | 671 |
| 1150 | Ga0501037_0038500 | 3300049573 | Bacteria | 3522 |
| 1151 | Ga0501037_0058098 | 3300049573 | Bacteria | 2823 |
| 1152 | Ga0501037_0067461 | 3300049573 | Bacteria | 2605 |
| 1153 | Ga0501037_0147819 | 3300049573 | Bacteria | 1680 |
| 1154 | Ga0501037_0215198 | 3300049573 | Bacteria | 1354 |
| 1155 | Ga0501037_0308671 | 3300049573 | Bacteria | 1097 |
| 1156 | Ga0501037_0610859 | 3300049573 | Bacteria | 731 |
| 1157 | Ga0501038_0046533 | 3300049574 | Bacteria | 3761 |
| 1158 | Ga0501038_0111161 | 3300049574 | Bacteria | 2270 |
| 1159 | Ga0501038_0149812 | 3300049574 | Bacteria | 1902 |
| 1160 | Ga0501038_0178958 | 3300049574 | Bacteria | 1712 |
| 1161 | Ga0501039_0094100 | 3300049575 | Bacteria | 2335 |
| 1162 | Ga0501039_0143242 | 3300049575 | Bacteria | 1878 |
| 1163 | Ga0501039_0220637 | 3300049575 | Bacteria | 1490 |
| 1164 | Ga0501039_1465325 | 3300049575 | Bacteria | 525 |
| 1165 | Ga0501040_0057060 | 3300049576 | Bacteria | 2680 |
| 1166 | Ga0501040_0104821 | 3300049576 | Bacteria | 1975 |
| 1167 | Ga0501042_0006352 | 3300049578 | Bacteria | 7666 |
| 1168 | Ga0501042_1104347 | 3300049578 | Bacteria | 578 |
| 1169 | Ga0501043_0032226 | 3300049579 | Bacteria | 4119 |
| 1170 | Ga0501043_0100195 | 3300049579 | Bacteria | 2277 |
| 1171 | Ga0501043_0374221 | 3300049579 | Bacteria | 1079 |
| 1172 | Ga0501043_0377711 | 3300049579 | Bacteria | 1073 |
| 1173 | Ga0501046_0079981 | 3300049580 | Bacteria | 2526 |
| 1174 | Ga0501046_0104265 | 3300049580 | Bacteria | 2173 |
| 1175 | Ga0501047_0005487 | 3300049581 | Bacteria | 11930 |
| 1176 | Ga0501047_0103854 | 3300049581 | Bacteria | 2722 |
| 1177 | Ga0501047_0322469 | 3300049581 | Bacteria | 1384 |
| 1178 | Ga0501047_0346110 | 3300049581 | Bacteria | 1323 |
| 1179 | Ga0501047_0511199 | 3300049581 | Bacteria | 1027 |
| 1180 | Ga0501047_0622027 | 3300049581 | Bacteria | 900 |
| 1181 | Ga0501048_0010499 | 3300049582 | Bacteria | 6911 |
| 1182 | Ga0501048_0644508 | 3300049582 | Bacteria | 761 |
| 1183 | Ga0501067_0001840 | 3300049583 | Bacteria | 11669 |
| 1184 | Ga0501067_0138882 | 3300049583 | Bacteria | 1353 |
| 1185 | Ga0501068_0031355 | 3300049584 | Bacteria | 3157 |
| 1186 | Ga0501068_0134851 | 3300049584 | Bacteria | 1545 |
| 1187 | Ga0501068_0679595 | 3300049584 | Bacteria | 673 |
| 1188 | Ga0501069_0192433 | 3300049585 | Bacteria | 1180 |
| 1189 | Ga0501069_0553027 | 3300049585 | Bacteria | 689 |
| 1190 | Ga0501069_0965278 | 3300049585 | Bacteria | 520 |
| 1191 | Ga0501070_0025506 | 3300049586 | Bacteria | 4958 |
| 1192 | Ga0501070_0219812 | 3300049586 | Bacteria | 1558 |
| 1193 | Ga0501071_0014068 | 3300049587 | Bacteria | 5468 |
| 1194 | Ga0501072_0184090 | 3300049588 | Bacteria | 1666 |
| 1195 | Ga0501072_0267299 | 3300049588 | Bacteria | 1361 |
| 1196 | Ga0501072_1024082 | 3300049588 | Bacteria | 643 |
| 1197 | Ga0501073_0023164 | 3300049589 | Bacteria | 4463 |
| 1198 | Ga0501073_0039588 | 3300049589 | Bacteria | 3338 |
| 1199 | Ga0501073_1281054 | 3300049589 | Bacteria | 502 |
| 1200 | Ga0501074_0026693 | 3300049590 | Bacteria | 4187 |
| 1201 | Ga0501074_0052758 | 3300049590 | Bacteria | 2934 |
| 1202 | Ga0501075_0433447 | 3300049591 | Bacteria | 1002 |
| 1203 | Ga0501076_0054065 | 3300049592 | Bacteria | 3182 |
| 1204 | Ga0501076_1252901 | 3300049592 | Bacteria | 610 |
| 1205 | Ga0501077_0028790 | 3300049593 | Bacteria | 3531 |
| 1206 | Ga0501077_0769530 | 3300049593 | Bacteria | 619 |
| 1207 | Ga0501198_084030 | 3300049649 | Bacteria | 621 |
| 1208 | Ga0501202_068220 | 3300049652 | Bacteria | 815 |
| 1209 | Ga0501209_090205 | 3300049656 | Bacteria | 891 |
| 1210 | Ga0501261_052301 | 3300049690 | Bacteria | 673 |
| 1211 | Ga0501234_067452 | 3300049707 | Bacteria | 614 |
| 1212 | Ga0501245_092165 | 3300049708 | Bacteria | 602 |
| 1213 | Ga0501079_0024576 | 3300049741 | Bacteria | 4623 |
| 1214 | Ga0501079_0126189 | 3300049741 | Bacteria | 1991 |
| 1215 | Ga0501079_0670703 | 3300049741 | Bacteria | 816 |
| 1216 | Ga0501080_0107267 | 3300049742 | Bacteria | 2588 |
| 1217 | Ga0501080_0137367 | 3300049742 | Bacteria | 2261 |
| 1218 | Ga0501080_0258855 | 3300049742 | Bacteria | 1586 |
| 1219 | Ga0501080_0871114 | 3300049742 | Bacteria | 786 |
| 1220 | Ga0501081_1036619 | 3300049743 | Bacteria | 620 |
| 1221 | Ga0501083_0006724 | 3300049744 | Bacteria | 8157 |
| 1222 | Ga0501083_0023858 | 3300049744 | Bacteria | 4242 |
| 1223 | Ga0501083_0493650 | 3300049744 | Bacteria | 797 |
| 1224 | Ga0501083_0604216 | 3300049744 | Bacteria | 714 |
| 1225 | Ga0501271_028555 | 3300049768 | Bacteria | 679 |
| 1226 | Ga0501035_0069162 | 3300049822 | Bacteria | 3130 |
| 1227 | Ga0501035_0143633 | 3300049822 | Bacteria | 2073 |
| 1228 | Ga0501035_0188785 | 3300049822 | Bacteria | 1772 |
| 1229 | Ga0501035_0274381 | 3300049822 | Bacteria | 1426 |
| 1230 | Ga0501035_0310484 | 3300049822 | Bacteria | 1327 |
| 1231 | Ga0501035_0584051 | 3300049822 | Bacteria | 912 |
| 1232 | Ga0501044_0047177 | 3300049823 | Bacteria | 4456 |
| 1233 | Ga0501044_0096645 | 3300049823 | Bacteria | 2975 |
| 1234 | Ga0501044_0163967 | 3300049823 | Bacteria | 2197 |
| 1235 | Ga0501044_0588757 | 3300049823 | Bacteria | 1006 |
| 1236 | Ga0501044_0984596 | 3300049823 | Bacteria | 715 |
| 1237 | Ga0501044_1040435 | 3300049823 | Bacteria | 689 |
| 1238 | Ga0501045_0484646 | 3300049824 | Bacteria | 919 |
| 1239 | Ga0501045_0496303 | 3300049824 | Bacteria | 906 |
| 1240 | Ga0501045_1397298 | 3300049824 | Bacteria | 508 |
| 1241 | nmdc:mga03683_30010_c1 | 3300050489 | Bacteria | 2173 |
| 1242 | nmdc:mga03683_55888_c1 | 3300050489 | Bacteria | 1328 |
| 1243 | nmdc:mga03683_57927_c1 | 3300050489 | Bacteria | 1632 |
| 1244 | nmdc:mga00v17_128506_c1 | 3300050491 | Bacteria | 1618 |
| 1245 | nmdc:mga00v17_158507_c1 | 3300050491 | Bacteria | 1456 |
| 1246 | nmdc:mga00v17_40128_c1 | 3300050491 | Bacteria | 2807 |
| 1247 | nmdc:mga0yw44_198666_c1 | 3300050492 | Bacteria | 1324 |
| 1248 | nmdc:mga0yw44_72574_c1 | 3300050492 | Bacteria | 2140 |
| 1249 | nmdc:mga0yw44_8112_c1 | 3300050492 | Bacteria | 5214 |
| 1250 | nmdc:mga0k408_107918_c1 | 3300050493 | Bacteria | 1644 |
| 1251 | nmdc:mga0k408_349325_c1 | 3300050493 | Bacteria | 882 |
| 1252 | nmdc:mga06z11_122918_c1 | 3300050494 | Bacteria | 1450 |
| 1253 | nmdc:mga06z11_65629_c1 | 3300050494 | Bacteria | 1905 |
| 1254 | nmdc:mga07m45_26736_c1 | 3300050496 | Bacteria | 3172 |
| 1255 | nmdc:mga07m45_313530_c1 | 3300050496 | Bacteria | 912 |
| 1256 | nmdc:mga05p37_109891_c1 | 3300050507 | Bacteria | 3392 |
| 1257 | nmdc:mga05p37_1141437_c1 | 3300050507 | Bacteria | 811 |
| 1258 | nmdc:mga09592_39027_c1 | 3300050508 | Bacteria | 3988 |
| 1259 | nmdc:mga06r32_11149_c1 | 3300050510 | Bacteria | 8095 |
| 1260 | nmdc:mga08y16_1002128_c1 | 3300050511 | Bacteria | 815 |
| 1261 | nmdc:mga08y16_1237329_c1 | 3300050511 | Bacteria | 716 |
| 1262 | nmdc:mga08y16_704116_c1 | 3300050511 | Bacteria | 1010 |
| 1263 | nmdc:mga0n895_260513_c1 | 3300050512 | Bacteria | 1760 |
| 1264 | nmdc:mga0n895_331977_c1 | 3300050512 | Bacteria | 1541 |
| 1265 | nmdc:mga0n895_5268_c1 | 3300050512 | Bacteria | 10768 |
| 1266 | nmdc:mga0rr50_53041_c1 | 3300050513 | Bacteria | 3016 |
| 1267 | nmdc:mga0rr50_97529_c2 | 3300050513 | Bacteria | 1849 |
| 1268 | nmdc:mga08x19_11254_c1 | 3300050514 | Bacteria | 5387 |
| 1269 | nmdc:mga08x19_816672_c1 | 3300050514 | Bacteria | 662 |
| 1270 | nmdc:mga0a205_44144_c1 | 3300050515 | Bacteria | 4297 |
| 1271 | Ga0495601_0112434 | 3300053077 | Bacteria | 1764 |
| 1272 | Ga0495601_0316895 | 3300053077 | Bacteria | 1015 |
| 1273 | Ga0495612_0089496 | 3300053078 | Bacteria | 1301 |
| 1274 | Ga0495612_0356432 | 3300053078 | Bacteria | 661 |
| 1275 | Ga0495612_0593509 | 3300053078 | Bacteria | 511 |
| 1276 | Ga0500635_0041067 | 3300053080 | Bacteria | 1545 |
| 1277 | Ga0500635_0116565 | 3300053080 | Bacteria | 996 |
| 1278 | Ga0495595_0116849 | 3300053084 | Bacteria | 1297 |
| 1279 | Ga0495619_0253113 | 3300053085 | Bacteria | 1220 |
| 1280 | Ga0495619_0321326 | 3300053085 | Bacteria | 1071 |
| 1281 | Ga0495619_0339923 | 3300053085 | Bacteria | 1039 |
| 1282 | Ga0495619_0705296 | 3300053085 | Bacteria | 686 |
| 1283 | Ga0500647_0175353 | 3300053091 | Bacteria | 987 |
| 1284 | Ga0500647_0233186 | 3300053091 | Bacteria | 817 |
| 1285 | Ga0500566_0000320 | 3300053094 | Bacteria | 25974 |
| 1286 | Ga0500566_0088640 | 3300053094 | Bacteria | 1712 |
| 1287 | Ga0500640_029114 | 3300053095 | Bacteria | 2413 |
| 1288 | Ga0500556_0004256 | 3300053104 | Bacteria | 4087 |
| 1289 | Ga0500558_109295 | 3300053106 | Bacteria | 1087 |
| 1290 | Ga0500562_009418 | 3300053108 | Bacteria | 2469 |
| 1291 | Ga0500572_001638 | 3300053111 | Bacteria | 5877 |
| 1292 | Ga0500572_015788 | 3300053111 | Bacteria | 1910 |
| 1293 | Ga0500591_079976 | 3300053115 | Bacteria | 1456 |
| 1294 | Ga0500608_083229 | 3300053122 | Bacteria | 1506 |
| 1295 | Ga0500614_057503 | 3300053123 | Bacteria | 1037 |
| 1296 | Ga0500614_280998 | 3300053123 | Bacteria | 521 |
| 1297 | Ga0500655_071954 | 3300053133 | Bacteria | 705 |
| 1298 | Ga0500559_0007811 | 3300053136 | Bacteria | 4724 |
| 1299 | Ga0500559_0012275 | 3300053136 | Bacteria | 3644 |
| 1300 | Ga0500559_0120340 | 3300053136 | Bacteria | 1220 |
| 1301 | Ga0500561_0200419 | 3300053137 | Bacteria | 631 |
| 1302 | Ga0500564_290061 | 3300053138 | Bacteria | 632 |
| 1303 | Ga0500568_0113847 | 3300053139 | Bacteria | 1010 |
| 1304 | Ga0500573_0006745 | 3300053140 | Bacteria | 6228 |
| 1305 | Ga0500585_223960 | 3300053144 | Bacteria | 613 |
| 1306 | Ga0500590_151829 | 3300053148 | Bacteria | 1043 |
| 1307 | Ga0500590_307903 | 3300053148 | Bacteria | 591 |
| 1308 | Ga0500603_021102 | 3300053150 | Bacteria | 1599 |
| 1309 | Ga0500603_027424 | 3300053150 | Bacteria | 1447 |
| 1310 | Ga0500603_030409 | 3300053150 | Bacteria | 1389 |
| 1311 | Ga0500616_0006596 | 3300053153 | Bacteria | 7567 |
| 1312 | Ga0500616_0048582 | 3300053153 | Bacteria | 2249 |
| 1313 | Ga0500619_208526 | 3300053154 | Bacteria | 654 |
| 1314 | Ga0500630_005936 | 3300053159 | Bacteria | 5975 |
| 1315 | Ga0500638_035746 | 3300053162 | Bacteria | 2408 |
| 1316 | Ga0500639_019780 | 3300053163 | Bacteria | 3551 |
| 1317 | Ga0500639_044490 | 3300053163 | Bacteria | 2324 |
| 1318 | Ga0500636_0067281 | 3300053177 | Bacteria | 2081 |
| 1319 | Ga0500636_0144725 | 3300053177 | Bacteria | 1311 |
| 1320 | Ga0500637_0072771 | 3300053178 | Bacteria | 1978 |
| 1321 | Ga0500637_0190508 | 3300053178 | Bacteria | 1172 |
| 1322 | Ga0500637_0215172 | 3300053178 | Bacteria | 1088 |
| 1323 | Ga0500576_041535 | 3300053725 | Bacteria | 2068 |
| 1324 | Ga0500657_147716 | 3300053728 | Bacteria | 879 |
| 1325 | Ga0500552_113454 | 3300053733 | Bacteria | 523 |
| 1326 | Ga0500596_003892 | 3300053735 | Bacteria | 2792 |
| 1327 | Ga0500596_007930 | 3300053735 | Bacteria | 1714 |
| 1328 | Ga0500596_051092 | 3300053735 | Bacteria | 676 |
| 1329 | Ga0500601_007073 | 3300053737 | Bacteria | 1241 |
| 1330 | Ga0500601_012157 | 3300053737 | Bacteria | 970 |
| 1331 | Ga0501084_0080043 | 3300054114 | Bacteria | 2739 |
| 1332 | Ga0501084_0424221 | 3300054114 | Bacteria | 1124 |
| 1333 | Ga0500661_118751 | 3300055283 | Bacteria | 510 |
| 1334 | Ga0590077_180360 | 3300059426 | Bacteria | 510 |
| 1335 | Ga0587093_049355 | 3300059478 | Bacteria | 660 |
| 1336 | Ga0587066_027970 | 3300059490 | Bacteria | 984 |
| 1337 | Ga0587070_023933 | 3300059491 | Bacteria | 1053 |
| 1338 | Ga0587073_0145918 | 3300059492 | Bacteria | 664 |
| 1339 | Ga0587073_0272404 | 3300059492 | Bacteria | 540 |
| 1340 | Ga0587080_108329 | 3300059503 | Bacteria | 603 |
| 1341 | Ga0587082_107359 | 3300059504 | Bacteria | 616 |
| 1342 | Ga0587082_120957 | 3300059504 | Bacteria | 591 |
| 1343 | Ga0587083_0169989 | 3300059505 | Bacteria | 603 |
| 1344 | Ga0587085_122805 | 3300059506 | Bacteria | 572 |
| 1345 | Ga0587086_029713 | 3300059507 | Bacteria | 797 |
| 1346 | Ga0587090_001023 | 3300059510 | Bacteria | 2677 |
| 1347 | Ga0587098_048040 | 3300059604 | Bacteria | 640 |
| 1348 | Ga0587106_013279 | 3300059605 | Bacteria | 1117 |
| 1349 | Ga0587106_108624 | 3300059605 | Bacteria | 575 |
| 1350 | Ga0587101_004242 | 3300059623 | Bacteria | 1520 |
| 1351 | Ga0587101_105964 | 3300059623 | Bacteria | 565 |
| 1352 | Ga0587101_106800 | 3300059623 | Bacteria | 563 |
| 1353 | Ga0587101_120350 | 3300059623 | Bacteria | 542 |
| 1354 | Ga0587109_103867 | 3300059624 | Bacteria | 656 |
| 1355 | Ga0587117_024481 | 3300059627 | Bacteria | 868 |
| 1356 | Ga0587067_174578 | 3300059640 | Bacteria | 556 |
| 1357 | Ga0587067_220962 | 3300059640 | Bacteria | 513 |
| 1358 | Ga0587069_083867 | 3300059642 | Bacteria | 626 |
| 1359 | Ga0587069_097416 | 3300059642 | Bacteria | 596 |
| 1360 | Ga0587072_023778 | 3300059643 | Bacteria | 1103 |
| 1361 | Ga0587079_074253 | 3300059647 | Bacteria | 765 |
| 1362 | Ga0587079_157835 | 3300059647 | Bacteria | 591 |
| 1363 | Ga0587107_024275 | 3300059652 | Bacteria | 873 |
| 1364 | Ga0587107_038016 | 3300059652 | Bacteria | 765 |
| 1365 | Ga0587107_051941 | 3300059652 | Bacteria | 698 |
| 1366 | Ga0587107_112242 | 3300059652 | Bacteria | 552 |
| 1367 | Ga0587107_112462 | 3300059652 | Bacteria | 552 |
| 1368 | Ga0587108_004748 | 3300059653 | Bacteria | 1003 |
| 1369 | Ga0587116_06220 | 3300059656 | Bacteria | 732 |
| 1370 | Ga0587119_036177 | 3300059658 | Bacteria | 693 |
| 1371 | Ga0501082_0171311 | 3300060353 | Bacteria | 1887 |
| 1372 | Ga0501082_0526106 | 3300060353 | Bacteria | 1034 |
| 1373 | Ga0501082_1408072 | 3300060353 | Bacteria | 609 |
| 1374 | Ga0466962_0243768 | 3300061719 | Bacteria | 882 |
| 1375 | Ga0466962_0487514 | 3300061719 | Bacteria | 623 |
| 1376 | Ga0530510_0050130 | 3300061734 | Bacteria | 3015 |
| 1377 | Ga0530510_0261262 | 3300061734 | Bacteria | 1291 |
| 1378 | Ga0530510_0473104 | 3300061734 | Bacteria | 949 |
| 1379 | 2508735863 | 2508501050 | Bacteria | 9633614 |
| 1380 | 2509149632 | 2508501128 | Bacteria | 8613869 |
| 1381 | 2512642897 | 2512564014 | Bacteria | 4639632 |
| 1382 | 2513678617 | 2513237098 | Bacteria | 9902361 |
| 1383 | 2513894229 | 2513237141 | Bacteria | 8496279 |
| 1384 | 2524469971 | 2524023210 | Bacteria | 9029266 |
| 1385 | 2596374054 | 2595698237 | Bacteria | 6712432 |
| 1386 | 2723846171 | 2721755755 | Bacteria | 8322773 |
| 1387 | 2738745705 | 2738541281 | Bacteria | 5112672 |
| 1388 | 2739354935 | 2738543032 | Bacteria | 5115625 |
| 1389 | 2753359575 | 2751185800 | Bacteria | 5467370 |
| 1390 | 2758641836 | 2758568016 | Bacteria | 5645291 |
| 1391 | 2765465535 | 2765235802 | Bacteria | 5618596 |
| 1392 | 2776259137 | 2775506901 | Bacteria | 9631051 |
| 1393 | 2778126625 | 2775507255 | Bacteria | 3945731 |
| 1394 | 2828310148 | 2828305725 | Bacteria | 4916900 |
| 1395 | 2829749930 | 2829745981 | Bacteria | 5406054 |
| 1396 | 2839995597 | 2839993093 | Bacteria | 5512535 |
| 1397 | 2840768016 | 2840764183 | Bacteria | 6358399 |
| 1398 | 2842701718 | 2842698319 | Bacteria | 5190321 |
| 1399 | 2861692149 | 2861691609 | Bacteria | 5628931 |
| 1400 | 2885384445 | 2885383462 | Bacteria | 9473874 |
| 1401 | 2889311569 | 2889306138 | Bacteria | 6358934 |
| 1402 | 2891050820 | 2891048133 | Bacteria | 4447501 |
| 1403 | 2894240768 | 2894232714 | Bacteria | 8834183 |
| 1404 | 2902334109 | 2902330777 | Bacteria | 6395352 |
| 1405 | 2902411804 | 2902405164 | Bacteria | 6784948 |
| 1406 | 2903770862 | 2903768456 | Bacteria | 9749579 |
| 1407 | 2904583234 | 2904578770 | Bacteria | 5302906 |
| 1408 | 2909043598 | 2909042592 | Bacteria | 6499737 |
| 1409 | 2919123882 | 2919119836 | Bacteria | 5208557 |
| 1410 | 2922361967 | 2922361189 | Bacteria | 7436256 |
| 1411 | 2922428989 | |||
| 1412 | 2928129945 | 2928125067 | Bacteria | 5937560 |
| 1413 | 2995397021 | 2995392953 | Bacteria | 4539380 |
| 1414 | 3002143950 | 3002141150 | Bacteria | 5254435 |
| 1415 | 3005512709 | 3005506211 | Bacteria | 6943378 |
| 1416 | 3005598068 | 3005594810 | Bacteria | 8716512 |
| 1417 | 8056684520 | 8056681323 | Bacteria | 8472857 |
| 1418 | Ga0070680_101512712 | |||
| 1419 | JGI24741J21665_1000040 | |||
| 1420 | JGI24747J21853_1041351 | |||
| 1421 | JGI24740J21852_10001488 | |||
| 1422 | JGI24740J21852_10127217 | |||
| 1423 | JGI24739J22299_10009835 | |||
| 1424 | JGI24739J22299_10122518 | |||
| 1425 | JGI24739J22299_10146276 | |||
| 1426 | JGI24737J22298_10002296 | |||
| 1427 | JGI24737J22298_10002957 | |||
| 1428 | JGI24743J22301_10019644 | |||
| 1429 | JGI24735J21928_10003641 | |||
| 1430 | JGI24750J21931_1006031 | |||
| 1431 | JGI24745J21846_1025676 | |||
| 1432 | JGI24738J21930_10001475 | |||
| 1433 | JGI24738J21930_10006269 | |||
| 1434 | JGI24749J21850_1030226 | |||
| 1435 | JGI24751J29686_10003449 | |||
| 1436 | JGI24751J29686_10015322 | |||
| 1437 | JGI25165J46597_1011340 | |||
| 1438 | JGI25153J46596_10082871 | |||
| 1439 | rootH2_10016380 | |||
| 1440 | JGI25404J52841_10035096 | |||
| 1441 | Ga0055539_1021913 | |||
| 1442 | JGI25405J52794_10006513 | |||
| 1443 | Ga0058863_11772060 | |||
| 1444 | Ga0058863_11874628 | |||
| 1445 | Ga0070658_10013737 | |||
| 1446 | Ga0070658_10018691 | |||
| 1447 | Ga0070658_10417429 | |||
| 1448 | Ga0070658_10993116 | |||
| 1449 | Ga0070676_10598008 | |||
| 1450 | Ga0070683_100014681 | |||
| 1451 | Ga0070683_101643452 | |||
| 1452 | Ga0070690_100007778 | |||
| 1453 | Ga0070670_100000376 | |||
| 1454 | Ga0070677_10080667 | |||
| 1455 | Ga0068869_100022833 | |||
| 1456 | Ga0070666_10004644 | |||
| 1457 | Ga0070680_100085545 | |||
| 1458 | Ga0070680_100098147 | |||
| 1459 | Ga0070680_100310121 | |||
| 1460 | Ga0070680_100664914 | |||
| 1461 | Ga0070680_101082953 | |||
| 1462 | Ga0070680_101587842 | |||
| 1463 | Ga0070682_100002069 | |||
| 1464 | Ga0070682_100463941 | |||
| 1465 | Ga0068868_100202434 | |||
| 1466 | Ga0070660_100000686 | |||
| 1467 | Ga0070660_100662344 | |||
| 1468 | Ga0070660_100839069 | |||
| 1469 | Ga0070660_101161486 | |||
| 1470 | Ga0070689_100000122 | |||
| 1471 | Ga0070691_10000490 | |||
| 1472 | Ga0070691_10862610 | |||
| 1473 | Ga0070687_100016035 | |||
| 1474 | Ga0070661_100000385 | |||
| 1475 | Ga0070661_100303958 | |||
| 1476 | Ga0070692_10001302 | |||
| 1477 | Ga0070668_100005991 | |||
| 1478 | Ga0070668_100088347 | |||
| 1479 | Ga0070668_100390585 | |||
| 1480 | Ga0070669_100002082 | |||
| 1481 | Ga0070675_100016237 | |||
| 1482 | Ga0070675_101384211 | |||
| 1483 | Ga0070671_100001283 | |||
| 1484 | Ga0070674_100000649 | |||
| 1485 | Ga0070674_100148607 | |||
| 1486 | Ga0070674_100607101 | |||
| 1487 | Ga0070673_100002163 | |||
| 1488 | Ga0070688_100000217 | |||
| 1489 | Ga0070688_101153306 | |||
| 1490 | Ga0070659_100003485 | |||
| 1491 | Ga0070659_100165834 | |||
| 1492 | Ga0070667_100003614 | |||
| 1493 | Ga0070667_102074007 | |||
| 1494 | Ga0070703_10015462 | |||
| 1495 | Ga0070709_10001232 | |||
| 1496 | Ga0070709_10002316 | |||
| 1497 | Ga0070709_10010455 | |||
| 1498 | Ga0070709_10022452 | |||
| 1499 | Ga0070709_10938746 | |||
| 1500 | Ga0070714_100009083 | |||
| 1501 | Ga0070714_100017244 | |||
| 1502 | Ga0070714_100025578 | |||
| 1503 | Ga0070714_100026711 | |||
| 1504 | Ga0070714_100142833 | |||
| 1505 | Ga0070714_100177932 | |||
| 1506 | Ga0070714_100207603 | |||
| 1507 | Ga0070714_100562434 | |||
| 1508 | Ga0070714_101608588 | |||
| 1509 | Ga0070713_100036694 | |||
| 1510 | Ga0070713_100056912 | |||
| 1511 | Ga0070713_100061311 | |||
| 1512 | Ga0070713_100095838 | |||
| 1513 | Ga0070713_100111867 | |||
| 1514 | Ga0070713_100610599 | |||
| 1515 | Ga0070713_100645737 | |||
| 1516 | Ga0070713_100734475 | |||
| 1517 | Ga0070713_101400825 | |||
| 1518 | Ga0070713_101869425 | |||
| 1519 | Ga0070710_10005644 | |||
| 1520 | Ga0070710_10019970 | |||
| 1521 | Ga0070710_10058672 | |||
| 1522 | Ga0070710_10186643 | |||
| 1523 | Ga0070710_10236423 | |||
| 1524 | Ga0070710_10318422 | |||
| 1525 | Ga0070710_10470708 | |||
| 1526 | Ga0070710_11123421 | |||
| 1527 | Ga0070701_10000897 | |||
| 1528 | Ga0070711_100000834 | |||
| 1529 | Ga0070711_100004304 | |||
| 1530 | Ga0070711_100009870 | |||
| 1531 | Ga0070711_100155124 | |||
| 1532 | Ga0070711_100159576 | |||
| 1533 | Ga0070711_100663258 | |||
| 1534 | Ga0070711_101839668 | |||
| 1535 | Ga0070705_100022646 | |||
| 1536 | Ga0070705_100266449 | |||
| 1537 | Ga0070700_100002377 | |||
| 1538 | Ga0070700_100217734 | |||
| 1539 | Ga0070700_100387488 | |||
| 1540 | Ga0070700_100845120 | |||
| 1541 | Ga0070700_101711775 | |||
| 1542 | Ga0070694_100000195 | |||
| 1543 | Ga0070663_100000352 | |||
| 1544 | Ga0070663_100074211 | |||
| 1545 | Ga0070663_100573677 | |||
| 1546 | Ga0070678_100001146 | |||
| 1547 | Ga0070678_100497827 | |||
| 1548 | Ga0070662_100000412 | |||
| 1549 | Ga0070662_100501700 | |||
| 1550 | Ga0070662_101006609 | |||
| 1551 | Ga0070662_101760863 | |||
| 1552 | Ga0070662_101984517 | |||
| 1553 | Ga0070681_10329459 | |||
| 1554 | Ga0070681_10715142 | |||
| 1555 | Ga0070681_11170398 | |||
| 1556 | Ga0070681_11611799 | |||
| 1557 | Ga0068867_100008499 | |||
| 1558 | Ga0068867_100077308 | |||
| 1559 | Ga0070685_10058987 | |||
| 1560 | Ga0070685_10665402 | |||
| 1561 | Ga0070707_100127155 | |||
| 1562 | Ga0070698_100118731 | |||
| 1563 | Ga0070698_100482324 | |||
| 1564 | Ga0070699_100160319 | |||
| 1565 | Ga0070679_100040109 | |||
| 1566 | Ga0070679_100288276 | |||
| 1567 | Ga0070684_100047080 | |||
| 1568 | Ga0070684_100061861 | |||
| 1569 | Ga0070684_100356712 | |||
| 1570 | Ga0070684_100886686 | |||
| 1571 | Ga0070684_100919194 | |||
| 1572 | Ga0070697_100000391 | |||
| 1573 | Ga0070697_100077313 | |||
| 1574 | Ga0070697_101553947 | |||
| 1575 | Ga0068853_100001082 | |||
| 1576 | Ga0068853_100345112 | |||
| 1577 | Ga0068853_101848518 | |||
| 1578 | Ga0070672_100035019 | |||
| 1579 | Ga0070686_100001391 | |||
| 1580 | Ga0070695_100000238 | |||
| 1581 | Ga0070695_100385596 | |||
| 1582 | Ga0070696_100000815 | |||
| 1583 | Ga0070696_100031634 | |||
| 1584 | Ga0070696_100523824 | |||
| 1585 | Ga0070693_100000455 | |||
| 1586 | Ga0070693_100579599 | |||
| 1587 | Ga0070693_100721973 | |||
| 1588 | Ga0070665_100022864 | |||
| 1589 | Ga0070665_100548593 | |||
| 1590 | Ga0070704_100000124 | |||
| 1591 | Ga0070704_100746471 | |||
| 1592 | Ga0068855_100002691 | |||
| 1593 | Ga0068855_100220819 | |||
| 1594 | Ga0068855_100351567 | |||
| 1595 | Ga0068855_100464716 | |||
| 1596 | Ga0068855_100722076 | |||
| 1597 | Ga0070664_100002450 | |||
| 1598 | Ga0070664_100013985 | |||
| 1599 | Ga0070664_100963839 | |||
| 1600 | Ga0070664_101879664 | |||
| 1601 | Ga0068857_100008457 | |||
| 1602 | Ga0068857_100149759 | |||
| 1603 | Ga0068857_101190118 | |||
| 1604 | Ga0068857_101263112 | |||
| 1605 | Ga0068854_100007856 | |||
| 1606 | Ga0068854_100405940 | |||
| 1607 | Ga0068854_100596484 | |||
| 1608 | Ga0068854_100770040 | |||
| 1609 | Ga0068854_101112579 | |||
| 1610 | Ga0068856_100001924 | |||
| 1611 | Ga0068856_100005122 | |||
| 1612 | Ga0068856_101512037 | |||
| 1613 | Ga0070702_100000018 | |||
| 1614 | Ga0070702_100315096 | |||
| 1615 | Ga0070702_100375110 | |||
| 1616 | Ga0068852_100010938 | |||
| 1617 | Ga0068852_100225709 | |||
| 1618 | Ga0068852_100271636 | |||
| 1619 | Ga0068859_100131708 | |||
| 1620 | Ga0068859_100254511 | |||
| 1621 | Ga0068859_101714941 | |||
| 1622 | Ga0068864_100002243 | |||
| 1623 | Ga0068864_100847013 | |||
| 1624 | Ga0068864_101603329 | |||
| 1625 | Ga0068866_10001983 | |||
| 1626 | Ga0068866_10472774 | |||
| 1627 | Ga0068866_10579931 | |||
| 1628 | Ga0068861_100000942 | |||
| 1629 | Ga0068851_10055130 | |||
| 1630 | Ga0068851_10281205 | |||
| 1631 | Ga0068870_10379278 | |||
| 1632 | Ga0068863_100007838 | |||
| 1633 | Ga0068863_100237421 | |||
| 1634 | Ga0068858_100019589 | |||
| 1635 | Ga0068858_100270677 | |||
| 1636 | Ga0068860_100000598 | |||
| 1637 | Ga0068860_100088076 | |||
| 1638 | Ga0068862_100008039 | |||
| 1639 | Ga0068862_100688014 | |||
| 1640 | Ga0081455_10021909 | |||
| 1641 | Ga0081455_10288863 | |||
| 1642 | Ga0081538_10006855 | |||
| 1643 | Ga0081538_10029536 | |||
| 1644 | Ga0081540_1015691 | |||
| 1645 | Ga0081540_1017063 | |||
| 1646 | Ga0081540_1053318 | |||
| 1647 | Ga0081540_1065878 | |||
| 1648 | Ga0070717_10003669 | |||
| 1649 | Ga0070717_10027908 | |||
| 1650 | Ga0070717_10102080 | |||
| 1651 | Ga0070717_10381156 | |||
| 1652 | Ga0075365_10013851 | |||
| 1653 | Ga0075365_10452214 | |||
| 1654 | Ga0075365_10749770 | |||
| 1655 | Ga0075368_10218801 | |||
| 1656 | Ga0075368_10282307 | |||
| 1657 | Ga0075363_100113521 | |||
| 1658 | Ga0075364_10052785 | |||
| 1659 | Ga0075364_10057357 | |||
| 1660 | Ga0075364_10095261 | |||
| 1661 | Ga0075364_10220551 | |||
| 1662 | Ga0070715_10001643 | |||
| 1663 | Ga0070715_10312847 | |||
| 1664 | Ga0070715_10321955 | |||
| 1665 | Ga0070716_100001603 | |||
| 1666 | Ga0070716_100026432 | |||
| 1667 | Ga0070716_100079986 | |||
| 1668 | Ga0070716_100226032 | |||
| 1669 | Ga0070716_100397026 | |||
| 1670 | Ga0070716_100477478 | |||
| 1671 | Ga0070716_101460067 | |||
| 1672 | Ga0070712_100027843 | |||
| 1673 | Ga0070712_100052247 | |||
| 1674 | Ga0070712_100058664 | |||
| 1675 | Ga0070712_100058938 | |||
| 1676 | Ga0070712_100201784 | |||
| 1677 | Ga0070712_100412647 | |||
| 1678 | Ga0070712_100515983 | |||
| 1679 | Ga0070712_101410515 | |||
| 1680 | Ga0075362_10035975 | |||
| 1681 | Ga0075362_10049062 | |||
| 1682 | Ga0075362_10101966 | |||
| 1683 | Ga0075367_10111670 | |||
| 1684 | Ga0075367_10134243 | |||
| 1685 | Ga0075366_10359251 | |||
| 1686 | Ga0075366_10627287 | |||
| 1687 | Ga0097621_100107158 | |||
| 1688 | Ga0097621_100165361 | |||
| 1689 | Ga0097621_102073454 | |||
| 1690 | Ga0075370_10243707 | |||
| 1691 | Ga0068871_100022307 | |||
| 1692 | Ga0068871_100286866 | |||
| 1693 | Ga0068871_100486469 | |||
| 1694 | Ga0068871_100682814 | |||
| 1695 | Ga0075428_100054274 | |||
| 1696 | Ga0075428_100237574 | |||
| 1697 | Ga0075428_101096435 | |||
| 1698 | Ga0075430_100103604 | |||
| 1699 | Ga0075431_100003503 | |||
| 1700 | Ga0075433_10023032 | |||
| 1701 | Ga0075434_100025071 | |||
| 1702 | Ga0075434_100036662 | |||
| 1703 | Ga0075434_100215192 | |||
| 1704 | Ga0075434_102159013 | |||
| 1705 | Ga0075434_102196873 | |||
| 1706 | Ga0075429_100024809 | |||
| 1707 | Ga0075429_101174029 | |||
| 1708 | Ga0068865_100096538 | |||
| 1709 | Ga0068865_101186464 | |||
| 1710 | Ga0075436_100008941 | |||
| 1711 | Ga0097620_100131716 | |||
| 1712 | Ga0097620_100254508 | |||
| 1713 | Ga0097620_101715029 | |||
| 1714 | Ga0075435_100085522 | |||
| 1715 | Ga0075435_100102268 | |||
| 1716 | Ga0075435_100897708 | |||
| 1717 | Ga0099795_10003174 | |||
| 1718 | Ga0105251_10110631 | |||
| 1719 | Ga0105250_10008602 | |||
| 1720 | Ga0105250_10188339 | |||
| 1721 | Ga0105240_10230206 | |||
| 1722 | Ga0105240_10263935 | |||
| 1723 | Ga0105240_10304110 | |||
| 1724 | Ga0105240_10504075 | |||
| 1725 | Ga0105240_11509248 | |||
| 1726 | Ga0111539_10100865 | |||
| 1727 | Ga0111539_10428106 | |||
| 1728 | Ga0111539_10658944 | |||
| 1729 | Ga0105245_10000718 | |||
| 1730 | Ga0105247_10001104 | |||
| 1731 | Ga0105247_10035209 | |||
| 1732 | Ga0105247_10603522 | |||
| 1733 | Ga0114129_10401684 | |||
| 1734 | Ga0114129_11726057 | |||
| 1735 | Ga0114129_12202468 | |||
| 1736 | Ga0105243_10001752 | |||
| 1737 | Ga0105243_10362714 | |||
| 1738 | Ga0105241_10001866 | |||
| 1739 | Ga0105241_10088557 | |||
| 1740 | Ga0105241_10177796 | |||
| 1741 | Ga0105241_10256780 | |||
| 1742 | Ga0105242_10010515 | |||
| 1743 | Ga0105242_11411010 | |||
| 1744 | Ga0105242_11845975 | |||
| 1745 | Ga0105248_10002832 | |||
| 1746 | Ga0105237_10001618 | |||
| 1747 | Ga0105237_10394223 | |||
| 1748 | Ga0105237_10757616 | |||
| 1749 | Ga0105237_10997033 | |||
| 1750 | Ga0105237_11842462 | |||
| 1751 | Ga0105238_10007984 | |||
| 1752 | Ga0105238_10437534 | |||
| 1753 | Ga0105238_10718602 | |||
| 1754 | Ga0105249_10000814 | |||
| 1755 | Ga0105249_10354541 | |||
| 1756 | Ga0105249_10378887 | |||
| 1757 | Ga0105249_10713244 | |||
| 1758 | Ga0099796_10002269 | |||
| 1759 | Ga0105239_10120316 | |||
| 1760 | Ga0105239_10143574 | |||
| 1761 | Ga0105239_10239229 | |||
| 1762 | Ga0105239_10296034 | |||
| 1763 | Ga0105239_10601978 | |||
| 1764 | Ga0105239_12790328 | |||
| 1765 | Ga0105239_12945183 | |||
| 1766 | Ga0105246_10002439 | |||
| 1767 | Ga0105246_10045899 | |||
| 1768 | Ga0105246_10120687 | |||
| 1769 | Ga0105246_10630391 | |||
| 1770 | Ga0105246_12574566 | |||
| 1771 | Ga0157327_1033127 | |||
| 1772 | Ga0157373_10019849 | |||
| 1773 | Ga0157373_10027237 | |||
| 1774 | Ga0157373_11308834 | |||
| 1775 | Ga0157371_10056437 | |||
| 1776 | Ga0157371_10347917 | |||
| 1777 | Ga0157371_10638770 | |||
| 1778 | Ga0157370_10017001 | |||
| 1779 | Ga0157370_10461414 | |||
| 1780 | Ga0157370_10555656 | |||
| 1781 | Ga0157369_10164535 | |||
| 1782 | Ga0157369_10197436 | |||
| 1783 | Ga0157369_10312994 | |||
| 1784 | Ga0157369_10765468 | |||
| 1785 | Ga0157369_11138607 | |||
| 1786 | Ga0157369_11463227 | |||
| 1787 | Ga0157369_12136507 | |||
| 1788 | Ga0157374_10012339 | |||
| 1789 | Ga0157374_11221540 | |||
| 1790 | Ga0157378_10000470 | |||
| 1791 | Ga0157378_11432213 | |||
| 1792 | Ga0163162_10004532 | |||
| 1793 | Ga0163162_11073919 | |||
| 1794 | Ga0163162_11470543 | |||
| 1795 | Ga0163162_12543142 | |||
| 1796 | Ga0163162_12605215 | |||
| 1797 | Ga0157372_10001215 | |||
| 1798 | Ga0157372_10297910 | |||
| 1799 | Ga0157372_11055098 | |||
| 1800 | Ga0157372_11378347 | |||
| 1801 | Ga0157372_11623209 | |||
| 1802 | Ga0157372_12129590 | |||
| 1803 | Ga0157375_10012604 | |||
| 1804 | Ga0157375_11913853 | |||
| 1805 | Ga0157375_13287897 | |||
| 1806 | Ga0163163_10002129 | |||
| 1807 | Ga0163163_10005311 | |||
| 1808 | Ga0163163_12084633 | |||
| 1809 | Ga0157380_10008515 | |||
| 1810 | Ga0157380_10027055 | |||
| 1811 | Ga0157380_11594359 | |||
| 1812 | Ga0182008_10222662 | |||
| 1813 | Ga0182008_10365970 | |||
| 1814 | Ga0157377_10006965 | |||
| 1815 | Ga0157379_10001927 | |||
| 1816 | Ga0157379_10552180 | |||
| 1817 | Ga0157379_11730006 | |||
| 1818 | Ga0157376_10000606 | |||
| 1819 | Ga0157376_10743776 | |||
| 1820 | Ga0163161_10002394 | |||
| 1821 | Ga0163161_10573970 | |||
| 1822 | Ga0206356_11853575 | |||
| 1823 | Ga0206349_1277602 | |||
| 1824 | Ga0206355_1403799 | |||
| 1825 | Ga0206352_10097269 | |||
| 1826 | Ga0206352_11227367 | |||
| 1827 | Ga0206350_10960778 | |||
| 1828 | Ga0206353_10857624 | |||
| 1829 | Ga0154015_1108290 | |||
| 1830 | Ga0154015_1214890 | |||
| 1831 | Ga0213873_10106683 | |||
| 1832 | Ga0213873_10313968 | |||
| 1833 | Ga0213872_10023323 | |||
| 1834 | Ga0213872_10307143 | |||
| 1835 | Ga0213874_10001821 | |||
| 1836 | Ga0213874_10009960 | |||
| 1837 | Ga0213874_10010979 | |||
| 1838 | Ga0213874_10220157 | |||
| 1839 | Ga0213874_10264446 | |||
| 1840 | Ga0213874_10275691 | |||
| 1841 | Ga0213874_10354152 | |||
| 1842 | Ga0213876_10002961 | |||
| 1843 | Ga0213876_10004772 | |||
| 1844 | Ga0213875_10000089 | |||
| 1845 | Ga0213875_10059627 | |||
| 1846 | Ga0213871_10016747 | |||
| 1847 | Ga0213871_10155626 | |||
| 1848 | Ga0224712_10002117 | |||
| 1849 | Ga0224712_10050101 | |||
| 1850 | Ga0256714_113971 | |||
| 1851 | Ga0256744_130108 | |||
| 1852 | Ga0256743_128847 | |||
| 1853 | Ga0256720_139806 | |||
| 1854 | Ga0209677_100816 | |||
| 1855 | Ga0209148_1004162 | |||
| 1856 | Ga0209148_1008955 | |||
| 1857 | Ga0209233_1003250 | |||
| 1858 | Ga0209455_1009081 | |||
| 1859 | Ga0209455_1038588 | |||
| 1860 | Ga0209758_1040129 | |||
| 1861 | Ga0207697_10057185 | |||
| 1862 | Ga0207656_10012084 | |||
| 1863 | Ga0207656_10173122 | |||
| 1864 | Ga0207696_1128942 | |||
| 1865 | Ga0207713_1157248 | |||
| 1866 | Ga0207653_10032934 | |||
| 1867 | Ga0207682_10132490 | |||
| 1868 | Ga0207692_10002601 | |||
| 1869 | Ga0207692_10039674 | |||
| 1870 | Ga0207692_10075631 | |||
| 1871 | Ga0207642_10091188 | |||
| 1872 | Ga0207642_10845179 | |||
| 1873 | Ga0207710_10003497 | |||
| 1874 | Ga0207688_10002614 | |||
| 1875 | Ga0207688_10044664 | |||
| 1876 | Ga0207680_10006344 | |||
| 1877 | Ga0207647_10001956 | |||
| 1878 | Ga0207647_10027406 | |||
| 1879 | Ga0207685_10005152 | |||
| 1880 | Ga0207685_10019197 | |||
| 1881 | Ga0207685_10075667 | |||
| 1882 | Ga0207685_10103277 | |||
| 1883 | Ga0207685_10228851 | |||
| 1884 | Ga0207699_10000692 | |||
| 1885 | Ga0207699_10008214 | |||
| 1886 | Ga0207699_10028433 | |||
| 1887 | Ga0207699_10062019 | |||
| 1888 | Ga0207699_10421039 | |||
| 1889 | Ga0207699_10731373 | |||
| 1890 | Ga0207699_11028083 | |||
| 1891 | Ga0207699_11057182 | |||
| 1892 | Ga0207643_10116032 | |||
| 1893 | Ga0207705_10093610 | |||
| 1894 | Ga0207705_10244702 | |||
| 1895 | Ga0207705_10348126 | |||
| 1896 | Ga0207705_10933880 | |||
| 1897 | Ga0207705_11096131 | |||
| 1898 | Ga0207654_10003285 | |||
| 1899 | Ga0207654_10185216 | |||
| 1900 | Ga0207654_10534960 | |||
| 1901 | Ga0207707_10074687 | |||
| 1902 | Ga0207707_10298153 | |||
| 1903 | Ga0207707_10734408 | |||
| 1904 | Ga0207695_10056587 | |||
| 1905 | Ga0207695_10104513 | |||
| 1906 | Ga0207695_10228101 | |||
| 1907 | Ga0207695_10284481 | |||
| 1908 | Ga0207695_10930390 | |||
| 1909 | Ga0207671_10057494 | |||
| 1910 | Ga0207671_10120775 | |||
| 1911 | Ga0207671_10332555 | |||
| 1912 | Ga0207671_10659429 | |||
| 1913 | Ga0207693_10000493 | |||
| 1914 | Ga0207693_10008270 | |||
| 1915 | Ga0207693_10030071 | |||
| 1916 | Ga0207693_10059279 | |||
| 1917 | Ga0207693_10112539 | |||
| 1918 | Ga0207693_10159520 | |||
| 1919 | Ga0207693_10635016 | |||
| 1920 | Ga0207693_10705887 | |||
| 1921 | Ga0207693_11179653 | |||
| 1922 | Ga0207663_10001067 | |||
| 1923 | Ga0207663_10012076 | |||
| 1924 | Ga0207663_10466318 | |||
| 1925 | Ga0207663_10961543 | |||
| 1926 | Ga0207663_10967373 | |||
| 1927 | Ga0207660_10644243 | |||
| 1928 | Ga0207660_11115557 | |||
| 1929 | Ga0207660_11293772 | |||
| 1930 | Ga0207662_10002067 | |||
| 1931 | Ga0207657_10000282 | |||
| 1932 | Ga0207657_10051869 | |||
| 1933 | Ga0207657_10620448 | |||
| 1934 | Ga0207657_11124284 | |||
| 1935 | Ga0207649_10017750 | |||
| 1936 | Ga0207649_10239309 | |||
| 1937 | Ga0207652_10104736 | |||
| 1938 | Ga0207652_10179342 | |||
| 1939 | Ga0207652_10298273 | |||
| 1940 | Ga0207646_10920567 | |||
| 1941 | Ga0207646_10983489 | |||
| 1942 | Ga0207681_10015153 | |||
| 1943 | Ga0207694_10006423 | |||
| 1944 | Ga0207694_10137335 | |||
| 1945 | Ga0207694_10234115 | |||
| 1946 | Ga0207650_10069986 | |||
| 1947 | Ga0207659_10005250 | |||
| 1948 | Ga0207659_11051182 | |||
| 1949 | Ga0207687_10008551 | |||
| 1950 | Ga0207700_10014261 | |||
| 1951 | Ga0207700_10071645 | |||
| 1952 | Ga0207700_10104591 | |||
| 1953 | Ga0207700_10574500 | |||
| 1954 | Ga0207700_10580562 | |||
| 1955 | Ga0207700_10669401 | |||
| 1956 | Ga0207700_10929541 | |||
| 1957 | Ga0207700_11315927 | |||
| 1958 | Ga0207700_11901970 | |||
| 1959 | Ga0207664_10012756 | |||
| 1960 | Ga0207664_10023422 | |||
| 1961 | Ga0207664_10054900 | |||
| 1962 | Ga0207664_10086181 | |||
| 1963 | Ga0207664_10125208 | |||
| 1964 | Ga0207664_10303495 | |||
| 1965 | Ga0207664_10503883 | |||
| 1966 | Ga0207644_10048201 | |||
| 1967 | Ga0207690_10003444 | |||
| 1968 | Ga0207690_10019766 | |||
| 1969 | Ga0207706_10000270 | |||
| 1970 | Ga0207706_10008316 | |||
| 1971 | Ga0207706_10200935 | |||
| 1972 | Ga0207706_10302615 | |||
| 1973 | Ga0207709_10048849 | |||
| 1974 | Ga0207709_10120230 | |||
| 1975 | Ga0207709_11104993 | |||
| 1976 | Ga0207670_10092363 | |||
| 1977 | Ga0207669_10002208 | |||
| 1978 | Ga0207669_10129680 | |||
| 1979 | Ga0207669_10292009 | |||
| 1980 | Ga0207704_10395404 | |||
| 1981 | Ga0207704_11004593 | |||
| 1982 | Ga0207665_10001538 | |||
| 1983 | Ga0207665_10010112 | |||
| 1984 | Ga0207665_10070979 | |||
| 1985 | Ga0207665_10103792 | |||
| 1986 | Ga0207665_10368058 | |||
| 1987 | Ga0207665_10501814 | |||
| 1988 | Ga0207665_10578776 | |||
| 1989 | Ga0207665_11010106 | |||
| 1990 | Ga0207691_10053192 | |||
| 1991 | Ga0207711_10137545 | |||
| 1992 | Ga0207711_10543545 | |||
| 1993 | Ga0207689_10885848 | |||
| 1994 | Ga0207661_10025741 | |||
| 1995 | Ga0207661_10050770 | |||
| 1996 | Ga0207661_10148369 | |||
| 1997 | Ga0207661_10847999 | |||
| 1998 | Ga0207661_12008276 | |||
| 1999 | Ga0207679_10004166 | |||
| 2000 | Ga0207679_10371865 | |||
| 2001 | Ga0207679_10841364 | |||
| 2002 | Ga0207667_10011595 | |||
| 2003 | Ga0207667_10186152 | |||
| 2004 | Ga0207667_10309951 | |||
| 2005 | Ga0207651_10004358 | |||
| 2006 | Ga0207712_10047767 | |||
| 2007 | Ga0207712_10738205 | |||
| 2008 | Ga0207668_10006213 | |||
| 2009 | Ga0207668_10039960 | |||
| 2010 | Ga0207668_11612398 | |||
| 2011 | Ga0207640_10002653 | |||
| 2012 | Ga0207640_10003639 | |||
| 2013 | Ga0207640_10209176 | |||
| 2014 | Ga0207658_10023872 | |||
| 2015 | Ga0207658_11557595 | |||
| 2016 | Ga0207677_10103809 | |||
| 2017 | Ga0207677_11197635 | |||
| 2018 | Ga0207703_10433391 | |||
| 2019 | Ga0207703_10688729 | |||
| 2020 | Ga0207703_10776479 | |||
| 2021 | Ga0207639_10000784 | |||
| 2022 | Ga0207639_10017244 | |||
| 2023 | Ga0207678_10000159 | |||
| 2024 | Ga0207678_10000477 | |||
| 2025 | Ga0207678_10476999 | |||
| 2026 | Ga0207708_10000337 | |||
| 2027 | Ga0207708_10282110 | |||
| 2028 | Ga0207708_10441466 | |||
| 2029 | Ga0207702_10007687 | |||
| 2030 | Ga0207702_10046306 | |||
| 2031 | Ga0207702_10458876 | |||
| 2032 | Ga0207641_10017486 | |||
| 2033 | Ga0207641_11062543 | |||
| 2034 | Ga0207648_10102108 | |||
| 2035 | Ga0207648_10363858 | |||
| 2036 | Ga0207676_10825727 | |||
| 2037 | Ga0207674_10018829 | |||
| 2038 | Ga0207674_10030575 | |||
| 2039 | Ga0207674_10621991 | |||
| 2040 | Ga0207675_100001292 | |||
| 2041 | Ga0207675_100149393 | |||
| 2042 | Ga0207675_101393715 | |||
| 2043 | Ga0207683_10001738 | |||
| 2044 | Ga0207683_10353704 | |||
| 2045 | Ga0207683_10966376 | |||
| 2046 | Ga0207683_11094234 | |||
| 2047 | Ga0207698_10021538 | |||
| 2048 | Ga0207698_10768882 | |||
| 2049 | Ga0207698_11455564 | |||
| 2050 | Ga0209179_1003967 | |||
| 2051 | Ga0209966_1085348 | |||
| 2052 | Ga0209998_10038761 | |||
| 2053 | Ga0209998_10125883 | |||
| 2054 | Ga0207428_10008303 | |||
| 2055 | Ga0207428_10670860 | |||
| 2056 | Ga0268266_10206194 | |||
| 2057 | Ga0268266_10630747 | |||
| 2058 | Ga0268265_10612294 | |||
| 2059 | Ga0268264_10000377 | |||
| 2060 | Ga0268264_10015446 | |||
| 2061 | Ga0268264_10910854 | |||
| 2062 | Ga0307515_10248135 | |||
| 2063 | Ga0311000_100475 | |||
| 2064 | Ga0311004_113545 | |||
| 2065 | Ga0311001_1079354 | |||
| 2066 | Ga0310981_1002449 | |||
| 2067 | Ga0307511_10057801 | |||
| 2068 | Ga0265340_10045595 | |||
| 2069 | Ga0265339_10011362 | |||
| 2070 | Ga0265327_10069811 | |||
| 2071 | Ga0307513_10340634 | |||
| 2072 | Ga0307509_10276688 | |||
| 2073 | Ga0307408_100016009 | |||
| 2074 | Ga0307408_100092650 | |||
| 2075 | Ga0307408_100395387 | |||
| 2076 | Ga0307408_100681236 | |||
| 2077 | Ga0307408_102164597 | |||
| 2078 | Ga0307508_10000378 | |||
| 2079 | Ga0307508_10014201 | |||
| 2080 | Ga0310105_121407 | |||
| 2081 | Ga0316579_10240025 | |||
| 2082 | Ga0265314_10636688 | |||
| 2083 | Ga0316576_10978254 | |||
| 2084 | Ga0307516_10019779 | |||
| 2085 | Ga0307405_10020264 | |||
| 2086 | Ga0307405_10610613 | |||
| 2087 | Ga0307405_10828608 | |||
| 2088 | Ga0307405_11844834 | |||
| 2089 | Ga0316577_10382766 | |||
| 2090 | Ga0307413_11016513 | |||
| 2091 | Ga0307410_10088334 | |||
| 2092 | Ga0307410_10159678 | |||
| 2093 | Ga0307410_10384358 | |||
| 2094 | Ga0307410_10678337 | |||
| 2095 | Ga0307410_11601175 | |||
| 2096 | Ga0307410_11820968 | |||
| 2097 | Ga0326468_10002343 | |||
| 2098 | Ga0307406_10173110 | |||
| 2099 | Ga0307406_10326285 | |||
| 2100 | Ga0307406_10608954 | |||
| 2101 | Ga0307406_10802626 | |||
| 2102 | Ga0307407_10126458 | |||
| 2103 | Ga0307407_10545266 | |||
| 2104 | Ga0307412_10001095 | |||
| 2105 | Ga0307412_10102836 | |||
| 2106 | Ga0307412_11036061 | |||
| 2107 | Ga0307409_100004876 | |||
| 2108 | Ga0307409_100837912 | |||
| 2109 | Ga0307409_101915378 | |||
| 2110 | Ga0307416_100036609 | |||
| 2111 | Ga0307416_100057739 | |||
| 2112 | Ga0307416_100419408 | |||
| 2113 | Ga0307416_100824435 | |||
| 2114 | Ga0307414_10054953 | |||
| 2115 | Ga0307411_10077414 | |||
| 2116 | Ga0307411_10528563 | |||
| 2117 | Ga0307411_11376330 | |||
| 2118 | Ga0307415_100292801 | |||
| 2119 | Ga0307415_101649487 | |||
| 2120 | Ga0316583_10263990 | |||
| 2121 | Ga0307507_10070872 | |||
| 2122 | Ga0307510_10243235 | |||
| 2123 | Ga0316596_1037368 | |||
| 2124 | Ga0316215_1002459 | |||
| 2125 | Ga0373950_0005337 | |||
| 2126 | Ga0373958_0005093 | |||
| 2127 | Ga0373959_0030593 | |||
| 2128 | Ga0373938_0003982 | |||
| 2129 | Ga0373926_0003147 | |||
| 2130 | Ga0373926_0005778 | |||
| 2131 | Ga0373928_0006912 | |||
| 2132 | Ga0373940_0072756 | |||
| 2133 | Ga0373944_0445889 | |||
| 2134 | Ga0373949_0011140 | |||
| 2135 | Ga0373952_0016138 | |||
| 2136 | Ga0373932_0062532 | |||
| 2137 | Ga0373936_0010464 | |||
| 2138 | Ga0373936_0015906 | |||
| 2139 | Ga0373936_0341737 | |||
| 2140 | Ga0373939_0010461 | |||
| 2141 | Ga0373941_0044026 | |||
| 2142 | Ga0373945_0012687 | |||
| 2143 | Ga0373945_0171395 | |||
| 2144 | Ga0373953_0099066 | |||
| 2145 | Ga0373953_0106539 | |||
| 2146 | Ga0373954_0006766 | |||
| 2147 | Ga0373956_0012723 | |||
| 2148 | Ga0373957_0106937 | |||
| 2149 | Ga0373957_0168239 | |||
| 2150 | Ga0373960_0001622 | |||
| 2151 | Ga0373943_0010548 | |||
| 2152 | Ga0373943_0017321 | |||
| 2153 | Ga0373943_0124534 | |||
| 2154 | Ga0373946_0019180 | |||
| 2155 | Ga0373946_0359825 | |||
| 2156 | Ga0373955_0020793 | |||
| 2157 | Ga0373955_0126635 | |||
| 2158 | Ga0373942_0152487 | |||
| 2159 | Ga0373962_0126509 | |||
| 2160 | Ga0373924_0014731 | |||
| 2161 | Ga0373924_0201528 | |||
| 2162 | Ga0373931_0030144 | |||
| 2163 | Ga0373931_0062360 | |||
| 2164 | Ga0373931_0823862 | |||
| 2165 | Ga0373935_0012257 | |||
| 2166 | Ga0373935_0053250 | |||
| 2167 | Ga0373935_0286934 | |||
| 2168 | Ga0373927_0004904 | |||
| 2169 | Ga0373927_0222869 | |||
| 2170 | Ga0373927_0333387 | |||
| 2171 | Ga0373933_0010736 | |||
| 2172 | Ga0373933_0196707 | |||
| 2173 | Ga0373933_0875935 | |||
| 2174 | Ga0373947_0009798 | |||
| 2175 | Ga0373947_0034111 | |||
| 2176 | Ga0373947_0398099 | |||
| 2177 | Ga0373947_0871454 | |||
| 2178 | Ga0310104_00193 | |||
| 2179 | Ga0373937_0031089 | |||
| 2180 | Ga0373937_0050692 | |||
| 2181 | Ga0373937_0425070 | |||
| 2182 | Ga0316582_0181961 | |||
| 2183 | Ga0373925_0024722 | |||
| 2184 | Ga0373925_0039116 | |||
| 2185 | Ga0373925_0586461 | |||
| 2186 | Ga0373925_0685520 | |||
| 2187 | Ga0395899_0072585 | |||
| 2188 | Ga0395899_0204290 | |||
| 2189 | Ga0395899_0701927 | |||
| 2190 | Ga0395900_0238023 | |||
| 2191 | Ga0395900_0343977 | |||
| 2192 | Ga0395900_0369151 | |||
| 2193 | Ga0395900_0493002 | |||
| 2194 | Ga0395898_0007760 | |||
| 2195 | Ga0395898_0055115 | |||
| 2196 | Ga0395898_0064043 | |||
| 2197 | Ga0395898_0294093 | |||
| 2198 | Ga0395898_0917040 | |||
| 2199 | Ga0395898_1122328 | |||
| 2200 | Ga0395905_0002506 | |||
| 2201 | Ga0395905_0112513 | |||
| 2202 | Ga0395905_0217669 | |||
| 2203 | Ga0436364_0089033 | |||
| 2204 | Ga0436364_0333324 | |||
| 2205 | Ga0436364_0335675 | |||
| 2206 | Ga0436364_0508030 | |||
| 2207 | Ga0436364_0554121 | |||
| 2208 | Ga0436364_1191222 | |||
| 2209 | Ga0436364_1352603 | |||
| 2210 | Ga0395901_0002674 | |||
| 2211 | Ga0395901_0132044 | |||
| 2212 | Ga0395901_0318811 | |||
| 2213 | Ga0395901_0408662 | |||
| 2214 | Ga0395901_0637417 | |||
| 2215 | Ga0395901_1012464 | |||
| 2216 | Ga0242420_011095 | |||
| 2217 | Ga0436365_0368899 | |||
| 2218 | Ga0436365_0870893 | |||
| 2219 | Ga0436365_1010396 | |||
| 2220 | Ga0436365_1047672 | |||
| 2221 | Ga0436365_1253031 | |||
| 2222 | Ga0436365_1350477 | |||
| 2223 | Ga0436365_1529438 | |||
| 2224 | Ga0436365_1760276 | |||
| 2225 | Ga0436365_1870318 | |||
| 2226 | Ga0436365_1902820 | |||
| 2227 | Ga0436360_0409482 | |||
| 2228 | Ga0436360_0777771 | |||
| 2229 | Ga0436360_0885775 | |||
| 2230 | Ga0436360_0888847 | |||
| 2231 | Ga0436360_1268636 | |||
| 2232 | Ga0436361_0317849 | |||
| 2233 | Ga0436361_0427976 | |||
| 2234 | Ga0436361_0763086 | |||
| 2235 | Ga0436361_0963669 | |||
| 2236 | Ga0436363_0131403 | |||
| 2237 | Ga0436363_0242717 | |||
| 2238 | Ga0436363_0312775 | |||
| 2239 | Ga0436363_0880899 | |||
| 2240 | Ga0436363_1014283 | |||
| 2241 | Ga0436363_1046285 | |||
| 2242 | Ga0436363_1113612 | |||
| 2243 | Ga0436363_1387407 | |||
| 2244 | Ga0436363_1575848 | |||
| 2245 | Ga0436363_1627336 | |||
| 2246 | Ga0436362_0002334 | |||
| 2247 | Ga0436362_0607333 | |||
| 2248 | Ga0436362_0793870 | |||
| 2249 | Ga0436362_0982213 | |||
| 2250 | Ga0436362_1142159 | |||
| 2251 | Ga0439439_0132040 | |||
| 2252 | Ga0439465_0053801 | |||
| 2253 | Ga0439465_0127160 | |||
| 2254 | Ga0451794_34969 | |||
| 2255 | Ga0451798_0606664 | |||
| 2256 | Ga0451807_2208106 | |||
| 2257 | Ga0451837_0342915 | |||
| 2258 | Ga0451855_0769345 | |||
| 2259 | Ga0451853_3344493 | |||
| 2260 | Ga0439431_0094769 | |||
| 2261 | Ga0439432_128392 | |||
| 2262 | Ga0439457_151757 | |||
| 2263 | Ga0450900_053254 | |||
| 2264 | Ga0450903_051975 | |||
| 2265 | Ga0439459_0018016 | |||
| 2266 | Ga0450901_002715 | |||
| 2267 | Ga0466969_0217487 | |||
| 2268 | Ga0466969_0511409 | |||
| 2269 | Ga0466965_0333684 | |||
| 2270 | Ga0466966_0037447 | |||
| 2271 | Ga0466966_0038631 | |||
| 2272 | Ga0466966_0063022 | |||
| 2273 | Ga0466961_0017735 | |||
| 2274 | Ga0466961_0058522 | |||
| 2275 | Ga0466963_0016197 | |||
| 2276 | Ga0466963_0037303 | |||
| 2277 | Ga0466963_0070352 | |||
| 2278 | Ga0466963_0354875 | |||
| 2279 | Ga0466963_0358283 | |||
| 2280 | Ga0466963_0543930 | |||
| 2281 | Ga0466964_0475103 | |||
| 2282 | Ga0466971_0080841 | |||
| 2283 | Ga0466971_0675604 | |||
| 2284 | Ga0466968_0060841 | |||
| 2285 | Ga0466970_0122687 | |||
| 2286 | Ga0466970_0201450 | |||
| 2287 | Ga0466970_0506738 | |||
| 2288 | Ga0466957_0014805 | |||
| 2289 | Ga0466957_0075585 | |||
| 2290 | Ga0466957_0318692 | |||
| 2291 | Ga0466957_0935663 | |||
| 2292 | Ga0466960_0051465 | |||
| 2293 | Ga0466960_0958273 | |||
| 2294 | Ga0466959_0098844 | |||
| 2295 | Ga0466959_0744194 | |||
| 2296 | Ga0466967_0011664 | |||
| 2297 | Ga0466967_0056204 | |||
| 2298 | Ga0466967_0096571 | |||
| 2299 | Ga0466967_0434220 | |||
| 2300 | Ga0466967_0471064 | |||
| 2301 | Ga0466967_1078797 | |||
| 2302 | Ga0495617_093369 | |||
| 2303 | Ga0495603_0011756 | |||
| 2304 | Ga0495603_0725840 | |||
| 2305 | Ga0495629_0026319 | |||
| 2306 | Ga0495629_0589356 | |||
| 2307 | Ga0495641_0210957 | |||
| 2308 | Ga0495651_0353235 | |||
| 2309 | Ga0495651_0361100 | |||
| 2310 | Ga0495650_0056786 | |||
| 2311 | Ga0495580_0111434 | |||
| 2312 | Ga0495580_0791263 | |||
| 2313 | Ga0495582_0016883 | |||
| 2314 | Ga0495639_0026164 | |||
| 2315 | Ga0495662_0031478 | |||
| 2316 | Ga0495664_0018921 | |||
| 2317 | Ga0495584_0038672 | |||
| 2318 | Ga0495606_0055089 | |||
| 2319 | Ga0495608_0912010 | |||
| 2320 | Ga0495618_0043838 | |||
| 2321 | Ga0495618_0926569 | |||
| 2322 | Ga0495630_0095907 | |||
| 2323 | Ga0495630_0170546 | |||
| 2324 | Ga0495630_0274888 | |||
| 2325 | Ga0495666_0087221 | |||
| 2326 | Ga0495652_0204382 | |||
| 2327 | Ga0495652_0526129 | |||
| 2328 | Ga0495665_0039396 | |||
| 2329 | Ga0495665_0168192 | |||
| 2330 | Ga0495640_0019304 | |||
| 2331 | Ga0495640_0127966 | |||
| 2332 | Ga0495586_0136518 | |||
| 2333 | Ga0495586_0158041 | |||
| 2334 | Ga0495587_0239915 | |||
| 2335 | Ga0495597_0068164 | |||
| 2336 | Ga0495645_0003533 | |||
| 2337 | Ga0495622_0204243 | |||
| 2338 | Ga0495622_0452756 | |||
| 2339 | Ga0495667_0108852 | |||
| 2340 | Ga0495667_0319903 | |||
| 2341 | Ga0495656_0482666 | |||
| 2342 | Ga0495668_0426247 | |||
| 2343 | Ga0495668_0430953 | |||
| 2344 | Ga0495634_0015564 | |||
| 2345 | Ga0495634_0209436 | |||
| 2346 | Ga0495625_0265563 | |||
| 2347 | Ga0495625_0747054 | |||
| 2348 | Ga0495635_0099960 | |||
| 2349 | Ga0495635_0260117 | |||
| 2350 | Ga0495635_0810117 | |||
| 2351 | Ga0495657_0732641 | |||
| 2352 | Ga0495657_0864147 | |||
| 2353 | Ga0495599_0154630 | |||
| 2354 | Ga0495599_0165274 | |||
| 2355 | Ga0495623_0224284 | |||
| 2356 | Ga0495623_0315983 | |||
| 2357 | Ga0495646_0054443 | |||
| 2358 | Ga0495646_0560632 | |||
| 2359 | Ga0495647_0005756 | |||
| 2360 | Ga0495658_0398360 | |||
| 2361 | Ga0495613_0078402 | |||
| 2362 | Ga0495624_0051066 | |||
| 2363 | Ga0495624_0186772 | |||
| 2364 | Ga0495600_0144763 | |||
| 2365 | Ga0495581_0033672 | |||
| 2366 | Ga0495604_0190355 | |||
| 2367 | Ga0495604_0317839 | |||
| 2368 | Ga0495604_0453169 | |||
| 2369 | Ga0495604_0644638 | |||
| 2370 | Ga0495674_0010137 | |||
| 2371 | Ga0495676_0156541 | |||
| 2372 | Ga0495680_0263931 | |||
| 2373 | Ga0495680_0366455 | |||
| 2374 | Ga0495680_0474417 | |||
| 2375 | Ga0495680_0621850 | |||
| 2376 | Ga0495675_0033574 | |||
| 2377 | Ga0495675_0852003 | |||
| 2378 | Ga0495684_0016236 | |||
| 2379 | Ga0495684_0526279 | |||
| 2380 | Ga0495686_0247696 | |||
| 2381 | Ga0495593_0035110 | |||
| 2382 | Ga0495602_0073140 | |||
| 2383 | Ga0495615_0245224 | |||
| 2384 | Ga0496100_0017720 | |||
| 2385 | Ga0496100_0086615 | |||
| 2386 | Ga0496100_0088497 | |||
| 2387 | Ga0496100_0252106 | |||
| 2388 | Ga0496100_0427167 | |||
| 2389 | Ga0496100_0849411 | |||
| 2390 | Ga0496101_0010556 | |||
| 2391 | Ga0496101_0142858 | |||
| 2392 | Ga0496101_0146063 | |||
| 2393 | Ga0496101_0322108 | |||
| 2394 | Ga0496101_0501719 | |||
| 2395 | Ga0496101_1047976 | |||
| 2396 | Ga0496101_1537642 | |||
| 2397 | Ga0496102_0021341 | |||
| 2398 | Ga0496102_0269233 | |||
| 2399 | Ga0496102_0276267 | |||
| 2400 | Ga0496102_0641575 | |||
| 2401 | Ga0496102_1387868 | |||
| 2402 | Ga0496103_0067933 | |||
| 2403 | Ga0496103_0112317 | |||
| 2404 | Ga0496103_0172850 | |||
| 2405 | Ga0496104_0001364 | |||
| 2406 | Ga0496104_0044527 | |||
| 2407 | Ga0496104_0044528 | |||
| 2408 | Ga0496104_0108172 | |||
| 2409 | Ga0496104_0274478 | |||
| 2410 | Ga0496105_0004404 | |||
| 2411 | Ga0496105_0005504 | |||
| 2412 | Ga0496105_0148751 | |||
| 2413 | Ga0496105_0615649 | |||
| 2414 | Ga0496106_0049371 | |||
| 2415 | Ga0496106_0074612 | |||
| 2416 | Ga0496106_0255760 | |||
| 2417 | Ga0496106_0784058 | |||
| 2418 | Ga0496107_0111293 | |||
| 2419 | Ga0496107_0296518 | |||
| 2420 | Ga0496107_0336293 | |||
| 2421 | Ga0496107_0450946 | |||
| 2422 | Ga0496107_0687808 | |||
| 2423 | Ga0496108_0001133 | |||
| 2424 | Ga0496108_0032633 | |||
| 2425 | Ga0496108_0085334 | |||
| 2426 | Ga0496108_0224656 | |||
| 2427 | Ga0496108_0517813 | |||
| 2428 | Ga0496108_0668902 | |||
| 2429 | Ga0496109_0000583 | |||
| 2430 | Ga0496109_0005439 | |||
| 2431 | Ga0496109_0042827 | |||
| 2432 | Ga0496109_0138169 | |||
| 2433 | Ga0496109_0557498 | |||
| 2434 | Ga0496110_0010849 | |||
| 2435 | Ga0496110_0112064 | |||
| 2436 | Ga0496110_0181086 | |||
| 2437 | Ga0496110_0430482 | |||
| 2438 | Ga0496110_0766449 | |||
| 2439 | Ga0496110_1855276 | |||
| 2440 | Ga0496111_0009370 | |||
| 2441 | Ga0496111_0074867 | |||
| 2442 | Ga0496111_0100084 | |||
| 2443 | Ga0496111_0397434 | |||
| 2444 | Ga0496111_0783833 | |||
| 2445 | Ga0496112_0000884 | |||
| 2446 | Ga0496112_0056643 | |||
| 2447 | Ga0496112_0059398 | |||
| 2448 | Ga0496112_0262667 | |||
| 2449 | Ga0496112_0301262 | |||
| 2450 | Ga0496112_0865970 | |||
| 2451 | Ga0496112_0959312 | |||
| 2452 | Ga0496112_1903594 | |||
| 2453 | Ga0496113_0000351 | |||
| 2454 | Ga0496113_0004259 | |||
| 2455 | Ga0496113_0014431 | |||
| 2456 | Ga0496113_0480557 | |||
| 2457 | Ga0496114_0159980 | |||
| 2458 | Ga0496114_0325387 | |||
| 2459 | Ga0496114_0526862 | |||
| 2460 | Ga0496114_0727902 | |||
| 2461 | Ga0496115_0004536 | |||
| 2462 | Ga0496115_0117368 | |||
| 2463 | Ga0496115_0208195 | |||
| 2464 | Ga0496115_0307943 | |||
| 2465 | Ga0496115_0774600 | |||
| 2466 | Ga0496115_1004222 | |||
| 2467 | Ga0496116_0104480 | |||
| 2468 | Ga0496116_0224902 | |||
| 2469 | Ga0496117_0071108 | |||
| 2470 | Ga0496117_0079014 | |||
| 2471 | Ga0496117_0126021 | |||
| 2472 | Ga0496117_0280736 | |||
| 2473 | Ga0496118_0024920 | |||
| 2474 | Ga0496118_0029731 | |||
| 2475 | Ga0496118_0073065 | |||
| 2476 | Ga0496118_0524006 | |||
| 2477 | Ga0496118_0560981 | |||
| 2478 | Ga0496119_0004353 | |||
| 2479 | Ga0496119_0015798 | |||
| 2480 | Ga0496119_0047286 | |||
| 2481 | Ga0496119_0186852 | |||
| 2482 | Ga0496119_0240910 | |||
| 2483 | Ga0496119_0295542 | |||
| 2484 | Ga0496119_0381273 | |||
| 2485 | Ga0496120_0058656 | |||
| 2486 | Ga0496120_0072566 | |||
| 2487 | Ga0496120_0227045 | |||
| 2488 | Ga0496121_0003703 | |||
| 2489 | Ga0496121_0035490 | |||
| 2490 | Ga0496121_0076984 | |||
| 2491 | Ga0496121_0273289 | |||
| 2492 | Ga0496121_0396206 | |||
| 2493 | Ga0496121_0414452 | |||
| 2494 | Ga0496122_0049328 | |||
| 2495 | Ga0496122_0133672 | |||
| 2496 | Ga0496122_0620340 | |||
| 2497 | Ga0496123_0023041 | |||
| 2498 | Ga0496123_0443489 | |||
| 2499 | Ga0496124_0037995 | |||
| 2500 | Ga0496124_0201142 | |||
| 2501 | Ga0496124_0280696 | |||
| 2502 | Ga0496124_0639254 | |||
| 2503 | Ga0496125_0017448 | |||
| 2504 | Ga0496125_0187364 | |||
| 2505 | Ga0496125_0228180 | |||
| 2506 | Ga0496126_0052029 | |||
| 2507 | Ga0496126_0062525 | |||
| 2508 | Ga0496126_0076397 | |||
| 2509 | Ga0496126_0088438 | |||
| 2510 | Ga0496126_0110380 | |||
| 2511 | Ga0496126_0157561 | |||
| 2512 | Ga0496126_0185973 | |||
| 2513 | Ga0496126_0552488 | |||
| 2514 | Ga0501306_005013 | |||
| 2515 | Ga0501309_018091 | |||
| 2516 | Ga0501310_000913 | |||
| 2517 | Ga0501304_015606 | |||
| 2518 | Ga0501307_051215 | |||
| 2519 | Ga0501307_069927 | |||
| 2520 | Ga0501295_087541 | |||
| 2521 | Ga0501311_058550 | |||
| 2522 | Ga0501311_058695 | |||
| 2523 | Ga0501312_002347 | |||
| 2524 | Ga0501313_012946 | |||
| 2525 | Ga0501314_004633 | |||
| 2526 | Ga0501315_000284 | |||
| 2527 | Ga0501316_001152 | |||
| 2528 | Ga0501317_000192 | |||
| 2529 | Ga0501318_000037 | |||
| 2530 | Ga0501320_007213 | |||
| 2531 | Ga0501320_033205 | |||
| 2532 | Ga0501323_009389 | |||
| 2533 | Ga0501324_025965 | |||
| 2534 | Ga0501329_01320 | |||
| 2535 | Ga0501331_07283 | |||
| 2536 | Ga0501332_19326 | |||
| 2537 | Ga0501335_019758 | |||
| 2538 | Ga0501031_0058878 | |||
| 2539 | Ga0501031_0189582 | |||
| 2540 | Ga0501031_0245821 | |||
| 2541 | Ga0501031_0336341 | |||
| 2542 | Ga0501031_0384727 | |||
| 2543 | Ga0501032_0102312 | |||
| 2544 | Ga0501032_0196587 | |||
| 2545 | Ga0501032_0510860 | |||
| 2546 | Ga0501033_0003899 | |||
| 2547 | Ga0501033_0077789 | |||
| 2548 | Ga0501033_0087576 | |||
| 2549 | Ga0501033_0329421 | |||
| 2550 | Ga0501033_0561852 | |||
| 2551 | Ga0501034_0009013 | |||
| 2552 | Ga0501034_0045501 | |||
| 2553 | Ga0501034_0046023 | |||
| 2554 | Ga0501034_0072791 | |||
| 2555 | Ga0501034_0215781 | |||
| 2556 | Ga0501034_0280847 | |||
| 2557 | Ga0501034_0296749 | |||
| 2558 | Ga0501034_0660737 | |||
| 2559 | Ga0501034_0789867 | |||
| 2560 | Ga0501034_1100999 | |||
| 2561 | Ga0501034_1586763 | |||
| 2562 | Ga0501036_0042790 | |||
| 2563 | Ga0501036_0156089 | |||
| 2564 | Ga0501036_0373840 | |||
| 2565 | Ga0501036_0761878 | |||
| 2566 | Ga0501036_1036998 | |||
| 2567 | Ga0501037_0038500 | |||
| 2568 | Ga0501037_0058098 | |||
| 2569 | Ga0501037_0067461 | |||
| 2570 | Ga0501037_0147819 | |||
| 2571 | Ga0501037_0215198 | |||
| 2572 | Ga0501037_0308671 | |||
| 2573 | Ga0501037_0610859 | |||
| 2574 | Ga0501038_0046533 | |||
| 2575 | Ga0501038_0111161 | |||
| 2576 | Ga0501038_0149812 | |||
| 2577 | Ga0501038_0178958 | |||
| 2578 | Ga0501039_0094100 | |||
| 2579 | Ga0501039_0143242 | |||
| 2580 | Ga0501039_0220637 | |||
| 2581 | Ga0501039_1465325 | |||
| 2582 | Ga0501040_0057060 | |||
| 2583 | Ga0501040_0104821 | |||
| 2584 | Ga0501042_0006352 | |||
| 2585 | Ga0501042_1104347 | |||
| 2586 | Ga0501043_0032226 | |||
| 2587 | Ga0501043_0100195 | |||
| 2588 | Ga0501043_0374221 | |||
| 2589 | Ga0501043_0377711 | |||
| 2590 | Ga0501046_0079981 | |||
| 2591 | Ga0501046_0104265 | |||
| 2592 | Ga0501047_0005487 | |||
| 2593 | Ga0501047_0103854 | |||
| 2594 | Ga0501047_0322469 | |||
| 2595 | Ga0501047_0346110 | |||
| 2596 | Ga0501047_0511199 | |||
| 2597 | Ga0501047_0622027 | |||
| 2598 | Ga0501048_0010499 | |||
| 2599 | Ga0501048_0644508 | |||
| 2600 | Ga0501067_0001840 | |||
| 2601 | Ga0501067_0138882 | |||
| 2602 | Ga0501068_0031355 | |||
| 2603 | Ga0501068_0134851 | |||
| 2604 | Ga0501068_0679595 | |||
| 2605 | Ga0501069_0192433 | |||
| 2606 | Ga0501069_0553027 | |||
| 2607 | Ga0501069_0965278 | |||
| 2608 | Ga0501070_0025506 | |||
| 2609 | Ga0501070_0219812 | |||
| 2610 | Ga0501071_0014068 | |||
| 2611 | Ga0501072_0184090 | |||
| 2612 | Ga0501072_0267299 | |||
| 2613 | Ga0501072_1024082 | |||
| 2614 | Ga0501073_0023164 | |||
| 2615 | Ga0501073_0039588 | |||
| 2616 | Ga0501073_1281054 | |||
| 2617 | Ga0501074_0026693 | |||
| 2618 | Ga0501074_0052758 | |||
| 2619 | Ga0501075_0433447 | |||
| 2620 | Ga0501076_0054065 | |||
| 2621 | Ga0501076_1252901 | |||
| 2622 | Ga0501077_0028790 | |||
| 2623 | Ga0501077_0769530 | |||
| 2624 | Ga0501198_084030 | |||
| 2625 | Ga0501202_068220 | |||
| 2626 | Ga0501209_090205 | |||
| 2627 | Ga0501261_052301 | |||
| 2628 | Ga0501234_067452 | |||
| 2629 | Ga0501245_092165 | |||
| 2630 | Ga0501079_0024576 | |||
| 2631 | Ga0501079_0126189 | |||
| 2632 | Ga0501079_0670703 | |||
| 2633 | Ga0501080_0107267 | |||
| 2634 | Ga0501080_0137367 | |||
| 2635 | Ga0501080_0258855 | |||
| 2636 | Ga0501080_0871114 | |||
| 2637 | Ga0501081_1036619 | |||
| 2638 | Ga0501083_0006724 | |||
| 2639 | Ga0501083_0023858 | |||
| 2640 | Ga0501083_0493650 | |||
| 2641 | Ga0501083_0604216 | |||
| 2642 | Ga0501271_028555 | |||
| 2643 | Ga0501035_0069162 | |||
| 2644 | Ga0501035_0143633 | |||
| 2645 | Ga0501035_0188785 | |||
| 2646 | Ga0501035_0274381 | |||
| 2647 | Ga0501035_0310484 | |||
| 2648 | Ga0501035_0584051 | |||
| 2649 | Ga0501044_0047177 | |||
| 2650 | Ga0501044_0096645 | |||
| 2651 | Ga0501044_0163967 | |||
| 2652 | Ga0501044_0588757 | |||
| 2653 | Ga0501044_0984596 | |||
| 2654 | Ga0501044_1040435 | |||
| 2655 | Ga0501045_0484646 | |||
| 2656 | Ga0501045_0496303 | |||
| 2657 | Ga0501045_1397298 | |||
| 2658 | nmdc:mga03683_30010_c1 | |||
| 2659 | nmdc:mga03683_55888_c1 | |||
| 2660 | nmdc:mga03683_57927_c1 | |||
| 2661 | nmdc:mga00v17_128506_c1 | |||
| 2662 | nmdc:mga00v17_158507_c1 | |||
| 2663 | nmdc:mga00v17_40128_c1 | |||
| 2664 | nmdc:mga0yw44_198666_c1 | |||
| 2665 | nmdc:mga0yw44_72574_c1 | |||
| 2666 | nmdc:mga0yw44_8112_c1 | |||
| 2667 | nmdc:mga0k408_107918_c1 | |||
| 2668 | nmdc:mga0k408_349325_c1 | |||
| 2669 | nmdc:mga06z11_122918_c1 | |||
| 2670 | nmdc:mga06z11_65629_c1 | |||
| 2671 | nmdc:mga07m45_26736_c1 | |||
| 2672 | nmdc:mga07m45_313530_c1 | |||
| 2673 | nmdc:mga05p37_109891_c1 | |||
| 2674 | nmdc:mga05p37_1141437_c1 | |||
| 2675 | nmdc:mga09592_39027_c1 | |||
| 2676 | nmdc:mga06r32_11149_c1 | |||
| 2677 | nmdc:mga08y16_1002128_c1 | |||
| 2678 | nmdc:mga08y16_1237329_c1 | |||
| 2679 | nmdc:mga08y16_704116_c1 | |||
| 2680 | nmdc:mga0n895_260513_c1 | |||
| 2681 | nmdc:mga0n895_331977_c1 | |||
| 2682 | nmdc:mga0n895_5268_c1 | |||
| 2683 | nmdc:mga0rr50_53041_c1 | |||
| 2684 | nmdc:mga0rr50_97529_c2 | |||
| 2685 | nmdc:mga08x19_11254_c1 | |||
| 2686 | nmdc:mga08x19_816672_c1 | |||
| 2687 | nmdc:mga0a205_44144_c1 | |||
| 2688 | Ga0495601_0112434 | |||
| 2689 | Ga0495601_0316895 | |||
| 2690 | Ga0495612_0089496 | |||
| 2691 | Ga0495612_0356432 | |||
| 2692 | Ga0495612_0593509 | |||
| 2693 | Ga0500635_0041067 | |||
| 2694 | Ga0500635_0116565 | |||
| 2695 | Ga0495595_0116849 | |||
| 2696 | Ga0495619_0253113 | |||
| 2697 | Ga0495619_0321326 | |||
| 2698 | Ga0495619_0339923 | |||
| 2699 | Ga0495619_0705296 | |||
| 2700 | Ga0500647_0175353 | |||
| 2701 | Ga0500647_0233186 | |||
| 2702 | Ga0500566_0000320 | |||
| 2703 | Ga0500566_0088640 | |||
| 2704 | Ga0500640_029114 | |||
| 2705 | Ga0500556_0004256 | |||
| 2706 | Ga0500558_109295 | |||
| 2707 | Ga0500562_009418 | |||
| 2708 | Ga0500572_001638 | |||
| 2709 | Ga0500572_015788 | |||
| 2710 | Ga0500591_079976 | |||
| 2711 | Ga0500608_083229 | |||
| 2712 | Ga0500614_057503 | |||
| 2713 | Ga0500614_280998 | |||
| 2714 | Ga0500655_071954 | |||
| 2715 | Ga0500559_0007811 | |||
| 2716 | Ga0500559_0012275 | |||
| 2717 | Ga0500559_0120340 | |||
| 2718 | Ga0500561_0200419 | |||
| 2719 | Ga0500564_290061 | |||
| 2720 | Ga0500568_0113847 | |||
| 2721 | Ga0500573_0006745 | |||
| 2722 | Ga0500585_223960 | |||
| 2723 | Ga0500590_151829 | |||
| 2724 | Ga0500590_307903 | |||
| 2725 | Ga0500603_021102 | |||
| 2726 | Ga0500603_027424 | |||
| 2727 | Ga0500603_030409 | |||
| 2728 | Ga0500616_0006596 | |||
| 2729 | Ga0500616_0048582 | |||
| 2730 | Ga0500619_208526 | |||
| 2731 | Ga0500630_005936 | |||
| 2732 | Ga0500638_035746 | |||
| 2733 | Ga0500639_019780 | |||
| 2734 | Ga0500639_044490 | |||
| 2735 | Ga0500636_0067281 | |||
| 2736 | Ga0500636_0144725 | |||
| 2737 | Ga0500637_0072771 | |||
| 2738 | Ga0500637_0190508 | |||
| 2739 | Ga0500637_0215172 | |||
| 2740 | Ga0500576_041535 | |||
| 2741 | Ga0500657_147716 | |||
| 2742 | Ga0500552_113454 | |||
| 2743 | Ga0500596_003892 | |||
| 2744 | Ga0500596_007930 | |||
| 2745 | Ga0500596_051092 | |||
| 2746 | Ga0500601_007073 | |||
| 2747 | Ga0500601_012157 | |||
| 2748 | Ga0501084_0080043 | |||
| 2749 | Ga0501084_0424221 | |||
| 2750 | Ga0500661_118751 | |||
| 2751 | Ga0590077_180360 | |||
| 2752 | Ga0587093_049355 | |||
| 2753 | Ga0587066_027970 | |||
| 2754 | Ga0587070_023933 | |||
| 2755 | Ga0587073_0145918 | |||
| 2756 | Ga0587073_0272404 | |||
| 2757 | Ga0587080_108329 | |||
| 2758 | Ga0587082_107359 | |||
| 2759 | Ga0587082_120957 | |||
| 2760 | Ga0587083_0169989 | |||
| 2761 | Ga0587085_122805 | |||
| 2762 | Ga0587086_029713 | |||
| 2763 | Ga0587090_001023 | |||
| 2764 | Ga0587098_048040 | |||
| 2765 | Ga0587106_013279 | |||
| 2766 | Ga0587106_108624 | |||
| 2767 | Ga0587101_004242 | |||
| 2768 | Ga0587101_105964 | |||
| 2769 | Ga0587101_106800 | |||
| 2770 | Ga0587101_120350 | |||
| 2771 | Ga0587109_103867 | |||
| 2772 | Ga0587117_024481 | |||
| 2773 | Ga0587067_174578 | |||
| 2774 | Ga0587067_220962 | |||
| 2775 | Ga0587069_083867 | |||
| 2776 | Ga0587069_097416 | |||
| 2777 | Ga0587072_023778 | |||
| 2778 | Ga0587079_074253 | |||
| 2779 | Ga0587079_157835 | |||
| 2780 | Ga0587107_024275 | |||
| 2781 | Ga0587107_038016 | |||
| 2782 | Ga0587107_051941 | |||
| 2783 | Ga0587107_112242 | |||
| 2784 | Ga0587107_112462 | |||
| 2785 | Ga0587108_004748 | |||
| 2786 | Ga0587116_06220 | |||
| 2787 | Ga0587119_036177 | |||
| 2788 | Ga0501082_0171311 | |||
| 2789 | Ga0501082_0526106 | |||
| 2790 | Ga0501082_1408072 | |||
| 2791 | Ga0466962_0243768 | |||
| 2792 | Ga0466962_0487514 | |||
| 2793 | Ga0530510_0050130 | |||
| 2794 | Ga0530510_0261262 | |||
| 2795 | Ga0530510_0473104 | |||
| 2796 | 2508735863 | |||
| 2797 | 2509149632 | |||
| 2798 | 2512642897 | |||
| 2799 | 2513678617 | |||
| 2800 | 2513894229 | |||
| 2801 | 2524469971 | |||
| 2802 | 2596374054 | |||
| 2803 | 2723846171 | |||
| 2804 | 2738745705 | |||
| 2805 | 2739354935 | |||
| 2806 | 2753359575 | |||
| 2807 | 2758641836 | |||
| 2808 | 2765465535 | |||
| 2809 | 2776259137 | |||
| 2810 | 2778126625 | |||
| 2811 | 2828310148 | |||
| 2812 | 2829749930 | |||
| 2813 | 2839995597 | |||
| 2814 | 2840768016 | |||
| 2815 | 2842701718 | |||
| 2816 | 2861692149 | |||
| 2817 | 2885384445 | |||
| 2818 | 2889311569 | |||
| 2819 | 2891050820 | |||
| 2820 | 2894240768 | |||
| 2821 | 2902334109 | |||
| 2822 | 2902411804 | |||
| 2823 | 2903770862 | |||
| 2824 | 2904583234 | |||
| 2825 | 2909043598 | |||
| 2826 | 2919123882 | |||
| 2827 | 2922361967 | |||
| 2828 | 2922428989 | |||
| 2829 | 2928129945 | |||
| 2830 | 2995397021 | |||
| 2831 | 3002143950 | |||
| 2832 | 3005512709 | |||
| 2833 | 3005598068 | |||
| 2834 | 8056684520 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ce4-assembly1.cif.gz_X | 39s large subunit of the porcine mitochondrial ribosome | 0.882 | 32 | 99 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.8398 | 15 | 100 |
| 7jil-assembly1.cif.gz_T | 70s ribosome flavobacterium johnsoniae | 0.8396 | 17 | 100 |
| 7pak-assembly1.cif.gz_s | 70s ribosome with ef-tu-trna and p-site trna in mycoplasma pneumoniae cells | 0.8325 | 20 | 100 |
| 6enj-assembly1.cif.gz_T | polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) | 0.8311 | 16 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8194 | 14 | 99 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8134 | 15 | 100 | 3.30.70.330 |
| af_G5EGK6_273_340_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8056 | 33 | 94 | 3.30.70.330 |
| af_Q4D4H5_321_440_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7798 | 32 | 93 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7775 | 14 | 99 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E3YSJ4-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9892 | 31 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1V5X8V8-F1-model_v4 | 50S ribosomal protein L23 | 0.9808 | 33 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X1WP25-F1-model_v4 | deleted | 0.9575 | 31 | 100 |
|
| AF-A0A1F5B507-F1-model_v4 | 50S ribosomal protein L23 | 0.9526 | 32 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A382FB94-F1-model_v4 | 50S ribosomal protein L23 | 0.9306 | 30 | 104 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |