F493797

General Info

Members Datasets Scaffolds Average Seq Length
1417 618 2834 98

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101512712|Ga0070680_1015127121
Length 109
Sequence MKKAAKKTTAPVARAYHYDVIVSPIVTEKSTAASEFNKVMFNVHLDATKEDIKASVEALFNVKVSKVNTLRRLGKIKRFRNTVGKLSDTKKAIITLAEGQSIDLSSGVK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
158 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
165 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
168 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
170 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
171 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
172 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
173 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
254 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
255 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
256 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
257 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
258 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
259 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
265 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
266 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
269 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
270 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
271 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
272 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
273 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
274 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
283 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
284 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
285 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
286 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
288 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
289 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
290 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
291 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
292 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
293 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
294 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
295 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
296 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
297 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
298 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
299 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
301 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
302 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
303 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
307 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
308 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
309 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
310 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
311 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
312 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
313 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
315 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
319 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
322 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
323 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
324 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
325 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
327 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
330 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
331 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
334 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
335 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
336 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
337 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
338 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
339 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
340 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
341 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
342 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
343 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
344 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
345 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
346 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
347 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
348 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
349 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
350 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
351 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
352 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
353 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
356 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
359 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
360 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
361 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
364 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
367 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
368 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
372 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
373 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
374 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
375 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
376 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
377 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
378 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
379 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
382 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
386 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
387 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
388 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
389 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
390 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
391 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
401 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
409 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
410 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
411 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
412 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
413 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
414 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
415 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
419 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
420 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
421 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
422 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
423 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
431 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
447 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
477 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
478 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
479 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
480 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
481 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
482 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
483 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
484 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
485 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
486 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
487 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
488 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
489 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
490 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
491 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
492 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
493 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
494 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
495 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
496 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
497 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
498 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
501 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
502 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
503 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
504 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
505 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
506 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
507 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
508 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
509 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
510 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
511 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
512 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
513 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
514 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
515 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
516 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
517 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
518 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
519 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
520 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
521 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
522 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
523 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
524 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
525 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
526 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
527 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
528 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
529 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
530 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
531 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
532 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
533 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
534 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
535 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
536 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
537 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
538 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
539 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
540 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
541 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
542 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
543 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
544 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
545 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
546 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
547 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
548 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
549 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
550 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
551 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
552 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
553 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
554 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
578 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
579 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
580 2508501050 Microvirga lupini Lut6 Isolate Nodule
581 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
582 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
583 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
584 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
585 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
586 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
587 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
588 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
589 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
590 2751185800 Brucella pituitosa AA2 Isolate Unclassified
591 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
592 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
593 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
594 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
595 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
596 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
597 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
598 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
599 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
600 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
601 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
602 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
603 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
604 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
605 2902330777 Methylobacterium sp. 2A Isolate Unclassified
606 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
607 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
608 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
609 2909042592 Labrys sp. LIt4 Isolate Nodule
610 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
611 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
612 2922425934
613 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
614 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
615 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
616 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
617 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
618 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 5.93
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 0.78
Rhizoplane 6.14
Rhizosphere 77.98
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101512712 3300005336 Bacteria 581
2 JGI24741J21665_1000040 3300001915 Bacteria 30851
3 JGI24747J21853_1041351 3300001978 Bacteria 547
4 JGI24740J21852_10001488 3300001979 Bacteria 10769
5 JGI24740J21852_10127217 3300001979 Bacteria 636
6 JGI24739J22299_10009835 3300001989 Bacteria 3555
7 JGI24739J22299_10122518 3300001989 Bacteria 776
8 JGI24739J22299_10146276 3300001989 Bacteria 699
9 JGI24737J22298_10002296 3300001990 Bacteria 6798
10 JGI24737J22298_10002957 3300001990 Bacteria 6024
11 JGI24743J22301_10019644 3300001991 Bacteria 1284
12 JGI24735J21928_10003641 3300002067 Bacteria 5227
13 JGI24750J21931_1006031 3300002070 Bacteria 1500
14 JGI24745J21846_1025676 3300002073 Bacteria 701
15 JGI24738J21930_10001475 3300002075 Bacteria 6532
16 JGI24738J21930_10006269 3300002075 Bacteria 2803
17 JGI24749J21850_1030226 3300002076 Bacteria 777
18 JGI24751J29686_10003449 3300002459 Bacteria 3183
19 JGI24751J29686_10015322 3300002459 Bacteria 1581
20 JGI25165J46597_1011340 3300003214 Bacteria 1275
21 JGI25153J46596_10082871 3300003215 Bacteria 794
22 rootH2_10016380 3300003320 Bacteria 1635
23 JGI25404J52841_10035096 3300003659 Bacteria 1068
24 Ga0055539_1021913 3300003752 Bacteria 757
25 JGI25405J52794_10006513 3300003911 Bacteria 2134
26 Ga0058863_11772060 3300004799 Bacteria 625
27 Ga0058863_11874628 3300004799 Bacteria 752
28 Ga0070658_10013737 3300005327 Bacteria 6498
29 Ga0070658_10018691 3300005327 Bacteria 5551
30 Ga0070658_10417429 3300005327 Bacteria 1154
31 Ga0070658_10993116 3300005327 Bacteria 730
32 Ga0070676_10598008 3300005328 Bacteria 795
33 Ga0070683_100014681 3300005329 Bacteria 6861
34 Ga0070683_101643452 3300005329 Bacteria 618
35 Ga0070690_100007778 3300005330 Bacteria 6144
36 Ga0070670_100000376 3300005331 Bacteria 37212
37 Ga0070677_10080667 3300005333 Bacteria 1391
38 Ga0068869_100022833 3300005334 Bacteria 4314
39 Ga0070666_10004644 3300005335 Bacteria 8386
40 Ga0070680_100085545 3300005336 Bacteria 2605
41 Ga0070680_100098147 3300005336 Bacteria 2429
42 Ga0070680_100310121 3300005336 Bacteria 1339
43 Ga0070680_100664914 3300005336 Bacteria 896
44 Ga0070680_101082953 3300005336 Bacteria 692
45 Ga0070680_101587842 3300005336 Bacteria 567
46 Ga0070682_100002069 3300005337 Bacteria 11170
47 Ga0070682_100463941 3300005337 Bacteria 973
48 Ga0068868_100202434 3300005338 Bacteria 1655
49 Ga0070660_100000686 3300005339 Bacteria 22383
50 Ga0070660_100662344 3300005339 Bacteria 874
51 Ga0070660_100839069 3300005339 Bacteria 774
52 Ga0070660_101161486 3300005339 Bacteria 654
53 Ga0070689_100000122 3300005340 Bacteria 44668
54 Ga0070691_10000490 3300005341 Bacteria 14859
55 Ga0070691_10862610 3300005341 Bacteria 556
56 Ga0070687_100016035 3300005343 Bacteria 3404
57 Ga0070661_100000385 3300005344 Bacteria 34633
58 Ga0070661_100303958 3300005344 Bacteria 1242
59 Ga0070692_10001302 3300005345 Bacteria 8967
60 Ga0070668_100005991 3300005347 Bacteria 9018
61 Ga0070668_100088347 3300005347 Bacteria 2440
62 Ga0070668_100390585 3300005347 Bacteria 1186
63 Ga0070669_100002082 3300005353 Bacteria 14453
64 Ga0070675_100016237 3300005354 Bacteria 5907
65 Ga0070675_101384211 3300005354 Bacteria 649
66 Ga0070671_100001283 3300005355 Bacteria 18858
67 Ga0070674_100000649 3300005356 Bacteria 17518
68 Ga0070674_100148607 3300005356 Bacteria 1766
69 Ga0070674_100607101 3300005356 Bacteria 925
70 Ga0070673_100002163 3300005364 Bacteria 11899
71 Ga0070688_100000217 3300005365 Bacteria 30556
72 Ga0070688_101153306 3300005365 Bacteria 621
73 Ga0070659_100003485 3300005366 Bacteria 11201
74 Ga0070659_100165834 3300005366 Bacteria 1807
75 Ga0070667_100003614 3300005367 Bacteria 13156
76 Ga0070667_102074007 3300005367 Bacteria 536
77 Ga0070703_10015462 3300005406 Bacteria 2183
78 Ga0070709_10001232 3300005434 Bacteria 14032
79 Ga0070709_10002316 3300005434 Bacteria 10332
80 Ga0070709_10010455 3300005434 Bacteria 5143
81 Ga0070709_10022452 3300005434 Bacteria 3691
82 Ga0070709_10938746 3300005434 Bacteria 686
83 Ga0070714_100009083 3300005435 Bacteria 7794
84 Ga0070714_100017244 3300005435 Bacteria 5847
85 Ga0070714_100025578 3300005435 Bacteria 4872
86 Ga0070714_100026711 3300005435 Bacteria 4773
87 Ga0070714_100142833 3300005435 Bacteria 2150
88 Ga0070714_100177932 3300005435 Bacteria 1934
89 Ga0070714_100207603 3300005435 Bacteria 1794
90 Ga0070714_100562434 3300005435 Bacteria 1092
91 Ga0070714_101608588 3300005435 Bacteria 635
92 Ga0070713_100036694 3300005436 Bacteria 3957
93 Ga0070713_100056912 3300005436 Bacteria 3253
94 Ga0070713_100061311 3300005436 Bacteria 3146
95 Ga0070713_100095838 3300005436 Bacteria 2560
96 Ga0070713_100111867 3300005436 Bacteria 2382
97 Ga0070713_100610599 3300005436 Bacteria 1037
98 Ga0070713_100645737 3300005436 Bacteria 1007
99 Ga0070713_100734475 3300005436 Bacteria 944
100 Ga0070713_101400825 3300005436 Bacteria 678
101 Ga0070713_101869425 3300005436 Bacteria 583
102 Ga0070710_10005644 3300005437 Bacteria 5958
103 Ga0070710_10019970 3300005437 Bacteria 3470
104 Ga0070710_10058672 3300005437 Bacteria 2183
105 Ga0070710_10186643 3300005437 Bacteria 1301
106 Ga0070710_10236423 3300005437 Bacteria 1169
107 Ga0070710_10318422 3300005437 Bacteria 1020
108 Ga0070710_10470708 3300005437 Bacteria 855
109 Ga0070710_11123421 3300005437 Bacteria 578
110 Ga0070701_10000897 3300005438 Bacteria 10740
111 Ga0070711_100000834 3300005439 Bacteria 16154
112 Ga0070711_100004304 3300005439 Bacteria 8381
113 Ga0070711_100009870 3300005439 Bacteria 5888
114 Ga0070711_100155124 3300005439 Bacteria 1730
115 Ga0070711_100159576 3300005439 Bacteria 1708
116 Ga0070711_100663258 3300005439 Bacteria 875
117 Ga0070711_101839668 3300005439 Bacteria 531
118 Ga0070705_100022646 3300005440 Bacteria 3360
119 Ga0070705_100266449 3300005440 Bacteria 1211
120 Ga0070700_100002377 3300005441 Bacteria 9585
121 Ga0070700_100217734 3300005441 Bacteria 1351
122 Ga0070700_100387488 3300005441 Bacteria 1047
123 Ga0070700_100845120 3300005441 Bacteria 741
124 Ga0070700_101711775 3300005441 Bacteria 540
125 Ga0070694_100000195 3300005444 Bacteria 32086
126 Ga0070663_100000352 3300005455 Bacteria 24139
127 Ga0070663_100074211 3300005455 Bacteria 2483
128 Ga0070663_100573677 3300005455 Bacteria 946
129 Ga0070678_100001146 3300005456 Bacteria 14002
130 Ga0070678_100497827 3300005456 Bacteria 1075
131 Ga0070662_100000412 3300005457 Bacteria 25384
132 Ga0070662_100501700 3300005457 Bacteria 1012
133 Ga0070662_101006609 3300005457 Bacteria 713
134 Ga0070662_101760863 3300005457 Bacteria 535
135 Ga0070662_101984517 3300005457 Bacteria 503
136 Ga0070681_10329459 3300005458 Bacteria 1436
137 Ga0070681_10715142 3300005458 Bacteria 918
138 Ga0070681_11170398 3300005458 Bacteria 691
139 Ga0070681_11611799 3300005458 Bacteria 574
140 Ga0068867_100008499 3300005459 Bacteria 7247
141 Ga0068867_100077308 3300005459 Bacteria 2501
142 Ga0070685_10058987 3300005466 Bacteria 2239
143 Ga0070685_10665402 3300005466 Bacteria 756
144 Ga0070707_100127155 3300005468 Bacteria 2476
145 Ga0070698_100118731 3300005471 Bacteria 2605
146 Ga0070698_100482324 3300005471 Bacteria 1177
147 Ga0070699_100160319 3300005518 Bacteria 1990
148 Ga0070679_100040109 3300005530 Bacteria 4658
149 Ga0070679_100288276 3300005530 Bacteria 1593
150 Ga0070684_100047080 3300005535 Bacteria 3737
151 Ga0070684_100061861 3300005535 Bacteria 3278
152 Ga0070684_100356712 3300005535 Bacteria 1345
153 Ga0070684_100886686 3300005535 Bacteria 836
154 Ga0070684_100919194 3300005535 Bacteria 820
155 Ga0070697_100000391 3300005536 Bacteria 34002
156 Ga0070697_100077313 3300005536 Bacteria 2737
157 Ga0070697_101553947 3300005536 Bacteria 592
158 Ga0068853_100001082 3300005539 Bacteria 19264
159 Ga0068853_100345112 3300005539 Bacteria 1384
160 Ga0068853_101848518 3300005539 Bacteria 585
161 Ga0070672_100035019 3300005543 Bacteria 3813
162 Ga0070686_100001391 3300005544 Bacteria 13661
163 Ga0070695_100000238 3300005545 Bacteria 27265
164 Ga0070695_100385596 3300005545 Bacteria 1058
165 Ga0070696_100000815 3300005546 Bacteria 20059
166 Ga0070696_100031634 3300005546 Bacteria 3628
167 Ga0070696_100523824 3300005546 Bacteria 946
168 Ga0070693_100000455 3300005547 Bacteria 18375
169 Ga0070693_100579599 3300005547 Bacteria 807
170 Ga0070693_100721973 3300005547 Bacteria 731
171 Ga0070665_100022864 3300005548 Bacteria 6294
172 Ga0070665_100548593 3300005548 Bacteria 1168
173 Ga0070704_100000124 3300005549 Bacteria 27978
174 Ga0070704_100746471 3300005549 Bacteria 871
175 Ga0068855_100002691 3300005563 Bacteria 21916
176 Ga0068855_100220819 3300005563 Bacteria 2125
177 Ga0068855_100351567 3300005563 Bacteria 1623
178 Ga0068855_100464716 3300005563 Bacteria 1379
179 Ga0068855_100722076 3300005563 Bacteria 1065
180 Ga0070664_100002450 3300005564 Bacteria 14942
181 Ga0070664_100013985 3300005564 Bacteria 6544
182 Ga0070664_100963839 3300005564 Bacteria 801
183 Ga0070664_101879664 3300005564 Bacteria 568
184 Ga0068857_100008457 3300005577 Bacteria 8896
185 Ga0068857_100149759 3300005577 Bacteria 2113
186 Ga0068857_101190118 3300005577 Bacteria 738
187 Ga0068857_101263112 3300005577 Bacteria 716
188 Ga0068854_100007856 3300005578 Bacteria 6824
189 Ga0068854_100405940 3300005578 Bacteria 1128
190 Ga0068854_100596484 3300005578 Bacteria 942
191 Ga0068854_100770040 3300005578 Bacteria 836
192 Ga0068854_101112579 3300005578 Bacteria 704
193 Ga0068856_100001924 3300005614 Bacteria 21647
194 Ga0068856_100005122 3300005614 Bacteria 12946
195 Ga0068856_101512037 3300005614 Bacteria 685
196 Ga0070702_100000018 3300005615 Bacteria 47204
197 Ga0070702_100315096 3300005615 Bacteria 1088
198 Ga0070702_100375110 3300005615 Bacteria 1010
199 Ga0068852_100010938 3300005616 Bacteria 6801
200 Ga0068852_100225709 3300005616 Bacteria 1783
201 Ga0068852_100271636 3300005616 Bacteria 1631
202 Ga0068859_100131708 3300005617 Bacteria 2572
203 Ga0068859_100254511 3300005617 Bacteria 1847
204 Ga0068859_101714941 3300005617 Bacteria 694
205 Ga0068864_100002243 3300005618 Bacteria 15978
206 Ga0068864_100847013 3300005618 Bacteria 901
207 Ga0068864_101603329 3300005618 Bacteria 655
208 Ga0068866_10001983 3300005718 Bacteria 8531
209 Ga0068866_10472774 3300005718 Bacteria 824
210 Ga0068866_10579931 3300005718 Bacteria 754
211 Ga0068861_100000942 3300005719 Bacteria 17675
212 Ga0068851_10055130 3300005834 Bacteria 2025
213 Ga0068851_10281205 3300005834 Bacteria 951
214 Ga0068870_10379278 3300005840 Bacteria 915
215 Ga0068863_100007838 3300005841 Bacteria 10440
216 Ga0068863_100237421 3300005841 Bacteria 1759
217 Ga0068858_100019589 3300005842 Bacteria 6325
218 Ga0068858_100270677 3300005842 Bacteria 1616
219 Ga0068860_100000598 3300005843 Bacteria 43069
220 Ga0068860_100088076 3300005843 Bacteria 2955
221 Ga0068862_100008039 3300005844 Bacteria 8730
222 Ga0068862_100688014 3300005844 Bacteria 990
223 Ga0081455_10021909 3300005937 Bacteria 5985
224 Ga0081455_10288863 3300005937 Bacteria 1181
225 Ga0081538_10006855 3300005981 Bacteria 9922
226 Ga0081538_10029536 3300005981 Bacteria 3743
227 Ga0081540_1015691 3300005983 Bacteria 4782
228 Ga0081540_1017063 3300005983 Bacteria 4513
229 Ga0081540_1053318 3300005983 Bacteria 1984
230 Ga0081540_1065878 3300005983 Bacteria 1701
231 Ga0070717_10003669 3300006028 Bacteria 11020
232 Ga0070717_10027908 3300006028 Bacteria 4513
233 Ga0070717_10102080 3300006028 Bacteria 2436
234 Ga0070717_10381156 3300006028 Bacteria 1264
235 Ga0075365_10013851 3300006038 Bacteria 4838
236 Ga0075365_10452214 3300006038 Bacteria 907
237 Ga0075365_10749770 3300006038 Bacteria 689
238 Ga0075368_10218801 3300006042 Bacteria 809
239 Ga0075368_10282307 3300006042 Bacteria 714
240 Ga0075363_100113521 3300006048 Bacteria 1508
241 Ga0075364_10052785 3300006051 Bacteria 2657
242 Ga0075364_10057357 3300006051 Bacteria 2551
243 Ga0075364_10095261 3300006051 Bacteria 1979
244 Ga0075364_10220551 3300006051 Bacteria 1287
245 Ga0070715_10001643 3300006163 Bacteria 6622
246 Ga0070715_10312847 3300006163 Bacteria 845
247 Ga0070715_10321955 3300006163 Bacteria 835
248 Ga0070716_100001603 3300006173 Bacteria 10188
249 Ga0070716_100026432 3300006173 Bacteria 3108
250 Ga0070716_100079986 3300006173 Bacteria 1947
251 Ga0070716_100226032 3300006173 Bacteria 1260
252 Ga0070716_100397026 3300006173 Bacteria 990
253 Ga0070716_100477478 3300006173 Bacteria 915
254 Ga0070716_101460067 3300006173 Bacteria 558
255 Ga0070712_100027843 3300006175 Bacteria 3776
256 Ga0070712_100052247 3300006175 Bacteria 2849
257 Ga0070712_100058664 3300006175 Bacteria 2708
258 Ga0070712_100058938 3300006175 Bacteria 2702
259 Ga0070712_100201784 3300006175 Bacteria 1563
260 Ga0070712_100412647 3300006175 Bacteria 1117
261 Ga0070712_100515983 3300006175 Bacteria 1003
262 Ga0070712_101410515 3300006175 Bacteria 608
263 Ga0075362_10035975 3300006177 Bacteria 2164
264 Ga0075362_10049062 3300006177 Bacteria 1885
265 Ga0075362_10101966 3300006177 Bacteria 1343
266 Ga0075367_10111670 3300006178 Bacteria 1678
267 Ga0075367_10134243 3300006178 Bacteria 1531
268 Ga0075366_10359251 3300006195 Bacteria 895
269 Ga0075366_10627287 3300006195 Bacteria 667
270 Ga0097621_100107158 3300006237 Bacteria 2358
271 Ga0097621_100165361 3300006237 Bacteria 1904
272 Ga0097621_102073454 3300006237 Bacteria 544
273 Ga0075370_10243707 3300006353 Bacteria 1064
274 Ga0068871_100022307 3300006358 Bacteria 4881
275 Ga0068871_100286866 3300006358 Bacteria 1441
276 Ga0068871_100486469 3300006358 Bacteria 1111
277 Ga0068871_100682814 3300006358 Bacteria 940
278 Ga0075428_100054274 3300006844 Bacteria 4392
279 Ga0075428_100237574 3300006844 Bacteria 1966
280 Ga0075428_101096435 3300006844 Bacteria 841
281 Ga0075430_100103604 3300006846 Bacteria 2375
282 Ga0075431_100003503 3300006847 Bacteria 15211
283 Ga0075433_10023032 3300006852 Bacteria 5237
284 Ga0075434_100025071 3300006871 Bacteria 5834
285 Ga0075434_100036662 3300006871 Bacteria 4851
286 Ga0075434_100215192 3300006871 Bacteria 1941
287 Ga0075434_102159013 3300006871 Bacteria 561
288 Ga0075434_102196873 3300006871 Bacteria 556
289 Ga0075429_100024809 3300006880 Bacteria 5205
290 Ga0075429_101174029 3300006880 Bacteria 670
291 Ga0068865_100096538 3300006881 Bacteria 2155
292 Ga0068865_101186464 3300006881 Bacteria 675
293 Ga0075436_100008941 3300006914 Bacteria 6857
294 Ga0097620_100131716 3300006931 Bacteria 2572
295 Ga0097620_100254508 3300006931 Bacteria 1847
296 Ga0097620_101715029 3300006931 Bacteria 694
297 Ga0075435_100085522 3300007076 Bacteria 2596
298 Ga0075435_100102268 3300007076 Bacteria 2375
299 Ga0075435_100897708 3300007076 Bacteria 773
300 Ga0099795_10003174 3300007788 Bacteria 4033
301 Ga0105251_10110631 3300009011 Bacteria 1251
302 Ga0105250_10008602 3300009092 Bacteria 4327
303 Ga0105250_10188339 3300009092 Bacteria 868
304 Ga0105240_10230206 3300009093 Bacteria 2154
305 Ga0105240_10263935 3300009093 Bacteria 1985
306 Ga0105240_10304110 3300009093 Bacteria 1823
307 Ga0105240_10504075 3300009093 Bacteria 1345
308 Ga0105240_11509248 3300009093 Bacteria 704
309 Ga0111539_10100865 3300009094 Bacteria 3389
310 Ga0111539_10428106 3300009094 Bacteria 1541
311 Ga0111539_10658944 3300009094 Bacteria 1219
312 Ga0105245_10000718 3300009098 Bacteria 29853
313 Ga0105247_10001104 3300009101 Bacteria 20096
314 Ga0105247_10035209 3300009101 Bacteria 3051
315 Ga0105247_10603522 3300009101 Bacteria 814
316 Ga0114129_10401684 3300009147 Bacteria 1806
317 Ga0114129_11726057 3300009147 Bacteria 763
318 Ga0114129_12202468 3300009147 Bacteria 663
319 Ga0105243_10001752 3300009148 Bacteria 18680
320 Ga0105243_10362714 3300009148 Bacteria 1334
321 Ga0105241_10001866 3300009174 Bacteria 15988
322 Ga0105241_10088557 3300009174 Bacteria 2438
323 Ga0105241_10177796 3300009174 Bacteria 1763
324 Ga0105241_10256780 3300009174 Bacteria 1484
325 Ga0105242_10010515 3300009176 Bacteria 7104
326 Ga0105242_11411010 3300009176 Bacteria 724
327 Ga0105242_11845975 3300009176 Bacteria 644
328 Ga0105248_10002832 3300009177 Bacteria 19248
329 Ga0105237_10001618 3300009545 Bacteria 29243
330 Ga0105237_10394223 3300009545 Bacteria 1389
331 Ga0105237_10757616 3300009545 Bacteria 977
332 Ga0105237_10997033 3300009545 Bacteria 844
333 Ga0105237_11842462 3300009545 Bacteria 613
334 Ga0105238_10007984 3300009551 Bacteria 10588
335 Ga0105238_10437534 3300009551 Bacteria 1304
336 Ga0105238_10718602 3300009551 Bacteria 1011
337 Ga0105249_10000814 3300009553 Bacteria 28107
338 Ga0105249_10354541 3300009553 Bacteria 1487
339 Ga0105249_10378887 3300009553 Bacteria 1440
340 Ga0105249_10713244 3300009553 Bacteria 1064
341 Ga0099796_10002269 3300010159 Bacteria 4177
342 Ga0105239_10120316 3300010375 Bacteria 2915
343 Ga0105239_10143574 3300010375 Bacteria 2661
344 Ga0105239_10239229 3300010375 Bacteria 2038
345 Ga0105239_10296034 3300010375 Bacteria 1822
346 Ga0105239_10601978 3300010375 Bacteria 1254
347 Ga0105239_12790328 3300010375 Bacteria 570
348 Ga0105239_12945183 3300010375 Bacteria 555
349 Ga0105246_10002439 3300011119 Bacteria 11222
350 Ga0105246_10045899 3300011119 Bacteria 2978
351 Ga0105246_10120687 3300011119 Bacteria 1942
352 Ga0105246_10630391 3300011119 Bacteria 930
353 Ga0105246_12574566 3300011119 Bacteria 502
354 Ga0157327_1033127 3300012512 Bacteria 656
355 Ga0157373_10019849 3300013100 Bacteria 4890
356 Ga0157373_10027237 3300013100 Bacteria 4123
357 Ga0157373_11308834 3300013100 Bacteria 549
358 Ga0157371_10056437 3300013102 Bacteria 2786
359 Ga0157371_10347917 3300013102 Bacteria 1079
360 Ga0157371_10638770 3300013102 Bacteria 794
361 Ga0157370_10017001 3300013104 Bacteria 7351
362 Ga0157370_10461414 3300013104 Bacteria 1168
363 Ga0157370_10555656 3300013104 Bacteria 1052
364 Ga0157369_10164535 3300013105 Bacteria 2340
365 Ga0157369_10197436 3300013105 Bacteria 2112
366 Ga0157369_10312994 3300013105 Bacteria 1632
367 Ga0157369_10765468 3300013105 Bacteria 993
368 Ga0157369_11138607 3300013105 Bacteria 797
369 Ga0157369_11463227 3300013105 Bacteria 695
370 Ga0157369_12136507 3300013105 Bacteria 568
371 Ga0157374_10012339 3300013296 Bacteria 7433
372 Ga0157374_11221540 3300013296 Bacteria 773
373 Ga0157378_10000470 3300013297 Bacteria 38483
374 Ga0157378_11432213 3300013297 Bacteria 734
375 Ga0163162_10004532 3300013306 Bacteria 13382
376 Ga0163162_11073919 3300013306 Bacteria 912
377 Ga0163162_11470543 3300013306 Bacteria 776
378 Ga0163162_12543142 3300013306 Bacteria 589
379 Ga0163162_12605215 3300013306 Bacteria 582
380 Ga0157372_10001215 3300013307 Bacteria 27865
381 Ga0157372_10297910 3300013307 Bacteria 1876
382 Ga0157372_11055098 3300013307 Bacteria 941
383 Ga0157372_11378347 3300013307 Bacteria 813
384 Ga0157372_11623209 3300013307 Bacteria 744
385 Ga0157372_12129590 3300013307 Bacteria 644
386 Ga0157375_10012604 3300013308 Bacteria 7503
387 Ga0157375_11913853 3300013308 Bacteria 704
388 Ga0157375_13287897 3300013308 Bacteria 539
389 Ga0163163_10002129 3300014325 Bacteria 16714
390 Ga0163163_10005311 3300014325 Bacteria 11124
391 Ga0163163_12084633 3300014325 Bacteria 627
392 Ga0157380_10008515 3300014326 Bacteria 7329
393 Ga0157380_10027055 3300014326 Bacteria 4358
394 Ga0157380_11594359 3300014326 Bacteria 708
395 Ga0182008_10222662 3300014497 Bacteria 966
396 Ga0182008_10365970 3300014497 Bacteria 768
397 Ga0157377_10006965 3300014745 Bacteria 5428
398 Ga0157379_10001927 3300014968 Bacteria 17169
399 Ga0157379_10552180 3300014968 Bacteria 1072
400 Ga0157379_11730006 3300014968 Bacteria 613
401 Ga0157376_10000606 3300014969 Bacteria 23175
402 Ga0157376_10743776 3300014969 Bacteria 989
403 Ga0163161_10002394 3300017792 Bacteria 13438
404 Ga0163161_10573970 3300017792 Bacteria 927
405 Ga0206356_11853575 3300020070 Bacteria 897
406 Ga0206349_1277602 3300020075 Bacteria 1001
407 Ga0206355_1403799 3300020076 Bacteria 1190
408 Ga0206352_10097269 3300020078 Bacteria 589
409 Ga0206352_11227367 3300020078 Bacteria 518
410 Ga0206350_10960778 3300020080 Bacteria 819
411 Ga0206353_10857624 3300020082 Bacteria 1191
412 Ga0154015_1108290 3300020610 Bacteria 599
413 Ga0154015_1214890 3300020610 Bacteria 1033
414 Ga0213873_10106683 3300021358 Bacteria 810
415 Ga0213873_10313968 3300021358 Bacteria 508
416 Ga0213872_10023323 3300021361 Bacteria 2847
417 Ga0213872_10307143 3300021361 Bacteria 657
418 Ga0213874_10001821 3300021377 Bacteria 4469
419 Ga0213874_10009960 3300021377 Bacteria 2367
420 Ga0213874_10010979 3300021377 Bacteria 2283
421 Ga0213874_10220157 3300021377 Bacteria 690
422 Ga0213874_10264446 3300021377 Bacteria 638
423 Ga0213874_10275691 3300021377 Bacteria 627
424 Ga0213874_10354152 3300021377 Bacteria 563
425 Ga0213876_10002961 3300021384 Bacteria 9840
426 Ga0213876_10004772 3300021384 Bacteria 7531
427 Ga0213875_10000089 3300021388 Bacteria 105772
428 Ga0213875_10059627 3300021388 Bacteria 1786
429 Ga0213871_10016747 3300021441 Bacteria 1771
430 Ga0213871_10155626 3300021441 Bacteria 697
431 Ga0224712_10002117 3300022467 Bacteria 4832
432 Ga0224712_10050101 3300022467 Bacteria 1621
433 Ga0256714_113971 3300023304 Bacteria 616
434 Ga0256744_130108 3300023309 Bacteria 789
435 Ga0256743_128847 3300023436 Bacteria 579
436 Ga0256720_139806 3300023438 Bacteria 784
437 Ga0209677_100816 3300025253 Bacteria 15575
438 Ga0209148_1004162 3300025254 Bacteria 3638
439 Ga0209148_1008955 3300025254 Bacteria 1982
440 Ga0209233_1003250 3300025261 Bacteria 5762
441 Ga0209455_1009081 3300025272 Bacteria 2639
442 Ga0209455_1038588 3300025272 Bacteria 743
443 Ga0209758_1040129 3300025297 Bacteria 1770
444 Ga0207697_10057185 3300025315 Bacteria 1619
445 Ga0207656_10012084 3300025321 Bacteria 3278
446 Ga0207656_10173122 3300025321 Bacteria 1033
447 Ga0207696_1128942 3300025711 Bacteria 680
448 Ga0207713_1157248 3300025735 Bacteria 728
449 Ga0207653_10032934 3300025885 Bacteria 1678
450 Ga0207682_10132490 3300025893 Bacteria 1113
451 Ga0207692_10002601 3300025898 Bacteria 6941
452 Ga0207692_10039674 3300025898 Bacteria 2318
453 Ga0207692_10075631 3300025898 Bacteria 1787
454 Ga0207642_10091188 3300025899 Bacteria 1505
455 Ga0207642_10845179 3300025899 Bacteria 584
456 Ga0207710_10003497 3300025900 Bacteria 6990
457 Ga0207688_10002614 3300025901 Bacteria 9749
458 Ga0207688_10044664 3300025901 Bacteria 2469
459 Ga0207680_10006344 3300025903 Bacteria 5711
460 Ga0207647_10001956 3300025904 Bacteria 15734
461 Ga0207647_10027406 3300025904 Bacteria 3714
462 Ga0207685_10005152 3300025905 Bacteria 3415
463 Ga0207685_10019197 3300025905 Bacteria 2249
464 Ga0207685_10075667 3300025905 Bacteria 1378
465 Ga0207685_10103277 3300025905 Bacteria 1222
466 Ga0207685_10228851 3300025905 Bacteria 888
467 Ga0207699_10000692 3300025906 Bacteria 16128
468 Ga0207699_10008214 3300025906 Bacteria 5139
469 Ga0207699_10028433 3300025906 Bacteria 3107
470 Ga0207699_10062019 3300025906 Bacteria 2252
471 Ga0207699_10421039 3300025906 Bacteria 954
472 Ga0207699_10731373 3300025906 Bacteria 725
473 Ga0207699_11028083 3300025906 Unclassified 609
474 Ga0207699_11057182 3300025906 Bacteria 601
475 Ga0207643_10116032 3300025908 Bacteria 1581
476 Ga0207705_10093610 3300025909 Bacteria 2203
477 Ga0207705_10244702 3300025909 Bacteria 1367
478 Ga0207705_10348126 3300025909 Bacteria 1141
479 Ga0207705_10933880 3300025909 Bacteria 671
480 Ga0207705_11096131 3300025909 Bacteria 613
481 Ga0207654_10003285 3300025911 Bacteria 8172
482 Ga0207654_10185216 3300025911 Bacteria 1361
483 Ga0207654_10534960 3300025911 Bacteria 831
484 Ga0207707_10074687 3300025912 Bacteria 2957
485 Ga0207707_10298153 3300025912 Bacteria 1394
486 Ga0207707_10734408 3300025912 Bacteria 827
487 Ga0207695_10056587 3300025913 Bacteria 4080
488 Ga0207695_10104513 3300025913 Bacteria 2821
489 Ga0207695_10228101 3300025913 Bacteria 1768
490 Ga0207695_10284481 3300025913 Bacteria 1547
491 Ga0207695_10930390 3300025913 Bacteria 749
492 Ga0207671_10057494 3300025914 Bacteria 2883
493 Ga0207671_10120775 3300025914 Bacteria 2003
494 Ga0207671_10332555 3300025914 Bacteria 1203
495 Ga0207671_10659429 3300025914 Bacteria 833
496 Ga0207693_10000493 3300025915 Bacteria 35669
497 Ga0207693_10008270 3300025915 Bacteria 8519
498 Ga0207693_10030071 3300025915 Bacteria 4288
499 Ga0207693_10059279 3300025915 Bacteria 2998
500 Ga0207693_10112539 3300025915 Bacteria 2135
501 Ga0207693_10159520 3300025915 Bacteria 1774
502 Ga0207693_10635016 3300025915 Bacteria 830
503 Ga0207693_10705887 3300025915 Bacteria 781
504 Ga0207693_11179653 3300025915 Bacteria 578
505 Ga0207663_10001067 3300025916 Bacteria 12565
506 Ga0207663_10012076 3300025916 Bacteria 4657
507 Ga0207663_10466318 3300025916 Bacteria 976
508 Ga0207663_10961543 3300025916 Bacteria 684
509 Ga0207663_10967373 3300025916 Bacteria 682
510 Ga0207660_10644243 3300025917 Bacteria 864
511 Ga0207660_11115557 3300025917 Bacteria 643
512 Ga0207660_11293772 3300025917 Bacteria 592
513 Ga0207662_10002067 3300025918 Bacteria 9951
514 Ga0207657_10000282 3300025919 Bacteria 54101
515 Ga0207657_10051869 3300025919 Bacteria 3564
516 Ga0207657_10620448 3300025919 Bacteria 843
517 Ga0207657_11124284 3300025919 Bacteria 600
518 Ga0207649_10017750 3300025920 Bacteria 4034
519 Ga0207649_10239309 3300025920 Bacteria 1302
520 Ga0207652_10104736 3300025921 Bacteria 2502
521 Ga0207652_10179342 3300025921 Bacteria 1903
522 Ga0207652_10298273 3300025921 Bacteria 1454
523 Ga0207646_10920567 3300025922 Bacteria 775
524 Ga0207646_10983489 3300025922 Bacteria 746
525 Ga0207681_10015153 3300025923 Bacteria 4807
526 Ga0207694_10006423 3300025924 Bacteria 8959
527 Ga0207694_10137335 3300025924 Bacteria 1964
528 Ga0207694_10234115 3300025924 Bacteria 1500
529 Ga0207650_10069986 3300025925 Bacteria 2636
530 Ga0207659_10005250 3300025926 Bacteria 7843
531 Ga0207659_11051182 3300025926 Bacteria 701
532 Ga0207687_10008551 3300025927 Bacteria 6694
533 Ga0207700_10014261 3300025928 Bacteria 5201
534 Ga0207700_10071645 3300025928 Bacteria 2669
535 Ga0207700_10104591 3300025928 Bacteria 2265
536 Ga0207700_10574500 3300025928 Bacteria 1002
537 Ga0207700_10580562 3300025928 Bacteria 997
538 Ga0207700_10669401 3300025928 Bacteria 926
539 Ga0207700_10929541 3300025928 Bacteria 778
540 Ga0207700_11315927 3300025928 Bacteria 644
541 Ga0207700_11901970 3300025928 Bacteria 521
542 Ga0207664_10012756 3300025929 Bacteria 6015
543 Ga0207664_10023422 3300025929 Bacteria 4626
544 Ga0207664_10054900 3300025929 Bacteria 3159
545 Ga0207664_10086181 3300025929 Bacteria 2565
546 Ga0207664_10125208 3300025929 Bacteria 2157
547 Ga0207664_10303495 3300025929 Bacteria 1405
548 Ga0207664_10503883 3300025929 Bacteria 1084
549 Ga0207644_10048201 3300025931 Bacteria 3044
550 Ga0207690_10003444 3300025932 Bacteria 9444
551 Ga0207690_10019766 3300025932 Bacteria 4153
552 Ga0207706_10000270 3300025933 Bacteria 56584
553 Ga0207706_10008316 3300025933 Bacteria 9567
554 Ga0207706_10200935 3300025933 Bacteria 1748
555 Ga0207706_10302615 3300025933 Bacteria 1393
556 Ga0207709_10048849 3300025935 Bacteria 2580
557 Ga0207709_10120230 3300025935 Bacteria 1772
558 Ga0207709_11104993 3300025935 Bacteria 651
559 Ga0207670_10092363 3300025936 Bacteria 2142
560 Ga0207669_10002208 3300025937 Bacteria 8271
561 Ga0207669_10129680 3300025937 Bacteria 1730
562 Ga0207669_10292009 3300025937 Bacteria 1235
563 Ga0207704_10395404 3300025938 Bacteria 1089
564 Ga0207704_11004593 3300025938 Bacteria 706
565 Ga0207665_10001538 3300025939 Bacteria 15513
566 Ga0207665_10010112 3300025939 Bacteria 6196
567 Ga0207665_10070979 3300025939 Bacteria 2377
568 Ga0207665_10103792 3300025939 Bacteria 1989
569 Ga0207665_10368058 3300025939 Bacteria 1088
570 Ga0207665_10501814 3300025939 Bacteria 937
571 Ga0207665_10578776 3300025939 Bacteria 875
572 Ga0207665_11010106 3300025939 Bacteria 662
573 Ga0207691_10053192 3300025940 Bacteria 3697
574 Ga0207711_10137545 3300025941 Bacteria 2195
575 Ga0207711_10543545 3300025941 Bacteria 1084
576 Ga0207689_10885848 3300025942 Bacteria 753
577 Ga0207661_10025741 3300025944 Bacteria 4476
578 Ga0207661_10050770 3300025944 Bacteria 3306
579 Ga0207661_10148369 3300025944 Bacteria 2025
580 Ga0207661_10847999 3300025944 Bacteria 841
581 Ga0207661_12008276 3300025944 Bacteria 524
582 Ga0207679_10004166 3300025945 Bacteria 8986
583 Ga0207679_10371865 3300025945 Bacteria 1251
584 Ga0207679_10841364 3300025945 Bacteria 838
585 Ga0207667_10011595 3300025949 Bacteria 10234
586 Ga0207667_10186152 3300025949 Bacteria 2131
587 Ga0207667_10309951 3300025949 Bacteria 1612
588 Ga0207651_10004358 3300025960 Bacteria 7116
589 Ga0207712_10047767 3300025961 Bacteria 2974
590 Ga0207712_10738205 3300025961 Bacteria 862
591 Ga0207668_10006213 3300025972 Bacteria 7052
592 Ga0207668_10039960 3300025972 Bacteria 3162
593 Ga0207668_11612398 3300025972 Bacteria 586
594 Ga0207640_10002653 3300025981 Bacteria 9576
595 Ga0207640_10003639 3300025981 Bacteria 8314
596 Ga0207640_10209176 3300025981 Bacteria 1485
597 Ga0207658_10023872 3300025986 Bacteria 4272
598 Ga0207658_11557595 3300025986 Bacteria 604
599 Ga0207677_10103809 3300026023 Bacteria 2099
600 Ga0207677_11197635 3300026023 Bacteria 695
601 Ga0207703_10433391 3300026035 Bacteria 1225
602 Ga0207703_10688729 3300026035 Bacteria 971
603 Ga0207703_10776479 3300026035 Bacteria 914
604 Ga0207639_10000784 3300026041 Bacteria 21626
605 Ga0207639_10017244 3300026041 Bacteria 5119
606 Ga0207678_10000159 3300026067 Bacteria 56028
607 Ga0207678_10000477 3300026067 Bacteria 36336
608 Ga0207678_10476999 3300026067 Bacteria 1086
609 Ga0207708_10000337 3300026075 Bacteria 36962
610 Ga0207708_10282110 3300026075 Bacteria 1346
611 Ga0207708_10441466 3300026075 Bacteria 1082
612 Ga0207702_10007687 3300026078 Bacteria 9165
613 Ga0207702_10046306 3300026078 Bacteria 3661
614 Ga0207702_10458876 3300026078 Bacteria 1237
615 Ga0207641_10017486 3300026088 Bacteria 5870
616 Ga0207641_11062543 3300026088 Bacteria 807
617 Ga0207648_10102108 3300026089 Bacteria 2513
618 Ga0207648_10363858 3300026089 Bacteria 1305
619 Ga0207676_10825727 3300026095 Bacteria 905
620 Ga0207674_10018829 3300026116 Bacteria 7490
621 Ga0207674_10030575 3300026116 Bacteria 5660
622 Ga0207674_10621991 3300026116 Bacteria 1043
623 Ga0207675_100001292 3300026118 Bacteria 25099
624 Ga0207675_100149393 3300026118 Bacteria 2223
625 Ga0207675_101393715 3300026118 Bacteria 722
626 Ga0207683_10001738 3300026121 Bacteria 19398
627 Ga0207683_10353704 3300026121 Bacteria 1348
628 Ga0207683_10966376 3300026121 Bacteria 791
629 Ga0207683_11094234 3300026121 Bacteria 739
630 Ga0207698_10021538 3300026142 Bacteria 4461
631 Ga0207698_10768882 3300026142 Bacteria 963
632 Ga0207698_11455564 3300026142 Bacteria 700
633 Ga0209179_1003967 3300027512 Bacteria 2191
634 Ga0209966_1085348 3300027695 Bacteria 703
635 Ga0209998_10038761 3300027717 Bacteria 1076
636 Ga0209998_10125883 3300027717 Bacteria 648
637 Ga0207428_10008303 3300027907 Bacteria 9386
638 Ga0207428_10670860 3300027907 Bacteria 743
639 Ga0268266_10206194 3300028379 Bacteria 1801
640 Ga0268266_10630747 3300028379 Bacteria 1031
641 Ga0268265_10612294 3300028380 Bacteria 1042
642 Ga0268264_10000377 3300028381 Bacteria 65413
643 Ga0268264_10015446 3300028381 Bacteria 6262
644 Ga0268264_10910854 3300028381 Bacteria 883
645 Ga0307515_10248135 3300028794 Bacteria 1538
646 Ga0311000_100475 3300029272 Bacteria 638
647 Ga0311004_113545 3300029276 Bacteria 667
648 Ga0311001_1079354 3300029277 Bacteria 5162
649 Ga0310981_1002449 3300029285 Bacteria 2299
650 Ga0307511_10057801 3300030521 Bacteria 3009
651 Ga0265340_10045595 3300031247 Bacteria 2141
652 Ga0265339_10011362 3300031249 Bacteria 5484
653 Ga0265327_10069811 3300031251 Bacteria 1762
654 Ga0307513_10340634 3300031456 Bacteria 1250
655 Ga0307509_10276688 3300031507 Bacteria 1442
656 Ga0307408_100016009 3300031548 Bacteria 5000
657 Ga0307408_100092650 3300031548 Bacteria 2284
658 Ga0307408_100395387 3300031548 Bacteria 1185
659 Ga0307408_100681236 3300031548 Bacteria 922
660 Ga0307408_102164597 3300031548 Bacteria 537
661 Ga0307508_10000378 3300031616 Bacteria 53801
662 Ga0307508_10014201 3300031616 Bacteria 7263
663 Ga0310105_121407 3300031666 Bacteria 503
664 Ga0316579_10240025 3300031691 Bacteria 877
665 Ga0265314_10636688 3300031711 Unclassified 545
666 Ga0316576_10978254 3300031727 Bacteria 604
667 Ga0307516_10019779 3300031730 Bacteria 6965
668 Ga0307405_10020264 3300031731 Bacteria 3712
669 Ga0307405_10610613 3300031731 Bacteria 891
670 Ga0307405_10828608 3300031731 Bacteria 777
671 Ga0307405_11844834 3300031731 Bacteria 538
672 Ga0316577_10382766 3300031733 Bacteria 799
673 Ga0307413_11016513 3300031824 Bacteria 711
674 Ga0307410_10088334 3300031852 Bacteria 2194
675 Ga0307410_10159678 3300031852 Bacteria 1687
676 Ga0307410_10384358 3300031852 Bacteria 1130
677 Ga0307410_10678337 3300031852 Bacteria 867
678 Ga0307410_11601175 3300031852 Bacteria 575
679 Ga0307410_11820968 3300031852 Bacteria 541
680 Ga0326468_10002343 3300031889 Bacteria 1579
681 Ga0307406_10173110 3300031901 Bacteria 1564
682 Ga0307406_10326285 3300031901 Bacteria 1189
683 Ga0307406_10608954 3300031901 Bacteria 902
684 Ga0307406_10802626 3300031901 Bacteria 794
685 Ga0307407_10126458 3300031903 Bacteria 1629
686 Ga0307407_10545266 3300031903 Bacteria 856
687 Ga0307412_10001095 3300031911 Bacteria 15519
688 Ga0307412_10102836 3300031911 Bacteria 2024
689 Ga0307412_11036061 3300031911 Bacteria 727
690 Ga0307409_100004876 3300031995 Bacteria 7628
691 Ga0307409_100837912 3300031995 Bacteria 929
692 Ga0307409_101915378 3300031995 Bacteria 622
693 Ga0307416_100036609 3300032002 Bacteria 3765
694 Ga0307416_100057739 3300032002 Bacteria 3142
695 Ga0307416_100419408 3300032002 Bacteria 1382
696 Ga0307416_100824435 3300032002 Bacteria 1024
697 Ga0307414_10054953 3300032004 Bacteria 2785
698 Ga0307411_10077414 3300032005 Bacteria 2276
699 Ga0307411_10528563 3300032005 Bacteria 1002
700 Ga0307411_11376330 3300032005 Bacteria 645
701 Ga0307415_100292801 3300032126 Bacteria 1345
702 Ga0307415_101649487 3300032126 Bacteria 617
703 Ga0316583_10263990 3300032133 Bacteria 596
704 Ga0307507_10070872 3300033179 Bacteria 3157
705 Ga0307510_10243235 3300033180 Bacteria 1292
706 Ga0316596_1037368 3300033541 Bacteria 1270
707 Ga0316215_1002459 3300033544 Bacteria 1751
708 Ga0373950_0005337 3300034818 Bacteria 1917
709 Ga0373958_0005093 3300034819 Bacteria 1979
710 Ga0373959_0030593 3300034820 Bacteria 1085
711 Ga0373938_0003982 3300034957 Bacteria 2442
712 Ga0373926_0003147 3300035083 Bacteria 5299
713 Ga0373926_0005778 3300035083 Bacteria 4089
714 Ga0373928_0006912 3300035084 Bacteria 2186
715 Ga0373940_0072756 3300035088 Bacteria 1004
716 Ga0373944_0445889 3300035089 Bacteria 504
717 Ga0373949_0011140 3300035090 Bacteria 1978
718 Ga0373952_0016138 3300035092 Bacteria 1514
719 Ga0373932_0062532 3300035112 Bacteria 1135
720 Ga0373936_0010464 3300035113 Bacteria 3500
721 Ga0373936_0015906 3300035113 Bacteria 2887
722 Ga0373936_0341737 3300035113 Bacteria 681
723 Ga0373939_0010461 3300035114 Bacteria 2321
724 Ga0373941_0044026 3300035115 Bacteria 1391
725 Ga0373945_0012687 3300035116 Bacteria 2802
726 Ga0373945_0171395 3300035116 Bacteria 889
727 Ga0373953_0099066 3300035117 Bacteria 1225
728 Ga0373953_0106539 3300035117 Bacteria 1183
729 Ga0373954_0006766 3300035118 Bacteria 5002
730 Ga0373956_0012723 3300035119 Bacteria 3493
731 Ga0373957_0106937 3300035120 Bacteria 1124
732 Ga0373957_0168239 3300035120 Bacteria 905
733 Ga0373960_0001622 3300035121 Bacteria 5029
734 Ga0373943_0010548 3300035170 Bacteria 4141
735 Ga0373943_0017321 3300035170 Bacteria 3296
736 Ga0373943_0124534 3300035170 Bacteria 1373
737 Ga0373946_0019180 3300035171 Bacteria 2633
738 Ga0373946_0359825 3300035171 Bacteria 729
739 Ga0373955_0020793 3300035172 Bacteria 3303
740 Ga0373955_0126635 3300035172 Bacteria 1488
741 Ga0373942_0152487 3300035207 Bacteria 743
742 Ga0373962_0126509 3300035242 Bacteria 819
743 Ga0373924_0014731 3300035410 Bacteria 2958
744 Ga0373924_0201528 3300035410 Bacteria 878
745 Ga0373931_0030144 3300035691 Bacteria 2791
746 Ga0373931_0062360 3300035691 Bacteria 2012
747 Ga0373931_0823862 3300035691 Bacteria 620
748 Ga0373935_0012257 3300035692 Bacteria 5156
749 Ga0373935_0053250 3300035692 Bacteria 2574
750 Ga0373935_0286934 3300035692 Bacteria 1160
751 Ga0373927_0004904 3300035695 Bacteria 9294
752 Ga0373927_0222869 3300035695 Bacteria 1238
753 Ga0373927_0333387 3300035695 Bacteria 999
754 Ga0373933_0010736 3300035724 Bacteria 5025
755 Ga0373933_0196707 3300035724 Bacteria 1289
756 Ga0373933_0875935 3300035724 Bacteria 591
757 Ga0373947_0009798 3300035725 Bacteria 5497
758 Ga0373947_0034111 3300035725 Bacteria 3009
759 Ga0373947_0398099 3300035725 Bacteria 928
760 Ga0373947_0871454 3300035725 Bacteria 615
761 Ga0310104_00193 3300036242 Bacteria 3346
762 Ga0373937_0031089 3300036401 Bacteria 4835
763 Ga0373937_0050692 3300036401 Bacteria 3802
764 Ga0373937_0425070 3300036401 Bacteria 1261
765 Ga0316582_0181961 3300036647 Bacteria 1430
766 Ga0373925_0024722 3300037068 Bacteria 4386
767 Ga0373925_0039116 3300037068 Bacteria 3508
768 Ga0373925_0586461 3300037068 Bacteria 918
769 Ga0373925_0685520 3300037068 Bacteria 845
770 Ga0395899_0072585 3300037312 Bacteria 2518
771 Ga0395899_0204290 3300037312 Bacteria 1376
772 Ga0395899_0701927 3300037312 Bacteria 634
773 Ga0395900_0238023 3300037418 Bacteria 1827
774 Ga0395900_0343977 3300037418 Bacteria 1466
775 Ga0395900_0369151 3300037418 Bacteria 1405
776 Ga0395900_0493002 3300037418 Bacteria 1176
777 Ga0395898_0007760 3300037466 Bacteria 11394
778 Ga0395898_0055115 3300037466 Bacteria 3878
779 Ga0395898_0064043 3300037466 Bacteria 3567
780 Ga0395898_0294093 3300037466 Bacteria 1549
781 Ga0395898_0917040 3300037466 Bacteria 814
782 Ga0395898_1122328 3300037466 Bacteria 719
783 Ga0395905_0002506 3300037471 Bacteria 20297
784 Ga0395905_0112513 3300037471 Bacteria 2557
785 Ga0395905_0217669 3300037471 Bacteria 1788
786 Ga0436364_0089033 3300037853 Bacteria 2364
787 Ga0436364_0333324 3300037853 Bacteria 10396
788 Ga0436364_0335675 3300037853 Bacteria 1232
789 Ga0436364_0508030 3300037853 Bacteria 1342
790 Ga0436364_0554121 3300037853 Bacteria 902
791 Ga0436364_1191222 3300037853 Bacteria 1265
792 Ga0436364_1352603 3300037853 Bacteria 2275
793 Ga0395901_0002674 3300038443 Bacteria 17986
794 Ga0395901_0132044 3300038443 Bacteria 2624
795 Ga0395901_0318811 3300038443 Bacteria 1609
796 Ga0395901_0408662 3300038443 Bacteria 1394
797 Ga0395901_0637417 3300038443 Bacteria 1070
798 Ga0395901_1012464 3300038443 Bacteria 806
799 Ga0242420_011095 3300038996 Bacteria 1506
800 Ga0436365_0368899 3300039437 Bacteria 1973
801 Ga0436365_0870893 3300039437 Bacteria 2017
802 Ga0436365_1010396 3300039437 Bacteria 801
803 Ga0436365_1047672 3300039437 Bacteria 1074
804 Ga0436365_1253031 3300039437 Bacteria 47093
805 Ga0436365_1350477 3300039437 Bacteria 523
806 Ga0436365_1529438 3300039437 Bacteria 926
807 Ga0436365_1760276 3300039437 Bacteria 874
808 Ga0436365_1870318 3300039437 Bacteria 5247
809 Ga0436365_1902820 3300039437 Bacteria 1335
810 Ga0436360_0409482 3300039438 Bacteria 1423
811 Ga0436360_0777771 3300039438 Bacteria 1037
812 Ga0436360_0885775 3300039438 Bacteria 829
813 Ga0436360_0888847 3300039438 Bacteria 573
814 Ga0436360_1268636 3300039438 Bacteria 533
815 Ga0436361_0317849 3300039447 Bacteria 1007
816 Ga0436361_0427976 3300039447 Bacteria 1496
817 Ga0436361_0763086 3300039447 Bacteria 801
818 Ga0436361_0963669 3300039447 Bacteria 3298
819 Ga0436363_0131403 3300039450 Bacteria 1132
820 Ga0436363_0242717 3300039450 Bacteria 589
821 Ga0436363_0312775 3300039450 Bacteria 1035
822 Ga0436363_0880899 3300039450 Bacteria 6318
823 Ga0436363_1014283 3300039450 Bacteria 1082
824 Ga0436363_1046285 3300039450 Bacteria 10399
825 Ga0436363_1113612 3300039450 Bacteria 631
826 Ga0436363_1387407 3300039450 Bacteria 1077
827 Ga0436363_1575848 3300039450 Bacteria 1027
828 Ga0436363_1627336 3300039450 Bacteria 720
829 Ga0436362_0002334 3300039453 Bacteria 939
830 Ga0436362_0607333 3300039453 Bacteria 833
831 Ga0436362_0793870 3300039453 Bacteria 1297
832 Ga0436362_0982213 3300039453 Bacteria 745
833 Ga0436362_1142159 3300039453 Bacteria 1204
834 Ga0439439_0132040 3300041406 Bacteria 702
835 Ga0439465_0053801 3300041413 Bacteria 1323
836 Ga0439465_0127160 3300041413 Bacteria 897
837 Ga0451794_34969 3300041446 Bacteria 594
838 Ga0451798_0606664 3300041458 Bacteria 500
839 Ga0451807_2208106 3300041486 Bacteria 579
840 Ga0451837_0342915 3300041494 Bacteria 1221
841 Ga0451855_0769345 3300041511 Bacteria 513
842 Ga0451853_3344493 3300041512 Bacteria 740
843 Ga0439431_0094769 3300041997 Bacteria 816
844 Ga0439432_128392 3300042006 Bacteria 749
845 Ga0439457_151757 3300042014 Bacteria 558
846 Ga0450900_053254 3300042136 Bacteria 623
847 Ga0450903_051975 3300042138 Bacteria 599
848 Ga0439459_0018016 3300042438 Bacteria 1323
849 Ga0450901_002715 3300042533 Bacteria 1880
850 Ga0466969_0217487 3300044656 Bacteria 869
851 Ga0466969_0511409 3300044656 Bacteria 548
852 Ga0466965_0333684 3300044683 Bacteria 828
853 Ga0466966_0037447 3300044684 Bacteria 3128
854 Ga0466966_0038631 3300044684 Bacteria 3076
855 Ga0466966_0063022 3300044684 Bacteria 2337
856 Ga0466961_0017735 3300044693 Bacteria 4574
857 Ga0466961_0058522 3300044693 Bacteria 2452
858 Ga0466963_0016197 3300044694 Bacteria 4633
859 Ga0466963_0037303 3300044694 Bacteria 3172
860 Ga0466963_0070352 3300044694 Bacteria 2353
861 Ga0466963_0354875 3300044694 Bacteria 1033
862 Ga0466963_0358283 3300044694 Bacteria 1027
863 Ga0466963_0543930 3300044694 Bacteria 820
864 Ga0466964_0475103 3300044706 Bacteria 667
865 Ga0466971_0080841 3300044719 Bacteria 1482
866 Ga0466971_0675604 3300044719 Bacteria 518
867 Ga0466968_0060841 3300044735 Bacteria 1628
868 Ga0466970_0122687 3300044765 Bacteria 1424
869 Ga0466970_0201450 3300044765 Bacteria 1107
870 Ga0466970_0506738 3300044765 Bacteria 695
871 Ga0466957_0014805 3300044842 Bacteria 4545
872 Ga0466957_0075585 3300044842 Bacteria 2090
873 Ga0466957_0318692 3300044842 Bacteria 1048
874 Ga0466957_0935663 3300044842 Bacteria 620
875 Ga0466960_0051465 3300044901 Bacteria 1990
876 Ga0466960_0958273 3300044901 Bacteria 524
877 Ga0466959_0098844 3300045049 Bacteria 2090
878 Ga0466959_0744194 3300045049 Bacteria 656
879 Ga0466967_0011664 3300045976 Bacteria 6675
880 Ga0466967_0056204 3300045976 Bacteria 3469
881 Ga0466967_0096571 3300045976 Bacteria 2696
882 Ga0466967_0434220 3300045976 Bacteria 1281
883 Ga0466967_0471064 3300045976 Bacteria 1229
884 Ga0466967_1078797 3300045976 Bacteria 800
885 Ga0495617_093369 3300046452 Bacteria 981
886 Ga0495603_0011756 3300046455 Bacteria 5297
887 Ga0495603_0725840 3300046455 Bacteria 568
888 Ga0495629_0026319 3300046459 Bacteria 4133
889 Ga0495629_0589356 3300046459 Bacteria 744
890 Ga0495641_0210957 3300046461 Bacteria 871
891 Ga0495651_0353235 3300046462 Bacteria 971
892 Ga0495651_0361100 3300046462 Bacteria 957
893 Ga0495650_0056786 3300046471 Bacteria 1587
894 Ga0495580_0111434 3300046472 Bacteria 1900
895 Ga0495580_0791263 3300046472 Bacteria 615
896 Ga0495582_0016883 3300046473 Bacteria 3997
897 Ga0495639_0026164 3300046475 Bacteria 2577
898 Ga0495662_0031478 3300046476 Bacteria 2562
899 Ga0495664_0018921 3300046477 Bacteria 3953
900 Ga0495584_0038672 3300046491 Bacteria 2411
901 Ga0495606_0055089 3300046507 Bacteria 2573
902 Ga0495608_0912010 3300046511 Bacteria 514
903 Ga0495618_0043838 3300046514 Bacteria 2822
904 Ga0495618_0926569 3300046514 Bacteria 502
905 Ga0495630_0095907 3300046517 Bacteria 2242
906 Ga0495630_0170546 3300046517 Bacteria 1658
907 Ga0495630_0274888 3300046517 Bacteria 1287
908 Ga0495666_0087221 3300046526 Bacteria 1474
909 Ga0495652_0204382 3300046529 Bacteria 1496
910 Ga0495652_0526129 3300046529 Bacteria 816
911 Ga0495665_0039396 3300046531 Bacteria 2517
912 Ga0495665_0168192 3300046531 Bacteria 1142
913 Ga0495640_0019304 3300046533 Bacteria 5035
914 Ga0495640_0127966 3300046533 Bacteria 1646
915 Ga0495586_0136518 3300046535 Bacteria 1375
916 Ga0495586_0158041 3300046535 Bacteria 1278
917 Ga0495587_0239915 3300046536 Bacteria 1020
918 Ga0495597_0068164 3300046542 Bacteria 1538
919 Ga0495645_0003533 3300046543 Bacteria 10576
920 Ga0495622_0204243 3300046557 Bacteria 879
921 Ga0495622_0452756 3300046557 Bacteria 550
922 Ga0495667_0108852 3300046559 Bacteria 1790
923 Ga0495667_0319903 3300046559 Bacteria 982
924 Ga0495656_0482666 3300046615 Bacteria 656
925 Ga0495668_0426247 3300046616 Bacteria 730
926 Ga0495668_0430953 3300046616 Bacteria 725
927 Ga0495634_0015564 3300046642 Bacteria 5459
928 Ga0495634_0209436 3300046642 Bacteria 1208
929 Ga0495625_0265563 3300046660 Bacteria 1109
930 Ga0495625_0747054 3300046660 Bacteria 574
931 Ga0495635_0099960 3300046663 Bacteria 1982
932 Ga0495635_0260117 3300046663 Bacteria 1169
933 Ga0495635_0810117 3300046663 Bacteria 603
934 Ga0495657_0732641 3300046675 Bacteria 567
935 Ga0495657_0864147 3300046675 Bacteria 515
936 Ga0495599_0154630 3300046678 Bacteria 1419
937 Ga0495599_0165274 3300046678 Bacteria 1367
938 Ga0495623_0224284 3300046679 Bacteria 1069
939 Ga0495623_0315983 3300046679 Bacteria 859
940 Ga0495646_0054443 3300046680 Bacteria 2406
941 Ga0495646_0560632 3300046680 Bacteria 583
942 Ga0495647_0005756 3300046681 Bacteria 4074
943 Ga0495658_0398360 3300046683 Bacteria 877
944 Ga0495613_0078402 3300046689 Bacteria 2403
945 Ga0495624_0051066 3300046690 Bacteria 2618
946 Ga0495624_0186772 3300046690 Bacteria 1261
947 Ga0495600_0144763 3300046809 Bacteria 1541
948 Ga0495581_0033672 3300047315 Bacteria 2966
949 Ga0495604_0190355 3300047317 Bacteria 1430
950 Ga0495604_0317839 3300047317 Bacteria 1041
951 Ga0495604_0453169 3300047317 Bacteria 838
952 Ga0495604_0644638 3300047317 Bacteria 676
953 Ga0495674_0010137 3300047319 Bacteria 8927
954 Ga0495676_0156541 3300047321 Bacteria 1616
955 Ga0495680_0263931 3300047322 Bacteria 1217
956 Ga0495680_0366455 3300047322 Bacteria 1000
957 Ga0495680_0474417 3300047322 Bacteria 853
958 Ga0495680_0621850 3300047322 Bacteria 720
959 Ga0495675_0033574 3300047444 Bacteria 3275
960 Ga0495675_0852003 3300047444 Unclassified 502
961 Ga0495684_0016236 3300047471 Bacteria 5733
962 Ga0495684_0526279 3300047471 Bacteria 809
963 Ga0495686_0247696 3300047472 Bacteria 1002
964 Ga0495593_0035110 3300047673 Bacteria 2723
965 Ga0495602_0073140 3300048088 Bacteria 2919
966 Ga0495615_0245224 3300048090 Bacteria 566
967 Ga0496100_0017720 3300048903 Bacteria 4210
968 Ga0496100_0086615 3300048903 Bacteria 2128
969 Ga0496100_0088497 3300048903 Bacteria 2108
970 Ga0496100_0252106 3300048903 Bacteria 1306
971 Ga0496100_0427167 3300048903 Bacteria 1013
972 Ga0496100_0849411 3300048903 Bacteria 716
973 Ga0496101_0010556 3300048904 Bacteria 6102
974 Ga0496101_0142858 3300048904 Bacteria 1825
975 Ga0496101_0146063 3300048904 Bacteria 1806
976 Ga0496101_0322108 3300048904 Bacteria 1213
977 Ga0496101_0501719 3300048904 Bacteria 959
978 Ga0496101_1047976 3300048904 Bacteria 641
979 Ga0496101_1537642 3300048904 Bacteria 518
980 Ga0496102_0021341 3300048905 Bacteria 5727
981 Ga0496102_0269233 3300048905 Bacteria 1606
982 Ga0496102_0276267 3300048905 Bacteria 1583
983 Ga0496102_0641575 3300048905 Bacteria 985
984 Ga0496102_1387868 3300048905 Bacteria 621
985 Ga0496103_0067933 3300048906 Bacteria 2227
986 Ga0496103_0112317 3300048906 Bacteria 1731
987 Ga0496103_0172850 3300048906 Bacteria 1388
988 Ga0496104_0001364 3300048907 Bacteria 21131
989 Ga0496104_0044527 3300048907 Bacteria 4169
990 Ga0496104_0044528 3300048907 Bacteria 4169
991 Ga0496104_0108172 3300048907 Bacteria 2664
992 Ga0496104_0274478 3300048907 Bacteria 1598
993 Ga0496105_0004404 3300048908 Bacteria 10600
994 Ga0496105_0005504 3300048908 Bacteria 9611
995 Ga0496105_0148751 3300048908 Bacteria 1925
996 Ga0496105_0615649 3300048908 Bacteria 841
997 Ga0496106_0049371 3300048909 Bacteria 3169
998 Ga0496106_0074612 3300048909 Bacteria 2597
999 Ga0496106_0255760 3300048909 Bacteria 1401
1000 Ga0496106_0784058 3300048909 Bacteria 756
1001 Ga0496107_0111293 3300048910 Bacteria 2013
1002 Ga0496107_0296518 3300048910 Bacteria 1203
1003 Ga0496107_0336293 3300048910 Bacteria 1123
1004 Ga0496107_0450946 3300048910 Bacteria 955
1005 Ga0496107_0687808 3300048910 Bacteria 753
1006 Ga0496108_0001133 3300048911 Bacteria 20819
1007 Ga0496108_0032633 3300048911 Bacteria 4325
1008 Ga0496108_0085334 3300048911 Bacteria 2680
1009 Ga0496108_0224656 3300048911 Bacteria 1632
1010 Ga0496108_0517813 3300048911 Bacteria 1041
1011 Ga0496108_0668902 3300048911 Bacteria 902
1012 Ga0496109_0000583 3300048912 Bacteria 30510
1013 Ga0496109_0005439 3300048912 Bacteria 10654
1014 Ga0496109_0042827 3300048912 Bacteria 4103
1015 Ga0496109_0138169 3300048912 Bacteria 2278
1016 Ga0496109_0557498 3300048912 Bacteria 1081
1017 Ga0496110_0010849 3300048913 Bacteria 7430
1018 Ga0496110_0112064 3300048913 Bacteria 2453
1019 Ga0496110_0181086 3300048913 Bacteria 1913
1020 Ga0496110_0430482 3300048913 Bacteria 1203
1021 Ga0496110_0766449 3300048913 Bacteria 868
1022 Ga0496110_1855276 3300048913 Bacteria 513
1023 Ga0496111_0009370 3300048914 Bacteria 6529
1024 Ga0496111_0074867 3300048914 Bacteria 2466
1025 Ga0496111_0100084 3300048914 Bacteria 2129
1026 Ga0496111_0397434 3300048914 Bacteria 1019
1027 Ga0496111_0783833 3300048914 Bacteria 690
1028 Ga0496112_0000884 3300048915 Bacteria 21517
1029 Ga0496112_0056643 3300048915 Bacteria 3858
1030 Ga0496112_0059398 3300048915 Bacteria 3767
1031 Ga0496112_0262667 3300048915 Bacteria 1676
1032 Ga0496112_0301262 3300048915 Bacteria 1548
1033 Ga0496112_0865970 3300048915 Bacteria 826
1034 Ga0496112_0959312 3300048915 Bacteria 776
1035 Ga0496112_1903594 3300048915 Bacteria 506
1036 Ga0496113_0000351 3300048916 Bacteria 22021
1037 Ga0496113_0004259 3300048916 Bacteria 8765
1038 Ga0496113_0014431 3300048916 Bacteria 5389
1039 Ga0496113_0480557 3300048916 Bacteria 998
1040 Ga0496114_0159980 3300048917 Bacteria 1957
1041 Ga0496114_0325387 3300048917 Bacteria 1359
1042 Ga0496114_0526862 3300048917 Bacteria 1045
1043 Ga0496114_0727902 3300048917 Bacteria 868
1044 Ga0496115_0004536 3300048918 Bacteria 10046
1045 Ga0496115_0117368 3300048918 Bacteria 2189
1046 Ga0496115_0208195 3300048918 Bacteria 1615
1047 Ga0496115_0307943 3300048918 Bacteria 1297
1048 Ga0496115_0774600 3300048918 Bacteria 748
1049 Ga0496115_1004222 3300048918 Bacteria 637
1050 Ga0496116_0104480 3300048919 Bacteria 1683
1051 Ga0496116_0224902 3300048919 Bacteria 957
1052 Ga0496117_0071108 3300048920 Bacteria 2333
1053 Ga0496117_0079014 3300048920 Bacteria 2169
1054 Ga0496117_0126021 3300048920 Bacteria 1562
1055 Ga0496117_0280736 3300048920 Bacteria 892
1056 Ga0496118_0024920 3300048921 Bacteria 5148
1057 Ga0496118_0029731 3300048921 Bacteria 4576
1058 Ga0496118_0073065 3300048921 Bacteria 2459
1059 Ga0496118_0524006 3300048921 Bacteria 584
1060 Ga0496118_0560981 3300048921 Bacteria 555
1061 Ga0496119_0004353 3300048922 Bacteria 14129
1062 Ga0496119_0015798 3300048922 Bacteria 5783
1063 Ga0496119_0047286 3300048922 Bacteria 2678
1064 Ga0496119_0186852 3300048922 Bacteria 1083
1065 Ga0496119_0240910 3300048922 Bacteria 916
1066 Ga0496119_0295542 3300048922 Bacteria 800
1067 Ga0496119_0381273 3300048922 Bacteria 676
1068 Ga0496120_0058656 3300048923 Bacteria 2161
1069 Ga0496120_0072566 3300048923 Bacteria 1886
1070 Ga0496120_0227045 3300048923 Bacteria 889
1071 Ga0496121_0003703 3300048924 Bacteria 21450
1072 Ga0496121_0035490 3300048924 Bacteria 4468
1073 Ga0496121_0076984 3300048924 Bacteria 2658
1074 Ga0496121_0273289 3300048924 Bacteria 1160
1075 Ga0496121_0396206 3300048924 Bacteria 906
1076 Ga0496121_0414452 3300048924 Bacteria 878
1077 Ga0496122_0049328 3300048925 Bacteria 3225
1078 Ga0496122_0133672 3300048925 Bacteria 1569
1079 Ga0496122_0620340 3300048925 Bacteria 502
1080 Ga0496123_0023041 3300048926 Bacteria 4779
1081 Ga0496123_0443489 3300048926 Bacteria 580
1082 Ga0496124_0037995 3300048927 Bacteria 4182
1083 Ga0496124_0201142 3300048927 Bacteria 1515
1084 Ga0496124_0280696 3300048927 Bacteria 1214
1085 Ga0496124_0639254 3300048927 Bacteria 685
1086 Ga0496125_0017448 3300048928 Bacteria 6842
1087 Ga0496125_0187364 3300048928 Bacteria 1370
1088 Ga0496125_0228180 3300048928 Bacteria 1193
1089 Ga0496126_0052029 3300048929 Bacteria 3725
1090 Ga0496126_0062525 3300048929 Bacteria 3340
1091 Ga0496126_0076397 3300048929 Bacteria 2971
1092 Ga0496126_0088438 3300048929 Bacteria 2728
1093 Ga0496126_0110380 3300048929 Bacteria 2396
1094 Ga0496126_0157561 3300048929 Bacteria 1942
1095 Ga0496126_0185973 3300048929 Bacteria 1762
1096 Ga0496126_0552488 3300048929 Bacteria 913
1097 Ga0501306_005013 3300049127 Bacteria 1502
1098 Ga0501309_018091 3300049129 Bacteria 971
1099 Ga0501310_000913 3300049130 Bacteria 2631
1100 Ga0501304_015606 3300049160 Bacteria 713
1101 Ga0501307_051215 3300049162 Bacteria 621
1102 Ga0501307_069927 3300049162 Bacteria 558
1103 Ga0501295_087541 3300049518 Bacteria 716
1104 Ga0501311_058550 3300049527 Bacteria 618
1105 Ga0501311_058695 3300049527 Bacteria 617
1106 Ga0501312_002347 3300049528 Bacteria 2034
1107 Ga0501313_012946 3300049529 Bacteria 976
1108 Ga0501314_004633 3300049530 Bacteria 1147
1109 Ga0501315_000284 3300049531 Bacteria 3262
1110 Ga0501316_001152 3300049532 Bacteria 2158
1111 Ga0501317_000192 3300049533 Bacteria 3649
1112 Ga0501318_000037 3300049534 Bacteria 5323
1113 Ga0501320_007213 3300049536 Bacteria 1064
1114 Ga0501320_033205 3300049536 Bacteria 650
1115 Ga0501323_009389 3300049539 Bacteria 1152
1116 Ga0501324_025965 3300049540 Bacteria 620
1117 Ga0501329_01320 3300049545 Bacteria 1070
1118 Ga0501331_07283 3300049547 Bacteria 656
1119 Ga0501332_19326 3300049548 Bacteria 502
1120 Ga0501335_019758 3300049551 Bacteria 713
1121 Ga0501031_0058878 3300049568 Bacteria 2503
1122 Ga0501031_0189582 3300049568 Bacteria 1343
1123 Ga0501031_0245821 3300049568 Bacteria 1163
1124 Ga0501031_0336341 3300049568 Bacteria 978
1125 Ga0501031_0384727 3300049568 Bacteria 908
1126 Ga0501032_0102312 3300049569 Bacteria 1898
1127 Ga0501032_0196587 3300049569 Bacteria 1317
1128 Ga0501032_0510860 3300049569 Bacteria 767
1129 Ga0501033_0003899 3300049570 Bacteria 12129
1130 Ga0501033_0077789 3300049570 Bacteria 2434
1131 Ga0501033_0087576 3300049570 Bacteria 2279
1132 Ga0501033_0329421 3300049570 Bacteria 1072
1133 Ga0501033_0561852 3300049570 Bacteria 785
1134 Ga0501034_0009013 3300049571 Bacteria 10479
1135 Ga0501034_0045501 3300049571 Bacteria 4434
1136 Ga0501034_0046023 3300049571 Bacteria 4408
1137 Ga0501034_0072791 3300049571 Bacteria 3445
1138 Ga0501034_0215781 3300049571 Bacteria 1872
1139 Ga0501034_0280847 3300049571 Bacteria 1604
1140 Ga0501034_0296749 3300049571 Bacteria 1553
1141 Ga0501034_0660737 3300049571 Bacteria 946
1142 Ga0501034_0789867 3300049571 Bacteria 843
1143 Ga0501034_1100999 3300049571 Bacteria 675
1144 Ga0501034_1586763 3300049571 Bacteria 527
1145 Ga0501036_0042790 3300049572 Bacteria 3834
1146 Ga0501036_0156089 3300049572 Bacteria 1924
1147 Ga0501036_0373840 3300049572 Bacteria 1190
1148 Ga0501036_0761878 3300049572 Bacteria 798
1149 Ga0501036_1036998 3300049572 Bacteria 671
1150 Ga0501037_0038500 3300049573 Bacteria 3522
1151 Ga0501037_0058098 3300049573 Bacteria 2823
1152 Ga0501037_0067461 3300049573 Bacteria 2605
1153 Ga0501037_0147819 3300049573 Bacteria 1680
1154 Ga0501037_0215198 3300049573 Bacteria 1354
1155 Ga0501037_0308671 3300049573 Bacteria 1097
1156 Ga0501037_0610859 3300049573 Bacteria 731
1157 Ga0501038_0046533 3300049574 Bacteria 3761
1158 Ga0501038_0111161 3300049574 Bacteria 2270
1159 Ga0501038_0149812 3300049574 Bacteria 1902
1160 Ga0501038_0178958 3300049574 Bacteria 1712
1161 Ga0501039_0094100 3300049575 Bacteria 2335
1162 Ga0501039_0143242 3300049575 Bacteria 1878
1163 Ga0501039_0220637 3300049575 Bacteria 1490
1164 Ga0501039_1465325 3300049575 Bacteria 525
1165 Ga0501040_0057060 3300049576 Bacteria 2680
1166 Ga0501040_0104821 3300049576 Bacteria 1975
1167 Ga0501042_0006352 3300049578 Bacteria 7666
1168 Ga0501042_1104347 3300049578 Bacteria 578
1169 Ga0501043_0032226 3300049579 Bacteria 4119
1170 Ga0501043_0100195 3300049579 Bacteria 2277
1171 Ga0501043_0374221 3300049579 Bacteria 1079
1172 Ga0501043_0377711 3300049579 Bacteria 1073
1173 Ga0501046_0079981 3300049580 Bacteria 2526
1174 Ga0501046_0104265 3300049580 Bacteria 2173
1175 Ga0501047_0005487 3300049581 Bacteria 11930
1176 Ga0501047_0103854 3300049581 Bacteria 2722
1177 Ga0501047_0322469 3300049581 Bacteria 1384
1178 Ga0501047_0346110 3300049581 Bacteria 1323
1179 Ga0501047_0511199 3300049581 Bacteria 1027
1180 Ga0501047_0622027 3300049581 Bacteria 900
1181 Ga0501048_0010499 3300049582 Bacteria 6911
1182 Ga0501048_0644508 3300049582 Bacteria 761
1183 Ga0501067_0001840 3300049583 Bacteria 11669
1184 Ga0501067_0138882 3300049583 Bacteria 1353
1185 Ga0501068_0031355 3300049584 Bacteria 3157
1186 Ga0501068_0134851 3300049584 Bacteria 1545
1187 Ga0501068_0679595 3300049584 Bacteria 673
1188 Ga0501069_0192433 3300049585 Bacteria 1180
1189 Ga0501069_0553027 3300049585 Bacteria 689
1190 Ga0501069_0965278 3300049585 Bacteria 520
1191 Ga0501070_0025506 3300049586 Bacteria 4958
1192 Ga0501070_0219812 3300049586 Bacteria 1558
1193 Ga0501071_0014068 3300049587 Bacteria 5468
1194 Ga0501072_0184090 3300049588 Bacteria 1666
1195 Ga0501072_0267299 3300049588 Bacteria 1361
1196 Ga0501072_1024082 3300049588 Bacteria 643
1197 Ga0501073_0023164 3300049589 Bacteria 4463
1198 Ga0501073_0039588 3300049589 Bacteria 3338
1199 Ga0501073_1281054 3300049589 Bacteria 502
1200 Ga0501074_0026693 3300049590 Bacteria 4187
1201 Ga0501074_0052758 3300049590 Bacteria 2934
1202 Ga0501075_0433447 3300049591 Bacteria 1002
1203 Ga0501076_0054065 3300049592 Bacteria 3182
1204 Ga0501076_1252901 3300049592 Bacteria 610
1205 Ga0501077_0028790 3300049593 Bacteria 3531
1206 Ga0501077_0769530 3300049593 Bacteria 619
1207 Ga0501198_084030 3300049649 Bacteria 621
1208 Ga0501202_068220 3300049652 Bacteria 815
1209 Ga0501209_090205 3300049656 Bacteria 891
1210 Ga0501261_052301 3300049690 Bacteria 673
1211 Ga0501234_067452 3300049707 Bacteria 614
1212 Ga0501245_092165 3300049708 Bacteria 602
1213 Ga0501079_0024576 3300049741 Bacteria 4623
1214 Ga0501079_0126189 3300049741 Bacteria 1991
1215 Ga0501079_0670703 3300049741 Bacteria 816
1216 Ga0501080_0107267 3300049742 Bacteria 2588
1217 Ga0501080_0137367 3300049742 Bacteria 2261
1218 Ga0501080_0258855 3300049742 Bacteria 1586
1219 Ga0501080_0871114 3300049742 Bacteria 786
1220 Ga0501081_1036619 3300049743 Bacteria 620
1221 Ga0501083_0006724 3300049744 Bacteria 8157
1222 Ga0501083_0023858 3300049744 Bacteria 4242
1223 Ga0501083_0493650 3300049744 Bacteria 797
1224 Ga0501083_0604216 3300049744 Bacteria 714
1225 Ga0501271_028555 3300049768 Bacteria 679
1226 Ga0501035_0069162 3300049822 Bacteria 3130
1227 Ga0501035_0143633 3300049822 Bacteria 2073
1228 Ga0501035_0188785 3300049822 Bacteria 1772
1229 Ga0501035_0274381 3300049822 Bacteria 1426
1230 Ga0501035_0310484 3300049822 Bacteria 1327
1231 Ga0501035_0584051 3300049822 Bacteria 912
1232 Ga0501044_0047177 3300049823 Bacteria 4456
1233 Ga0501044_0096645 3300049823 Bacteria 2975
1234 Ga0501044_0163967 3300049823 Bacteria 2197
1235 Ga0501044_0588757 3300049823 Bacteria 1006
1236 Ga0501044_0984596 3300049823 Bacteria 715
1237 Ga0501044_1040435 3300049823 Bacteria 689
1238 Ga0501045_0484646 3300049824 Bacteria 919
1239 Ga0501045_0496303 3300049824 Bacteria 906
1240 Ga0501045_1397298 3300049824 Bacteria 508
1241 nmdc:mga03683_30010_c1 3300050489 Bacteria 2173
1242 nmdc:mga03683_55888_c1 3300050489 Bacteria 1328
1243 nmdc:mga03683_57927_c1 3300050489 Bacteria 1632
1244 nmdc:mga00v17_128506_c1 3300050491 Bacteria 1618
1245 nmdc:mga00v17_158507_c1 3300050491 Bacteria 1456
1246 nmdc:mga00v17_40128_c1 3300050491 Bacteria 2807
1247 nmdc:mga0yw44_198666_c1 3300050492 Bacteria 1324
1248 nmdc:mga0yw44_72574_c1 3300050492 Bacteria 2140
1249 nmdc:mga0yw44_8112_c1 3300050492 Bacteria 5214
1250 nmdc:mga0k408_107918_c1 3300050493 Bacteria 1644
1251 nmdc:mga0k408_349325_c1 3300050493 Bacteria 882
1252 nmdc:mga06z11_122918_c1 3300050494 Bacteria 1450
1253 nmdc:mga06z11_65629_c1 3300050494 Bacteria 1905
1254 nmdc:mga07m45_26736_c1 3300050496 Bacteria 3172
1255 nmdc:mga07m45_313530_c1 3300050496 Bacteria 912
1256 nmdc:mga05p37_109891_c1 3300050507 Bacteria 3392
1257 nmdc:mga05p37_1141437_c1 3300050507 Bacteria 811
1258 nmdc:mga09592_39027_c1 3300050508 Bacteria 3988
1259 nmdc:mga06r32_11149_c1 3300050510 Bacteria 8095
1260 nmdc:mga08y16_1002128_c1 3300050511 Bacteria 815
1261 nmdc:mga08y16_1237329_c1 3300050511 Bacteria 716
1262 nmdc:mga08y16_704116_c1 3300050511 Bacteria 1010
1263 nmdc:mga0n895_260513_c1 3300050512 Bacteria 1760
1264 nmdc:mga0n895_331977_c1 3300050512 Bacteria 1541
1265 nmdc:mga0n895_5268_c1 3300050512 Bacteria 10768
1266 nmdc:mga0rr50_53041_c1 3300050513 Bacteria 3016
1267 nmdc:mga0rr50_97529_c2 3300050513 Bacteria 1849
1268 nmdc:mga08x19_11254_c1 3300050514 Bacteria 5387
1269 nmdc:mga08x19_816672_c1 3300050514 Bacteria 662
1270 nmdc:mga0a205_44144_c1 3300050515 Bacteria 4297
1271 Ga0495601_0112434 3300053077 Bacteria 1764
1272 Ga0495601_0316895 3300053077 Bacteria 1015
1273 Ga0495612_0089496 3300053078 Bacteria 1301
1274 Ga0495612_0356432 3300053078 Bacteria 661
1275 Ga0495612_0593509 3300053078 Bacteria 511
1276 Ga0500635_0041067 3300053080 Bacteria 1545
1277 Ga0500635_0116565 3300053080 Bacteria 996
1278 Ga0495595_0116849 3300053084 Bacteria 1297
1279 Ga0495619_0253113 3300053085 Bacteria 1220
1280 Ga0495619_0321326 3300053085 Bacteria 1071
1281 Ga0495619_0339923 3300053085 Bacteria 1039
1282 Ga0495619_0705296 3300053085 Bacteria 686
1283 Ga0500647_0175353 3300053091 Bacteria 987
1284 Ga0500647_0233186 3300053091 Bacteria 817
1285 Ga0500566_0000320 3300053094 Bacteria 25974
1286 Ga0500566_0088640 3300053094 Bacteria 1712
1287 Ga0500640_029114 3300053095 Bacteria 2413
1288 Ga0500556_0004256 3300053104 Bacteria 4087
1289 Ga0500558_109295 3300053106 Bacteria 1087
1290 Ga0500562_009418 3300053108 Bacteria 2469
1291 Ga0500572_001638 3300053111 Bacteria 5877
1292 Ga0500572_015788 3300053111 Bacteria 1910
1293 Ga0500591_079976 3300053115 Bacteria 1456
1294 Ga0500608_083229 3300053122 Bacteria 1506
1295 Ga0500614_057503 3300053123 Bacteria 1037
1296 Ga0500614_280998 3300053123 Bacteria 521
1297 Ga0500655_071954 3300053133 Bacteria 705
1298 Ga0500559_0007811 3300053136 Bacteria 4724
1299 Ga0500559_0012275 3300053136 Bacteria 3644
1300 Ga0500559_0120340 3300053136 Bacteria 1220
1301 Ga0500561_0200419 3300053137 Bacteria 631
1302 Ga0500564_290061 3300053138 Bacteria 632
1303 Ga0500568_0113847 3300053139 Bacteria 1010
1304 Ga0500573_0006745 3300053140 Bacteria 6228
1305 Ga0500585_223960 3300053144 Bacteria 613
1306 Ga0500590_151829 3300053148 Bacteria 1043
1307 Ga0500590_307903 3300053148 Bacteria 591
1308 Ga0500603_021102 3300053150 Bacteria 1599
1309 Ga0500603_027424 3300053150 Bacteria 1447
1310 Ga0500603_030409 3300053150 Bacteria 1389
1311 Ga0500616_0006596 3300053153 Bacteria 7567
1312 Ga0500616_0048582 3300053153 Bacteria 2249
1313 Ga0500619_208526 3300053154 Bacteria 654
1314 Ga0500630_005936 3300053159 Bacteria 5975
1315 Ga0500638_035746 3300053162 Bacteria 2408
1316 Ga0500639_019780 3300053163 Bacteria 3551
1317 Ga0500639_044490 3300053163 Bacteria 2324
1318 Ga0500636_0067281 3300053177 Bacteria 2081
1319 Ga0500636_0144725 3300053177 Bacteria 1311
1320 Ga0500637_0072771 3300053178 Bacteria 1978
1321 Ga0500637_0190508 3300053178 Bacteria 1172
1322 Ga0500637_0215172 3300053178 Bacteria 1088
1323 Ga0500576_041535 3300053725 Bacteria 2068
1324 Ga0500657_147716 3300053728 Bacteria 879
1325 Ga0500552_113454 3300053733 Bacteria 523
1326 Ga0500596_003892 3300053735 Bacteria 2792
1327 Ga0500596_007930 3300053735 Bacteria 1714
1328 Ga0500596_051092 3300053735 Bacteria 676
1329 Ga0500601_007073 3300053737 Bacteria 1241
1330 Ga0500601_012157 3300053737 Bacteria 970
1331 Ga0501084_0080043 3300054114 Bacteria 2739
1332 Ga0501084_0424221 3300054114 Bacteria 1124
1333 Ga0500661_118751 3300055283 Bacteria 510
1334 Ga0590077_180360 3300059426 Bacteria 510
1335 Ga0587093_049355 3300059478 Bacteria 660
1336 Ga0587066_027970 3300059490 Bacteria 984
1337 Ga0587070_023933 3300059491 Bacteria 1053
1338 Ga0587073_0145918 3300059492 Bacteria 664
1339 Ga0587073_0272404 3300059492 Bacteria 540
1340 Ga0587080_108329 3300059503 Bacteria 603
1341 Ga0587082_107359 3300059504 Bacteria 616
1342 Ga0587082_120957 3300059504 Bacteria 591
1343 Ga0587083_0169989 3300059505 Bacteria 603
1344 Ga0587085_122805 3300059506 Bacteria 572
1345 Ga0587086_029713 3300059507 Bacteria 797
1346 Ga0587090_001023 3300059510 Bacteria 2677
1347 Ga0587098_048040 3300059604 Bacteria 640
1348 Ga0587106_013279 3300059605 Bacteria 1117
1349 Ga0587106_108624 3300059605 Bacteria 575
1350 Ga0587101_004242 3300059623 Bacteria 1520
1351 Ga0587101_105964 3300059623 Bacteria 565
1352 Ga0587101_106800 3300059623 Bacteria 563
1353 Ga0587101_120350 3300059623 Bacteria 542
1354 Ga0587109_103867 3300059624 Bacteria 656
1355 Ga0587117_024481 3300059627 Bacteria 868
1356 Ga0587067_174578 3300059640 Bacteria 556
1357 Ga0587067_220962 3300059640 Bacteria 513
1358 Ga0587069_083867 3300059642 Bacteria 626
1359 Ga0587069_097416 3300059642 Bacteria 596
1360 Ga0587072_023778 3300059643 Bacteria 1103
1361 Ga0587079_074253 3300059647 Bacteria 765
1362 Ga0587079_157835 3300059647 Bacteria 591
1363 Ga0587107_024275 3300059652 Bacteria 873
1364 Ga0587107_038016 3300059652 Bacteria 765
1365 Ga0587107_051941 3300059652 Bacteria 698
1366 Ga0587107_112242 3300059652 Bacteria 552
1367 Ga0587107_112462 3300059652 Bacteria 552
1368 Ga0587108_004748 3300059653 Bacteria 1003
1369 Ga0587116_06220 3300059656 Bacteria 732
1370 Ga0587119_036177 3300059658 Bacteria 693
1371 Ga0501082_0171311 3300060353 Bacteria 1887
1372 Ga0501082_0526106 3300060353 Bacteria 1034
1373 Ga0501082_1408072 3300060353 Bacteria 609
1374 Ga0466962_0243768 3300061719 Bacteria 882
1375 Ga0466962_0487514 3300061719 Bacteria 623
1376 Ga0530510_0050130 3300061734 Bacteria 3015
1377 Ga0530510_0261262 3300061734 Bacteria 1291
1378 Ga0530510_0473104 3300061734 Bacteria 949
1379 2508735863 2508501050 Bacteria 9633614
1380 2509149632 2508501128 Bacteria 8613869
1381 2512642897 2512564014 Bacteria 4639632
1382 2513678617 2513237098 Bacteria 9902361
1383 2513894229 2513237141 Bacteria 8496279
1384 2524469971 2524023210 Bacteria 9029266
1385 2596374054 2595698237 Bacteria 6712432
1386 2723846171 2721755755 Bacteria 8322773
1387 2738745705 2738541281 Bacteria 5112672
1388 2739354935 2738543032 Bacteria 5115625
1389 2753359575 2751185800 Bacteria 5467370
1390 2758641836 2758568016 Bacteria 5645291
1391 2765465535 2765235802 Bacteria 5618596
1392 2776259137 2775506901 Bacteria 9631051
1393 2778126625 2775507255 Bacteria 3945731
1394 2828310148 2828305725 Bacteria 4916900
1395 2829749930 2829745981 Bacteria 5406054
1396 2839995597 2839993093 Bacteria 5512535
1397 2840768016 2840764183 Bacteria 6358399
1398 2842701718 2842698319 Bacteria 5190321
1399 2861692149 2861691609 Bacteria 5628931
1400 2885384445 2885383462 Bacteria 9473874
1401 2889311569 2889306138 Bacteria 6358934
1402 2891050820 2891048133 Bacteria 4447501
1403 2894240768 2894232714 Bacteria 8834183
1404 2902334109 2902330777 Bacteria 6395352
1405 2902411804 2902405164 Bacteria 6784948
1406 2903770862 2903768456 Bacteria 9749579
1407 2904583234 2904578770 Bacteria 5302906
1408 2909043598 2909042592 Bacteria 6499737
1409 2919123882 2919119836 Bacteria 5208557
1410 2922361967 2922361189 Bacteria 7436256
1411 2922428989
1412 2928129945 2928125067 Bacteria 5937560
1413 2995397021 2995392953 Bacteria 4539380
1414 3002143950 3002141150 Bacteria 5254435
1415 3005512709 3005506211 Bacteria 6943378
1416 3005598068 3005594810 Bacteria 8716512
1417 8056684520 8056681323 Bacteria 8472857
1418 Ga0070680_101512712
1419 JGI24741J21665_1000040
1420 JGI24747J21853_1041351
1421 JGI24740J21852_10001488
1422 JGI24740J21852_10127217
1423 JGI24739J22299_10009835
1424 JGI24739J22299_10122518
1425 JGI24739J22299_10146276
1426 JGI24737J22298_10002296
1427 JGI24737J22298_10002957
1428 JGI24743J22301_10019644
1429 JGI24735J21928_10003641
1430 JGI24750J21931_1006031
1431 JGI24745J21846_1025676
1432 JGI24738J21930_10001475
1433 JGI24738J21930_10006269
1434 JGI24749J21850_1030226
1435 JGI24751J29686_10003449
1436 JGI24751J29686_10015322
1437 JGI25165J46597_1011340
1438 JGI25153J46596_10082871
1439 rootH2_10016380
1440 JGI25404J52841_10035096
1441 Ga0055539_1021913
1442 JGI25405J52794_10006513
1443 Ga0058863_11772060
1444 Ga0058863_11874628
1445 Ga0070658_10013737
1446 Ga0070658_10018691
1447 Ga0070658_10417429
1448 Ga0070658_10993116
1449 Ga0070676_10598008
1450 Ga0070683_100014681
1451 Ga0070683_101643452
1452 Ga0070690_100007778
1453 Ga0070670_100000376
1454 Ga0070677_10080667
1455 Ga0068869_100022833
1456 Ga0070666_10004644
1457 Ga0070680_100085545
1458 Ga0070680_100098147
1459 Ga0070680_100310121
1460 Ga0070680_100664914
1461 Ga0070680_101082953
1462 Ga0070680_101587842
1463 Ga0070682_100002069
1464 Ga0070682_100463941
1465 Ga0068868_100202434
1466 Ga0070660_100000686
1467 Ga0070660_100662344
1468 Ga0070660_100839069
1469 Ga0070660_101161486
1470 Ga0070689_100000122
1471 Ga0070691_10000490
1472 Ga0070691_10862610
1473 Ga0070687_100016035
1474 Ga0070661_100000385
1475 Ga0070661_100303958
1476 Ga0070692_10001302
1477 Ga0070668_100005991
1478 Ga0070668_100088347
1479 Ga0070668_100390585
1480 Ga0070669_100002082
1481 Ga0070675_100016237
1482 Ga0070675_101384211
1483 Ga0070671_100001283
1484 Ga0070674_100000649
1485 Ga0070674_100148607
1486 Ga0070674_100607101
1487 Ga0070673_100002163
1488 Ga0070688_100000217
1489 Ga0070688_101153306
1490 Ga0070659_100003485
1491 Ga0070659_100165834
1492 Ga0070667_100003614
1493 Ga0070667_102074007
1494 Ga0070703_10015462
1495 Ga0070709_10001232
1496 Ga0070709_10002316
1497 Ga0070709_10010455
1498 Ga0070709_10022452
1499 Ga0070709_10938746
1500 Ga0070714_100009083
1501 Ga0070714_100017244
1502 Ga0070714_100025578
1503 Ga0070714_100026711
1504 Ga0070714_100142833
1505 Ga0070714_100177932
1506 Ga0070714_100207603
1507 Ga0070714_100562434
1508 Ga0070714_101608588
1509 Ga0070713_100036694
1510 Ga0070713_100056912
1511 Ga0070713_100061311
1512 Ga0070713_100095838
1513 Ga0070713_100111867
1514 Ga0070713_100610599
1515 Ga0070713_100645737
1516 Ga0070713_100734475
1517 Ga0070713_101400825
1518 Ga0070713_101869425
1519 Ga0070710_10005644
1520 Ga0070710_10019970
1521 Ga0070710_10058672
1522 Ga0070710_10186643
1523 Ga0070710_10236423
1524 Ga0070710_10318422
1525 Ga0070710_10470708
1526 Ga0070710_11123421
1527 Ga0070701_10000897
1528 Ga0070711_100000834
1529 Ga0070711_100004304
1530 Ga0070711_100009870
1531 Ga0070711_100155124
1532 Ga0070711_100159576
1533 Ga0070711_100663258
1534 Ga0070711_101839668
1535 Ga0070705_100022646
1536 Ga0070705_100266449
1537 Ga0070700_100002377
1538 Ga0070700_100217734
1539 Ga0070700_100387488
1540 Ga0070700_100845120
1541 Ga0070700_101711775
1542 Ga0070694_100000195
1543 Ga0070663_100000352
1544 Ga0070663_100074211
1545 Ga0070663_100573677
1546 Ga0070678_100001146
1547 Ga0070678_100497827
1548 Ga0070662_100000412
1549 Ga0070662_100501700
1550 Ga0070662_101006609
1551 Ga0070662_101760863
1552 Ga0070662_101984517
1553 Ga0070681_10329459
1554 Ga0070681_10715142
1555 Ga0070681_11170398
1556 Ga0070681_11611799
1557 Ga0068867_100008499
1558 Ga0068867_100077308
1559 Ga0070685_10058987
1560 Ga0070685_10665402
1561 Ga0070707_100127155
1562 Ga0070698_100118731
1563 Ga0070698_100482324
1564 Ga0070699_100160319
1565 Ga0070679_100040109
1566 Ga0070679_100288276
1567 Ga0070684_100047080
1568 Ga0070684_100061861
1569 Ga0070684_100356712
1570 Ga0070684_100886686
1571 Ga0070684_100919194
1572 Ga0070697_100000391
1573 Ga0070697_100077313
1574 Ga0070697_101553947
1575 Ga0068853_100001082
1576 Ga0068853_100345112
1577 Ga0068853_101848518
1578 Ga0070672_100035019
1579 Ga0070686_100001391
1580 Ga0070695_100000238
1581 Ga0070695_100385596
1582 Ga0070696_100000815
1583 Ga0070696_100031634
1584 Ga0070696_100523824
1585 Ga0070693_100000455
1586 Ga0070693_100579599
1587 Ga0070693_100721973
1588 Ga0070665_100022864
1589 Ga0070665_100548593
1590 Ga0070704_100000124
1591 Ga0070704_100746471
1592 Ga0068855_100002691
1593 Ga0068855_100220819
1594 Ga0068855_100351567
1595 Ga0068855_100464716
1596 Ga0068855_100722076
1597 Ga0070664_100002450
1598 Ga0070664_100013985
1599 Ga0070664_100963839
1600 Ga0070664_101879664
1601 Ga0068857_100008457
1602 Ga0068857_100149759
1603 Ga0068857_101190118
1604 Ga0068857_101263112
1605 Ga0068854_100007856
1606 Ga0068854_100405940
1607 Ga0068854_100596484
1608 Ga0068854_100770040
1609 Ga0068854_101112579
1610 Ga0068856_100001924
1611 Ga0068856_100005122
1612 Ga0068856_101512037
1613 Ga0070702_100000018
1614 Ga0070702_100315096
1615 Ga0070702_100375110
1616 Ga0068852_100010938
1617 Ga0068852_100225709
1618 Ga0068852_100271636
1619 Ga0068859_100131708
1620 Ga0068859_100254511
1621 Ga0068859_101714941
1622 Ga0068864_100002243
1623 Ga0068864_100847013
1624 Ga0068864_101603329
1625 Ga0068866_10001983
1626 Ga0068866_10472774
1627 Ga0068866_10579931
1628 Ga0068861_100000942
1629 Ga0068851_10055130
1630 Ga0068851_10281205
1631 Ga0068870_10379278
1632 Ga0068863_100007838
1633 Ga0068863_100237421
1634 Ga0068858_100019589
1635 Ga0068858_100270677
1636 Ga0068860_100000598
1637 Ga0068860_100088076
1638 Ga0068862_100008039
1639 Ga0068862_100688014
1640 Ga0081455_10021909
1641 Ga0081455_10288863
1642 Ga0081538_10006855
1643 Ga0081538_10029536
1644 Ga0081540_1015691
1645 Ga0081540_1017063
1646 Ga0081540_1053318
1647 Ga0081540_1065878
1648 Ga0070717_10003669
1649 Ga0070717_10027908
1650 Ga0070717_10102080
1651 Ga0070717_10381156
1652 Ga0075365_10013851
1653 Ga0075365_10452214
1654 Ga0075365_10749770
1655 Ga0075368_10218801
1656 Ga0075368_10282307
1657 Ga0075363_100113521
1658 Ga0075364_10052785
1659 Ga0075364_10057357
1660 Ga0075364_10095261
1661 Ga0075364_10220551
1662 Ga0070715_10001643
1663 Ga0070715_10312847
1664 Ga0070715_10321955
1665 Ga0070716_100001603
1666 Ga0070716_100026432
1667 Ga0070716_100079986
1668 Ga0070716_100226032
1669 Ga0070716_100397026
1670 Ga0070716_100477478
1671 Ga0070716_101460067
1672 Ga0070712_100027843
1673 Ga0070712_100052247
1674 Ga0070712_100058664
1675 Ga0070712_100058938
1676 Ga0070712_100201784
1677 Ga0070712_100412647
1678 Ga0070712_100515983
1679 Ga0070712_101410515
1680 Ga0075362_10035975
1681 Ga0075362_10049062
1682 Ga0075362_10101966
1683 Ga0075367_10111670
1684 Ga0075367_10134243
1685 Ga0075366_10359251
1686 Ga0075366_10627287
1687 Ga0097621_100107158
1688 Ga0097621_100165361
1689 Ga0097621_102073454
1690 Ga0075370_10243707
1691 Ga0068871_100022307
1692 Ga0068871_100286866
1693 Ga0068871_100486469
1694 Ga0068871_100682814
1695 Ga0075428_100054274
1696 Ga0075428_100237574
1697 Ga0075428_101096435
1698 Ga0075430_100103604
1699 Ga0075431_100003503
1700 Ga0075433_10023032
1701 Ga0075434_100025071
1702 Ga0075434_100036662
1703 Ga0075434_100215192
1704 Ga0075434_102159013
1705 Ga0075434_102196873
1706 Ga0075429_100024809
1707 Ga0075429_101174029
1708 Ga0068865_100096538
1709 Ga0068865_101186464
1710 Ga0075436_100008941
1711 Ga0097620_100131716
1712 Ga0097620_100254508
1713 Ga0097620_101715029
1714 Ga0075435_100085522
1715 Ga0075435_100102268
1716 Ga0075435_100897708
1717 Ga0099795_10003174
1718 Ga0105251_10110631
1719 Ga0105250_10008602
1720 Ga0105250_10188339
1721 Ga0105240_10230206
1722 Ga0105240_10263935
1723 Ga0105240_10304110
1724 Ga0105240_10504075
1725 Ga0105240_11509248
1726 Ga0111539_10100865
1727 Ga0111539_10428106
1728 Ga0111539_10658944
1729 Ga0105245_10000718
1730 Ga0105247_10001104
1731 Ga0105247_10035209
1732 Ga0105247_10603522
1733 Ga0114129_10401684
1734 Ga0114129_11726057
1735 Ga0114129_12202468
1736 Ga0105243_10001752
1737 Ga0105243_10362714
1738 Ga0105241_10001866
1739 Ga0105241_10088557
1740 Ga0105241_10177796
1741 Ga0105241_10256780
1742 Ga0105242_10010515
1743 Ga0105242_11411010
1744 Ga0105242_11845975
1745 Ga0105248_10002832
1746 Ga0105237_10001618
1747 Ga0105237_10394223
1748 Ga0105237_10757616
1749 Ga0105237_10997033
1750 Ga0105237_11842462
1751 Ga0105238_10007984
1752 Ga0105238_10437534
1753 Ga0105238_10718602
1754 Ga0105249_10000814
1755 Ga0105249_10354541
1756 Ga0105249_10378887
1757 Ga0105249_10713244
1758 Ga0099796_10002269
1759 Ga0105239_10120316
1760 Ga0105239_10143574
1761 Ga0105239_10239229
1762 Ga0105239_10296034
1763 Ga0105239_10601978
1764 Ga0105239_12790328
1765 Ga0105239_12945183
1766 Ga0105246_10002439
1767 Ga0105246_10045899
1768 Ga0105246_10120687
1769 Ga0105246_10630391
1770 Ga0105246_12574566
1771 Ga0157327_1033127
1772 Ga0157373_10019849
1773 Ga0157373_10027237
1774 Ga0157373_11308834
1775 Ga0157371_10056437
1776 Ga0157371_10347917
1777 Ga0157371_10638770
1778 Ga0157370_10017001
1779 Ga0157370_10461414
1780 Ga0157370_10555656
1781 Ga0157369_10164535
1782 Ga0157369_10197436
1783 Ga0157369_10312994
1784 Ga0157369_10765468
1785 Ga0157369_11138607
1786 Ga0157369_11463227
1787 Ga0157369_12136507
1788 Ga0157374_10012339
1789 Ga0157374_11221540
1790 Ga0157378_10000470
1791 Ga0157378_11432213
1792 Ga0163162_10004532
1793 Ga0163162_11073919
1794 Ga0163162_11470543
1795 Ga0163162_12543142
1796 Ga0163162_12605215
1797 Ga0157372_10001215
1798 Ga0157372_10297910
1799 Ga0157372_11055098
1800 Ga0157372_11378347
1801 Ga0157372_11623209
1802 Ga0157372_12129590
1803 Ga0157375_10012604
1804 Ga0157375_11913853
1805 Ga0157375_13287897
1806 Ga0163163_10002129
1807 Ga0163163_10005311
1808 Ga0163163_12084633
1809 Ga0157380_10008515
1810 Ga0157380_10027055
1811 Ga0157380_11594359
1812 Ga0182008_10222662
1813 Ga0182008_10365970
1814 Ga0157377_10006965
1815 Ga0157379_10001927
1816 Ga0157379_10552180
1817 Ga0157379_11730006
1818 Ga0157376_10000606
1819 Ga0157376_10743776
1820 Ga0163161_10002394
1821 Ga0163161_10573970
1822 Ga0206356_11853575
1823 Ga0206349_1277602
1824 Ga0206355_1403799
1825 Ga0206352_10097269
1826 Ga0206352_11227367
1827 Ga0206350_10960778
1828 Ga0206353_10857624
1829 Ga0154015_1108290
1830 Ga0154015_1214890
1831 Ga0213873_10106683
1832 Ga0213873_10313968
1833 Ga0213872_10023323
1834 Ga0213872_10307143
1835 Ga0213874_10001821
1836 Ga0213874_10009960
1837 Ga0213874_10010979
1838 Ga0213874_10220157
1839 Ga0213874_10264446
1840 Ga0213874_10275691
1841 Ga0213874_10354152
1842 Ga0213876_10002961
1843 Ga0213876_10004772
1844 Ga0213875_10000089
1845 Ga0213875_10059627
1846 Ga0213871_10016747
1847 Ga0213871_10155626
1848 Ga0224712_10002117
1849 Ga0224712_10050101
1850 Ga0256714_113971
1851 Ga0256744_130108
1852 Ga0256743_128847
1853 Ga0256720_139806
1854 Ga0209677_100816
1855 Ga0209148_1004162
1856 Ga0209148_1008955
1857 Ga0209233_1003250
1858 Ga0209455_1009081
1859 Ga0209455_1038588
1860 Ga0209758_1040129
1861 Ga0207697_10057185
1862 Ga0207656_10012084
1863 Ga0207656_10173122
1864 Ga0207696_1128942
1865 Ga0207713_1157248
1866 Ga0207653_10032934
1867 Ga0207682_10132490
1868 Ga0207692_10002601
1869 Ga0207692_10039674
1870 Ga0207692_10075631
1871 Ga0207642_10091188
1872 Ga0207642_10845179
1873 Ga0207710_10003497
1874 Ga0207688_10002614
1875 Ga0207688_10044664
1876 Ga0207680_10006344
1877 Ga0207647_10001956
1878 Ga0207647_10027406
1879 Ga0207685_10005152
1880 Ga0207685_10019197
1881 Ga0207685_10075667
1882 Ga0207685_10103277
1883 Ga0207685_10228851
1884 Ga0207699_10000692
1885 Ga0207699_10008214
1886 Ga0207699_10028433
1887 Ga0207699_10062019
1888 Ga0207699_10421039
1889 Ga0207699_10731373
1890 Ga0207699_11028083
1891 Ga0207699_11057182
1892 Ga0207643_10116032
1893 Ga0207705_10093610
1894 Ga0207705_10244702
1895 Ga0207705_10348126
1896 Ga0207705_10933880
1897 Ga0207705_11096131
1898 Ga0207654_10003285
1899 Ga0207654_10185216
1900 Ga0207654_10534960
1901 Ga0207707_10074687
1902 Ga0207707_10298153
1903 Ga0207707_10734408
1904 Ga0207695_10056587
1905 Ga0207695_10104513
1906 Ga0207695_10228101
1907 Ga0207695_10284481
1908 Ga0207695_10930390
1909 Ga0207671_10057494
1910 Ga0207671_10120775
1911 Ga0207671_10332555
1912 Ga0207671_10659429
1913 Ga0207693_10000493
1914 Ga0207693_10008270
1915 Ga0207693_10030071
1916 Ga0207693_10059279
1917 Ga0207693_10112539
1918 Ga0207693_10159520
1919 Ga0207693_10635016
1920 Ga0207693_10705887
1921 Ga0207693_11179653
1922 Ga0207663_10001067
1923 Ga0207663_10012076
1924 Ga0207663_10466318
1925 Ga0207663_10961543
1926 Ga0207663_10967373
1927 Ga0207660_10644243
1928 Ga0207660_11115557
1929 Ga0207660_11293772
1930 Ga0207662_10002067
1931 Ga0207657_10000282
1932 Ga0207657_10051869
1933 Ga0207657_10620448
1934 Ga0207657_11124284
1935 Ga0207649_10017750
1936 Ga0207649_10239309
1937 Ga0207652_10104736
1938 Ga0207652_10179342
1939 Ga0207652_10298273
1940 Ga0207646_10920567
1941 Ga0207646_10983489
1942 Ga0207681_10015153
1943 Ga0207694_10006423
1944 Ga0207694_10137335
1945 Ga0207694_10234115
1946 Ga0207650_10069986
1947 Ga0207659_10005250
1948 Ga0207659_11051182
1949 Ga0207687_10008551
1950 Ga0207700_10014261
1951 Ga0207700_10071645
1952 Ga0207700_10104591
1953 Ga0207700_10574500
1954 Ga0207700_10580562
1955 Ga0207700_10669401
1956 Ga0207700_10929541
1957 Ga0207700_11315927
1958 Ga0207700_11901970
1959 Ga0207664_10012756
1960 Ga0207664_10023422
1961 Ga0207664_10054900
1962 Ga0207664_10086181
1963 Ga0207664_10125208
1964 Ga0207664_10303495
1965 Ga0207664_10503883
1966 Ga0207644_10048201
1967 Ga0207690_10003444
1968 Ga0207690_10019766
1969 Ga0207706_10000270
1970 Ga0207706_10008316
1971 Ga0207706_10200935
1972 Ga0207706_10302615
1973 Ga0207709_10048849
1974 Ga0207709_10120230
1975 Ga0207709_11104993
1976 Ga0207670_10092363
1977 Ga0207669_10002208
1978 Ga0207669_10129680
1979 Ga0207669_10292009
1980 Ga0207704_10395404
1981 Ga0207704_11004593
1982 Ga0207665_10001538
1983 Ga0207665_10010112
1984 Ga0207665_10070979
1985 Ga0207665_10103792
1986 Ga0207665_10368058
1987 Ga0207665_10501814
1988 Ga0207665_10578776
1989 Ga0207665_11010106
1990 Ga0207691_10053192
1991 Ga0207711_10137545
1992 Ga0207711_10543545
1993 Ga0207689_10885848
1994 Ga0207661_10025741
1995 Ga0207661_10050770
1996 Ga0207661_10148369
1997 Ga0207661_10847999
1998 Ga0207661_12008276
1999 Ga0207679_10004166
2000 Ga0207679_10371865
2001 Ga0207679_10841364
2002 Ga0207667_10011595
2003 Ga0207667_10186152
2004 Ga0207667_10309951
2005 Ga0207651_10004358
2006 Ga0207712_10047767
2007 Ga0207712_10738205
2008 Ga0207668_10006213
2009 Ga0207668_10039960
2010 Ga0207668_11612398
2011 Ga0207640_10002653
2012 Ga0207640_10003639
2013 Ga0207640_10209176
2014 Ga0207658_10023872
2015 Ga0207658_11557595
2016 Ga0207677_10103809
2017 Ga0207677_11197635
2018 Ga0207703_10433391
2019 Ga0207703_10688729
2020 Ga0207703_10776479
2021 Ga0207639_10000784
2022 Ga0207639_10017244
2023 Ga0207678_10000159
2024 Ga0207678_10000477
2025 Ga0207678_10476999
2026 Ga0207708_10000337
2027 Ga0207708_10282110
2028 Ga0207708_10441466
2029 Ga0207702_10007687
2030 Ga0207702_10046306
2031 Ga0207702_10458876
2032 Ga0207641_10017486
2033 Ga0207641_11062543
2034 Ga0207648_10102108
2035 Ga0207648_10363858
2036 Ga0207676_10825727
2037 Ga0207674_10018829
2038 Ga0207674_10030575
2039 Ga0207674_10621991
2040 Ga0207675_100001292
2041 Ga0207675_100149393
2042 Ga0207675_101393715
2043 Ga0207683_10001738
2044 Ga0207683_10353704
2045 Ga0207683_10966376
2046 Ga0207683_11094234
2047 Ga0207698_10021538
2048 Ga0207698_10768882
2049 Ga0207698_11455564
2050 Ga0209179_1003967
2051 Ga0209966_1085348
2052 Ga0209998_10038761
2053 Ga0209998_10125883
2054 Ga0207428_10008303
2055 Ga0207428_10670860
2056 Ga0268266_10206194
2057 Ga0268266_10630747
2058 Ga0268265_10612294
2059 Ga0268264_10000377
2060 Ga0268264_10015446
2061 Ga0268264_10910854
2062 Ga0307515_10248135
2063 Ga0311000_100475
2064 Ga0311004_113545
2065 Ga0311001_1079354
2066 Ga0310981_1002449
2067 Ga0307511_10057801
2068 Ga0265340_10045595
2069 Ga0265339_10011362
2070 Ga0265327_10069811
2071 Ga0307513_10340634
2072 Ga0307509_10276688
2073 Ga0307408_100016009
2074 Ga0307408_100092650
2075 Ga0307408_100395387
2076 Ga0307408_100681236
2077 Ga0307408_102164597
2078 Ga0307508_10000378
2079 Ga0307508_10014201
2080 Ga0310105_121407
2081 Ga0316579_10240025
2082 Ga0265314_10636688
2083 Ga0316576_10978254
2084 Ga0307516_10019779
2085 Ga0307405_10020264
2086 Ga0307405_10610613
2087 Ga0307405_10828608
2088 Ga0307405_11844834
2089 Ga0316577_10382766
2090 Ga0307413_11016513
2091 Ga0307410_10088334
2092 Ga0307410_10159678
2093 Ga0307410_10384358
2094 Ga0307410_10678337
2095 Ga0307410_11601175
2096 Ga0307410_11820968
2097 Ga0326468_10002343
2098 Ga0307406_10173110
2099 Ga0307406_10326285
2100 Ga0307406_10608954
2101 Ga0307406_10802626
2102 Ga0307407_10126458
2103 Ga0307407_10545266
2104 Ga0307412_10001095
2105 Ga0307412_10102836
2106 Ga0307412_11036061
2107 Ga0307409_100004876
2108 Ga0307409_100837912
2109 Ga0307409_101915378
2110 Ga0307416_100036609
2111 Ga0307416_100057739
2112 Ga0307416_100419408
2113 Ga0307416_100824435
2114 Ga0307414_10054953
2115 Ga0307411_10077414
2116 Ga0307411_10528563
2117 Ga0307411_11376330
2118 Ga0307415_100292801
2119 Ga0307415_101649487
2120 Ga0316583_10263990
2121 Ga0307507_10070872
2122 Ga0307510_10243235
2123 Ga0316596_1037368
2124 Ga0316215_1002459
2125 Ga0373950_0005337
2126 Ga0373958_0005093
2127 Ga0373959_0030593
2128 Ga0373938_0003982
2129 Ga0373926_0003147
2130 Ga0373926_0005778
2131 Ga0373928_0006912
2132 Ga0373940_0072756
2133 Ga0373944_0445889
2134 Ga0373949_0011140
2135 Ga0373952_0016138
2136 Ga0373932_0062532
2137 Ga0373936_0010464
2138 Ga0373936_0015906
2139 Ga0373936_0341737
2140 Ga0373939_0010461
2141 Ga0373941_0044026
2142 Ga0373945_0012687
2143 Ga0373945_0171395
2144 Ga0373953_0099066
2145 Ga0373953_0106539
2146 Ga0373954_0006766
2147 Ga0373956_0012723
2148 Ga0373957_0106937
2149 Ga0373957_0168239
2150 Ga0373960_0001622
2151 Ga0373943_0010548
2152 Ga0373943_0017321
2153 Ga0373943_0124534
2154 Ga0373946_0019180
2155 Ga0373946_0359825
2156 Ga0373955_0020793
2157 Ga0373955_0126635
2158 Ga0373942_0152487
2159 Ga0373962_0126509
2160 Ga0373924_0014731
2161 Ga0373924_0201528
2162 Ga0373931_0030144
2163 Ga0373931_0062360
2164 Ga0373931_0823862
2165 Ga0373935_0012257
2166 Ga0373935_0053250
2167 Ga0373935_0286934
2168 Ga0373927_0004904
2169 Ga0373927_0222869
2170 Ga0373927_0333387
2171 Ga0373933_0010736
2172 Ga0373933_0196707
2173 Ga0373933_0875935
2174 Ga0373947_0009798
2175 Ga0373947_0034111
2176 Ga0373947_0398099
2177 Ga0373947_0871454
2178 Ga0310104_00193
2179 Ga0373937_0031089
2180 Ga0373937_0050692
2181 Ga0373937_0425070
2182 Ga0316582_0181961
2183 Ga0373925_0024722
2184 Ga0373925_0039116
2185 Ga0373925_0586461
2186 Ga0373925_0685520
2187 Ga0395899_0072585
2188 Ga0395899_0204290
2189 Ga0395899_0701927
2190 Ga0395900_0238023
2191 Ga0395900_0343977
2192 Ga0395900_0369151
2193 Ga0395900_0493002
2194 Ga0395898_0007760
2195 Ga0395898_0055115
2196 Ga0395898_0064043
2197 Ga0395898_0294093
2198 Ga0395898_0917040
2199 Ga0395898_1122328
2200 Ga0395905_0002506
2201 Ga0395905_0112513
2202 Ga0395905_0217669
2203 Ga0436364_0089033
2204 Ga0436364_0333324
2205 Ga0436364_0335675
2206 Ga0436364_0508030
2207 Ga0436364_0554121
2208 Ga0436364_1191222
2209 Ga0436364_1352603
2210 Ga0395901_0002674
2211 Ga0395901_0132044
2212 Ga0395901_0318811
2213 Ga0395901_0408662
2214 Ga0395901_0637417
2215 Ga0395901_1012464
2216 Ga0242420_011095
2217 Ga0436365_0368899
2218 Ga0436365_0870893
2219 Ga0436365_1010396
2220 Ga0436365_1047672
2221 Ga0436365_1253031
2222 Ga0436365_1350477
2223 Ga0436365_1529438
2224 Ga0436365_1760276
2225 Ga0436365_1870318
2226 Ga0436365_1902820
2227 Ga0436360_0409482
2228 Ga0436360_0777771
2229 Ga0436360_0885775
2230 Ga0436360_0888847
2231 Ga0436360_1268636
2232 Ga0436361_0317849
2233 Ga0436361_0427976
2234 Ga0436361_0763086
2235 Ga0436361_0963669
2236 Ga0436363_0131403
2237 Ga0436363_0242717
2238 Ga0436363_0312775
2239 Ga0436363_0880899
2240 Ga0436363_1014283
2241 Ga0436363_1046285
2242 Ga0436363_1113612
2243 Ga0436363_1387407
2244 Ga0436363_1575848
2245 Ga0436363_1627336
2246 Ga0436362_0002334
2247 Ga0436362_0607333
2248 Ga0436362_0793870
2249 Ga0436362_0982213
2250 Ga0436362_1142159
2251 Ga0439439_0132040
2252 Ga0439465_0053801
2253 Ga0439465_0127160
2254 Ga0451794_34969
2255 Ga0451798_0606664
2256 Ga0451807_2208106
2257 Ga0451837_0342915
2258 Ga0451855_0769345
2259 Ga0451853_3344493
2260 Ga0439431_0094769
2261 Ga0439432_128392
2262 Ga0439457_151757
2263 Ga0450900_053254
2264 Ga0450903_051975
2265 Ga0439459_0018016
2266 Ga0450901_002715
2267 Ga0466969_0217487
2268 Ga0466969_0511409
2269 Ga0466965_0333684
2270 Ga0466966_0037447
2271 Ga0466966_0038631
2272 Ga0466966_0063022
2273 Ga0466961_0017735
2274 Ga0466961_0058522
2275 Ga0466963_0016197
2276 Ga0466963_0037303
2277 Ga0466963_0070352
2278 Ga0466963_0354875
2279 Ga0466963_0358283
2280 Ga0466963_0543930
2281 Ga0466964_0475103
2282 Ga0466971_0080841
2283 Ga0466971_0675604
2284 Ga0466968_0060841
2285 Ga0466970_0122687
2286 Ga0466970_0201450
2287 Ga0466970_0506738
2288 Ga0466957_0014805
2289 Ga0466957_0075585
2290 Ga0466957_0318692
2291 Ga0466957_0935663
2292 Ga0466960_0051465
2293 Ga0466960_0958273
2294 Ga0466959_0098844
2295 Ga0466959_0744194
2296 Ga0466967_0011664
2297 Ga0466967_0056204
2298 Ga0466967_0096571
2299 Ga0466967_0434220
2300 Ga0466967_0471064
2301 Ga0466967_1078797
2302 Ga0495617_093369
2303 Ga0495603_0011756
2304 Ga0495603_0725840
2305 Ga0495629_0026319
2306 Ga0495629_0589356
2307 Ga0495641_0210957
2308 Ga0495651_0353235
2309 Ga0495651_0361100
2310 Ga0495650_0056786
2311 Ga0495580_0111434
2312 Ga0495580_0791263
2313 Ga0495582_0016883
2314 Ga0495639_0026164
2315 Ga0495662_0031478
2316 Ga0495664_0018921
2317 Ga0495584_0038672
2318 Ga0495606_0055089
2319 Ga0495608_0912010
2320 Ga0495618_0043838
2321 Ga0495618_0926569
2322 Ga0495630_0095907
2323 Ga0495630_0170546
2324 Ga0495630_0274888
2325 Ga0495666_0087221
2326 Ga0495652_0204382
2327 Ga0495652_0526129
2328 Ga0495665_0039396
2329 Ga0495665_0168192
2330 Ga0495640_0019304
2331 Ga0495640_0127966
2332 Ga0495586_0136518
2333 Ga0495586_0158041
2334 Ga0495587_0239915
2335 Ga0495597_0068164
2336 Ga0495645_0003533
2337 Ga0495622_0204243
2338 Ga0495622_0452756
2339 Ga0495667_0108852
2340 Ga0495667_0319903
2341 Ga0495656_0482666
2342 Ga0495668_0426247
2343 Ga0495668_0430953
2344 Ga0495634_0015564
2345 Ga0495634_0209436
2346 Ga0495625_0265563
2347 Ga0495625_0747054
2348 Ga0495635_0099960
2349 Ga0495635_0260117
2350 Ga0495635_0810117
2351 Ga0495657_0732641
2352 Ga0495657_0864147
2353 Ga0495599_0154630
2354 Ga0495599_0165274
2355 Ga0495623_0224284
2356 Ga0495623_0315983
2357 Ga0495646_0054443
2358 Ga0495646_0560632
2359 Ga0495647_0005756
2360 Ga0495658_0398360
2361 Ga0495613_0078402
2362 Ga0495624_0051066
2363 Ga0495624_0186772
2364 Ga0495600_0144763
2365 Ga0495581_0033672
2366 Ga0495604_0190355
2367 Ga0495604_0317839
2368 Ga0495604_0453169
2369 Ga0495604_0644638
2370 Ga0495674_0010137
2371 Ga0495676_0156541
2372 Ga0495680_0263931
2373 Ga0495680_0366455
2374 Ga0495680_0474417
2375 Ga0495680_0621850
2376 Ga0495675_0033574
2377 Ga0495675_0852003
2378 Ga0495684_0016236
2379 Ga0495684_0526279
2380 Ga0495686_0247696
2381 Ga0495593_0035110
2382 Ga0495602_0073140
2383 Ga0495615_0245224
2384 Ga0496100_0017720
2385 Ga0496100_0086615
2386 Ga0496100_0088497
2387 Ga0496100_0252106
2388 Ga0496100_0427167
2389 Ga0496100_0849411
2390 Ga0496101_0010556
2391 Ga0496101_0142858
2392 Ga0496101_0146063
2393 Ga0496101_0322108
2394 Ga0496101_0501719
2395 Ga0496101_1047976
2396 Ga0496101_1537642
2397 Ga0496102_0021341
2398 Ga0496102_0269233
2399 Ga0496102_0276267
2400 Ga0496102_0641575
2401 Ga0496102_1387868
2402 Ga0496103_0067933
2403 Ga0496103_0112317
2404 Ga0496103_0172850
2405 Ga0496104_0001364
2406 Ga0496104_0044527
2407 Ga0496104_0044528
2408 Ga0496104_0108172
2409 Ga0496104_0274478
2410 Ga0496105_0004404
2411 Ga0496105_0005504
2412 Ga0496105_0148751
2413 Ga0496105_0615649
2414 Ga0496106_0049371
2415 Ga0496106_0074612
2416 Ga0496106_0255760
2417 Ga0496106_0784058
2418 Ga0496107_0111293
2419 Ga0496107_0296518
2420 Ga0496107_0336293
2421 Ga0496107_0450946
2422 Ga0496107_0687808
2423 Ga0496108_0001133
2424 Ga0496108_0032633
2425 Ga0496108_0085334
2426 Ga0496108_0224656
2427 Ga0496108_0517813
2428 Ga0496108_0668902
2429 Ga0496109_0000583
2430 Ga0496109_0005439
2431 Ga0496109_0042827
2432 Ga0496109_0138169
2433 Ga0496109_0557498
2434 Ga0496110_0010849
2435 Ga0496110_0112064
2436 Ga0496110_0181086
2437 Ga0496110_0430482
2438 Ga0496110_0766449
2439 Ga0496110_1855276
2440 Ga0496111_0009370
2441 Ga0496111_0074867
2442 Ga0496111_0100084
2443 Ga0496111_0397434
2444 Ga0496111_0783833
2445 Ga0496112_0000884
2446 Ga0496112_0056643
2447 Ga0496112_0059398
2448 Ga0496112_0262667
2449 Ga0496112_0301262
2450 Ga0496112_0865970
2451 Ga0496112_0959312
2452 Ga0496112_1903594
2453 Ga0496113_0000351
2454 Ga0496113_0004259
2455 Ga0496113_0014431
2456 Ga0496113_0480557
2457 Ga0496114_0159980
2458 Ga0496114_0325387
2459 Ga0496114_0526862
2460 Ga0496114_0727902
2461 Ga0496115_0004536
2462 Ga0496115_0117368
2463 Ga0496115_0208195
2464 Ga0496115_0307943
2465 Ga0496115_0774600
2466 Ga0496115_1004222
2467 Ga0496116_0104480
2468 Ga0496116_0224902
2469 Ga0496117_0071108
2470 Ga0496117_0079014
2471 Ga0496117_0126021
2472 Ga0496117_0280736
2473 Ga0496118_0024920
2474 Ga0496118_0029731
2475 Ga0496118_0073065
2476 Ga0496118_0524006
2477 Ga0496118_0560981
2478 Ga0496119_0004353
2479 Ga0496119_0015798
2480 Ga0496119_0047286
2481 Ga0496119_0186852
2482 Ga0496119_0240910
2483 Ga0496119_0295542
2484 Ga0496119_0381273
2485 Ga0496120_0058656
2486 Ga0496120_0072566
2487 Ga0496120_0227045
2488 Ga0496121_0003703
2489 Ga0496121_0035490
2490 Ga0496121_0076984
2491 Ga0496121_0273289
2492 Ga0496121_0396206
2493 Ga0496121_0414452
2494 Ga0496122_0049328
2495 Ga0496122_0133672
2496 Ga0496122_0620340
2497 Ga0496123_0023041
2498 Ga0496123_0443489
2499 Ga0496124_0037995
2500 Ga0496124_0201142
2501 Ga0496124_0280696
2502 Ga0496124_0639254
2503 Ga0496125_0017448
2504 Ga0496125_0187364
2505 Ga0496125_0228180
2506 Ga0496126_0052029
2507 Ga0496126_0062525
2508 Ga0496126_0076397
2509 Ga0496126_0088438
2510 Ga0496126_0110380
2511 Ga0496126_0157561
2512 Ga0496126_0185973
2513 Ga0496126_0552488
2514 Ga0501306_005013
2515 Ga0501309_018091
2516 Ga0501310_000913
2517 Ga0501304_015606
2518 Ga0501307_051215
2519 Ga0501307_069927
2520 Ga0501295_087541
2521 Ga0501311_058550
2522 Ga0501311_058695
2523 Ga0501312_002347
2524 Ga0501313_012946
2525 Ga0501314_004633
2526 Ga0501315_000284
2527 Ga0501316_001152
2528 Ga0501317_000192
2529 Ga0501318_000037
2530 Ga0501320_007213
2531 Ga0501320_033205
2532 Ga0501323_009389
2533 Ga0501324_025965
2534 Ga0501329_01320
2535 Ga0501331_07283
2536 Ga0501332_19326
2537 Ga0501335_019758
2538 Ga0501031_0058878
2539 Ga0501031_0189582
2540 Ga0501031_0245821
2541 Ga0501031_0336341
2542 Ga0501031_0384727
2543 Ga0501032_0102312
2544 Ga0501032_0196587
2545 Ga0501032_0510860
2546 Ga0501033_0003899
2547 Ga0501033_0077789
2548 Ga0501033_0087576
2549 Ga0501033_0329421
2550 Ga0501033_0561852
2551 Ga0501034_0009013
2552 Ga0501034_0045501
2553 Ga0501034_0046023
2554 Ga0501034_0072791
2555 Ga0501034_0215781
2556 Ga0501034_0280847
2557 Ga0501034_0296749
2558 Ga0501034_0660737
2559 Ga0501034_0789867
2560 Ga0501034_1100999
2561 Ga0501034_1586763
2562 Ga0501036_0042790
2563 Ga0501036_0156089
2564 Ga0501036_0373840
2565 Ga0501036_0761878
2566 Ga0501036_1036998
2567 Ga0501037_0038500
2568 Ga0501037_0058098
2569 Ga0501037_0067461
2570 Ga0501037_0147819
2571 Ga0501037_0215198
2572 Ga0501037_0308671
2573 Ga0501037_0610859
2574 Ga0501038_0046533
2575 Ga0501038_0111161
2576 Ga0501038_0149812
2577 Ga0501038_0178958
2578 Ga0501039_0094100
2579 Ga0501039_0143242
2580 Ga0501039_0220637
2581 Ga0501039_1465325
2582 Ga0501040_0057060
2583 Ga0501040_0104821
2584 Ga0501042_0006352
2585 Ga0501042_1104347
2586 Ga0501043_0032226
2587 Ga0501043_0100195
2588 Ga0501043_0374221
2589 Ga0501043_0377711
2590 Ga0501046_0079981
2591 Ga0501046_0104265
2592 Ga0501047_0005487
2593 Ga0501047_0103854
2594 Ga0501047_0322469
2595 Ga0501047_0346110
2596 Ga0501047_0511199
2597 Ga0501047_0622027
2598 Ga0501048_0010499
2599 Ga0501048_0644508
2600 Ga0501067_0001840
2601 Ga0501067_0138882
2602 Ga0501068_0031355
2603 Ga0501068_0134851
2604 Ga0501068_0679595
2605 Ga0501069_0192433
2606 Ga0501069_0553027
2607 Ga0501069_0965278
2608 Ga0501070_0025506
2609 Ga0501070_0219812
2610 Ga0501071_0014068
2611 Ga0501072_0184090
2612 Ga0501072_0267299
2613 Ga0501072_1024082
2614 Ga0501073_0023164
2615 Ga0501073_0039588
2616 Ga0501073_1281054
2617 Ga0501074_0026693
2618 Ga0501074_0052758
2619 Ga0501075_0433447
2620 Ga0501076_0054065
2621 Ga0501076_1252901
2622 Ga0501077_0028790
2623 Ga0501077_0769530
2624 Ga0501198_084030
2625 Ga0501202_068220
2626 Ga0501209_090205
2627 Ga0501261_052301
2628 Ga0501234_067452
2629 Ga0501245_092165
2630 Ga0501079_0024576
2631 Ga0501079_0126189
2632 Ga0501079_0670703
2633 Ga0501080_0107267
2634 Ga0501080_0137367
2635 Ga0501080_0258855
2636 Ga0501080_0871114
2637 Ga0501081_1036619
2638 Ga0501083_0006724
2639 Ga0501083_0023858
2640 Ga0501083_0493650
2641 Ga0501083_0604216
2642 Ga0501271_028555
2643 Ga0501035_0069162
2644 Ga0501035_0143633
2645 Ga0501035_0188785
2646 Ga0501035_0274381
2647 Ga0501035_0310484
2648 Ga0501035_0584051
2649 Ga0501044_0047177
2650 Ga0501044_0096645
2651 Ga0501044_0163967
2652 Ga0501044_0588757
2653 Ga0501044_0984596
2654 Ga0501044_1040435
2655 Ga0501045_0484646
2656 Ga0501045_0496303
2657 Ga0501045_1397298
2658 nmdc:mga03683_30010_c1
2659 nmdc:mga03683_55888_c1
2660 nmdc:mga03683_57927_c1
2661 nmdc:mga00v17_128506_c1
2662 nmdc:mga00v17_158507_c1
2663 nmdc:mga00v17_40128_c1
2664 nmdc:mga0yw44_198666_c1
2665 nmdc:mga0yw44_72574_c1
2666 nmdc:mga0yw44_8112_c1
2667 nmdc:mga0k408_107918_c1
2668 nmdc:mga0k408_349325_c1
2669 nmdc:mga06z11_122918_c1
2670 nmdc:mga06z11_65629_c1
2671 nmdc:mga07m45_26736_c1
2672 nmdc:mga07m45_313530_c1
2673 nmdc:mga05p37_109891_c1
2674 nmdc:mga05p37_1141437_c1
2675 nmdc:mga09592_39027_c1
2676 nmdc:mga06r32_11149_c1
2677 nmdc:mga08y16_1002128_c1
2678 nmdc:mga08y16_1237329_c1
2679 nmdc:mga08y16_704116_c1
2680 nmdc:mga0n895_260513_c1
2681 nmdc:mga0n895_331977_c1
2682 nmdc:mga0n895_5268_c1
2683 nmdc:mga0rr50_53041_c1
2684 nmdc:mga0rr50_97529_c2
2685 nmdc:mga08x19_11254_c1
2686 nmdc:mga08x19_816672_c1
2687 nmdc:mga0a205_44144_c1
2688 Ga0495601_0112434
2689 Ga0495601_0316895
2690 Ga0495612_0089496
2691 Ga0495612_0356432
2692 Ga0495612_0593509
2693 Ga0500635_0041067
2694 Ga0500635_0116565
2695 Ga0495595_0116849
2696 Ga0495619_0253113
2697 Ga0495619_0321326
2698 Ga0495619_0339923
2699 Ga0495619_0705296
2700 Ga0500647_0175353
2701 Ga0500647_0233186
2702 Ga0500566_0000320
2703 Ga0500566_0088640
2704 Ga0500640_029114
2705 Ga0500556_0004256
2706 Ga0500558_109295
2707 Ga0500562_009418
2708 Ga0500572_001638
2709 Ga0500572_015788
2710 Ga0500591_079976
2711 Ga0500608_083229
2712 Ga0500614_057503
2713 Ga0500614_280998
2714 Ga0500655_071954
2715 Ga0500559_0007811
2716 Ga0500559_0012275
2717 Ga0500559_0120340
2718 Ga0500561_0200419
2719 Ga0500564_290061
2720 Ga0500568_0113847
2721 Ga0500573_0006745
2722 Ga0500585_223960
2723 Ga0500590_151829
2724 Ga0500590_307903
2725 Ga0500603_021102
2726 Ga0500603_027424
2727 Ga0500603_030409
2728 Ga0500616_0006596
2729 Ga0500616_0048582
2730 Ga0500619_208526
2731 Ga0500630_005936
2732 Ga0500638_035746
2733 Ga0500639_019780
2734 Ga0500639_044490
2735 Ga0500636_0067281
2736 Ga0500636_0144725
2737 Ga0500637_0072771
2738 Ga0500637_0190508
2739 Ga0500637_0215172
2740 Ga0500576_041535
2741 Ga0500657_147716
2742 Ga0500552_113454
2743 Ga0500596_003892
2744 Ga0500596_007930
2745 Ga0500596_051092
2746 Ga0500601_007073
2747 Ga0500601_012157
2748 Ga0501084_0080043
2749 Ga0501084_0424221
2750 Ga0500661_118751
2751 Ga0590077_180360
2752 Ga0587093_049355
2753 Ga0587066_027970
2754 Ga0587070_023933
2755 Ga0587073_0145918
2756 Ga0587073_0272404
2757 Ga0587080_108329
2758 Ga0587082_107359
2759 Ga0587082_120957
2760 Ga0587083_0169989
2761 Ga0587085_122805
2762 Ga0587086_029713
2763 Ga0587090_001023
2764 Ga0587098_048040
2765 Ga0587106_013279
2766 Ga0587106_108624
2767 Ga0587101_004242
2768 Ga0587101_105964
2769 Ga0587101_106800
2770 Ga0587101_120350
2771 Ga0587109_103867
2772 Ga0587117_024481
2773 Ga0587067_174578
2774 Ga0587067_220962
2775 Ga0587069_083867
2776 Ga0587069_097416
2777 Ga0587072_023778
2778 Ga0587079_074253
2779 Ga0587079_157835
2780 Ga0587107_024275
2781 Ga0587107_038016
2782 Ga0587107_051941
2783 Ga0587107_112242
2784 Ga0587107_112462
2785 Ga0587108_004748
2786 Ga0587116_06220
2787 Ga0587119_036177
2788 Ga0501082_0171311
2789 Ga0501082_0526106
2790 Ga0501082_1408072
2791 Ga0466962_0243768
2792 Ga0466962_0487514
2793 Ga0530510_0050130
2794 Ga0530510_0261262
2795 Ga0530510_0473104
2796 2508735863
2797 2509149632
2798 2512642897
2799 2513678617
2800 2513894229
2801 2524469971
2802 2596374054
2803 2723846171
2804 2738745705
2805 2739354935
2806 2753359575
2807 2758641836
2808 2765465535
2809 2776259137
2810 2778126625
2811 2828310148
2812 2829749930
2813 2839995597
2814 2840768016
2815 2842701718
2816 2861692149
2817 2885384445
2818 2889311569
2819 2891050820
2820 2894240768
2821 2902334109
2822 2902411804
2823 2903770862
2824 2904583234
2825 2909043598
2826 2919123882
2827 2922361967
2828 2922428989
2829 2928129945
2830 2995397021
2831 3002143950
2832 3005512709
2833 3005598068
2834 8056684520

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

19

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_X 39s large subunit of the porcine mitochondrial ribosome 0.882 32 99
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.8398 15 100
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.8396 17 100
7pak-assembly1.cif.gz_s 70s ribosome with ef-tu-trna and p-site trna in mycoplasma pneumoniae cells 0.8325 20 100
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.8311 16 98
ID Description Score Start End Superfamily
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8194 14 99 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8134 15 100 3.30.70.330
af_G5EGK6_273_340_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8056 33 94 3.30.70.330
af_Q4D4H5_321_440_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7798 32 93 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7775 14 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1E3YSJ4-F1-model_v4 Large ribosomal subunit protein uL23 0.9892 31 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V5X8V8-F1-model_v4 50S ribosomal protein L23 0.9808 33 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X1WP25-F1-model_v4 deleted 0.9575 31 100
AF-A0A1F5B507-F1-model_v4 50S ribosomal protein L23 0.9526 32 100 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A382FB94-F1-model_v4 50S ribosomal protein L23 0.9306 30 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map