F493624
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1395 | 554 | 1390 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_109071|Ga0500595_109071_126_599 |
| Length | 157 |
| Sequence | VPFFGANNGFRLRLNEAWSNDGMAKEATAAGRGGKVKKREKKNITSGVAHVNASFNNTMITITDAQGNTIAWSSSGTKGFKGSRKSTPYAAQMAAEDAGKKAQEHGMKVLEVEVCGPGSGRESALRALQAVGFQITSIRDVTPIPHNGCRPRKRRRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 2 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 3 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 4 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 5 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300002864 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 23 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 157 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 158 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 227 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 234 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 239 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 246 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 247 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 248 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 250 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 254 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 259 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 266 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 267 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 268 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 271 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 273 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 275 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 292 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 307 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 308 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 309 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 310 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 311 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 312 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 313 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 316 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 317 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 318 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 319 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 320 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 324 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 325 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 326 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 327 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 328 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 329 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 330 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 331 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 332 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 333 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 334 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 337 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 417 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 418 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 419 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 420 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 466 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 474 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 475 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 476 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 477 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 478 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 479 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 489 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 492 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 495 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 496 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 498 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 499 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 501 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 502 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 503 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 505 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 506 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 508 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 509 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 510 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 511 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 512 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 517 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 518 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 519 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 520 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 523 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 524 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 525 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 526 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 527 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 528 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 529 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 530 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.9 |
| Metatranscriptomes | 6.74 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.73 |
| Nodule | 0.14 |
| Rhizoplane | 4.73 |
| Rhizosphere | 85.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10057967 | 3300001979 | Bacteria | 1079 |
| 2 | JGI24740J21852_10130414 | 3300001979 | Bacteria | 628 |
| 3 | Ga0006764J43180_108466 | 3300002864 | Bacteria | 798 |
| 4 | Ga0006778J45830_1008131 | 3300003162 | Bacteria | 1176 |
| 5 | Ga0006778J45830_1018080 | 3300003162 | Bacteria | 921 |
| 6 | Ga0006778J45830_1049198 | 3300003162 | Bacteria | 1027 |
| 7 | Ga0006759J45824_1022394 | 3300003163 | Bacteria | 1050 |
| 8 | Ga0006759J45824_1022824 | 3300003163 | Bacteria | 2259 |
| 9 | JGI25165J46597_1001315 | 3300003214 | Bacteria | 14050 |
| 10 | JGI25153J46596_10000830 | 3300003215 | Bacteria | 18874 |
| 11 | Ga0006758J48902_1033810 | 3300003300 | Bacteria | 636 |
| 12 | Ga0006770J48903_1012980 | 3300003305 | Bacteria | 2736 |
| 13 | Ga0006770J48903_1025503 | 3300003305 | Bacteria | 958 |
| 14 | Ga0006777J48905_1011379 | 3300003308 | Bacteria | 3133 |
| 15 | Ga0007427J51700_105947 | 3300003559 | Bacteria | 1540 |
| 16 | Ga0007427J51700_106632 | 3300003559 | Bacteria | 1423 |
| 17 | Ga0006781J51513_1004232 | 3300003568 | Bacteria | 1387 |
| 18 | Ga0007410J51695_1014171 | 3300003574 | Bacteria | 841 |
| 19 | Ga0007410J51695_1020352 | 3300003574 | Bacteria | 927 |
| 20 | Ga0007409J51694_1008637 | 3300003575 | Bacteria | 1402 |
| 21 | Ga0007416J51690_1009570 | 3300003577 | Bacteria | 1874 |
| 22 | Ga0006562J51391_1036321 | 3300003578 | Bacteria | 2102 |
| 23 | Ga0007429J51699_1016068 | 3300003579 | Bacteria | 1206 |
| 24 | Ga0007429J51699_1033775 | 3300003579 | Bacteria | 1336 |
| 25 | JGI25404J52841_10015764 | 3300003659 | Bacteria | 1639 |
| 26 | Ga0032354_1001326 | 3300003693 | Bacteria | 1584 |
| 27 | Ga0032354_1016125 | 3300003693 | Bacteria | 1404 |
| 28 | Ga0006780_1014704 | 3300003735 | Bacteria | 1986 |
| 29 | JGI25405J52794_10077812 | 3300003911 | Bacteria | 728 |
| 30 | Ga0058863_11718014 | 3300004799 | Bacteria | 681 |
| 31 | Ga0058860_10041150 | 3300004801 | Bacteria | 1260 |
| 32 | Ga0058862_10033415 | 3300004803 | Bacteria | 868 |
| 33 | Ga0065715_10035160 | 3300005293 | Bacteria | 1531 |
| 34 | Ga0070658_10003455 | 3300005327 | Bacteria | 12992 |
| 35 | Ga0070683_100084749 | 3300005329 | Bacteria | 2969 |
| 36 | Ga0070690_100186523 | 3300005330 | Bacteria | 1436 |
| 37 | Ga0068869_100008437 | 3300005334 | Bacteria | 6643 |
| 38 | Ga0068869_100092987 | 3300005334 | Bacteria | 2271 |
| 39 | Ga0068869_100100452 | 3300005334 | Bacteria | 2188 |
| 40 | Ga0068869_100544084 | 3300005334 | Bacteria | 974 |
| 41 | Ga0068869_102057784 | 3300005334 | Bacteria | 513 |
| 42 | Ga0070666_10021121 | 3300005335 | Bacteria | 4218 |
| 43 | Ga0070666_10137163 | 3300005335 | Bacteria | 1703 |
| 44 | Ga0070666_10264260 | 3300005335 | Bacteria | 1220 |
| 45 | Ga0070680_100069250 | 3300005336 | Bacteria | 2897 |
| 46 | Ga0070680_100107819 | 3300005336 | Bacteria | 2317 |
| 47 | Ga0070680_100192763 | 3300005336 | Bacteria | 1717 |
| 48 | Ga0070680_100268121 | 3300005336 | Bacteria | 1445 |
| 49 | Ga0070680_100342469 | 3300005336 | Bacteria | 1270 |
| 50 | Ga0070682_100016529 | 3300005337 | Bacteria | 4291 |
| 51 | Ga0068868_100029525 | 3300005338 | Bacteria | 4199 |
| 52 | Ga0068868_100602383 | 3300005338 | Bacteria | 973 |
| 53 | Ga0068868_101136364 | 3300005338 | Bacteria | 720 |
| 54 | Ga0068868_101167888 | 3300005338 | Bacteria | 711 |
| 55 | Ga0068868_101354080 | 3300005338 | Bacteria | 663 |
| 56 | Ga0068868_101894648 | 3300005338 | Bacteria | 564 |
| 57 | Ga0070660_100023123 | 3300005339 | Bacteria | 4603 |
| 58 | Ga0070660_100061987 | 3300005339 | Bacteria | 2904 |
| 59 | Ga0070660_100084309 | 3300005339 | Bacteria | 2497 |
| 60 | Ga0070660_100140899 | 3300005339 | Bacteria | 1934 |
| 61 | Ga0070689_101758028 | 3300005340 | Bacteria | 565 |
| 62 | Ga0070691_10014834 | 3300005341 | Bacteria | 3577 |
| 63 | Ga0070691_10140140 | 3300005341 | Bacteria | 1232 |
| 64 | Ga0070687_100219327 | 3300005343 | Bacteria | 1164 |
| 65 | Ga0070661_100246457 | 3300005344 | Bacteria | 1377 |
| 66 | Ga0070661_101866016 | 3300005344 | Bacteria | 511 |
| 67 | Ga0070692_10012203 | 3300005345 | Bacteria | 3968 |
| 68 | Ga0070692_10069116 | 3300005345 | Bacteria | 1878 |
| 69 | Ga0070668_100043015 | 3300005347 | Bacteria | 3463 |
| 70 | Ga0070668_100443671 | 3300005347 | Bacteria | 1114 |
| 71 | Ga0070668_101463004 | 3300005347 | Bacteria | 624 |
| 72 | Ga0070669_100192007 | 3300005353 | Bacteria | 1602 |
| 73 | Ga0070669_101011062 | 3300005353 | Bacteria | 713 |
| 74 | Ga0070675_100372422 | 3300005354 | Bacteria | 1270 |
| 75 | Ga0070675_101001736 | 3300005354 | Bacteria | 767 |
| 76 | Ga0070671_100110233 | 3300005355 | Bacteria | 2312 |
| 77 | Ga0070671_100719742 | 3300005355 | Bacteria | 866 |
| 78 | Ga0070671_101004691 | 3300005355 | Bacteria | 731 |
| 79 | Ga0070673_100150421 | 3300005364 | Bacteria | 1971 |
| 80 | Ga0070673_100657775 | 3300005364 | Bacteria | 959 |
| 81 | Ga0070688_100101145 | 3300005365 | Bacteria | 1901 |
| 82 | Ga0070688_100187724 | 3300005365 | Bacteria | 1438 |
| 83 | Ga0070688_101421598 | 3300005365 | Bacteria | 563 |
| 84 | Ga0070659_100018614 | 3300005366 | Bacteria | 5242 |
| 85 | Ga0070659_100406858 | 3300005366 | Bacteria | 1149 |
| 86 | Ga0070667_100028269 | 3300005367 | Bacteria | 4668 |
| 87 | Ga0070667_100055820 | 3300005367 | Bacteria | 3335 |
| 88 | Ga0070667_100209903 | 3300005367 | Bacteria | 1730 |
| 89 | Ga0070667_100449117 | 3300005367 | Bacteria | 1178 |
| 90 | Ga0070667_101130230 | 3300005367 | Bacteria | 732 |
| 91 | Ga0070667_101319560 | 3300005367 | Bacteria | 676 |
| 92 | Ga0070703_10121833 | 3300005406 | Bacteria | 947 |
| 93 | Ga0070709_10599618 | 3300005434 | Bacteria | 848 |
| 94 | Ga0070714_100000676 | 3300005435 | Bacteria | 24155 |
| 95 | Ga0070713_100708019 | 3300005436 | Bacteria | 962 |
| 96 | Ga0070701_10012091 | 3300005438 | Bacteria | 3881 |
| 97 | Ga0070701_10216281 | 3300005438 | Bacteria | 1141 |
| 98 | Ga0070701_10382880 | 3300005438 | Bacteria | 887 |
| 99 | Ga0070705_100000459 | 3300005440 | Bacteria | 23431 |
| 100 | Ga0070705_100942308 | 3300005440 | Bacteria | 697 |
| 101 | Ga0070700_100035635 | 3300005441 | Bacteria | 3012 |
| 102 | Ga0070700_100159447 | 3300005441 | Bacteria | 1551 |
| 103 | Ga0070700_100800876 | 3300005441 | Bacteria | 759 |
| 104 | Ga0070694_100025303 | 3300005444 | Bacteria | 3840 |
| 105 | Ga0070694_100186460 | 3300005444 | Bacteria | 1537 |
| 106 | Ga0070708_101280534 | 3300005445 | Bacteria | 685 |
| 107 | Ga0070663_100001615 | 3300005455 | Bacteria | 12447 |
| 108 | Ga0070663_100014346 | 3300005455 | Bacteria | 5084 |
| 109 | Ga0070663_100355644 | 3300005455 | Bacteria | 1187 |
| 110 | Ga0070663_100439838 | 3300005455 | Bacteria | 1073 |
| 111 | Ga0070663_100763531 | 3300005455 | Bacteria | 826 |
| 112 | Ga0070678_100044559 | 3300005456 | Bacteria | 3169 |
| 113 | Ga0070678_100061831 | 3300005456 | Bacteria | 2762 |
| 114 | Ga0070678_100224282 | 3300005456 | Bacteria | 1563 |
| 115 | Ga0070678_100483807 | 3300005456 | Bacteria | 1089 |
| 116 | Ga0070678_100731174 | 3300005456 | Bacteria | 894 |
| 117 | Ga0070678_101715828 | 3300005456 | Bacteria | 591 |
| 118 | Ga0070662_100084838 | 3300005457 | Bacteria | 2366 |
| 119 | Ga0070662_100141547 | 3300005457 | Bacteria | 1865 |
| 120 | Ga0070681_10007102 | 3300005458 | Bacteria | 10905 |
| 121 | Ga0070681_10015119 | 3300005458 | Bacteria | 7677 |
| 122 | Ga0070681_10029516 | 3300005458 | Bacteria | 5508 |
| 123 | Ga0070681_10058942 | 3300005458 | Bacteria | 3819 |
| 124 | Ga0070681_10071358 | 3300005458 | Bacteria | 3437 |
| 125 | Ga0070681_10257706 | 3300005458 | Bacteria | 1656 |
| 126 | Ga0070681_10580881 | 3300005458 | Bacteria | 1034 |
| 127 | Ga0070681_10709552 | 3300005458 | Bacteria | 922 |
| 128 | Ga0070681_11263045 | 3300005458 | Bacteria | 661 |
| 129 | Ga0068867_100209008 | 3300005459 | Bacteria | 1566 |
| 130 | Ga0068867_100572102 | 3300005459 | Bacteria | 981 |
| 131 | Ga0068867_100916634 | 3300005459 | Bacteria | 789 |
| 132 | Ga0068867_100940904 | 3300005459 | Bacteria | 780 |
| 133 | Ga0068867_100990164 | 3300005459 | Bacteria | 762 |
| 134 | Ga0070707_100257272 | 3300005468 | Bacteria | 1699 |
| 135 | Ga0070698_100204506 | 3300005471 | Bacteria | 1910 |
| 136 | Ga0070699_100000540 | 3300005518 | Bacteria | 35757 |
| 137 | Ga0070679_100014413 | 3300005530 | Bacteria | 7593 |
| 138 | Ga0070679_100047434 | 3300005530 | Bacteria | 4282 |
| 139 | Ga0070679_100081241 | 3300005530 | Bacteria | 3230 |
| 140 | Ga0070679_100331407 | 3300005530 | Bacteria | 1470 |
| 141 | Ga0070679_100509180 | 3300005530 | Bacteria | 1148 |
| 142 | Ga0070679_101293727 | 3300005530 | Bacteria | 675 |
| 143 | Ga0070697_100011184 | 3300005536 | Bacteria | 7013 |
| 144 | Ga0068853_100022760 | 3300005539 | Bacteria | 5237 |
| 145 | Ga0068853_100043552 | 3300005539 | Bacteria | 3840 |
| 146 | Ga0068853_100408744 | 3300005539 | Bacteria | 1271 |
| 147 | Ga0068853_100954509 | 3300005539 | Bacteria | 824 |
| 148 | Ga0068853_100991632 | 3300005539 | Bacteria | 808 |
| 149 | Ga0070672_100288069 | 3300005543 | Bacteria | 1390 |
| 150 | Ga0070686_100183555 | 3300005544 | Bacteria | 1488 |
| 151 | Ga0070686_100334643 | 3300005544 | Bacteria | 1133 |
| 152 | Ga0070686_100502805 | 3300005544 | Bacteria | 941 |
| 153 | Ga0070686_100593463 | 3300005544 | Bacteria | 872 |
| 154 | Ga0070695_100024268 | 3300005545 | Bacteria | 3734 |
| 155 | Ga0070695_100964424 | 3300005545 | Bacteria | 692 |
| 156 | Ga0070696_100000156 | 3300005546 | Bacteria | 38002 |
| 157 | Ga0070696_100103413 | 3300005546 | Bacteria | 2044 |
| 158 | Ga0070696_100317609 | 3300005546 | Bacteria | 1198 |
| 159 | Ga0070693_100012485 | 3300005547 | Bacteria | 4300 |
| 160 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 161 | Ga0070665_100023111 | 3300005548 | Bacteria | 6262 |
| 162 | Ga0070665_100026249 | 3300005548 | Bacteria | 5866 |
| 163 | Ga0070665_100684034 | 3300005548 | Bacteria | 1039 |
| 164 | Ga0070704_100001256 | 3300005549 | Bacteria | 13362 |
| 165 | Ga0070704_101620467 | 3300005549 | Bacteria | 597 |
| 166 | Ga0068855_100028006 | 3300005563 | Bacteria | 6741 |
| 167 | Ga0068855_100046653 | 3300005563 | Bacteria | 5121 |
| 168 | Ga0068855_100071894 | 3300005563 | Bacteria | 4021 |
| 169 | Ga0068855_100073423 | 3300005563 | Bacteria | 3974 |
| 170 | Ga0068855_100137813 | 3300005563 | Bacteria | 2783 |
| 171 | Ga0068855_100171503 | 3300005563 | Bacteria | 2457 |
| 172 | Ga0068855_100716568 | 3300005563 | Bacteria | 1069 |
| 173 | Ga0070664_100347391 | 3300005564 | Bacteria | 1349 |
| 174 | Ga0070664_101506345 | 3300005564 | Bacteria | 636 |
| 175 | Ga0068857_100020659 | 3300005577 | Bacteria | 5795 |
| 176 | Ga0068857_100031465 | 3300005577 | Bacteria | 4689 |
| 177 | Ga0068857_100095785 | 3300005577 | Bacteria | 2660 |
| 178 | Ga0068857_100122566 | 3300005577 | Bacteria | 2342 |
| 179 | Ga0068857_102105737 | 3300005577 | Bacteria | 554 |
| 180 | Ga0068854_100724080 | 3300005578 | Bacteria | 861 |
| 181 | Ga0068856_100435995 | 3300005614 | Bacteria | 1330 |
| 182 | Ga0068856_101518382 | 3300005614 | Bacteria | 684 |
| 183 | Ga0070702_100047118 | 3300005615 | Bacteria | 2447 |
| 184 | Ga0070702_100257669 | 3300005615 | Bacteria | 1186 |
| 185 | Ga0070702_100844818 | 3300005615 | Bacteria | 712 |
| 186 | Ga0070702_100996528 | 3300005615 | Bacteria | 663 |
| 187 | Ga0070702_101822182 | 3300005615 | Bacteria | 509 |
| 188 | Ga0068852_100386755 | 3300005616 | Bacteria | 1373 |
| 189 | Ga0068852_100576541 | 3300005616 | Bacteria | 1128 |
| 190 | Ga0068852_100992990 | 3300005616 | Bacteria | 858 |
| 191 | Ga0068852_102000957 | 3300005616 | Bacteria | 601 |
| 192 | Ga0068859_100005627 | 3300005617 | Bacteria | 12773 |
| 193 | Ga0068859_100243742 | 3300005617 | Bacteria | 1887 |
| 194 | Ga0068859_100440943 | 3300005617 | Bacteria | 1398 |
| 195 | Ga0068864_100013728 | 3300005618 | Bacteria | 6719 |
| 196 | Ga0068864_100156071 | 3300005618 | Bacteria | 2071 |
| 197 | Ga0068864_100464393 | 3300005618 | Bacteria | 1213 |
| 198 | Ga0068864_102048436 | 3300005618 | Bacteria | 579 |
| 199 | Ga0068866_10209421 | 3300005718 | Bacteria | 1170 |
| 200 | Ga0068866_11087899 | 3300005718 | Bacteria | 572 |
| 201 | Ga0068861_100057102 | 3300005719 | Bacteria | 2981 |
| 202 | Ga0068861_100060641 | 3300005719 | Bacteria | 2900 |
| 203 | Ga0068861_100168742 | 3300005719 | Bacteria | 1812 |
| 204 | Ga0068861_100219088 | 3300005719 | Bacteria | 1607 |
| 205 | Ga0068861_100710333 | 3300005719 | Bacteria | 935 |
| 206 | Ga0068870_10394820 | 3300005840 | Bacteria | 899 |
| 207 | Ga0068863_100064279 | 3300005841 | Bacteria | 3471 |
| 208 | Ga0068863_100757821 | 3300005841 | Bacteria | 967 |
| 209 | Ga0068863_100787247 | 3300005841 | Bacteria | 948 |
| 210 | Ga0068863_100983699 | 3300005841 | Bacteria | 846 |
| 211 | Ga0068858_100012099 | 3300005842 | Bacteria | 8133 |
| 212 | Ga0068858_100135230 | 3300005842 | Bacteria | 2313 |
| 213 | Ga0068858_101440710 | 3300005842 | Bacteria | 679 |
| 214 | Ga0068860_100006701 | 3300005843 | Bacteria | 11559 |
| 215 | Ga0068860_100242218 | 3300005843 | Bacteria | 1754 |
| 216 | Ga0068860_100359325 | 3300005843 | Bacteria | 1434 |
| 217 | Ga0068862_100034875 | 3300005844 | Bacteria | 4259 |
| 218 | Ga0068862_101342016 | 3300005844 | Bacteria | 717 |
| 219 | Ga0068862_101436671 | 3300005844 | Bacteria | 694 |
| 220 | Ga0081455_10001008 | 3300005937 | Bacteria | 35646 |
| 221 | Ga0081455_10251889 | 3300005937 | Bacteria | 1291 |
| 222 | Ga0081540_1000645 | 3300005983 | Bacteria | 33098 |
| 223 | Ga0081540_1006488 | 3300005983 | Bacteria | 8508 |
| 224 | Ga0081540_1120111 | 3300005983 | Bacteria | 1092 |
| 225 | Ga0081540_1217922 | 3300005983 | Bacteria | 681 |
| 226 | Ga0081539_10028584 | 3300005985 | Bacteria | 3502 |
| 227 | Ga0081539_10052221 | 3300005985 | Bacteria | 2297 |
| 228 | Ga0070717_11373621 | 3300006028 | Bacteria | 642 |
| 229 | Ga0075365_10050909 | 3300006038 | Bacteria | 2734 |
| 230 | Ga0075368_10002415 | 3300006042 | Bacteria | 6093 |
| 231 | Ga0075363_100093378 | 3300006048 | Bacteria | 1658 |
| 232 | Ga0075363_100180519 | 3300006048 | Bacteria | 1201 |
| 233 | Ga0075364_10360052 | 3300006051 | Bacteria | 992 |
| 234 | Ga0070715_10072145 | 3300006163 | Bacteria | 1545 |
| 235 | Ga0070712_100461985 | 3300006175 | Bacteria | 1059 |
| 236 | Ga0075362_10206673 | 3300006177 | Bacteria | 957 |
| 237 | Ga0075367_10207325 | 3300006178 | Bacteria | 1225 |
| 238 | Ga0075366_10043441 | 3300006195 | Bacteria | 2663 |
| 239 | Ga0075366_10044076 | 3300006195 | Bacteria | 2644 |
| 240 | Ga0075366_10347162 | 3300006195 | Bacteria | 910 |
| 241 | Ga0097621_100003892 | 3300006237 | Bacteria | 10347 |
| 242 | Ga0097621_100291285 | 3300006237 | Bacteria | 1439 |
| 243 | Ga0097621_100339957 | 3300006237 | Bacteria | 1333 |
| 244 | Ga0097621_100679452 | 3300006237 | Bacteria | 946 |
| 245 | Ga0097621_101148182 | 3300006237 | Bacteria | 731 |
| 246 | Ga0075370_10121056 | 3300006353 | Bacteria | 1523 |
| 247 | Ga0068871_100064267 | 3300006358 | Bacteria | 3004 |
| 248 | Ga0068871_100532121 | 3300006358 | Bacteria | 1062 |
| 249 | Ga0068871_100605847 | 3300006358 | Bacteria | 996 |
| 250 | Ga0068871_100760895 | 3300006358 | Bacteria | 891 |
| 251 | Ga0075428_100121619 | 3300006844 | Bacteria | 2843 |
| 252 | Ga0075428_100277033 | 3300006844 | Bacteria | 1805 |
| 253 | Ga0075428_100337512 | 3300006844 | Bacteria | 1618 |
| 254 | Ga0075428_100677028 | 3300006844 | Bacteria | 1099 |
| 255 | Ga0075428_100809363 | 3300006844 | Bacteria | 996 |
| 256 | Ga0075430_100025465 | 3300006846 | Bacteria | 5033 |
| 257 | Ga0075430_100625942 | 3300006846 | Bacteria | 888 |
| 258 | Ga0075431_100004125 | 3300006847 | Bacteria | 14184 |
| 259 | Ga0075431_100014343 | 3300006847 | Bacteria | 8015 |
| 260 | Ga0075431_100137414 | 3300006847 | Bacteria | 2520 |
| 261 | Ga0075431_100204143 | 3300006847 | Bacteria | 2021 |
| 262 | Ga0075431_100372131 | 3300006847 | Bacteria | 1434 |
| 263 | Ga0075433_10001194 | 3300006852 | Bacteria | 18909 |
| 264 | Ga0075433_10455435 | 3300006852 | Bacteria | 1128 |
| 265 | Ga0075434_100002309 | 3300006871 | Bacteria | 16689 |
| 266 | Ga0075434_100005901 | 3300006871 | Bacteria | 11197 |
| 267 | Ga0075434_100489510 | 3300006871 | Bacteria | 1251 |
| 268 | Ga0075434_102039620 | 3300006871 | Bacteria | 579 |
| 269 | Ga0075429_100184313 | 3300006880 | Bacteria | 1829 |
| 270 | Ga0075429_100230456 | 3300006880 | Bacteria | 1622 |
| 271 | Ga0075429_100994062 | 3300006880 | Bacteria | 733 |
| 272 | Ga0075436_100627444 | 3300006914 | Bacteria | 793 |
| 273 | Ga0097620_100005627 | 3300006931 | Bacteria | 12773 |
| 274 | Ga0097620_100243755 | 3300006931 | Bacteria | 1887 |
| 275 | Ga0097620_100440942 | 3300006931 | Bacteria | 1398 |
| 276 | Ga0075435_100084480 | 3300007076 | Bacteria | 2612 |
| 277 | Ga0075435_100178503 | 3300007076 | Bacteria | 1794 |
| 278 | Ga0099795_10246029 | 3300007788 | Bacteria | 770 |
| 279 | Ga0105251_10178396 | 3300009011 | Bacteria | 957 |
| 280 | Ga0105240_10473595 | 3300009093 | Bacteria | 1397 |
| 281 | Ga0105240_10811134 | 3300009093 | Bacteria | 1013 |
| 282 | Ga0105240_10872993 | 3300009093 | Bacteria | 969 |
| 283 | Ga0111539_10009902 | 3300009094 | Bacteria | 12026 |
| 284 | Ga0111539_10102489 | 3300009094 | Bacteria | 3359 |
| 285 | Ga0111539_10159827 | 3300009094 | Bacteria | 2635 |
| 286 | Ga0111539_10186305 | 3300009094 | Bacteria | 2423 |
| 287 | Ga0111539_12497493 | 3300009094 | Bacteria | 599 |
| 288 | Ga0105245_10271673 | 3300009098 | Bacteria | 1654 |
| 289 | Ga0105245_11199584 | 3300009098 | Bacteria | 807 |
| 290 | Ga0105245_12327652 | 3300009098 | Bacteria | 589 |
| 291 | Ga0105247_10265933 | 3300009101 | Bacteria | 1178 |
| 292 | Ga0105247_10741764 | 3300009101 | Bacteria | 743 |
| 293 | Ga0114129_10052649 | 3300009147 | Bacteria | 5713 |
| 294 | Ga0114129_10115748 | 3300009147 | Bacteria | 3695 |
| 295 | Ga0114129_10307258 | 3300009147 | Bacteria | 2112 |
| 296 | Ga0114129_10532331 | 3300009147 | Bacteria | 1531 |
| 297 | Ga0105243_10005642 | 3300009148 | Bacteria | 9744 |
| 298 | Ga0105243_10185163 | 3300009148 | Bacteria | 1814 |
| 299 | Ga0105243_10424620 | 3300009148 | Bacteria | 1241 |
| 300 | Ga0105243_10624585 | 3300009148 | Bacteria | 1041 |
| 301 | Ga0105241_10853785 | 3300009174 | Bacteria | 842 |
| 302 | Ga0105242_11429425 | 3300009176 | Bacteria | 720 |
| 303 | Ga0105248_10048814 | 3300009177 | Bacteria | 4747 |
| 304 | Ga0105248_10239747 | 3300009177 | Bacteria | 2041 |
| 305 | Ga0105237_10343233 | 3300009545 | Bacteria | 1497 |
| 306 | Ga0105238_10014386 | 3300009551 | Bacteria | 7997 |
| 307 | Ga0105238_10037395 | 3300009551 | Bacteria | 4935 |
| 308 | Ga0105238_11994332 | 3300009551 | Bacteria | 614 |
| 309 | Ga0105238_12979379 | 3300009551 | Bacteria | 509 |
| 310 | Ga0105249_10010481 | 3300009553 | Bacteria | 8143 |
| 311 | Ga0105249_10232087 | 3300009553 | Bacteria | 1820 |
| 312 | Ga0105249_10504662 | 3300009553 | Bacteria | 1255 |
| 313 | Ga0105249_10629910 | 3300009553 | Bacteria | 1129 |
| 314 | Ga0105249_12646345 | 3300009553 | Bacteria | 574 |
| 315 | Ga0105239_10077772 | 3300010375 | Bacteria | 3651 |
| 316 | Ga0105239_10152056 | 3300010375 | Bacteria | 2583 |
| 317 | Ga0105239_10154786 | 3300010375 | Bacteria | 2560 |
| 318 | Ga0105239_10442559 | 3300010375 | Bacteria | 1474 |
| 319 | Ga0105239_11042557 | 3300010375 | Bacteria | 941 |
| 320 | Ga0105239_12960839 | 3300010375 | Bacteria | 554 |
| 321 | Ga0105246_10008563 | 3300011119 | Bacteria | 6291 |
| 322 | Ga0105246_10257174 | 3300011119 | Bacteria | 1389 |
| 323 | Ga0105246_10608919 | 3300011119 | Bacteria | 945 |
| 324 | Ga0105246_10610720 | 3300011119 | Bacteria | 944 |
| 325 | Ga0157373_11389966 | 3300013100 | Bacteria | 533 |
| 326 | Ga0157371_10018600 | 3300013102 | Bacteria | 5133 |
| 327 | Ga0157370_10029081 | 3300013104 | Bacteria | 5429 |
| 328 | Ga0157370_10096703 | 3300013104 | Bacteria | 2770 |
| 329 | Ga0157370_10141347 | 3300013104 | Bacteria | 2243 |
| 330 | Ga0157370_10231765 | 3300013104 | Bacteria | 1709 |
| 331 | Ga0157369_10032567 | 3300013105 | Bacteria | 5731 |
| 332 | Ga0157369_10356738 | 3300013105 | Bacteria | 1518 |
| 333 | Ga0157374_10534851 | 3300013296 | Bacteria | 1179 |
| 334 | Ga0157374_10609235 | 3300013296 | Bacteria | 1102 |
| 335 | Ga0157378_10357095 | 3300013297 | Bacteria | 1429 |
| 336 | Ga0157378_10540698 | 3300013297 | Bacteria | 1169 |
| 337 | Ga0157378_10618473 | 3300013297 | Bacteria | 1096 |
| 338 | Ga0157378_10845320 | 3300013297 | Bacteria | 943 |
| 339 | Ga0163162_10338990 | 3300013306 | Bacteria | 1636 |
| 340 | Ga0163162_11195020 | 3300013306 | Bacteria | 863 |
| 341 | Ga0157372_12584690 | 3300013307 | Bacteria | 583 |
| 342 | Ga0157372_12638887 | 3300013307 | Bacteria | 576 |
| 343 | Ga0157375_10116435 | 3300013308 | Bacteria | 2777 |
| 344 | Ga0157375_10859984 | 3300013308 | Bacteria | 1053 |
| 345 | Ga0157375_11491023 | 3300013308 | Bacteria | 798 |
| 346 | Ga0157375_11857261 | 3300013308 | Bacteria | 715 |
| 347 | Ga0157375_12522197 | 3300013308 | Bacteria | 614 |
| 348 | Ga0157375_12550657 | 3300013308 | Bacteria | 611 |
| 349 | Ga0157375_12925126 | 3300013308 | Bacteria | 571 |
| 350 | Ga0163163_10169829 | 3300014325 | Bacteria | 2227 |
| 351 | Ga0163163_10329470 | 3300014325 | Bacteria | 1581 |
| 352 | Ga0163163_11289895 | 3300014325 | Bacteria | 792 |
| 353 | Ga0163163_12852432 | 3300014325 | Bacteria | 539 |
| 354 | Ga0157380_10009306 | 3300014326 | Bacteria | 7035 |
| 355 | Ga0157380_10198955 | 3300014326 | Bacteria | 1776 |
| 356 | Ga0157380_10293021 | 3300014326 | Bacteria | 1495 |
| 357 | Ga0157380_11627094 | 3300014326 | Bacteria | 702 |
| 358 | Ga0157380_12925422 | 3300014326 | Bacteria | 544 |
| 359 | Ga0157380_13293333 | 3300014326 | Bacteria | 516 |
| 360 | Ga0182008_10027386 | 3300014497 | Bacteria | 2888 |
| 361 | Ga0157377_10578754 | 3300014745 | Bacteria | 797 |
| 362 | Ga0157379_10027510 | 3300014968 | Bacteria | 5063 |
| 363 | Ga0157379_10117175 | 3300014968 | Bacteria | 2396 |
| 364 | Ga0157379_10206026 | 3300014968 | Bacteria | 1779 |
| 365 | Ga0157379_11296326 | 3300014968 | Bacteria | 703 |
| 366 | Ga0157379_11624045 | 3300014968 | Bacteria | 632 |
| 367 | Ga0157376_10136727 | 3300014969 | Bacteria | 2194 |
| 368 | Ga0157376_10268214 | 3300014969 | Bacteria | 1602 |
| 369 | Ga0157376_10366273 | 3300014969 | Bacteria | 1384 |
| 370 | Ga0157376_10672713 | 3300014969 | Bacteria | 1038 |
| 371 | Ga0157376_10774006 | 3300014969 | Bacteria | 971 |
| 372 | Ga0157376_11520995 | 3300014969 | Bacteria | 702 |
| 373 | Ga0163161_10088631 | 3300017792 | Bacteria | 2287 |
| 374 | Ga0163161_10647377 | 3300017792 | Bacteria | 875 |
| 375 | Ga0206353_10361816 | 3300020082 | Bacteria | 662 |
| 376 | Ga0154015_1156125 | 3300020610 | Bacteria | 1061 |
| 377 | Ga0213872_10036033 | 3300021361 | Bacteria | 2261 |
| 378 | Ga0213872_10363622 | 3300021361 | Bacteria | 592 |
| 379 | Ga0213876_10003406 | 3300021384 | Bacteria | 9099 |
| 380 | Ga0213871_10311541 | 3300021441 | Bacteria | 510 |
| 381 | Ga0256744_117912 | 3300023309 | Bacteria | 1150 |
| 382 | Ga0256720_148736 | 3300023438 | Bacteria | 626 |
| 383 | Ga0207427_104861 | 3300025231 | Bacteria | 2078 |
| 384 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 385 | Ga0209455_1008380 | 3300025272 | Bacteria | 2813 |
| 386 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 387 | Ga0207656_10068548 | 3300025321 | Bacteria | 1572 |
| 388 | Ga0207653_10073529 | 3300025885 | Bacteria | 1172 |
| 389 | Ga0207653_10075550 | 3300025885 | Bacteria | 1158 |
| 390 | Ga0207642_10465669 | 3300025899 | Bacteria | 768 |
| 391 | Ga0207710_10206345 | 3300025900 | Bacteria | 972 |
| 392 | Ga0207680_10035901 | 3300025903 | Bacteria | 2851 |
| 393 | Ga0207680_10193851 | 3300025903 | Bacteria | 1381 |
| 394 | Ga0207680_10294370 | 3300025903 | Bacteria | 1130 |
| 395 | Ga0207680_11312866 | 3300025903 | Bacteria | 514 |
| 396 | Ga0207647_10069690 | 3300025904 | Bacteria | 2126 |
| 397 | Ga0207685_10002550 | 3300025905 | Bacteria | 4204 |
| 398 | Ga0207645_10027676 | 3300025907 | Bacteria | 3659 |
| 399 | Ga0207645_11026796 | 3300025907 | Bacteria | 558 |
| 400 | Ga0207643_10321808 | 3300025908 | Bacteria | 966 |
| 401 | Ga0207705_10004936 | 3300025909 | Bacteria | 10013 |
| 402 | Ga0207705_10035805 | 3300025909 | Bacteria | 3551 |
| 403 | Ga0207705_10076496 | 3300025909 | Bacteria | 2433 |
| 404 | Ga0207705_10591827 | 3300025909 | Bacteria | 862 |
| 405 | Ga0207707_10010230 | 3300025912 | Bacteria | 8144 |
| 406 | Ga0207707_10014060 | 3300025912 | Bacteria | 6977 |
| 407 | Ga0207707_10038191 | 3300025912 | Bacteria | 4196 |
| 408 | Ga0207707_10056826 | 3300025912 | Bacteria | 3405 |
| 409 | Ga0207707_10115614 | 3300025912 | Bacteria | 2344 |
| 410 | Ga0207707_10156822 | 3300025912 | Bacteria | 1991 |
| 411 | Ga0207707_10161372 | 3300025912 | Bacteria | 1960 |
| 412 | Ga0207707_10484945 | 3300025912 | Bacteria | 1056 |
| 413 | Ga0207695_10000575 | 3300025913 | Bacteria | 74997 |
| 414 | Ga0207695_10259669 | 3300025913 | Bacteria | 1635 |
| 415 | Ga0207695_10403007 | 3300025913 | Bacteria | 1252 |
| 416 | Ga0207695_10579178 | 3300025913 | Bacteria | 1004 |
| 417 | Ga0207695_10752667 | 3300025913 | Bacteria | 855 |
| 418 | Ga0207695_10863779 | 3300025913 | Bacteria | 785 |
| 419 | Ga0207671_10401373 | 3300025914 | Bacteria | 1090 |
| 420 | Ga0207671_10705708 | 3300025914 | Bacteria | 802 |
| 421 | Ga0207693_10275682 | 3300025915 | Bacteria | 1318 |
| 422 | Ga0207660_10000537 | 3300025917 | Bacteria | 25426 |
| 423 | Ga0207660_10003004 | 3300025917 | Bacteria | 11039 |
| 424 | Ga0207660_10052376 | 3300025917 | Bacteria | 2905 |
| 425 | Ga0207660_10146738 | 3300025917 | Bacteria | 1809 |
| 426 | Ga0207660_10155049 | 3300025917 | Bacteria | 1763 |
| 427 | Ga0207662_10130312 | 3300025918 | Bacteria | 1585 |
| 428 | Ga0207662_10356421 | 3300025918 | Bacteria | 983 |
| 429 | Ga0207657_10006388 | 3300025919 | Bacteria | 12240 |
| 430 | Ga0207657_10021181 | 3300025919 | Bacteria | 6124 |
| 431 | Ga0207657_10083597 | 3300025919 | Bacteria | 2678 |
| 432 | Ga0207657_10100998 | 3300025919 | Bacteria | 2394 |
| 433 | Ga0207657_10290398 | 3300025919 | Bacteria | 1297 |
| 434 | Ga0207649_11136592 | 3300025920 | Bacteria | 617 |
| 435 | Ga0207652_10045523 | 3300025921 | Bacteria | 3741 |
| 436 | Ga0207652_10048851 | 3300025921 | Bacteria | 3619 |
| 437 | Ga0207652_10116633 | 3300025921 | Bacteria | 2372 |
| 438 | Ga0207652_10154260 | 3300025921 | Bacteria | 2057 |
| 439 | Ga0207652_10271075 | 3300025921 | Bacteria | 1531 |
| 440 | Ga0207652_10546380 | 3300025921 | Bacteria | 1041 |
| 441 | Ga0207646_10178105 | 3300025922 | Bacteria | 1920 |
| 442 | Ga0207681_10078471 | 3300025923 | Bacteria | 2324 |
| 443 | Ga0207681_10191943 | 3300025923 | Bacteria | 1563 |
| 444 | Ga0207694_10021191 | 3300025924 | Bacteria | 4923 |
| 445 | Ga0207694_10279826 | 3300025924 | Bacteria | 1370 |
| 446 | Ga0207694_10581570 | 3300025924 | Bacteria | 941 |
| 447 | Ga0207659_11379701 | 3300025926 | Bacteria | 604 |
| 448 | Ga0207687_10155570 | 3300025927 | Bacteria | 1749 |
| 449 | Ga0207687_10527637 | 3300025927 | Bacteria | 988 |
| 450 | Ga0207687_10625466 | 3300025927 | Bacteria | 909 |
| 451 | Ga0207687_10945196 | 3300025927 | Bacteria | 738 |
| 452 | Ga0207687_11507210 | 3300025927 | Bacteria | 578 |
| 453 | Ga0207700_10719333 | 3300025928 | Bacteria | 892 |
| 454 | Ga0207700_11264045 | 3300025928 | Bacteria | 658 |
| 455 | Ga0207700_12009809 | 3300025928 | Bacteria | 505 |
| 456 | Ga0207664_10000478 | 3300025929 | Bacteria | 28408 |
| 457 | Ga0207664_11336705 | 3300025929 | Bacteria | 637 |
| 458 | Ga0207664_11404239 | 3300025929 | Bacteria | 619 |
| 459 | Ga0207644_10078687 | 3300025931 | Bacteria | 2431 |
| 460 | Ga0207644_10420732 | 3300025931 | Bacteria | 1094 |
| 461 | Ga0207690_10000322 | 3300025932 | Bacteria | 32043 |
| 462 | Ga0207690_10008862 | 3300025932 | Bacteria | 5970 |
| 463 | Ga0207690_10008933 | 3300025932 | Bacteria | 5948 |
| 464 | Ga0207690_10232426 | 3300025932 | Bacteria | 1416 |
| 465 | Ga0207706_10025334 | 3300025933 | Bacteria | 5315 |
| 466 | Ga0207706_10205402 | 3300025933 | Bacteria | 1727 |
| 467 | Ga0207706_10531531 | 3300025933 | Bacteria | 1013 |
| 468 | Ga0207706_10548571 | 3300025933 | Bacteria | 995 |
| 469 | Ga0207706_11004057 | 3300025933 | Bacteria | 701 |
| 470 | Ga0207706_11532526 | 3300025933 | Bacteria | 542 |
| 471 | Ga0207709_10007982 | 3300025935 | Bacteria | 5862 |
| 472 | Ga0207709_10384088 | 3300025935 | Bacteria | 1069 |
| 473 | Ga0207670_10366911 | 3300025936 | Bacteria | 1144 |
| 474 | Ga0207670_10396942 | 3300025936 | Bacteria | 1102 |
| 475 | Ga0207691_10350676 | 3300025940 | Bacteria | 1263 |
| 476 | Ga0207691_10750320 | 3300025940 | Bacteria | 822 |
| 477 | Ga0207711_10009066 | 3300025941 | Bacteria | 8311 |
| 478 | Ga0207689_10013634 | 3300025942 | Bacteria | 6930 |
| 479 | Ga0207689_10030241 | 3300025942 | Bacteria | 4513 |
| 480 | Ga0207689_10221147 | 3300025942 | Bacteria | 1564 |
| 481 | Ga0207689_10442129 | 3300025942 | Bacteria | 1086 |
| 482 | Ga0207661_10058611 | 3300025944 | Bacteria | 3099 |
| 483 | Ga0207661_10519997 | 3300025944 | Bacteria | 1088 |
| 484 | Ga0207661_11055193 | 3300025944 | Bacteria | 748 |
| 485 | Ga0207679_10981191 | 3300025945 | Bacteria | 774 |
| 486 | Ga0207679_11662135 | 3300025945 | Bacteria | 585 |
| 487 | Ga0207679_11747271 | 3300025945 | Bacteria | 569 |
| 488 | Ga0207667_10026409 | 3300025949 | Bacteria | 6345 |
| 489 | Ga0207667_10057429 | 3300025949 | Bacteria | 4085 |
| 490 | Ga0207667_10063505 | 3300025949 | Bacteria | 3858 |
| 491 | Ga0207667_10351288 | 3300025949 | Bacteria | 1504 |
| 492 | Ga0207667_10411725 | 3300025949 | Bacteria | 1376 |
| 493 | Ga0207667_10466180 | 3300025949 | Bacteria | 1283 |
| 494 | Ga0207667_10589684 | 3300025949 | Bacteria | 1121 |
| 495 | Ga0207651_10027205 | 3300025960 | Bacteria | 3588 |
| 496 | Ga0207651_10174855 | 3300025960 | Bacteria | 1697 |
| 497 | Ga0207712_10003369 | 3300025961 | Bacteria | 10107 |
| 498 | Ga0207712_10246693 | 3300025961 | Bacteria | 1441 |
| 499 | Ga0207668_10098919 | 3300025972 | Bacteria | 2162 |
| 500 | Ga0207668_10222061 | 3300025972 | Bacteria | 1518 |
| 501 | Ga0207668_10456132 | 3300025972 | Bacteria | 1092 |
| 502 | Ga0207640_10503971 | 3300025981 | Bacteria | 1009 |
| 503 | Ga0207640_11840477 | 3300025981 | Bacteria | 547 |
| 504 | Ga0207658_10031844 | 3300025986 | Bacteria | 3749 |
| 505 | Ga0207658_10231702 | 3300025986 | Bacteria | 1559 |
| 506 | Ga0207658_10420427 | 3300025986 | Bacteria | 1178 |
| 507 | Ga0207658_10593453 | 3300025986 | Bacteria | 994 |
| 508 | Ga0207658_11283616 | 3300025986 | Bacteria | 669 |
| 509 | Ga0207677_10646154 | 3300026023 | Bacteria | 933 |
| 510 | Ga0207677_11091649 | 3300026023 | Bacteria | 727 |
| 511 | Ga0207703_10124896 | 3300026035 | Bacteria | 2214 |
| 512 | Ga0207703_10246380 | 3300026035 | Bacteria | 1609 |
| 513 | Ga0207703_10644001 | 3300026035 | Bacteria | 1005 |
| 514 | Ga0207703_10784666 | 3300026035 | Bacteria | 909 |
| 515 | Ga0207703_12344404 | 3300026035 | Bacteria | 509 |
| 516 | Ga0207639_10019252 | 3300026041 | Bacteria | 4866 |
| 517 | Ga0207639_10117451 | 3300026041 | Bacteria | 2180 |
| 518 | Ga0207639_10371523 | 3300026041 | Bacteria | 1282 |
| 519 | Ga0207639_10734826 | 3300026041 | Bacteria | 917 |
| 520 | Ga0207639_11620230 | 3300026041 | Bacteria | 607 |
| 521 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 522 | Ga0207678_10001998 | 3300026067 | Bacteria | 18570 |
| 523 | Ga0207678_10092917 | 3300026067 | Bacteria | 2578 |
| 524 | Ga0207678_10568602 | 3300026067 | Bacteria | 992 |
| 525 | Ga0207678_10750054 | 3300026067 | Bacteria | 861 |
| 526 | Ga0207708_10001023 | 3300026075 | Bacteria | 20938 |
| 527 | Ga0207708_10079350 | 3300026075 | Bacteria | 2521 |
| 528 | Ga0207708_10660023 | 3300026075 | Bacteria | 891 |
| 529 | Ga0207708_10707224 | 3300026075 | Bacteria | 862 |
| 530 | Ga0207708_11505701 | 3300026075 | Bacteria | 591 |
| 531 | Ga0207702_10981532 | 3300026078 | Bacteria | 838 |
| 532 | Ga0207641_10031526 | 3300026088 | Bacteria | 4397 |
| 533 | Ga0207641_10064762 | 3300026088 | Bacteria | 3125 |
| 534 | Ga0207641_10576200 | 3300026088 | Bacteria | 1100 |
| 535 | Ga0207648_10025631 | 3300026089 | Bacteria | 5250 |
| 536 | Ga0207648_10099185 | 3300026089 | Bacteria | 2551 |
| 537 | Ga0207648_10217728 | 3300026089 | Bacteria | 1696 |
| 538 | Ga0207648_10625804 | 3300026089 | Bacteria | 993 |
| 539 | Ga0207648_10982180 | 3300026089 | Bacteria | 790 |
| 540 | Ga0207648_11278503 | 3300026089 | Bacteria | 689 |
| 541 | Ga0207676_10147003 | 3300026095 | Bacteria | 2025 |
| 542 | Ga0207676_11589531 | 3300026095 | Bacteria | 651 |
| 543 | Ga0207674_10038880 | 3300026116 | Bacteria | 4935 |
| 544 | Ga0207674_10040450 | 3300026116 | Bacteria | 4829 |
| 545 | Ga0207674_10066996 | 3300026116 | Bacteria | 3615 |
| 546 | Ga0207674_10145952 | 3300026116 | Bacteria | 2325 |
| 547 | Ga0207674_10430144 | 3300026116 | Bacteria | 1276 |
| 548 | Ga0207674_11534436 | 3300026116 | Bacteria | 635 |
| 549 | Ga0207675_100022568 | 3300026118 | Bacteria | 5859 |
| 550 | Ga0207675_100066743 | 3300026118 | Bacteria | 3363 |
| 551 | Ga0207675_100559964 | 3300026118 | Bacteria | 1143 |
| 552 | Ga0207675_101024505 | 3300026118 | Bacteria | 844 |
| 553 | Ga0207683_10190947 | 3300026121 | Bacteria | 1860 |
| 554 | Ga0207683_10337170 | 3300026121 | Bacteria | 1382 |
| 555 | Ga0207683_10432369 | 3300026121 | Bacteria | 1213 |
| 556 | Ga0207683_10522017 | 3300026121 | Bacteria | 1097 |
| 557 | Ga0207683_10566477 | 3300026121 | Bacteria | 1051 |
| 558 | Ga0207698_10443331 | 3300026142 | Bacteria | 1251 |
| 559 | Ga0207698_10522792 | 3300026142 | Bacteria | 1158 |
| 560 | Ga0207698_10834411 | 3300026142 | Bacteria | 926 |
| 561 | Ga0207698_10904180 | 3300026142 | Bacteria | 890 |
| 562 | Ga0209981_1000043 | 3300027378 | Bacteria | 12361 |
| 563 | Ga0209999_1007077 | 3300027543 | Bacteria | 2016 |
| 564 | Ga0209983_1050968 | 3300027665 | Bacteria | 906 |
| 565 | Ga0209813_10054754 | 3300027866 | Bacteria | 1258 |
| 566 | Ga0207428_10007316 | 3300027907 | Bacteria | 10081 |
| 567 | Ga0207428_10023296 | 3300027907 | Bacteria | 5209 |
| 568 | Ga0207428_10156661 | 3300027907 | Bacteria | 1732 |
| 569 | Ga0207428_10829115 | 3300027907 | Bacteria | 656 |
| 570 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 571 | Ga0268266_10000557 | 3300028379 | Bacteria | 51935 |
| 572 | Ga0268266_10178394 | 3300028379 | Bacteria | 1932 |
| 573 | Ga0268266_10233432 | 3300028379 | Bacteria | 1695 |
| 574 | Ga0268266_11790024 | 3300028379 | Bacteria | 589 |
| 575 | Ga0268265_10004169 | 3300028380 | Bacteria | 10121 |
| 576 | Ga0268265_10052380 | 3300028380 | Bacteria | 3086 |
| 577 | Ga0268265_10593862 | 3300028380 | Bacteria | 1057 |
| 578 | Ga0268265_10775640 | 3300028380 | Bacteria | 932 |
| 579 | Ga0268265_12266033 | 3300028380 | Bacteria | 550 |
| 580 | Ga0268264_10002325 | 3300028381 | Bacteria | 16817 |
| 581 | Ga0268264_10005719 | 3300028381 | Bacteria | 10538 |
| 582 | Ga0268264_10201865 | 3300028381 | Bacteria | 1820 |
| 583 | Ga0268264_10349240 | 3300028381 | Bacteria | 1407 |
| 584 | Ga0268264_12263184 | 3300028381 | Bacteria | 551 |
| 585 | Ga0265319_1102853 | 3300028563 | Bacteria | 896 |
| 586 | Ga0265334_10127982 | 3300028573 | Bacteria | 905 |
| 587 | Ga0265318_10004788 | 3300028577 | Bacteria | 6480 |
| 588 | Ga0265336_10029236 | 3300028666 | Bacteria | 1720 |
| 589 | Ga0307517_10012557 | 3300028786 | Bacteria | 11610 |
| 590 | Ga0307515_10153824 | 3300028794 | Bacteria | 2387 |
| 591 | Ga0307515_10173473 | 3300028794 | Bacteria | 2137 |
| 592 | Ga0265338_10002896 | 3300028800 | Bacteria | 24981 |
| 593 | Ga0265338_10046965 | 3300028800 | Bacteria | 3949 |
| 594 | Ga0265338_10096847 | 3300028800 | Bacteria | 2419 |
| 595 | Ga0265338_10156776 | 3300028800 | Bacteria | 1763 |
| 596 | Ga0265338_10170295 | 3300028800 | Bacteria | 1671 |
| 597 | Ga0265338_10664129 | 3300028800 | Bacteria | 722 |
| 598 | Ga0265338_11063122 | 3300028800 | Bacteria | 546 |
| 599 | Ga0310981_1020365 | 3300029285 | Bacteria | 861 |
| 600 | Ga0310981_1053128 | 3300029285 | Bacteria | 1261 |
| 601 | Ga0265770_1041356 | 3300030878 | Bacteria | 807 |
| 602 | Ga0265761_105604 | 3300030889 | Bacteria | 659 |
| 603 | Ga0265330_10077828 | 3300031235 | Bacteria | 1431 |
| 604 | Ga0265332_10033404 | 3300031238 | Bacteria | 2239 |
| 605 | Ga0265328_10157031 | 3300031239 | Bacteria | 857 |
| 606 | Ga0265328_10296701 | 3300031239 | Bacteria | 624 |
| 607 | Ga0265320_10057316 | 3300031240 | Bacteria | 1869 |
| 608 | Ga0265320_10355914 | 3300031240 | Bacteria | 647 |
| 609 | Ga0265325_10008115 | 3300031241 | Bacteria | 6223 |
| 610 | Ga0265325_10146029 | 3300031241 | Bacteria | 1122 |
| 611 | Ga0265329_10051749 | 3300031242 | Bacteria | 1307 |
| 612 | Ga0265339_10063241 | 3300031249 | Bacteria | 1988 |
| 613 | Ga0265339_10205030 | 3300031249 | Bacteria | 971 |
| 614 | Ga0265331_10033733 | 3300031250 | Bacteria | 2530 |
| 615 | Ga0265331_10035730 | 3300031250 | Bacteria | 2443 |
| 616 | Ga0265331_10058532 | 3300031250 | Bacteria | 1824 |
| 617 | Ga0265331_10063163 | 3300031250 | Bacteria | 1745 |
| 618 | Ga0265316_10075091 | 3300031344 | Bacteria | 2600 |
| 619 | Ga0265316_10100937 | 3300031344 | Bacteria | 2193 |
| 620 | Ga0265316_10748816 | 3300031344 | Bacteria | 687 |
| 621 | Ga0265316_10886912 | 3300031344 | Bacteria | 623 |
| 622 | Ga0307513_10002446 | 3300031456 | Bacteria | 25748 |
| 623 | Ga0307513_10009092 | 3300031456 | Bacteria | 12594 |
| 624 | Ga0307513_10285642 | 3300031456 | Bacteria | 1425 |
| 625 | Ga0307513_10387495 | 3300031456 | Bacteria | 1135 |
| 626 | Ga0307513_10600403 | 3300031456 | Bacteria | 810 |
| 627 | Ga0307509_10386543 | 3300031507 | Bacteria | 1111 |
| 628 | Ga0307408_101933520 | 3300031548 | Bacteria | 566 |
| 629 | Ga0265313_10006418 | 3300031595 | Bacteria | 8329 |
| 630 | Ga0265313_10011787 | 3300031595 | Bacteria | 5406 |
| 631 | Ga0265313_10081099 | 3300031595 | Bacteria | 1473 |
| 632 | Ga0265313_10093517 | 3300031595 | Bacteria | 1345 |
| 633 | Ga0265313_10197474 | 3300031595 | Bacteria | 838 |
| 634 | Ga0265313_10328556 | 3300031595 | Bacteria | 609 |
| 635 | Ga0307508_10171057 | 3300031616 | Bacteria | 1776 |
| 636 | Ga0316579_10545452 | 3300031691 | Bacteria | 561 |
| 637 | Ga0265314_10037136 | 3300031711 | Bacteria | 3533 |
| 638 | Ga0265314_10049812 | 3300031711 | Bacteria | 2929 |
| 639 | Ga0265314_10063782 | 3300031711 | Bacteria | 2498 |
| 640 | Ga0265314_10081934 | 3300031711 | Bacteria | 2124 |
| 641 | Ga0265314_10373438 | 3300031711 | Bacteria | 778 |
| 642 | Ga0265342_10063846 | 3300031712 | Bacteria | 2163 |
| 643 | Ga0265342_10086286 | 3300031712 | Bacteria | 1805 |
| 644 | Ga0316576_10011989 | 3300031727 | Bacteria | 5706 |
| 645 | Ga0316578_10084150 | 3300031728 | Bacteria | 1895 |
| 646 | Ga0307516_10001565 | 3300031730 | Bacteria | 31484 |
| 647 | Ga0307516_10104724 | 3300031730 | Bacteria | 2641 |
| 648 | Ga0307405_10438305 | 3300031731 | Bacteria | 1033 |
| 649 | Ga0307405_10942466 | 3300031731 | Bacteria | 733 |
| 650 | Ga0316577_10030400 | 3300031733 | Bacteria | 3016 |
| 651 | Ga0316577_10663423 | 3300031733 | Bacteria | 593 |
| 652 | Ga0307413_10122230 | 3300031824 | Bacteria | 1766 |
| 653 | Ga0307413_10485172 | 3300031824 | Bacteria | 989 |
| 654 | Ga0307413_11365589 | 3300031824 | Bacteria | 622 |
| 655 | Ga0307410_11498005 | 3300031852 | Bacteria | 594 |
| 656 | Ga0307406_10327963 | 3300031901 | Bacteria | 1187 |
| 657 | Ga0307406_10505848 | 3300031901 | Bacteria | 980 |
| 658 | Ga0307406_10572785 | 3300031901 | Bacteria | 927 |
| 659 | Ga0307412_11212886 | 3300031911 | Bacteria | 676 |
| 660 | Ga0307412_11396599 | 3300031911 | Bacteria | 633 |
| 661 | Ga0307412_11859440 | 3300031911 | Bacteria | 555 |
| 662 | Ga0307409_100035784 | 3300031995 | Bacteria | 3642 |
| 663 | Ga0307409_100050696 | 3300031995 | Bacteria | 3172 |
| 664 | Ga0307409_100573334 | 3300031995 | Bacteria | 1111 |
| 665 | Ga0307409_102742855 | 3300031995 | Bacteria | 521 |
| 666 | Ga0307416_101912685 | 3300032002 | Bacteria | 696 |
| 667 | Ga0307414_10097082 | 3300032004 | Bacteria | 2206 |
| 668 | Ga0307414_10673833 | 3300032004 | Bacteria | 934 |
| 669 | Ga0307414_10877295 | 3300032004 | Bacteria | 821 |
| 670 | Ga0307414_10920124 | 3300032004 | Bacteria | 802 |
| 671 | Ga0307411_10075136 | 3300032005 | Bacteria | 2306 |
| 672 | Ga0307415_100169025 | 3300032126 | Bacteria | 1703 |
| 673 | Ga0307510_10028447 | 3300033180 | Bacteria | 6383 |
| 674 | Ga0307510_10168985 | 3300033180 | Bacteria | 1769 |
| 675 | Ga0307510_10348817 | 3300033180 | Bacteria | 931 |
| 676 | Ga0307510_10417455 | 3300033180 | Bacteria | 784 |
| 677 | Ga0307510_10540988 | 3300033180 | Bacteria | 610 |
| 678 | Ga0316596_1001896 | 3300033541 | Bacteria | 4374 |
| 679 | Ga0373950_0003924 | 3300034818 | Bacteria | 2159 |
| 680 | Ga0373950_0098931 | 3300034818 | Bacteria | 627 |
| 681 | Ga0373958_0038915 | 3300034819 | Bacteria | 965 |
| 682 | Ga0373959_0073071 | 3300034820 | Bacteria | 778 |
| 683 | Ga0373938_0026082 | 3300034957 | Bacteria | 1221 |
| 684 | Ga0373928_0039569 | 3300035084 | Bacteria | 1078 |
| 685 | Ga0373929_0131098 | 3300035085 | Bacteria | 657 |
| 686 | Ga0373940_0038650 | 3300035088 | Bacteria | 1303 |
| 687 | Ga0373940_0075564 | 3300035088 | Bacteria | 988 |
| 688 | Ga0373949_0042118 | 3300035090 | Bacteria | 1126 |
| 689 | Ga0373951_0041827 | 3300035091 | Bacteria | 1107 |
| 690 | Ga0373952_0003002 | 3300035092 | Bacteria | 3046 |
| 691 | Ga0373952_0011057 | 3300035092 | Bacteria | 1754 |
| 692 | Ga0373936_0102330 | 3300035113 | Bacteria | 1209 |
| 693 | Ga0373939_0010321 | 3300035114 | Bacteria | 2333 |
| 694 | Ga0373939_0052644 | 3300035114 | Bacteria | 1269 |
| 695 | Ga0373941_0149178 | 3300035115 | Bacteria | 856 |
| 696 | Ga0373941_0339322 | 3300035115 | Bacteria | 609 |
| 697 | Ga0373945_0233133 | 3300035116 | Bacteria | 773 |
| 698 | Ga0373945_0346528 | 3300035116 | Bacteria | 643 |
| 699 | Ga0373953_0007154 | 3300035117 | Bacteria | 3723 |
| 700 | Ga0373954_0129176 | 3300035118 | Bacteria | 1229 |
| 701 | Ga0373956_0193735 | 3300035119 | Bacteria | 963 |
| 702 | Ga0373960_0014902 | 3300035121 | Bacteria | 1976 |
| 703 | Ga0373943_0260156 | 3300035170 | Bacteria | 977 |
| 704 | Ga0373955_0085689 | 3300035172 | Bacteria | 1788 |
| 705 | Ga0373942_0014138 | 3300035207 | Bacteria | 1928 |
| 706 | Ga0373942_0073387 | 3300035207 | Bacteria | 1003 |
| 707 | Ga0373961_0008082 | 3300035241 | Bacteria | 2556 |
| 708 | Ga0373961_0074440 | 3300035241 | Bacteria | 1057 |
| 709 | Ga0373961_0183781 | 3300035241 | Bacteria | 729 |
| 710 | Ga0373962_0004031 | 3300035242 | Bacteria | 3538 |
| 711 | Ga0373962_0012560 | 3300035242 | Bacteria | 2136 |
| 712 | Ga0373962_0261189 | 3300035242 | Bacteria | 604 |
| 713 | Ga0316574_0196185 | 3300035398 | Bacteria | 1298 |
| 714 | Ga0316574_0302208 | 3300035398 | Bacteria | 1017 |
| 715 | Ga0316574_0581708 | 3300035398 | Bacteria | 693 |
| 716 | Ga0373931_0002939 | 3300035691 | Bacteria | 7603 |
| 717 | Ga0373931_0005200 | 3300035691 | Bacteria | 6000 |
| 718 | Ga0373931_0711394 | 3300035691 | Bacteria | 664 |
| 719 | Ga0373935_0136168 | 3300035692 | Bacteria | 1655 |
| 720 | Ga0373935_0690433 | 3300035692 | Bacteria | 750 |
| 721 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 722 | Ga0373927_0162569 | 3300035695 | Bacteria | 1463 |
| 723 | Ga0373927_0188819 | 3300035695 | Bacteria | 1352 |
| 724 | Ga0373927_0964677 | 3300035695 | Bacteria | 563 |
| 725 | Ga0373933_0034262 | 3300035724 | Bacteria | 2958 |
| 726 | Ga0373933_0554236 | 3300035724 | Bacteria | 754 |
| 727 | Ga0373933_0600353 | 3300035724 | Bacteria | 723 |
| 728 | Ga0373947_0052110 | 3300035725 | Bacteria | 2465 |
| 729 | Ga0373947_0480313 | 3300035725 | Bacteria | 843 |
| 730 | Ga0373947_0515441 | 3300035725 | Bacteria | 813 |
| 731 | Ga0373937_0006001 | 3300036401 | Bacteria | 10455 |
| 732 | Ga0373937_0143345 | 3300036401 | Bacteria | 2235 |
| 733 | Ga0373937_0228037 | 3300036401 | Bacteria | 1754 |
| 734 | Ga0316582_0065073 | 3300036647 | Bacteria | 2347 |
| 735 | Ga0316584_0060375 | 3300036712 | Bacteria | 2839 |
| 736 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 737 | Ga0373925_0310107 | 3300037068 | Bacteria | 1275 |
| 738 | Ga0373925_0557184 | 3300037068 | Bacteria | 943 |
| 739 | Ga0373925_1295228 | 3300037068 | Bacteria | 598 |
| 740 | Ga0395899_0004948 | 3300037312 | Bacteria | 10369 |
| 741 | Ga0395899_0135860 | 3300037312 | Bacteria | 1753 |
| 742 | Ga0395900_0054207 | 3300037418 | Bacteria | 4128 |
| 743 | Ga0395900_0118387 | 3300037418 | Bacteria | 2718 |
| 744 | Ga0395900_0294566 | 3300037418 | Bacteria | 1610 |
| 745 | Ga0395898_0003055 | 3300037466 | Bacteria | 18965 |
| 746 | Ga0395898_0086433 | 3300037466 | Bacteria | 3022 |
| 747 | Ga0395898_0130907 | 3300037466 | Bacteria | 2403 |
| 748 | Ga0395898_0141060 | 3300037466 | Bacteria | 2307 |
| 749 | Ga0395905_1052736 | 3300037471 | Bacteria | 717 |
| 750 | Ga0395905_1413361 | 3300037471 | Bacteria | 600 |
| 751 | Ga0395901_0012391 | 3300038443 | Bacteria | 8650 |
| 752 | Ga0395901_0250996 | 3300038443 | Bacteria | 1843 |
| 753 | Ga0395901_0270554 | 3300038443 | Bacteria | 1767 |
| 754 | Ga0395901_0493640 | 3300038443 | Bacteria | 1247 |
| 755 | Ga0400490_05556 | 3300038726 | Bacteria | 1964 |
| 756 | Ga0400485_18010 | 3300038735 | Bacteria | 1587 |
| 757 | Ga0400485_18067 | 3300038735 | Bacteria | 3767 |
| 758 | Ga0400488_60863 | 3300038741 | Bacteria | 2930 |
| 759 | Ga0400486_19626 | 3300038742 | Bacteria | 1540 |
| 760 | Ga0400486_26804 | 3300038742 | Bacteria | 1777 |
| 761 | Ga0400483_275193 | 3300039062 | Bacteria | 1506 |
| 762 | Ga0436365_0367003 | 3300039437 | Bacteria | 1382 |
| 763 | Ga0436365_0697746 | 3300039437 | Bacteria | 24050 |
| 764 | Ga0436365_1239236 | 3300039437 | Bacteria | 18833 |
| 765 | Ga0436365_1281228 | 3300039437 | Bacteria | 2258 |
| 766 | Ga0436360_0387015 | 3300039438 | Bacteria | 831 |
| 767 | Ga0436360_0559098 | 3300039438 | Bacteria | 778 |
| 768 | Ga0436361_0953537 | 3300039447 | Bacteria | 44604 |
| 769 | Ga0436363_0491191 | 3300039450 | Bacteria | 758 |
| 770 | Ga0436363_1304811 | 3300039450 | Bacteria | 720 |
| 771 | Ga0436362_0512929 | 3300039453 | Bacteria | 519 |
| 772 | Ga0436362_0526223 | 3300039453 | Bacteria | 805 |
| 773 | Ga0436362_0940958 | 3300039453 | Bacteria | 802 |
| 774 | Ga0439447_056999 | 3300041407 | Bacteria | 924 |
| 775 | Ga0439465_0041536 | 3300041413 | Bacteria | 1489 |
| 776 | Ga0439465_0056207 | 3300041413 | Bacteria | 1297 |
| 777 | Ga0451790_24623 | 3300041444 | Bacteria | 565 |
| 778 | Ga0451797_1305445 | 3300041453 | Bacteria | 1559 |
| 779 | Ga0451795_0820506 | 3300041456 | Bacteria | 587 |
| 780 | Ga0451800_0177595 | 3300041459 | Bacteria | 577 |
| 781 | Ga0451800_1326835 | 3300041459 | Bacteria | 540 |
| 782 | Ga0451839_1312103 | 3300041496 | Bacteria | 728 |
| 783 | Ga0451846_63244 | 3300041502 | Bacteria | 579 |
| 784 | Ga0451851_0517789 | 3300041507 | Bacteria | 688 |
| 785 | Ga0451851_1169255 | 3300041507 | Bacteria | 512 |
| 786 | Ga0439433_0046360 | 3300041999 | Bacteria | 1019 |
| 787 | Ga0439448_0302565 | 3300042005 | Bacteria | 568 |
| 788 | Ga0450897_043015 | 3300042128 | Bacteria | 534 |
| 789 | Ga0450902_006870 | 3300042137 | Bacteria | 1750 |
| 790 | Ga0450906_049166 | 3300042145 | Unclassified | 744 |
| 791 | Ga0439435_0308571 | 3300042436 | Bacteria | 543 |
| 792 | Ga0466969_0224559 | 3300044656 | Bacteria | 854 |
| 793 | Ga0466966_0067594 | 3300044684 | Bacteria | 2244 |
| 794 | Ga0466963_0052778 | 3300044694 | Bacteria | 2698 |
| 795 | Ga0466963_0274798 | 3300044694 | Bacteria | 1184 |
| 796 | Ga0453684_0022894 | 3300044712 | Bacteria | 9243 |
| 797 | Ga0466957_0042883 | 3300044842 | Bacteria | 2738 |
| 798 | Ga0466957_0176495 | 3300044842 | Bacteria | 1393 |
| 799 | Ga0466957_0337115 | 3300044842 | Bacteria | 1020 |
| 800 | Ga0466960_0094316 | 3300044901 | Bacteria | 1531 |
| 801 | Ga0451576_0003979 | 3300045051 | Bacteria | 19673 |
| 802 | Ga0466958_0277112 | 3300045836 | Bacteria | 1075 |
| 803 | Ga0466958_0418373 | 3300045836 | Bacteria | 866 |
| 804 | Ga0466967_0148237 | 3300045976 | Bacteria | 2190 |
| 805 | Ga0466967_0928017 | 3300045976 | Bacteria | 866 |
| 806 | Ga0466967_1031331 | 3300045976 | Bacteria | 819 |
| 807 | Ga0495627_000399 | 3300046453 | Bacteria | 38947 |
| 808 | Ga0495627_077937 | 3300046453 | Bacteria | 963 |
| 809 | Ga0495603_0502067 | 3300046455 | Bacteria | 695 |
| 810 | Ga0495590_0136108 | 3300046457 | Bacteria | 885 |
| 811 | Ga0495629_0392276 | 3300046459 | Bacteria | 944 |
| 812 | Ga0495638_0247288 | 3300046460 | Bacteria | 984 |
| 813 | Ga0495638_0278505 | 3300046460 | Bacteria | 910 |
| 814 | Ga0495638_0451268 | 3300046460 | Bacteria | 656 |
| 815 | Ga0495638_0649888 | 3300046460 | Bacteria | 513 |
| 816 | Ga0495653_0606452 | 3300046463 | Bacteria | 672 |
| 817 | Ga0495580_0688532 | 3300046472 | Bacteria | 670 |
| 818 | Ga0495605_0136067 | 3300046474 | Bacteria | 1105 |
| 819 | Ga0495639_0574932 | 3300046475 | Bacteria | 578 |
| 820 | Ga0495584_0027432 | 3300046491 | Bacteria | 2886 |
| 821 | Ga0495584_0233145 | 3300046491 | Bacteria | 936 |
| 822 | Ga0495585_0066533 | 3300046492 | Bacteria | 1973 |
| 823 | Ga0495583_0048649 | 3300046506 | Bacteria | 1945 |
| 824 | Ga0495606_0032036 | 3300046507 | Bacteria | 3647 |
| 825 | Ga0495610_0307179 | 3300046512 | Bacteria | 609 |
| 826 | Ga0495618_0184469 | 3300046514 | Bacteria | 1325 |
| 827 | Ga0495620_0101865 | 3300046515 | Bacteria | 1144 |
| 828 | Ga0495628_0966317 | 3300046516 | Bacteria | 588 |
| 829 | Ga0495630_0702144 | 3300046517 | Bacteria | 774 |
| 830 | Ga0495632_0079274 | 3300046519 | Bacteria | 1568 |
| 831 | Ga0495632_0083729 | 3300046519 | Bacteria | 1518 |
| 832 | Ga0495637_0367090 | 3300046520 | Bacteria | 503 |
| 833 | Ga0495644_0251560 | 3300046523 | Bacteria | 686 |
| 834 | Ga0495648_0206971 | 3300046524 | Bacteria | 977 |
| 835 | Ga0495642_0075799 | 3300046528 | Bacteria | 1411 |
| 836 | Ga0495652_0050149 | 3300046529 | Bacteria | 3570 |
| 837 | Ga0495654_0060993 | 3300046530 | Bacteria | 1812 |
| 838 | Ga0495640_0240079 | 3300046533 | Bacteria | 1138 |
| 839 | Ga0495640_0447182 | 3300046533 | Bacteria | 790 |
| 840 | Ga0495586_0376981 | 3300046535 | Bacteria | 816 |
| 841 | Ga0495587_0740903 | 3300046536 | Bacteria | 538 |
| 842 | Ga0495609_0061486 | 3300046538 | Bacteria | 1659 |
| 843 | Ga0495622_0005663 | 3300046557 | Bacteria | 5792 |
| 844 | Ga0495633_0000510 | 3300046558 | Bacteria | 39075 |
| 845 | Ga0495633_0161794 | 3300046558 | Bacteria | 1033 |
| 846 | Ga0495667_0103734 | 3300046559 | Bacteria | 1839 |
| 847 | Ga0495656_0073584 | 3300046615 | Bacteria | 1524 |
| 848 | Ga0495656_0523824 | 3300046615 | Bacteria | 630 |
| 849 | Ga0495611_0076340 | 3300046648 | Bacteria | 1536 |
| 850 | Ga0495611_0428415 | 3300046648 | Bacteria | 604 |
| 851 | Ga0495625_0020239 | 3300046660 | Bacteria | 5143 |
| 852 | Ga0495625_0087377 | 3300046660 | Bacteria | 2161 |
| 853 | Ga0495659_0038300 | 3300046664 | Bacteria | 1702 |
| 854 | Ga0495661_0128758 | 3300046665 | Bacteria | 1390 |
| 855 | Ga0495588_0504029 | 3300046674 | Bacteria | 634 |
| 856 | Ga0495646_0590075 | 3300046680 | Bacteria | 565 |
| 857 | Ga0495658_0291721 | 3300046683 | Bacteria | 1031 |
| 858 | Ga0495669_0175551 | 3300046684 | Bacteria | 1020 |
| 859 | Ga0495669_0185650 | 3300046684 | Bacteria | 991 |
| 860 | Ga0495613_0229804 | 3300046689 | Bacteria | 1300 |
| 861 | Ga0495671_0129761 | 3300046692 | Bacteria | 1229 |
| 862 | Ga0495649_0050668 | 3300046694 | Bacteria | 2252 |
| 863 | Ga0495589_0086629 | 3300046794 | Bacteria | 1521 |
| 864 | Ga0495604_0027202 | 3300047317 | Bacteria | 4551 |
| 865 | Ga0495604_0536468 | 3300047317 | Bacteria | 756 |
| 866 | Ga0495636_0052191 | 3300047318 | Bacteria | 1715 |
| 867 | Ga0495636_0103531 | 3300047318 | Bacteria | 1247 |
| 868 | Ga0495674_0802390 | 3300047319 | Bacteria | 732 |
| 869 | Ga0495676_0264279 | 3300047321 | Bacteria | 1170 |
| 870 | Ga0495683_0031924 | 3300047323 | Bacteria | 2683 |
| 871 | Ga0495677_0143449 | 3300047445 | Bacteria | 917 |
| 872 | Ga0495679_017960 | 3300047446 | Bacteria | 2522 |
| 873 | Ga0495679_195562 | 3300047446 | Bacteria | 533 |
| 874 | Ga0495685_082832 | 3300047447 | Bacteria | 1067 |
| 875 | Ga0495673_0000189 | 3300047469 | Bacteria | 99018 |
| 876 | Ga0495673_0158617 | 3300047469 | Bacteria | 870 |
| 877 | Ga0495684_0922227 | 3300047471 | Bacteria | 561 |
| 878 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 879 | Ga0495615_0221308 | 3300048090 | Bacteria | 591 |
| 880 | Ga0496100_0093096 | 3300048903 | Bacteria | 2061 |
| 881 | Ga0496100_0215715 | 3300048903 | Bacteria | 1406 |
| 882 | Ga0496100_0436428 | 3300048903 | Bacteria | 1002 |
| 883 | Ga0496101_0044118 | 3300048904 | Bacteria | 3190 |
| 884 | Ga0496101_0122223 | 3300048904 | Bacteria | 1969 |
| 885 | Ga0496101_0139715 | 3300048904 | Bacteria | 1845 |
| 886 | Ga0496101_0150505 | 3300048904 | Bacteria | 1780 |
| 887 | Ga0496102_0002642 | 3300048905 | Bacteria | 15222 |
| 888 | Ga0496102_0015318 | 3300048905 | Bacteria | 6676 |
| 889 | Ga0496102_0029392 | 3300048905 | Bacteria | 4919 |
| 890 | Ga0496102_0294433 | 3300048905 | Bacteria | 1530 |
| 891 | Ga0496102_0318035 | 3300048905 | Bacteria | 1466 |
| 892 | Ga0496102_0370286 | 3300048905 | Bacteria | 1348 |
| 893 | Ga0496102_0455678 | 3300048905 | Bacteria | 1200 |
| 894 | Ga0496103_0017034 | 3300048906 | Bacteria | 4344 |
| 895 | Ga0496103_0035388 | 3300048906 | Bacteria | 3057 |
| 896 | Ga0496103_0169394 | 3300048906 | Bacteria | 1402 |
| 897 | Ga0496103_0209716 | 3300048906 | Bacteria | 1253 |
| 898 | Ga0496104_0051414 | 3300048907 | Bacteria | 3890 |
| 899 | Ga0496104_0061755 | 3300048907 | Bacteria | 3553 |
| 900 | Ga0496104_0087155 | 3300048907 | Bacteria | 2981 |
| 901 | Ga0496104_0609717 | 3300048907 | Bacteria | 1002 |
| 902 | Ga0496104_0932809 | 3300048907 | Bacteria | 773 |
| 903 | Ga0496105_0038459 | 3300048908 | Bacteria | 3941 |
| 904 | Ga0496105_0098467 | 3300048908 | Bacteria | 2415 |
| 905 | Ga0496106_0002278 | 3300048909 | Bacteria | 14316 |
| 906 | Ga0496106_0004608 | 3300048909 | Bacteria | 10225 |
| 907 | Ga0496106_0384857 | 3300048909 | Bacteria | 1127 |
| 908 | Ga0496107_0018263 | 3300048910 | Bacteria | 4936 |
| 909 | Ga0496107_0098093 | 3300048910 | Bacteria | 2146 |
| 910 | Ga0496107_0366440 | 3300048910 | Bacteria | 1072 |
| 911 | Ga0496107_0678626 | 3300048910 | Bacteria | 758 |
| 912 | Ga0496107_0743478 | 3300048910 | Bacteria | 720 |
| 913 | Ga0496107_0973644 | 3300048910 | Bacteria | 616 |
| 914 | Ga0496108_0010640 | 3300048911 | Bacteria | 7463 |
| 915 | Ga0496108_0100742 | 3300048911 | Bacteria | 2464 |
| 916 | Ga0496108_0160553 | 3300048911 | Bacteria | 1942 |
| 917 | Ga0496109_0095451 | 3300048912 | Bacteria | 2753 |
| 918 | Ga0496109_0139689 | 3300048912 | Bacteria | 2265 |
| 919 | Ga0496109_0223543 | 3300048912 | Bacteria | 1771 |
| 920 | Ga0496110_0018375 | 3300048913 | Bacteria | 5862 |
| 921 | Ga0496110_1106175 | 3300048913 | Bacteria | 700 |
| 922 | Ga0496111_0267272 | 3300048914 | Bacteria | 1269 |
| 923 | Ga0496111_0480506 | 3300048914 | Bacteria | 915 |
| 924 | Ga0496112_0043241 | 3300048915 | Bacteria | 4410 |
| 925 | Ga0496112_0077705 | 3300048915 | Bacteria | 3283 |
| 926 | Ga0496112_0400670 | 3300048915 | Bacteria | 1312 |
| 927 | Ga0496112_1692895 | 3300048915 | Bacteria | 545 |
| 928 | Ga0496113_0464420 | 3300048916 | Bacteria | 1017 |
| 929 | Ga0496113_0990499 | 3300048916 | Bacteria | 662 |
| 930 | Ga0496113_1518333 | 3300048916 | Bacteria | 517 |
| 931 | Ga0496114_0148509 | 3300048917 | Bacteria | 2033 |
| 932 | Ga0496114_0389759 | 3300048917 | Bacteria | 1234 |
| 933 | Ga0496114_0765310 | 3300048917 | Bacteria | 843 |
| 934 | Ga0496114_0855636 | 3300048917 | Bacteria | 790 |
| 935 | Ga0496115_0001049 | 3300048918 | Bacteria | 20043 |
| 936 | Ga0496115_0001671 | 3300048918 | Bacteria | 15949 |
| 937 | Ga0496115_0003309 | 3300048918 | Bacteria | 11572 |
| 938 | Ga0496115_0017590 | 3300048918 | Bacteria | 5470 |
| 939 | Ga0496115_0032794 | 3300048918 | Bacteria | 4099 |
| 940 | Ga0496115_0098395 | 3300048918 | Bacteria | 2396 |
| 941 | Ga0496116_0078632 | 3300048919 | Bacteria | 2056 |
| 942 | Ga0496117_0146665 | 3300048920 | Bacteria | 1404 |
| 943 | Ga0496120_0067960 | 3300048923 | Bacteria | 1967 |
| 944 | Ga0496121_0006108 | 3300048924 | Bacteria | 15150 |
| 945 | Ga0496121_0253153 | 3300048924 | Bacteria | 1220 |
| 946 | Ga0496121_0258393 | 3300048924 | Bacteria | 1204 |
| 947 | Ga0496122_0035977 | 3300048925 | Bacteria | 4015 |
| 948 | Ga0496122_0188410 | 3300048925 | Bacteria | 1220 |
| 949 | Ga0496123_0000699 | 3300048926 | Bacteria | 55169 |
| 950 | Ga0496124_0119515 | 3300048927 | Bacteria | 2108 |
| 951 | Ga0496124_0387394 | 3300048927 | Bacteria | 975 |
| 952 | Ga0496124_0467131 | 3300048927 | Bacteria | 856 |
| 953 | Ga0496124_0933360 | 3300048927 | Bacteria | 523 |
| 954 | Ga0496125_0011137 | 3300048928 | Bacteria | 9019 |
| 955 | Ga0496125_0110284 | 3300048928 | Bacteria | 1996 |
| 956 | Ga0496126_0031566 | 3300048929 | Bacteria | 5002 |
| 957 | Ga0496126_0094915 | 3300048929 | Bacteria | 2617 |
| 958 | Ga0496126_0680280 | 3300048929 | Bacteria | 802 |
| 959 | Ga0496126_0685237 | 3300048929 | Bacteria | 798 |
| 960 | Ga0496126_0913724 | 3300048929 | Bacteria | 665 |
| 961 | Ga0501308_027199 | 3300049128 | Bacteria | 750 |
| 962 | Ga0501308_046599 | 3300049128 | Bacteria | 625 |
| 963 | Ga0501309_058434 | 3300049129 | Bacteria | 617 |
| 964 | Ga0501310_068948 | 3300049130 | Bacteria | 539 |
| 965 | Ga0501341_00973 | 3300049131 | Bacteria | 1351 |
| 966 | Ga0501307_005363 | 3300049162 | Bacteria | 1349 |
| 967 | Ga0495678_005745 | 3300049459 | Bacteria | 6741 |
| 968 | Ga0495682_0189414 | 3300049460 | Bacteria | 730 |
| 969 | Ga0501311_001594 | 3300049527 | Bacteria | 2015 |
| 970 | Ga0501311_004336 | 3300049527 | Bacteria | 1505 |
| 971 | Ga0501311_014284 | 3300049527 | Bacteria | 1012 |
| 972 | Ga0501314_042818 | 3300049530 | Bacteria | 531 |
| 973 | Ga0501315_016915 | 3300049531 | Bacteria | 948 |
| 974 | Ga0501315_018380 | 3300049531 | Bacteria | 921 |
| 975 | Ga0501316_071005 | 3300049532 | Bacteria | 527 |
| 976 | Ga0501317_006005 | 3300049533 | Bacteria | 1321 |
| 977 | Ga0501317_011743 | 3300049533 | Bacteria | 1070 |
| 978 | Ga0501317_066260 | 3300049533 | Bacteria | 602 |
| 979 | Ga0501317_085576 | 3300049533 | Bacteria | 551 |
| 980 | Ga0501318_005621 | 3300049534 | Bacteria | 1251 |
| 981 | Ga0501318_009292 | 3300049534 | Bacteria | 1069 |
| 982 | Ga0501319_000156 | 3300049535 | Bacteria | 2646 |
| 983 | Ga0501323_008595 | 3300049539 | Bacteria | 1188 |
| 984 | Ga0501323_011490 | 3300049539 | Bacteria | 1069 |
| 985 | Ga0501323_070165 | 3300049539 | Bacteria | 560 |
| 986 | Ga0501325_007275 | 3300049541 | Bacteria | 933 |
| 987 | Ga0501031_0018496 | 3300049568 | Bacteria | 4534 |
| 988 | Ga0501031_0122081 | 3300049568 | Bacteria | 1702 |
| 989 | Ga0501031_0126957 | 3300049568 | Bacteria | 1666 |
| 990 | Ga0501032_0004362 | 3300049569 | Bacteria | 10681 |
| 991 | Ga0501032_0289863 | 3300049569 | Bacteria | 1059 |
| 992 | Ga0501032_0328982 | 3300049569 | Bacteria | 986 |
| 993 | Ga0501032_0511585 | 3300049569 | Bacteria | 767 |
| 994 | Ga0501032_0669897 | 3300049569 | Bacteria | 658 |
| 995 | Ga0501033_0012917 | 3300049570 | Bacteria | 6369 |
| 996 | Ga0501033_0044704 | 3300049570 | Bacteria | 3296 |
| 997 | Ga0501033_0082082 | 3300049570 | Bacteria | 2364 |
| 998 | Ga0501033_0094343 | 3300049570 | Bacteria | 2188 |
| 999 | Ga0501033_0129530 | 3300049570 | Bacteria | 1828 |
| 1000 | Ga0501033_0226014 | 3300049570 | Bacteria | 1331 |
| 1001 | Ga0501033_0270110 | 3300049570 | Bacteria | 1202 |
| 1002 | Ga0501033_0515904 | 3300049570 | Bacteria | 826 |
| 1003 | Ga0501033_0571565 | 3300049570 | Bacteria | 777 |
| 1004 | Ga0501033_0922255 | 3300049570 | Bacteria | 586 |
| 1005 | Ga0501034_0000208 | 3300049571 | Bacteria | 111739 |
| 1006 | Ga0501034_0009460 | 3300049571 | Bacteria | 10201 |
| 1007 | Ga0501034_0063720 | 3300049571 | Bacteria | 3700 |
| 1008 | Ga0501034_0067818 | 3300049571 | Bacteria | 3579 |
| 1009 | Ga0501034_0123530 | 3300049571 | Bacteria | 2574 |
| 1010 | Ga0501034_0181982 | 3300049571 | Bacteria | 2066 |
| 1011 | Ga0501034_0202292 | 3300049571 | Bacteria | 1944 |
| 1012 | Ga0501034_0213528 | 3300049571 | Bacteria | 1884 |
| 1013 | Ga0501034_0357812 | 3300049571 | Bacteria | 1387 |
| 1014 | Ga0501034_0442181 | 3300049571 | Bacteria | 1219 |
| 1015 | Ga0501034_0484804 | 3300049571 | Bacteria | 1151 |
| 1016 | Ga0501034_0598496 | 3300049571 | Bacteria | 1008 |
| 1017 | Ga0501034_0606783 | 3300049571 | Bacteria | 999 |
| 1018 | Ga0501034_0643494 | 3300049571 | Bacteria | 962 |
| 1019 | Ga0501034_1619741 | 3300049571 | Bacteria | 520 |
| 1020 | Ga0501036_0027433 | 3300049572 | Bacteria | 4811 |
| 1021 | Ga0501036_0072449 | 3300049572 | Bacteria | 2912 |
| 1022 | Ga0501036_0076785 | 3300049572 | Bacteria | 2826 |
| 1023 | Ga0501036_0401367 | 3300049572 | Bacteria | 1144 |
| 1024 | Ga0501036_0437121 | 3300049572 | Bacteria | 1090 |
| 1025 | Ga0501036_0450143 | 3300049572 | Bacteria | 1073 |
| 1026 | Ga0501036_0599766 | 3300049572 | Bacteria | 913 |
| 1027 | Ga0501036_0708953 | 3300049572 | Bacteria | 831 |
| 1028 | Ga0501036_0806694 | 3300049572 | Bacteria | 773 |
| 1029 | Ga0501036_0815168 | 3300049572 | Bacteria | 768 |
| 1030 | Ga0501036_1141308 | 3300049572 | Bacteria | 636 |
| 1031 | Ga0501036_1433706 | 3300049572 | Bacteria | 559 |
| 1032 | Ga0501037_0005168 | 3300049573 | Bacteria | 9497 |
| 1033 | Ga0501037_0023671 | 3300049573 | Bacteria | 4540 |
| 1034 | Ga0501037_0029353 | 3300049573 | Bacteria | 4063 |
| 1035 | Ga0501037_0418622 | 3300049573 | Bacteria | 917 |
| 1036 | Ga0501037_0684765 | 3300049573 | Bacteria | 683 |
| 1037 | Ga0501038_0000069 | 3300049574 | Bacteria | 84666 |
| 1038 | Ga0501038_0009962 | 3300049574 | Bacteria | 8704 |
| 1039 | Ga0501038_0269357 | 3300049574 | Bacteria | 1343 |
| 1040 | Ga0501038_0402943 | 3300049574 | Bacteria | 1058 |
| 1041 | Ga0501038_0485697 | 3300049574 | Bacteria | 946 |
| 1042 | Ga0501038_0525631 | 3300049574 | Bacteria | 902 |
| 1043 | Ga0501038_0636953 | 3300049574 | Bacteria | 804 |
| 1044 | Ga0501038_0661597 | 3300049574 | Bacteria | 785 |
| 1045 | Ga0501038_0732930 | 3300049574 | Bacteria | 738 |
| 1046 | Ga0501038_0807937 | 3300049574 | Bacteria | 696 |
| 1047 | Ga0501039_0000072 | 3300049575 | Bacteria | 76673 |
| 1048 | Ga0501039_0014819 | 3300049575 | Bacteria | 5962 |
| 1049 | Ga0501039_0166307 | 3300049575 | Bacteria | 1734 |
| 1050 | Ga0501039_0450135 | 3300049575 | Bacteria | 1011 |
| 1051 | Ga0501039_0547576 | 3300049575 | Bacteria | 908 |
| 1052 | Ga0501039_0613820 | 3300049575 | Bacteria | 852 |
| 1053 | Ga0501039_0648893 | 3300049575 | Bacteria | 826 |
| 1054 | Ga0501039_0681252 | 3300049575 | Bacteria | 804 |
| 1055 | Ga0501039_0769915 | 3300049575 | Bacteria | 751 |
| 1056 | Ga0501039_1145568 | 3300049575 | Bacteria | 602 |
| 1057 | Ga0501040_0085266 | 3300049576 | Bacteria | 2192 |
| 1058 | Ga0501040_0378603 | 3300049576 | Bacteria | 1015 |
| 1059 | Ga0501040_0550938 | 3300049576 | Bacteria | 832 |
| 1060 | Ga0501040_0655701 | 3300049576 | Bacteria | 759 |
| 1061 | Ga0501040_1222801 | 3300049576 | Bacteria | 545 |
| 1062 | Ga0501041_0118391 | 3300049577 | Bacteria | 1645 |
| 1063 | Ga0501041_0509396 | 3300049577 | Bacteria | 766 |
| 1064 | Ga0501041_0590807 | 3300049577 | Bacteria | 708 |
| 1065 | Ga0501042_0016472 | 3300049578 | Bacteria | 5073 |
| 1066 | Ga0501042_0447496 | 3300049578 | Bacteria | 937 |
| 1067 | Ga0501042_0768679 | 3300049578 | Bacteria | 701 |
| 1068 | Ga0501042_1000071 | 3300049578 | Bacteria | 609 |
| 1069 | Ga0501042_1088683 | 3300049578 | Bacteria | 583 |
| 1070 | Ga0501043_0057196 | 3300049579 | Bacteria | 3062 |
| 1071 | Ga0501043_0172568 | 3300049579 | Bacteria | 1687 |
| 1072 | Ga0501043_0411029 | 3300049579 | Bacteria | 1021 |
| 1073 | Ga0501043_0538625 | 3300049579 | Bacteria | 869 |
| 1074 | Ga0501043_0651224 | 3300049579 | Bacteria | 774 |
| 1075 | Ga0501043_0987574 | 3300049579 | Bacteria | 600 |
| 1076 | Ga0501043_0990134 | 3300049579 | Bacteria | 599 |
| 1077 | Ga0501046_0000045 | 3300049580 | Bacteria | 144492 |
| 1078 | Ga0501046_0004977 | 3300049580 | Bacteria | 11926 |
| 1079 | Ga0501046_0005416 | 3300049580 | Bacteria | 11410 |
| 1080 | Ga0501046_0016665 | 3300049580 | Bacteria | 6147 |
| 1081 | Ga0501046_0021690 | 3300049580 | Bacteria | 5297 |
| 1082 | Ga0501046_0171333 | 3300049580 | Bacteria | 1629 |
| 1083 | Ga0501046_0180748 | 3300049580 | Bacteria | 1577 |
| 1084 | Ga0501046_0313286 | 3300049580 | Bacteria | 1144 |
| 1085 | Ga0501046_0333543 | 3300049580 | Bacteria | 1103 |
| 1086 | Ga0501047_0001212 | 3300049581 | Bacteria | 25586 |
| 1087 | Ga0501047_0014860 | 3300049581 | Bacteria | 7410 |
| 1088 | Ga0501047_0046064 | 3300049581 | Bacteria | 4216 |
| 1089 | Ga0501047_0164561 | 3300049581 | Bacteria | 2089 |
| 1090 | Ga0501047_0334586 | 3300049581 | Bacteria | 1352 |
| 1091 | Ga0501047_0407290 | 3300049581 | Bacteria | 1192 |
| 1092 | Ga0501047_0538509 | 3300049581 | Bacteria | 992 |
| 1093 | Ga0501047_1019154 | 3300049581 | Bacteria | 641 |
| 1094 | Ga0501047_1069360 | 3300049581 | Bacteria | 620 |
| 1095 | Ga0501048_0000501 | 3300049582 | Bacteria | 27413 |
| 1096 | Ga0501048_0082989 | 3300049582 | Bacteria | 2260 |
| 1097 | Ga0501048_0089966 | 3300049582 | Bacteria | 2165 |
| 1098 | Ga0501048_0312882 | 3300049582 | Bacteria | 1118 |
| 1099 | Ga0501067_0001102 | 3300049583 | Bacteria | 14576 |
| 1100 | Ga0501067_0008019 | 3300049583 | Bacteria | 5865 |
| 1101 | Ga0501067_0073051 | 3300049583 | Bacteria | 1900 |
| 1102 | Ga0501067_0073295 | 3300049583 | Bacteria | 1897 |
| 1103 | Ga0501067_0124203 | 3300049583 | Bacteria | 1437 |
| 1104 | Ga0501067_0283029 | 3300049583 | Bacteria | 923 |
| 1105 | Ga0501067_0311891 | 3300049583 | Bacteria | 876 |
| 1106 | Ga0501067_0592349 | 3300049583 | Bacteria | 622 |
| 1107 | Ga0501068_0154668 | 3300049584 | Bacteria | 1443 |
| 1108 | Ga0501068_0251126 | 3300049584 | Bacteria | 1127 |
| 1109 | Ga0501068_0532634 | 3300049584 | Bacteria | 763 |
| 1110 | Ga0501068_1061389 | 3300049584 | Bacteria | 535 |
| 1111 | Ga0501069_0004829 | 3300049585 | Bacteria | 6980 |
| 1112 | Ga0501069_0071224 | 3300049585 | Bacteria | 1948 |
| 1113 | Ga0501069_0132004 | 3300049585 | Bacteria | 1430 |
| 1114 | Ga0501069_0175997 | 3300049585 | Bacteria | 1236 |
| 1115 | Ga0501069_0468363 | 3300049585 | Bacteria | 750 |
| 1116 | Ga0501070_0016943 | 3300049586 | Bacteria | 6115 |
| 1117 | Ga0501070_0106653 | 3300049586 | Bacteria | 2315 |
| 1118 | Ga0501070_0160366 | 3300049586 | Bacteria | 1854 |
| 1119 | Ga0501070_0390283 | 3300049586 | Bacteria | 1127 |
| 1120 | Ga0501070_0432667 | 3300049586 | Bacteria | 1062 |
| 1121 | Ga0501070_0462200 | 3300049586 | Bacteria | 1022 |
| 1122 | Ga0501070_0547289 | 3300049586 | Bacteria | 927 |
| 1123 | Ga0501070_0603528 | 3300049586 | Bacteria | 875 |
| 1124 | Ga0501070_0798815 | 3300049586 | Bacteria | 741 |
| 1125 | Ga0501070_0919529 | 3300049586 | Bacteria | 682 |
| 1126 | Ga0501071_0034272 | 3300049587 | Bacteria | 3612 |
| 1127 | Ga0501071_0322356 | 3300049587 | Bacteria | 1173 |
| 1128 | Ga0501071_0436307 | 3300049587 | Bacteria | 1002 |
| 1129 | Ga0501071_0638969 | 3300049587 | Bacteria | 819 |
| 1130 | Ga0501071_1171802 | 3300049587 | Bacteria | 594 |
| 1131 | Ga0501071_1248804 | 3300049587 | Bacteria | 574 |
| 1132 | Ga0501072_0134262 | 3300049588 | Bacteria | 1973 |
| 1133 | Ga0501072_0147528 | 3300049588 | Bacteria | 1876 |
| 1134 | Ga0501072_0163516 | 3300049588 | Bacteria | 1776 |
| 1135 | Ga0501072_0208507 | 3300049588 | Bacteria | 1557 |
| 1136 | Ga0501072_0482486 | 3300049588 | Bacteria | 981 |
| 1137 | Ga0501072_0526950 | 3300049588 | Bacteria | 934 |
| 1138 | Ga0501072_1096059 | 3300049588 | Bacteria | 620 |
| 1139 | Ga0501072_1150109 | 3300049588 | Bacteria | 603 |
| 1140 | Ga0501072_1525348 | 3300049588 | Bacteria | 516 |
| 1141 | Ga0501073_0001669 | 3300049589 | Bacteria | 16438 |
| 1142 | Ga0501073_0024093 | 3300049589 | Bacteria | 4370 |
| 1143 | Ga0501073_0029749 | 3300049589 | Bacteria | 3904 |
| 1144 | Ga0501073_0076482 | 3300049589 | Bacteria | 2329 |
| 1145 | Ga0501073_0213301 | 3300049589 | Bacteria | 1334 |
| 1146 | Ga0501073_0350204 | 3300049589 | Bacteria | 1020 |
| 1147 | Ga0501073_0429999 | 3300049589 | Bacteria | 912 |
| 1148 | Ga0501073_0460050 | 3300049589 | Bacteria | 880 |
| 1149 | Ga0501073_0586976 | 3300049589 | Bacteria | 770 |
| 1150 | Ga0501073_0875787 | 3300049589 | Bacteria | 618 |
| 1151 | Ga0501074_0004453 | 3300049590 | Bacteria | 10023 |
| 1152 | Ga0501074_0012386 | 3300049590 | Bacteria | 6199 |
| 1153 | Ga0501074_0261439 | 3300049590 | Bacteria | 1230 |
| 1154 | Ga0501074_0467707 | 3300049590 | Bacteria | 894 |
| 1155 | Ga0501074_0508823 | 3300049590 | Bacteria | 853 |
| 1156 | Ga0501074_0523107 | 3300049590 | Bacteria | 840 |
| 1157 | Ga0501074_0583602 | 3300049590 | Bacteria | 791 |
| 1158 | Ga0501074_0742033 | 3300049590 | Bacteria | 692 |
| 1159 | Ga0501075_0062889 | 3300049591 | Bacteria | 2798 |
| 1160 | Ga0501075_0178154 | 3300049591 | Bacteria | 1622 |
| 1161 | Ga0501075_0244635 | 3300049591 | Bacteria | 1367 |
| 1162 | Ga0501075_0316490 | 3300049591 | Bacteria | 1189 |
| 1163 | Ga0501075_1269028 | 3300049591 | Bacteria | 558 |
| 1164 | Ga0501076_0217802 | 3300049592 | Bacteria | 1560 |
| 1165 | Ga0501076_0368912 | 3300049592 | Bacteria | 1180 |
| 1166 | Ga0501076_0571613 | 3300049592 | Bacteria | 932 |
| 1167 | Ga0501076_0573295 | 3300049592 | Bacteria | 931 |
| 1168 | Ga0501076_0606309 | 3300049592 | Bacteria | 903 |
| 1169 | Ga0501076_0608996 | 3300049592 | Bacteria | 901 |
| 1170 | Ga0501076_1397253 | 3300049592 | Bacteria | 575 |
| 1171 | Ga0501077_0007051 | 3300049593 | Bacteria | 6929 |
| 1172 | Ga0501077_0067662 | 3300049593 | Bacteria | 2264 |
| 1173 | Ga0501077_0072576 | 3300049593 | Bacteria | 2181 |
| 1174 | Ga0501077_0334534 | 3300049593 | Bacteria | 966 |
| 1175 | Ga0501077_0609326 | 3300049593 | Bacteria | 701 |
| 1176 | Ga0501077_0695917 | 3300049593 | Bacteria | 653 |
| 1177 | Ga0501238_001704 | 3300049671 | Bacteria | 2563 |
| 1178 | Ga0501079_0001478 | 3300049741 | Bacteria | 16629 |
| 1179 | Ga0501079_0022217 | 3300049741 | Bacteria | 4863 |
| 1180 | Ga0501079_0085229 | 3300049741 | Bacteria | 2445 |
| 1181 | Ga0501079_0699080 | 3300049741 | Bacteria | 798 |
| 1182 | Ga0501079_0757933 | 3300049741 | Bacteria | 764 |
| 1183 | Ga0501079_0782294 | 3300049741 | Bacteria | 751 |
| 1184 | Ga0501080_0000005 | 3300049742 | Bacteria | 176271 |
| 1185 | Ga0501080_0010846 | 3300049742 | Bacteria | 8339 |
| 1186 | Ga0501080_0188525 | 3300049742 | Bacteria | 1896 |
| 1187 | Ga0501080_0517088 | 3300049742 | Bacteria | 1065 |
| 1188 | Ga0501080_0615338 | 3300049742 | Bacteria | 963 |
| 1189 | Ga0501080_1520202 | 3300049742 | Bacteria | 568 |
| 1190 | Ga0501081_0042743 | 3300049743 | Bacteria | 3106 |
| 1191 | Ga0501081_0113773 | 3300049743 | Bacteria | 1922 |
| 1192 | Ga0501081_0422688 | 3300049743 | Bacteria | 988 |
| 1193 | Ga0501081_0433895 | 3300049743 | Bacteria | 975 |
| 1194 | Ga0501081_0465185 | 3300049743 | Bacteria | 940 |
| 1195 | Ga0501081_0935444 | 3300049743 | Bacteria | 654 |
| 1196 | Ga0501081_1054618 | 3300049743 | Bacteria | 615 |
| 1197 | Ga0501083_0022615 | 3300049744 | Bacteria | 4362 |
| 1198 | Ga0501083_0114508 | 3300049744 | Bacteria | 1771 |
| 1199 | Ga0501083_0225221 | 3300049744 | Bacteria | 1221 |
| 1200 | Ga0501083_1014560 | 3300049744 | Bacteria | 540 |
| 1201 | Ga0501083_1087282 | 3300049744 | Bacteria | 520 |
| 1202 | Ga0501035_0000049 | 3300049822 | Bacteria | 145684 |
| 1203 | Ga0501035_0030043 | 3300049822 | Bacteria | 4955 |
| 1204 | Ga0501035_0050699 | 3300049822 | Bacteria | 3719 |
| 1205 | Ga0501035_0113525 | 3300049822 | Bacteria | 2373 |
| 1206 | Ga0501035_0186418 | 3300049822 | Bacteria | 1785 |
| 1207 | Ga0501035_0351623 | 3300049822 | Bacteria | 1233 |
| 1208 | Ga0501035_0415470 | 3300049822 | Bacteria | 1117 |
| 1209 | Ga0501035_0696089 | 3300049822 | Bacteria | 820 |
| 1210 | Ga0501035_0804700 | 3300049822 | Bacteria | 750 |
| 1211 | Ga0501035_1403280 | 3300049822 | Bacteria | 535 |
| 1212 | Ga0501044_0000030 | 3300049823 | Bacteria | 173442 |
| 1213 | Ga0501044_0024878 | 3300049823 | Bacteria | 6351 |
| 1214 | Ga0501044_0027898 | 3300049823 | Bacteria | 5959 |
| 1215 | Ga0501044_0210409 | 3300049823 | Bacteria | 1899 |
| 1216 | Ga0501044_0237864 | 3300049823 | Bacteria | 1766 |
| 1217 | Ga0501044_0272626 | 3300049823 | Bacteria | 1627 |
| 1218 | Ga0501044_0321454 | 3300049823 | Bacteria | 1472 |
| 1219 | Ga0501044_0419727 | 3300049823 | Bacteria | 1248 |
| 1220 | Ga0501044_0462733 | 3300049823 | Bacteria | 1173 |
| 1221 | Ga0501044_0469605 | 3300049823 | Bacteria | 1162 |
| 1222 | Ga0501044_0666789 | 3300049823 | Bacteria | 928 |
| 1223 | Ga0501044_0793535 | 3300049823 | Bacteria | 827 |
| 1224 | Ga0501045_0026586 | 3300049824 | Bacteria | 4165 |
| 1225 | Ga0501045_0068338 | 3300049824 | Bacteria | 2610 |
| 1226 | Ga0501045_0110710 | 3300049824 | Bacteria | 2036 |
| 1227 | Ga0501045_0388511 | 3300049824 | Bacteria | 1039 |
| 1228 | Ga0501045_0462869 | 3300049824 | Bacteria | 942 |
| 1229 | Ga0501045_0610950 | 3300049824 | Bacteria | 807 |
| 1230 | Ga0501045_1139098 | 3300049824 | Bacteria | 570 |
| 1231 | nmdc:mga03683_70319_c1 | 3300050489 | Bacteria | 1495 |
| 1232 | nmdc:mga0yw44_205378_c1 | 3300050492 | Bacteria | 1302 |
| 1233 | nmdc:mga0yw44_319256_c1 | 3300050492 | Bacteria | 1043 |
| 1234 | nmdc:mga0yw44_70411_c1 | 3300050492 | Bacteria | 2168 |
| 1235 | nmdc:mga0k408_139435_c1 | 3300050493 | Bacteria | 1442 |
| 1236 | nmdc:mga0k408_36414_c1 | 3300050493 | Bacteria | 2824 |
| 1237 | nmdc:mga06z11_14438_c1 | 3300050494 | Bacteria | 3499 |
| 1238 | nmdc:mga04h51_2833_c1 | 3300050495 | Bacteria | 4152 |
| 1239 | nmdc:mga07m45_231865_c1 | 3300050496 | Bacteria | 1074 |
| 1240 | nmdc:mga05p37_1596261_c1 | 3300050507 | Bacteria | 643 |
| 1241 | nmdc:mga05p37_172193_c1 | 3300050507 | Bacteria | 2640 |
| 1242 | nmdc:mga05p37_236239_c1 | 3300050507 | Bacteria | 2200 |
| 1243 | nmdc:mga05p37_317241_c1 | 3300050507 | Bacteria | 1846 |
| 1244 | nmdc:mga05p37_56603_c1 | 3300050507 | Bacteria | 4828 |
| 1245 | nmdc:mga05p37_780216_c1 | 3300050507 | Bacteria | 1049 |
| 1246 | nmdc:mga09592_165761_c1 | 3300050508 | Bacteria | 1910 |
| 1247 | nmdc:mga09592_8483_c1 | 3300050508 | Bacteria | 8357 |
| 1248 | nmdc:mga0qj67_186404_c1 | 3300050509 | Bacteria | 1686 |
| 1249 | nmdc:mga0qj67_211251_c1 | 3300050509 | Bacteria | 1576 |
| 1250 | nmdc:mga0qj67_344652_c1 | 3300050509 | Bacteria | 1205 |
| 1251 | nmdc:mga0qj67_4050_c1 | 3300050509 | Bacteria | 10619 |
| 1252 | nmdc:mga06r32_385104_c1 | 3300050510 | Bacteria | 1385 |
| 1253 | nmdc:mga06r32_650083_c1 | 3300050510 | Bacteria | 1023 |
| 1254 | nmdc:mga06r32_660_c1 | 3300050510 | Bacteria | 30156 |
| 1255 | nmdc:mga06r32_671829_c1 | 3300050510 | Bacteria | 1003 |
| 1256 | nmdc:mga08y16_1220500_c1 | 3300050511 | Bacteria | 722 |
| 1257 | nmdc:mga08y16_174191_c1 | 3300050511 | Bacteria | 2234 |
| 1258 | nmdc:mga08y16_29815_c1 | 3300050511 | Bacteria | 5745 |
| 1259 | nmdc:mga08y16_31334_c1 | 3300050511 | Bacteria | 5593 |
| 1260 | nmdc:mga08y16_45619_c1 | 3300050511 | Bacteria | 4592 |
| 1261 | nmdc:mga08y16_867444_c1 | 3300050511 | Bacteria | 891 |
| 1262 | nmdc:mga0n895_173736_c1 | 3300050512 | Bacteria | 2186 |
| 1263 | nmdc:mga0n895_2833_c1 | 3300050512 | Bacteria | 13734 |
| 1264 | nmdc:mga0n895_400566_c1 | 3300050512 | Bacteria | 1388 |
| 1265 | nmdc:mga0rr50_38822_c1 | 3300050513 | Bacteria | 3449 |
| 1266 | nmdc:mga0rr50_970250_c1 | 3300050513 | Bacteria | 724 |
| 1267 | nmdc:mga08x19_522658_c1 | 3300050514 | Bacteria | 839 |
| 1268 | nmdc:mga0a205_2479_c1 | 3300050515 | Bacteria | 16274 |
| 1269 | nmdc:mga0a205_396682_c1 | 3300050515 | Bacteria | 1244 |
| 1270 | nmdc:mga0a205_685731_c1 | 3300050515 | Bacteria | 875 |
| 1271 | nmdc:mga0sz30_24066_c1 | 3300050516 | Bacteria | 2483 |
| 1272 | Ga0495601_0194481 | 3300053077 | Bacteria | 1326 |
| 1273 | Ga0495601_0939069 | 3300053077 | Bacteria | 545 |
| 1274 | Ga0495612_0018232 | 3300053078 | Bacteria | 2811 |
| 1275 | Ga0500635_0031075 | 3300053080 | Bacteria | 1726 |
| 1276 | Ga0495595_0051526 | 3300053084 | Bacteria | 1908 |
| 1277 | Ga0495619_0057702 | 3300053085 | Bacteria | 2576 |
| 1278 | Ga0495619_0125055 | 3300053085 | Bacteria | 1764 |
| 1279 | Ga0495619_0578918 | 3300053085 | Bacteria | 769 |
| 1280 | Ga0500578_0000459 | 3300053086 | Bacteria | 49572 |
| 1281 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 1282 | Ga0500643_001398 | 3300053087 | Bacteria | 13944 |
| 1283 | Ga0500643_002694 | 3300053087 | Bacteria | 8926 |
| 1284 | Ga0500644_0163011 | 3300053088 | Bacteria | 902 |
| 1285 | Ga0500583_0162063 | 3300053092 | Bacteria | 1114 |
| 1286 | Ga0500566_0487259 | 3300053094 | Bacteria | 533 |
| 1287 | Ga0500641_0097697 | 3300053096 | Bacteria | 1258 |
| 1288 | Ga0500648_374559 | 3300053097 | Bacteria | 561 |
| 1289 | Ga0500554_070188 | 3300053102 | Bacteria | 1139 |
| 1290 | Ga0500555_050120 | 3300053103 | Bacteria | 1144 |
| 1291 | Ga0500556_0000636 | 3300053104 | Bacteria | 22036 |
| 1292 | Ga0500556_0030971 | 3300053104 | Bacteria | 1817 |
| 1293 | Ga0500557_217408 | 3300053105 | Bacteria | 609 |
| 1294 | Ga0500562_003308 | 3300053108 | Bacteria | 4029 |
| 1295 | Ga0500572_000706 | 3300053111 | Bacteria | 10831 |
| 1296 | Ga0500594_0123906 | 3300053118 | Bacteria | 813 |
| 1297 | Ga0500594_0160110 | 3300053118 | Bacteria | 727 |
| 1298 | Ga0500595_030639 | 3300053119 | Bacteria | 1810 |
| 1299 | Ga0500595_071208 | 3300053119 | Bacteria | 1031 |
| 1300 | Ga0500595_109071 | 3300053119 | Bacteria | 788 |
| 1301 | Ga0500597_331540 | 3300053120 | Bacteria | 598 |
| 1302 | Ga0500608_000084 | 3300053122 | Bacteria | 38834 |
| 1303 | Ga0500614_032376 | 3300053123 | Bacteria | 1286 |
| 1304 | Ga0500618_000395 | 3300053125 | Bacteria | 30005 |
| 1305 | Ga0500642_0080981 | 3300053130 | Bacteria | 1491 |
| 1306 | Ga0500658_0113288 | 3300053134 | Bacteria | 1196 |
| 1307 | Ga0500559_0000113 | 3300053136 | Bacteria | 63512 |
| 1308 | Ga0500559_0001398 | 3300053136 | Bacteria | 13721 |
| 1309 | Ga0500559_0045933 | 3300053136 | Bacteria | 1914 |
| 1310 | Ga0500559_0084588 | 3300053136 | Bacteria | 1446 |
| 1311 | Ga0500559_0179035 | 3300053136 | Bacteria | 998 |
| 1312 | Ga0500573_0040077 | 3300053140 | Bacteria | 2705 |
| 1313 | Ga0500577_0017824 | 3300053142 | Bacteria | 2270 |
| 1314 | Ga0500577_0279280 | 3300053142 | Bacteria | 728 |
| 1315 | Ga0500588_0375719 | 3300053146 | Bacteria | 541 |
| 1316 | Ga0500590_305366 | 3300053148 | Bacteria | 596 |
| 1317 | Ga0500604_0065300 | 3300053151 | Bacteria | 1151 |
| 1318 | Ga0500616_0003259 | 3300053153 | Bacteria | 12557 |
| 1319 | Ga0500616_0054505 | 3300053153 | Bacteria | 2094 |
| 1320 | Ga0500616_0062207 | 3300053153 | Bacteria | 1929 |
| 1321 | Ga0500622_0019916 | 3300053156 | Bacteria | 3562 |
| 1322 | Ga0500633_0184725 | 3300053160 | Bacteria | 782 |
| 1323 | Ga0500634_0157358 | 3300053161 | Bacteria | 1054 |
| 1324 | Ga0500639_075340 | 3300053163 | Bacteria | 1710 |
| 1325 | Ga0500639_120431 | 3300053163 | Bacteria | 1261 |
| 1326 | Ga0500611_095561 | 3300053727 | Bacteria | 762 |
| 1327 | Ga0500611_100892 | 3300053727 | Bacteria | 747 |
| 1328 | Ga0500645_010383 | 3300053730 | Bacteria | 3083 |
| 1329 | Ga0500609_054154 | 3300053731 | Bacteria | 558 |
| 1330 | Ga0500596_028037 | 3300053735 | Bacteria | 866 |
| 1331 | Ga0501084_0006267 | 3300054114 | Bacteria | 9778 |
| 1332 | Ga0501084_0042518 | 3300054114 | Bacteria | 3801 |
| 1333 | Ga0501084_0141553 | 3300054114 | Bacteria | 2025 |
| 1334 | Ga0501084_0184188 | 3300054114 | Bacteria | 1763 |
| 1335 | Ga0501084_0289759 | 3300054114 | Bacteria | 1383 |
| 1336 | Ga0501084_0299474 | 3300054114 | Bacteria | 1358 |
| 1337 | Ga0501084_0540805 | 3300054114 | Bacteria | 984 |
| 1338 | Ga0501084_0663744 | 3300054114 | Bacteria | 880 |
| 1339 | Ga0501084_0770388 | 3300054114 | Bacteria | 811 |
| 1340 | Ga0501084_0977468 | 3300054114 | Bacteria | 712 |
| 1341 | Ga0587084_008616 | 3300059477 | Bacteria | 1296 |
| 1342 | Ga0587084_083583 | 3300059477 | Bacteria | 622 |
| 1343 | Ga0587093_042853 | 3300059478 | Bacteria | 692 |
| 1344 | Ga0587073_0232585 | 3300059492 | Bacteria | 569 |
| 1345 | Ga0587077_194132 | 3300059493 | Bacteria | 558 |
| 1346 | Ga0587080_066164 | 3300059503 | Bacteria | 714 |
| 1347 | Ga0587083_0074098 | 3300059505 | Bacteria | 797 |
| 1348 | Ga0587085_162338 | 3300059506 | Bacteria | 523 |
| 1349 | Ga0587088_128227 | 3300059508 | Bacteria | 594 |
| 1350 | Ga0587090_008388 | 3300059510 | Bacteria | 1385 |
| 1351 | Ga0587090_058580 | 3300059510 | Bacteria | 725 |
| 1352 | Ga0587091_150299 | 3300059511 | Bacteria | 591 |
| 1353 | Ga0587092_027629 | 3300059512 | Bacteria | 919 |
| 1354 | Ga0587092_098355 | 3300059512 | Bacteria | 600 |
| 1355 | Ga0587094_025516 | 3300059513 | Bacteria | 886 |
| 1356 | Ga0587098_005909 | 3300059604 | Bacteria | 1221 |
| 1357 | Ga0587106_000505 | 3300059605 | Bacteria | 2773 |
| 1358 | Ga0587106_102105 | 3300059605 | Bacteria | 587 |
| 1359 | Ga0587125_013034 | 3300059607 | Bacteria | 894 |
| 1360 | Ga0587129_004972 | 3300059608 | Bacteria | 893 |
| 1361 | Ga0587101_005062 | 3300059623 | Bacteria | 1444 |
| 1362 | Ga0587101_027562 | 3300059623 | Bacteria | 865 |
| 1363 | Ga0587101_067023 | 3300059623 | Bacteria | 653 |
| 1364 | Ga0587101_118593 | 3300059623 | Bacteria | 545 |
| 1365 | Ga0587101_135185 | 3300059623 | Bacteria | 522 |
| 1366 | Ga0587101_149138 | 3300059623 | Bacteria | 505 |
| 1367 | Ga0587068_011869 | 3300059641 | Bacteria | 1322 |
| 1368 | Ga0587076_050589 | 3300059645 | Bacteria | 809 |
| 1369 | Ga0587078_000294 | 3300059646 | Bacteria | 3487 |
| 1370 | Ga0587078_026257 | 3300059646 | Bacteria | 764 |
| 1371 | Ga0587107_011200 | 3300059652 | Bacteria | 1094 |
| 1372 | Ga0587111_0006810 | 3300060346 | Bacteria | 1829 |
| 1373 | Ga0587111_0253784 | 3300060346 | Bacteria | 521 |
| 1374 | Ga0501082_0006964 | 3300060353 | Bacteria | 9766 |
| 1375 | Ga0501082_0030302 | 3300060353 | Bacteria | 4663 |
| 1376 | Ga0501082_0069663 | 3300060353 | Bacteria | 3029 |
| 1377 | Ga0501082_0088119 | 3300060353 | Bacteria | 2678 |
| 1378 | Ga0501082_0114130 | 3300060353 | Bacteria | 2340 |
| 1379 | Ga0501082_0136753 | 3300060353 | Bacteria | 2126 |
| 1380 | Ga0501082_0665513 | 3300060353 | Bacteria | 911 |
| 1381 | Ga0501082_0997369 | 3300060353 | Bacteria | 732 |
| 1382 | Ga0501082_1046130 | 3300060353 | Bacteria | 714 |
| 1383 | Ga0501082_1561408 | 3300060353 | Bacteria | 576 |
| 1384 | Ga0501082_1692524 | 3300060353 | Bacteria | 552 |
| 1385 | Ga0530510_0021100 | 3300061734 | Bacteria | 4635 |
| 1386 | Ga0530510_0066947 | 3300061734 | Bacteria | 2605 |
| 1387 | Ga0530510_0118926 | 3300061734 | Bacteria | 1939 |
| 1388 | Ga0530510_0182254 | 3300061734 | Bacteria | 1557 |
| 1389 | Ga0530510_0877165 | 3300061734 | Bacteria | 685 |
| 1390 | Ga0530510_0997585 | 3300061734 | Bacteria | 641 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046453 | Ga0495627_077937 | Ga0495627_077937_83_493 | 121 |
| 2 | 3300005338 | Ga0068868_100029525 | Ga0068868_1000295255 | 122 |
| 3 | 3300006358 | Ga0068871_100064267 | Ga0068871_1000642674 | 122 |
| 4 | 3300014969 | Ga0157376_10672713 | Ga0157376_106727132 | 122 |
| 5 | 3300026121 | Ga0207683_10522017 | Ga0207683_105220171 | 122 |
| 6 | 3300053134 | Ga0500658_0113288 | Ga0500658_0113288_23_436 | 122 |
| 7 | 3300035724 | Ga0373933_0034262 | Ga0373933_0034262_1373_1780 | 123 |
| 8 | 3300036401 | Ga0373937_0006001 | Ga0373937_0006001_10035_10442 | 123 |
| 9 | 3300049568 | Ga0501031_0126957 | Ga0501031_0126957_1059_1451 | 123 |
| 10 | 3300049571 | Ga0501034_0063720 | Ga0501034_0063720_1792_2184 | 123 |
| 11 | 3300049573 | Ga0501037_0029353 | Ga0501037_0029353_2551_2943 | 123 |
| 12 | 3300049822 | Ga0501035_1403280 | Ga0501035_1403280_90_482 | 123 |
| 13 | 3300049823 | Ga0501044_0210409 | Ga0501044_0210409_548_940 | 123 |
| 14 | 3300006048 | Ga0075363_100180519 | Ga0075363_1001805192 | 124 |
| 15 | 3300006051 | Ga0075364_10360052 | Ga0075364_103600522 | 124 |
| 16 | 3300006177 | Ga0075362_10206673 | Ga0075362_102066732 | 124 |
| 17 | 3300021384 | Ga0213876_10003406 | Ga0213876_100034067 | 124 |
| 18 | 3300039437 | Ga0436365_0697746 | Ga0436365_0697746_11088_11498 | 124 |
| 19 | 3300039437 | Ga0436365_1239236 | Ga0436365_1239236_9716_10117 | 124 |
| 20 | 3300050489 | nmdc:mga03683_70319_c1 | nmdc:mga03683_70319_c1_752_1162 | 124 |
| 21 | 3300050492 | nmdc:mga0yw44_70411_c1 | nmdc:mga0yw44_70411_c1_542_952 | 124 |
| 22 | iso_pu_bacteria | 2524023250 | 2524609956 | 124 |
| 23 | iso_pu_bacteria | 2821443989 | 2821444264 | 124 |
| 24 | iso_pu_bacteria | 2842333319 | 2842335144 | 124 |
| 25 | iso_pu_bacteria | 2844533157 | 2844539289 | 124 |
| 26 | 3300049571 | Ga0501034_0484804 | Ga0501034_0484804_321_719 | 125 |
| 27 | 3300049822 | Ga0501035_0050699 | Ga0501035_0050699_1234_1632 | 125 |
| 28 | 3300053104 | Ga0500556_0030971 | Ga0500556_0030971_655_1053 | 125 |
| 29 | 3300049581 | Ga0501047_0164561 | Ga0501047_0164561_141_536 | 126 |
| 30 | iso_pu_bacteria | 2909042592 | 2909043619 | 126 |
| 31 | 3300005444 | Ga0070694_100186460 | Ga0070694_1001864601 | 127 |
| 32 | 3300025918 | Ga0207662_10130312 | Ga0207662_101303122 | 127 |
| 33 | 3300035115 | Ga0373941_0339322 | Ga0373941_0339322_65_463 | 127 |
| 34 | 3300046472 | Ga0495580_0688532 | Ga0495580_0688532_101_490 | 127 |
| 35 | 3300049584 | Ga0501068_1061389 | Ga0501068_1061389_116_505 | 127 |
| 36 | 3300002864 | Ga0006764J43180_108466 | Ga0006764J43180_1084662 | 128 |
| 37 | 3300003162 | Ga0006778J45830_1008131 | Ga0006778J45830_10081312 | 128 |
| 38 | 3300003162 | Ga0006778J45830_1018080 | Ga0006778J45830_10180801 | 128 |
| 39 | 3300003162 | Ga0006778J45830_1049198 | Ga0006778J45830_10491981 | 128 |
| 40 | 3300003163 | Ga0006759J45824_1022394 | Ga0006759J45824_10223942 | 128 |
| 41 | 3300003163 | Ga0006759J45824_1022824 | Ga0006759J45824_10228241 | 128 |
| 42 | 3300003300 | Ga0006758J48902_1033810 | Ga0006758J48902_10338101 | 128 |
| 43 | 3300003305 | Ga0006770J48903_1012980 | Ga0006770J48903_10129802 | 128 |
| 44 | 3300003305 | Ga0006770J48903_1025503 | Ga0006770J48903_10255032 | 128 |
| 45 | 3300003308 | Ga0006777J48905_1011379 | Ga0006777J48905_10113793 | 128 |
| 46 | 3300003559 | Ga0007427J51700_105947 | Ga0007427J51700_1059472 | 128 |
| 47 | 3300003568 | Ga0006781J51513_1004232 | Ga0006781J51513_10042322 | 128 |
| 48 | 3300003574 | Ga0007410J51695_1014171 | Ga0007410J51695_10141711 | 128 |
| 49 | 3300003574 | Ga0007410J51695_1020352 | Ga0007410J51695_10203521 | 128 |
| 50 | 3300003575 | Ga0007409J51694_1008637 | Ga0007409J51694_10086372 | 128 |
| 51 | 3300003577 | Ga0007416J51690_1009570 | Ga0007416J51690_10095702 | 128 |
| 52 | 3300003579 | Ga0007429J51699_1016068 | Ga0007429J51699_10160681 | 128 |
| 53 | 3300003579 | Ga0007429J51699_1033775 | Ga0007429J51699_10337751 | 128 |
| 54 | 3300003693 | Ga0032354_1001326 | Ga0032354_10013263 | 128 |
| 55 | 3300003735 | Ga0006780_1014704 | Ga0006780_10147041 | 128 |
| 56 | 3300004801 | Ga0058860_10041150 | Ga0058860_100411501 | 128 |
| 57 | 3300005434 | Ga0070709_10599618 | Ga0070709_105996181 | 128 |
| 58 | 3300005458 | Ga0070681_10029516 | Ga0070681_100295166 | 128 |
| 59 | 3300005458 | Ga0070681_10257706 | Ga0070681_102577062 | 128 |
| 60 | 3300005458 | Ga0070681_11263045 | Ga0070681_112630451 | 128 |
| 61 | 3300005530 | Ga0070679_101293727 | Ga0070679_1012937271 | 128 |
| 62 | 3300005539 | Ga0068853_100043552 | Ga0068853_1000435526 | 128 |
| 63 | 3300005563 | Ga0068855_100028006 | Ga0068855_1000280067 | 128 |
| 64 | 3300005577 | Ga0068857_100095785 | Ga0068857_1000957851 | 128 |
| 65 | 3300005842 | Ga0068858_101440710 | Ga0068858_1014407102 | 128 |
| 66 | 3300006844 | Ga0075428_100277033 | Ga0075428_1002770333 | 128 |
| 67 | 3300006846 | Ga0075430_100625942 | Ga0075430_1006259422 | 128 |
| 68 | 3300006847 | Ga0075431_100004125 | Ga0075431_1000041252 | 128 |
| 69 | 3300006880 | Ga0075429_100184313 | Ga0075429_1001843134 | 128 |
| 70 | 3300009093 | Ga0105240_10473595 | Ga0105240_104735952 | 128 |
| 71 | 3300009094 | Ga0111539_12497493 | Ga0111539_124974932 | 128 |
| 72 | 3300009553 | Ga0105249_12646345 | Ga0105249_126463452 | 128 |
| 73 | 3300011119 | Ga0105246_10257174 | Ga0105246_102571743 | 128 |
| 74 | 3300013104 | Ga0157370_10029081 | Ga0157370_100290813 | 128 |
| 75 | 3300013307 | Ga0157372_12638887 | Ga0157372_126388872 | 128 |
| 76 | 3300013308 | Ga0157375_12925126 | Ga0157375_129251262 | 128 |
| 77 | 3300014745 | Ga0157377_10578754 | Ga0157377_105787541 | 128 |
| 78 | 3300023309 | Ga0256744_117912 | Ga0256744_1179121 | 128 |
| 79 | 3300023438 | Ga0256720_148736 | Ga0256720_1487361 | 128 |
| 80 | 3300025912 | Ga0207707_10014060 | Ga0207707_100140605 | 128 |
| 81 | 3300025912 | Ga0207707_10161372 | Ga0207707_101613722 | 128 |
| 82 | 3300025921 | Ga0207652_10271075 | Ga0207652_102710752 | 128 |
| 83 | 3300025932 | Ga0207690_10232426 | Ga0207690_102324262 | 128 |
| 84 | 3300025949 | Ga0207667_10466180 | Ga0207667_104661801 | 128 |
| 85 | 3300026035 | Ga0207703_12344404 | Ga0207703_123444041 | 128 |
| 86 | 3300026041 | Ga0207639_10117451 | Ga0207639_101174513 | 128 |
| 87 | 3300026116 | Ga0207674_10038880 | Ga0207674_100388802 | 128 |
| 88 | 3300029285 | Ga0310981_1020365 | Ga0310981_10203652 | 128 |
| 89 | 3300029285 | Ga0310981_1053128 | Ga0310981_10531282 | 128 |
| 90 | 3300030889 | Ga0265761_105604 | Ga0265761_1056042 | 128 |
| 91 | 3300031901 | Ga0307406_10572785 | Ga0307406_105727852 | 128 |
| 92 | 3300031995 | Ga0307409_102742855 | Ga0307409_1027428551 | 128 |
| 93 | 3300032004 | Ga0307414_10920124 | Ga0307414_109201242 | 128 |
| 94 | 3300035398 | Ga0316574_0196185 | Ga0316574_0196185_506_898 | 128 |
| 95 | 3300039438 | Ga0436360_0559098 | Ga0436360_0559098_322_717 | 128 |
| 96 | 3300039453 | Ga0436362_0940958 | Ga0436362_0940958_296_685 | 128 |
| 97 | 3300041407 | Ga0439447_056999 | Ga0439447_056999_202_600 | 128 |
| 98 | 3300041999 | Ga0439433_0046360 | Ga0439433_0046360_542_940 | 128 |
| 99 | 3300042128 | Ga0450897_043015 | Ga0450897_043015_114_515 | 128 |
| 100 | 3300042145 | Ga0450906_049166 | Ga0450906_049166_69_461 | 128 |
| 101 | 3300042436 | Ga0439435_0308571 | Ga0439435_0308571_89_487 | 128 |
| 102 | 3300046515 | Ga0495620_0101865 | Ga0495620_0101865_704_1108 | 128 |
| 103 | 3300048923 | Ga0496120_0067960 | Ga0496120_0067960_1225_1623 | 128 |
| 104 | 3300048924 | Ga0496121_0258393 | Ga0496121_0258393_657_1061 | 128 |
| 105 | 3300048925 | Ga0496122_0188410 | Ga0496122_0188410_793_1191 | 128 |
| 106 | 3300048927 | Ga0496124_0467131 | Ga0496124_0467131_145_543 | 128 |
| 107 | 3300048928 | Ga0496125_0110284 | Ga0496125_0110284_548_946 | 128 |
| 108 | 3300049128 | Ga0501308_046599 | Ga0501308_046599_108_506 | 128 |
| 109 | 3300049129 | Ga0501309_058434 | Ga0501309_058434_126_524 | 128 |
| 110 | 3300049530 | Ga0501314_042818 | Ga0501314_042818_26_424 | 128 |
| 111 | 3300049531 | Ga0501315_016915 | Ga0501315_016915_108_506 | 128 |
| 112 | 3300049532 | Ga0501316_071005 | Ga0501316_071005_13_411 | 128 |
| 113 | 3300049533 | Ga0501317_006005 | Ga0501317_006005_36_434 | 128 |
| 114 | 3300049533 | Ga0501317_011743 | Ga0501317_011743_564_962 | 128 |
| 115 | 3300049533 | Ga0501317_066260 | Ga0501317_066260_97_495 | 128 |
| 116 | 3300049533 | Ga0501317_085576 | Ga0501317_085576_126_524 | 128 |
| 117 | 3300049534 | Ga0501318_009292 | Ga0501318_009292_564_962 | 128 |
| 118 | 3300049541 | Ga0501325_007275 | Ga0501325_007275_220_618 | 128 |
| 119 | 3300049568 | Ga0501031_0018496 | Ga0501031_0018496_3094_3492 | 128 |
| 120 | 3300049569 | Ga0501032_0004362 | Ga0501032_0004362_1067_1465 | 128 |
| 121 | 3300049570 | Ga0501033_0044704 | Ga0501033_0044704_658_1056 | 128 |
| 122 | 3300049571 | Ga0501034_0067818 | Ga0501034_0067818_880_1278 | 128 |
| 123 | 3300049572 | Ga0501036_0027433 | Ga0501036_0027433_2423_2821 | 128 |
| 124 | 3300049573 | Ga0501037_0023671 | Ga0501037_0023671_1588_1986 | 128 |
| 125 | 3300049574 | Ga0501038_0807937 | Ga0501038_0807937_162_560 | 128 |
| 126 | 3300049575 | Ga0501039_0014819 | Ga0501039_0014819_2168_2566 | 128 |
| 127 | 3300049575 | Ga0501039_0648893 | Ga0501039_0648893_252_650 | 128 |
| 128 | 3300049576 | Ga0501040_0085266 | Ga0501040_0085266_117_515 | 128 |
| 129 | 3300049576 | Ga0501040_1222801 | Ga0501040_1222801_45_443 | 128 |
| 130 | 3300049577 | Ga0501041_0590807 | Ga0501041_0590807_209_607 | 128 |
| 131 | 3300049578 | Ga0501042_0016472 | Ga0501042_0016472_3360_3758 | 128 |
| 132 | 3300049579 | Ga0501043_0057196 | Ga0501043_0057196_1466_1864 | 128 |
| 133 | 3300049580 | Ga0501046_0005416 | Ga0501046_0005416_955_1353 | 128 |
| 134 | 3300049581 | Ga0501047_0407290 | Ga0501047_0407290_658_1056 | 128 |
| 135 | 3300049582 | Ga0501048_0089966 | Ga0501048_0089966_679_1077 | 128 |
| 136 | 3300049583 | Ga0501067_0073051 | Ga0501067_0073051_823_1221 | 128 |
| 137 | 3300049584 | Ga0501068_0154668 | Ga0501068_0154668_612_1010 | 128 |
| 138 | 3300049585 | Ga0501069_0004829 | Ga0501069_0004829_3684_4082 | 128 |
| 139 | 3300049586 | Ga0501070_0106653 | Ga0501070_0106653_824_1222 | 128 |
| 140 | 3300049587 | Ga0501071_0322356 | Ga0501071_0322356_124_522 | 128 |
| 141 | 3300049588 | Ga0501072_0134262 | Ga0501072_0134262_438_836 | 128 |
| 142 | 3300049588 | Ga0501072_1096059 | Ga0501072_1096059_51_449 | 128 |
| 143 | 3300049589 | Ga0501073_0001669 | Ga0501073_0001669_7115_7513 | 128 |
| 144 | 3300049590 | Ga0501074_0004453 | Ga0501074_0004453_6285_6683 | 128 |
| 145 | 3300049590 | Ga0501074_0508823 | Ga0501074_0508823_406_804 | 128 |
| 146 | 3300049590 | Ga0501074_0523107 | Ga0501074_0523107_19_423 | 128 |
| 147 | 3300049591 | Ga0501075_0316490 | Ga0501075_0316490_647_1045 | 128 |
| 148 | 3300049592 | Ga0501076_0573295 | Ga0501076_0573295_200_598 | 128 |
| 149 | 3300049592 | Ga0501076_0608996 | Ga0501076_0608996_98_496 | 128 |
| 150 | 3300049741 | Ga0501079_0001478 | Ga0501079_0001478_12493_12891 | 128 |
| 151 | 3300049741 | Ga0501079_0699080 | Ga0501079_0699080_147_545 | 128 |
| 152 | 3300049742 | Ga0501080_1520202 | Ga0501080_1520202_34_432 | 128 |
| 153 | 3300049743 | Ga0501081_0422688 | Ga0501081_0422688_124_522 | 128 |
| 154 | 3300049743 | Ga0501081_0465185 | Ga0501081_0465185_96_494 | 128 |
| 155 | 3300049744 | Ga0501083_0022615 | Ga0501083_0022615_1683_2081 | 128 |
| 156 | 3300049744 | Ga0501083_1014560 | Ga0501083_1014560_44_442 | 128 |
| 157 | 3300049822 | Ga0501035_0186418 | Ga0501035_0186418_658_1056 | 128 |
| 158 | 3300049823 | Ga0501044_0024878 | Ga0501044_0024878_5792_6190 | 128 |
| 159 | 3300049824 | Ga0501045_0068338 | Ga0501045_0068338_1649_2047 | 128 |
| 160 | 3300049824 | Ga0501045_1139098 | Ga0501045_1139098_82_480 | 128 |
| 161 | 3300050508 | nmdc:mga09592_8483_c1 | nmdc:mga09592_8483_c1_7234_7632 | 128 |
| 162 | 3300050509 | nmdc:mga0qj67_211251_c1 | nmdc:mga0qj67_211251_c1_958_1356 | 128 |
| 163 | 3300050510 | nmdc:mga06r32_660_c1 | nmdc:mga06r32_660_c1_12814_13212 | 128 |
| 164 | 3300053077 | Ga0495601_0939069 | Ga0495601_0939069_95_490 | 128 |
| 165 | 3300053136 | Ga0500559_0045933 | Ga0500559_0045933_97_495 | 128 |
| 166 | 3300053153 | Ga0500616_0062207 | Ga0500616_0062207_77_469 | 128 |
| 167 | 3300054114 | Ga0501084_0042518 | Ga0501084_0042518_3267_3665 | 128 |
| 168 | 3300054114 | Ga0501084_0540805 | Ga0501084_0540805_162_560 | 128 |
| 169 | 3300059477 | Ga0587084_008616 | Ga0587084_008616_394_792 | 128 |
| 170 | 3300059506 | Ga0587085_162338 | Ga0587085_162338_12_410 | 128 |
| 171 | 3300059510 | Ga0587090_008388 | Ga0587090_008388_483_881 | 128 |
| 172 | 3300059511 | Ga0587091_150299 | Ga0587091_150299_36_431 | 128 |
| 173 | 3300059623 | Ga0587101_005062 | Ga0587101_005062_629_1027 | 128 |
| 174 | 3300059641 | Ga0587068_011869 | Ga0587068_011869_420_818 | 128 |
| 175 | 3300059646 | Ga0587078_000294 | Ga0587078_000294_504_902 | 128 |
| 176 | 3300060346 | Ga0587111_0006810 | Ga0587111_0006810_923_1321 | 128 |
| 177 | 3300060353 | Ga0501082_0006964 | Ga0501082_0006964_1043_1441 | 128 |
| 178 | 3300061734 | Ga0530510_0021100 | Ga0530510_0021100_3780_4178 | 128 |
| 179 | 3300001979 | JGI24740J21852_10130414 | JGI24740J21852_101304141 | 129 |
| 180 | 3300003215 | JGI25153J46596_10000830 | JGI25153J46596_100008308 | 129 |
| 181 | 3300003559 | Ga0007427J51700_106632 | Ga0007427J51700_1066322 | 129 |
| 182 | 3300003578 | Ga0006562J51391_1036321 | Ga0006562J51391_10363212 | 129 |
| 183 | 3300003659 | JGI25404J52841_10015764 | JGI25404J52841_100157643 | 129 |
| 184 | 3300003693 | Ga0032354_1016125 | Ga0032354_10161252 | 129 |
| 185 | 3300003911 | JGI25405J52794_10077812 | JGI25405J52794_100778122 | 129 |
| 186 | 3300004799 | Ga0058863_11718014 | Ga0058863_117180141 | 129 |
| 187 | 3300004803 | Ga0058862_10033415 | Ga0058862_100334151 | 129 |
| 188 | 3300005293 | Ga0065715_10035160 | Ga0065715_100351602 | 129 |
| 189 | 3300005327 | Ga0070658_10003455 | Ga0070658_100034553 | 129 |
| 190 | 3300005329 | Ga0070683_100084749 | Ga0070683_1000847494 | 129 |
| 191 | 3300005334 | Ga0068869_100092987 | Ga0068869_1000929872 | 129 |
| 192 | 3300005334 | Ga0068869_100100452 | Ga0068869_1001004523 | 129 |
| 193 | 3300005334 | Ga0068869_102057784 | Ga0068869_1020577841 | 129 |
| 194 | 3300005335 | Ga0070666_10021121 | Ga0070666_100211213 | 129 |
| 195 | 3300005335 | Ga0070666_10137163 | Ga0070666_101371632 | 129 |
| 196 | 3300005336 | Ga0070680_100069250 | Ga0070680_1000692502 | 129 |
| 197 | 3300005336 | Ga0070680_100107819 | Ga0070680_1001078191 | 129 |
| 198 | 3300005336 | Ga0070680_100192763 | Ga0070680_1001927632 | 129 |
| 199 | 3300005336 | Ga0070680_100268121 | Ga0070680_1002681212 | 129 |
| 200 | 3300005336 | Ga0070680_100342469 | Ga0070680_1003424691 | 129 |
| 201 | 3300005337 | Ga0070682_100016529 | Ga0070682_1000165295 | 129 |
| 202 | 3300005338 | Ga0068868_101167888 | Ga0068868_1011678882 | 129 |
| 203 | 3300005338 | Ga0068868_101354080 | Ga0068868_1013540801 | 129 |
| 204 | 3300005339 | Ga0070660_100023123 | Ga0070660_1000231232 | 129 |
| 205 | 3300005339 | Ga0070660_100084309 | Ga0070660_1000843092 | 129 |
| 206 | 3300005339 | Ga0070660_100140899 | Ga0070660_1001408994 | 129 |
| 207 | 3300005340 | Ga0070689_101758028 | Ga0070689_1017580281 | 129 |
| 208 | 3300005341 | Ga0070691_10014834 | Ga0070691_100148342 | 129 |
| 209 | 3300005343 | Ga0070687_100219327 | Ga0070687_1002193271 | 129 |
| 210 | 3300005345 | Ga0070692_10012203 | Ga0070692_100122034 | 129 |
| 211 | 3300005345 | Ga0070692_10069116 | Ga0070692_100691162 | 129 |
| 212 | 3300005347 | Ga0070668_100043015 | Ga0070668_1000430155 | 129 |
| 213 | 3300005347 | Ga0070668_101463004 | Ga0070668_1014630041 | 129 |
| 214 | 3300005353 | Ga0070669_100192007 | Ga0070669_1001920072 | 129 |
| 215 | 3300005354 | Ga0070675_100372422 | Ga0070675_1003724221 | 129 |
| 216 | 3300005355 | Ga0070671_100719742 | Ga0070671_1007197421 | 129 |
| 217 | 3300005364 | Ga0070673_100150421 | Ga0070673_1001504213 | 129 |
| 218 | 3300005364 | Ga0070673_100657775 | Ga0070673_1006577752 | 129 |
| 219 | 3300005365 | Ga0070688_100101145 | Ga0070688_1001011452 | 129 |
| 220 | 3300005366 | Ga0070659_100018614 | Ga0070659_1000186142 | 129 |
| 221 | 3300005366 | Ga0070659_100406858 | Ga0070659_1004068582 | 129 |
| 222 | 3300005367 | Ga0070667_100028269 | Ga0070667_1000282695 | 129 |
| 223 | 3300005367 | Ga0070667_100055820 | Ga0070667_1000558202 | 129 |
| 224 | 3300005367 | Ga0070667_100449117 | Ga0070667_1004491172 | 129 |
| 225 | 3300005367 | Ga0070667_101319560 | Ga0070667_1013195601 | 129 |
| 226 | 3300005406 | Ga0070703_10121833 | Ga0070703_101218332 | 129 |
| 227 | 3300005435 | Ga0070714_100000676 | Ga0070714_10000067612 | 129 |
| 228 | 3300005438 | Ga0070701_10012091 | Ga0070701_100120914 | 129 |
| 229 | 3300005438 | Ga0070701_10382880 | Ga0070701_103828802 | 129 |
| 230 | 3300005440 | Ga0070705_100000459 | Ga0070705_10000045926 | 129 |
| 231 | 3300005440 | Ga0070705_100942308 | Ga0070705_1009423081 | 129 |
| 232 | 3300005441 | Ga0070700_100035635 | Ga0070700_1000356354 | 129 |
| 233 | 3300005441 | Ga0070700_100159447 | Ga0070700_1001594472 | 129 |
| 234 | 3300005444 | Ga0070694_100025303 | Ga0070694_1000253034 | 129 |
| 235 | 3300005445 | Ga0070708_101280534 | Ga0070708_1012805341 | 129 |
| 236 | 3300005455 | Ga0070663_100001615 | Ga0070663_10000161517 | 129 |
| 237 | 3300005455 | Ga0070663_100014346 | Ga0070663_1000143462 | 129 |
| 238 | 3300005455 | Ga0070663_100355644 | Ga0070663_1003556442 | 129 |
| 239 | 3300005455 | Ga0070663_100439838 | Ga0070663_1004398382 | 129 |
| 240 | 3300005455 | Ga0070663_100763531 | Ga0070663_1007635311 | 129 |
| 241 | 3300005456 | Ga0070678_100044559 | Ga0070678_1000445594 | 129 |
| 242 | 3300005456 | Ga0070678_100061831 | Ga0070678_1000618312 | 129 |
| 243 | 3300005456 | Ga0070678_100224282 | Ga0070678_1002242822 | 129 |
| 244 | 3300005456 | Ga0070678_100731174 | Ga0070678_1007311741 | 129 |
| 245 | 3300005456 | Ga0070678_101715828 | Ga0070678_1017158281 | 129 |
| 246 | 3300005457 | Ga0070662_100084838 | Ga0070662_1000848382 | 129 |
| 247 | 3300005458 | Ga0070681_10007102 | Ga0070681_1000710219 | 129 |
| 248 | 3300005458 | Ga0070681_10015119 | Ga0070681_100151197 | 129 |
| 249 | 3300005458 | Ga0070681_10058942 | Ga0070681_100589425 | 129 |
| 250 | 3300005458 | Ga0070681_10071358 | Ga0070681_100713584 | 129 |
| 251 | 3300005458 | Ga0070681_10580881 | Ga0070681_105808812 | 129 |
| 252 | 3300005458 | Ga0070681_10709552 | Ga0070681_107095522 | 129 |
| 253 | 3300005459 | Ga0068867_100916634 | Ga0068867_1009166342 | 129 |
| 254 | 3300005459 | Ga0068867_100940904 | Ga0068867_1009409042 | 129 |
| 255 | 3300005459 | Ga0068867_100990164 | Ga0068867_1009901642 | 129 |
| 256 | 3300005468 | Ga0070707_100257272 | Ga0070707_1002572722 | 129 |
| 257 | 3300005471 | Ga0070698_100204506 | Ga0070698_1002045062 | 129 |
| 258 | 3300005518 | Ga0070699_100000540 | Ga0070699_10000054017 | 129 |
| 259 | 3300005530 | Ga0070679_100014413 | Ga0070679_1000144134 | 129 |
| 260 | 3300005530 | Ga0070679_100047434 | Ga0070679_1000474342 | 129 |
| 261 | 3300005530 | Ga0070679_100081241 | Ga0070679_1000812413 | 129 |
| 262 | 3300005530 | Ga0070679_100331407 | Ga0070679_1003314072 | 129 |
| 263 | 3300005530 | Ga0070679_100509180 | Ga0070679_1005091801 | 129 |
| 264 | 3300005536 | Ga0070697_100011184 | Ga0070697_1000111849 | 129 |
| 265 | 3300005539 | Ga0068853_100022760 | Ga0068853_1000227602 | 129 |
| 266 | 3300005539 | Ga0068853_100408744 | Ga0068853_1004087442 | 129 |
| 267 | 3300005539 | Ga0068853_100954509 | Ga0068853_1009545091 | 129 |
| 268 | 3300005539 | Ga0068853_100991632 | Ga0068853_1009916322 | 129 |
| 269 | 3300005543 | Ga0070672_100288069 | Ga0070672_1002880692 | 129 |
| 270 | 3300005544 | Ga0070686_100183555 | Ga0070686_1001835551 | 129 |
| 271 | 3300005544 | Ga0070686_100593463 | Ga0070686_1005934631 | 129 |
| 272 | 3300005545 | Ga0070695_100024268 | Ga0070695_1000242682 | 129 |
| 273 | 3300005545 | Ga0070695_100964424 | Ga0070695_1009644241 | 129 |
| 274 | 3300005546 | Ga0070696_100000156 | Ga0070696_10000015625 | 129 |
| 275 | 3300005546 | Ga0070696_100103413 | Ga0070696_1001034133 | 129 |
| 276 | 3300005546 | Ga0070696_100317609 | Ga0070696_1003176092 | 129 |
| 277 | 3300005547 | Ga0070693_100012485 | Ga0070693_1000124855 | 129 |
| 278 | 3300005548 | Ga0070665_100000121 | Ga0070665_100000121142 | 129 |
| 279 | 3300005548 | Ga0070665_100023111 | Ga0070665_1000231119 | 129 |
| 280 | 3300005548 | Ga0070665_100684034 | Ga0070665_1006840341 | 129 |
| 281 | 3300005549 | Ga0070704_100001256 | Ga0070704_10000125618 | 129 |
| 282 | 3300005563 | Ga0068855_100046653 | Ga0068855_1000466535 | 129 |
| 283 | 3300005563 | Ga0068855_100071894 | Ga0068855_1000718942 | 129 |
| 284 | 3300005563 | Ga0068855_100073423 | Ga0068855_1000734233 | 129 |
| 285 | 3300005563 | Ga0068855_100171503 | Ga0068855_1001715034 | 129 |
| 286 | 3300005563 | Ga0068855_100716568 | Ga0068855_1007165682 | 129 |
| 287 | 3300005564 | Ga0070664_100347391 | Ga0070664_1003473912 | 129 |
| 288 | 3300005577 | Ga0068857_100020659 | Ga0068857_1000206592 | 129 |
| 289 | 3300005577 | Ga0068857_100031465 | Ga0068857_1000314656 | 129 |
| 290 | 3300005577 | Ga0068857_100122566 | Ga0068857_1001225662 | 129 |
| 291 | 3300005577 | Ga0068857_102105737 | Ga0068857_1021057371 | 129 |
| 292 | 3300005578 | Ga0068854_100724080 | Ga0068854_1007240802 | 129 |
| 293 | 3300005614 | Ga0068856_100435995 | Ga0068856_1004359951 | 129 |
| 294 | 3300005614 | Ga0068856_101518382 | Ga0068856_1015183822 | 129 |
| 295 | 3300005615 | Ga0070702_100047118 | Ga0070702_1000471183 | 129 |
| 296 | 3300005615 | Ga0070702_100257669 | Ga0070702_1002576692 | 129 |
| 297 | 3300005615 | Ga0070702_100844818 | Ga0070702_1008448181 | 129 |
| 298 | 3300005615 | Ga0070702_100996528 | Ga0070702_1009965281 | 129 |
| 299 | 3300005616 | Ga0068852_100386755 | Ga0068852_1003867552 | 129 |
| 300 | 3300005616 | Ga0068852_100992990 | Ga0068852_1009929901 | 129 |
| 301 | 3300005616 | Ga0068852_102000957 | Ga0068852_1020009571 | 129 |
| 302 | 3300005617 | Ga0068859_100005627 | Ga0068859_1000056273 | 129 |
| 303 | 3300005617 | Ga0068859_100243742 | Ga0068859_1002437424 | 129 |
| 304 | 3300005617 | Ga0068859_100440943 | Ga0068859_1004409431 | 129 |
| 305 | 3300005618 | Ga0068864_100013728 | Ga0068864_1000137287 | 129 |
| 306 | 3300005618 | Ga0068864_100156071 | Ga0068864_1001560713 | 129 |
| 307 | 3300005618 | Ga0068864_100464393 | Ga0068864_1004643932 | 129 |
| 308 | 3300005718 | Ga0068866_11087899 | Ga0068866_110878991 | 129 |
| 309 | 3300005719 | Ga0068861_100057102 | Ga0068861_1000571024 | 129 |
| 310 | 3300005719 | Ga0068861_100060641 | Ga0068861_1000606414 | 129 |
| 311 | 3300005719 | Ga0068861_100168742 | Ga0068861_1001687422 | 129 |
| 312 | 3300005719 | Ga0068861_100219088 | Ga0068861_1002190882 | 129 |
| 313 | 3300005719 | Ga0068861_100710333 | Ga0068861_1007103331 | 129 |
| 314 | 3300005840 | Ga0068870_10394820 | Ga0068870_103948202 | 129 |
| 315 | 3300005841 | Ga0068863_100064279 | Ga0068863_1000642792 | 129 |
| 316 | 3300005841 | Ga0068863_100757821 | Ga0068863_1007578212 | 129 |
| 317 | 3300005841 | Ga0068863_100787247 | Ga0068863_1007872471 | 129 |
| 318 | 3300005842 | Ga0068858_100135230 | Ga0068858_1001352303 | 129 |
| 319 | 3300005843 | Ga0068860_100006701 | Ga0068860_10000670120 | 129 |
| 320 | 3300005843 | Ga0068860_100242218 | Ga0068860_1002422183 | 129 |
| 321 | 3300005843 | Ga0068860_100359325 | Ga0068860_1003593252 | 129 |
| 322 | 3300005844 | Ga0068862_100034875 | Ga0068862_1000348754 | 129 |
| 323 | 3300005844 | Ga0068862_101342016 | Ga0068862_1013420162 | 129 |
| 324 | 3300005844 | Ga0068862_101436671 | Ga0068862_1014366712 | 129 |
| 325 | 3300005937 | Ga0081455_10001008 | Ga0081455_1000100819 | 129 |
| 326 | 3300005937 | Ga0081455_10251889 | Ga0081455_102518893 | 129 |
| 327 | 3300005983 | Ga0081540_1000645 | Ga0081540_100064526 | 129 |
| 328 | 3300005983 | Ga0081540_1006488 | Ga0081540_100648812 | 129 |
| 329 | 3300005983 | Ga0081540_1120111 | Ga0081540_11201112 | 129 |
| 330 | 3300005983 | Ga0081540_1217922 | Ga0081540_12179222 | 129 |
| 331 | 3300005985 | Ga0081539_10028584 | Ga0081539_100285844 | 129 |
| 332 | 3300005985 | Ga0081539_10052221 | Ga0081539_100522214 | 129 |
| 333 | 3300006038 | Ga0075365_10050909 | Ga0075365_100509094 | 129 |
| 334 | 3300006042 | Ga0075368_10002415 | Ga0075368_1000241511 | 129 |
| 335 | 3300006048 | Ga0075363_100093378 | Ga0075363_1000933781 | 129 |
| 336 | 3300006163 | Ga0070715_10072145 | Ga0070715_100721452 | 129 |
| 337 | 3300006175 | Ga0070712_100461985 | Ga0070712_1004619851 | 129 |
| 338 | 3300006178 | Ga0075367_10207325 | Ga0075367_102073253 | 129 |
| 339 | 3300006195 | Ga0075366_10043441 | Ga0075366_100434412 | 129 |
| 340 | 3300006195 | Ga0075366_10347162 | Ga0075366_103471622 | 129 |
| 341 | 3300006237 | Ga0097621_100291285 | Ga0097621_1002912852 | 129 |
| 342 | 3300006237 | Ga0097621_100339957 | Ga0097621_1003399572 | 129 |
| 343 | 3300006237 | Ga0097621_101148182 | Ga0097621_1011481822 | 129 |
| 344 | 3300006353 | Ga0075370_10121056 | Ga0075370_101210562 | 129 |
| 345 | 3300006358 | Ga0068871_100760895 | Ga0068871_1007608952 | 129 |
| 346 | 3300006844 | Ga0075428_100121619 | Ga0075428_1001216194 | 129 |
| 347 | 3300006844 | Ga0075428_100337512 | Ga0075428_1003375122 | 129 |
| 348 | 3300006844 | Ga0075428_100677028 | Ga0075428_1006770282 | 129 |
| 349 | 3300006844 | Ga0075428_100809363 | Ga0075428_1008093631 | 129 |
| 350 | 3300006846 | Ga0075430_100025465 | Ga0075430_1000254653 | 129 |
| 351 | 3300006847 | Ga0075431_100014343 | Ga0075431_10001434312 | 129 |
| 352 | 3300006847 | Ga0075431_100137414 | Ga0075431_1001374142 | 129 |
| 353 | 3300006847 | Ga0075431_100204143 | Ga0075431_1002041431 | 129 |
| 354 | 3300006847 | Ga0075431_100372131 | Ga0075431_1003721312 | 129 |
| 355 | 3300006852 | Ga0075433_10001194 | Ga0075433_100011946 | 129 |
| 356 | 3300006852 | Ga0075433_10455435 | Ga0075433_104554352 | 129 |
| 357 | 3300006871 | Ga0075434_100002309 | Ga0075434_10000230918 | 129 |
| 358 | 3300006871 | Ga0075434_100005901 | Ga0075434_10000590111 | 129 |
| 359 | 3300006871 | Ga0075434_100489510 | Ga0075434_1004895101 | 129 |
| 360 | 3300006871 | Ga0075434_102039620 | Ga0075434_1020396202 | 129 |
| 361 | 3300006880 | Ga0075429_100230456 | Ga0075429_1002304562 | 129 |
| 362 | 3300006880 | Ga0075429_100994062 | Ga0075429_1009940622 | 129 |
| 363 | 3300006914 | Ga0075436_100627444 | Ga0075436_1006274442 | 129 |
| 364 | 3300006931 | Ga0097620_100005627 | Ga0097620_1000056273 | 129 |
| 365 | 3300006931 | Ga0097620_100243755 | Ga0097620_1002437554 | 129 |
| 366 | 3300006931 | Ga0097620_100440942 | Ga0097620_1004409421 | 129 |
| 367 | 3300007076 | Ga0075435_100084480 | Ga0075435_1000844804 | 129 |
| 368 | 3300007076 | Ga0075435_100178503 | Ga0075435_1001785032 | 129 |
| 369 | 3300009011 | Ga0105251_10178396 | Ga0105251_101783962 | 129 |
| 370 | 3300009093 | Ga0105240_10872993 | Ga0105240_108729932 | 129 |
| 371 | 3300009094 | Ga0111539_10009902 | Ga0111539_1000990220 | 129 |
| 372 | 3300009094 | Ga0111539_10102489 | Ga0111539_101024894 | 129 |
| 373 | 3300009094 | Ga0111539_10159827 | Ga0111539_101598273 | 129 |
| 374 | 3300009094 | Ga0111539_10186305 | Ga0111539_101863053 | 129 |
| 375 | 3300009098 | Ga0105245_10271673 | Ga0105245_102716732 | 129 |
| 376 | 3300009101 | Ga0105247_10265933 | Ga0105247_102659332 | 129 |
| 377 | 3300009147 | Ga0114129_10052649 | Ga0114129_100526494 | 129 |
| 378 | 3300009147 | Ga0114129_10115748 | Ga0114129_101157483 | 129 |
| 379 | 3300009147 | Ga0114129_10307258 | Ga0114129_103072584 | 129 |
| 380 | 3300009147 | Ga0114129_10532331 | Ga0114129_105323313 | 129 |
| 381 | 3300009148 | Ga0105243_10005642 | Ga0105243_1000564212 | 129 |
| 382 | 3300009148 | Ga0105243_10185163 | Ga0105243_101851633 | 129 |
| 383 | 3300009148 | Ga0105243_10424620 | Ga0105243_104246202 | 129 |
| 384 | 3300009174 | Ga0105241_10853785 | Ga0105241_108537852 | 129 |
| 385 | 3300009177 | Ga0105248_10048814 | Ga0105248_100488144 | 129 |
| 386 | 3300009545 | Ga0105237_10343233 | Ga0105237_103432332 | 129 |
| 387 | 3300009551 | Ga0105238_10014386 | Ga0105238_1001438610 | 129 |
| 388 | 3300009551 | Ga0105238_10037395 | Ga0105238_100373956 | 129 |
| 389 | 3300009551 | Ga0105238_12979379 | Ga0105238_129793791 | 129 |
| 390 | 3300009553 | Ga0105249_10010481 | Ga0105249_100104818 | 129 |
| 391 | 3300009553 | Ga0105249_10232087 | Ga0105249_102320872 | 129 |
| 392 | 3300009553 | Ga0105249_10504662 | Ga0105249_105046621 | 129 |
| 393 | 3300009553 | Ga0105249_10629910 | Ga0105249_106299102 | 129 |
| 394 | 3300010375 | Ga0105239_10077772 | Ga0105239_100777724 | 129 |
| 395 | 3300010375 | Ga0105239_10152056 | Ga0105239_101520563 | 129 |
| 396 | 3300010375 | Ga0105239_10154786 | Ga0105239_101547863 | 129 |
| 397 | 3300010375 | Ga0105239_10442559 | Ga0105239_104425591 | 129 |
| 398 | 3300010375 | Ga0105239_11042557 | Ga0105239_110425572 | 129 |
| 399 | 3300011119 | Ga0105246_10008563 | Ga0105246_100085638 | 129 |
| 400 | 3300011119 | Ga0105246_10608919 | Ga0105246_106089191 | 129 |
| 401 | 3300011119 | Ga0105246_10610720 | Ga0105246_106107202 | 129 |
| 402 | 3300013100 | Ga0157373_11389966 | Ga0157373_113899661 | 129 |
| 403 | 3300013102 | Ga0157371_10018600 | Ga0157371_100186003 | 129 |
| 404 | 3300013104 | Ga0157370_10096703 | Ga0157370_100967033 | 129 |
| 405 | 3300013104 | Ga0157370_10141347 | Ga0157370_101413472 | 129 |
| 406 | 3300013104 | Ga0157370_10231765 | Ga0157370_102317652 | 129 |
| 407 | 3300013105 | Ga0157369_10032567 | Ga0157369_100325678 | 129 |
| 408 | 3300013105 | Ga0157369_10356738 | Ga0157369_103567382 | 129 |
| 409 | 3300013296 | Ga0157374_10534851 | Ga0157374_105348512 | 129 |
| 410 | 3300013297 | Ga0157378_10357095 | Ga0157378_103570953 | 129 |
| 411 | 3300013297 | Ga0157378_10540698 | Ga0157378_105406982 | 129 |
| 412 | 3300013297 | Ga0157378_10845320 | Ga0157378_108453202 | 129 |
| 413 | 3300013306 | Ga0163162_10338990 | Ga0163162_103389903 | 129 |
| 414 | 3300013306 | Ga0163162_11195020 | Ga0163162_111950202 | 129 |
| 415 | 3300013307 | Ga0157372_12584690 | Ga0157372_125846901 | 129 |
| 416 | 3300013308 | Ga0157375_10116435 | Ga0157375_101164353 | 129 |
| 417 | 3300013308 | Ga0157375_10859984 | Ga0157375_108599842 | 129 |
| 418 | 3300013308 | Ga0157375_11491023 | Ga0157375_114910232 | 129 |
| 419 | 3300013308 | Ga0157375_11857261 | Ga0157375_118572612 | 129 |
| 420 | 3300013308 | Ga0157375_12550657 | Ga0157375_125506571 | 129 |
| 421 | 3300014325 | Ga0163163_10169829 | Ga0163163_101698291 | 129 |
| 422 | 3300014325 | Ga0163163_10329470 | Ga0163163_103294702 | 129 |
| 423 | 3300014325 | Ga0163163_11289895 | Ga0163163_112898952 | 129 |
| 424 | 3300014325 | Ga0163163_12852432 | Ga0163163_128524321 | 129 |
| 425 | 3300014326 | Ga0157380_10009306 | Ga0157380_100093064 | 129 |
| 426 | 3300014326 | Ga0157380_10198955 | Ga0157380_101989552 | 129 |
| 427 | 3300014326 | Ga0157380_10293021 | Ga0157380_102930213 | 129 |
| 428 | 3300014326 | Ga0157380_11627094 | Ga0157380_116270942 | 129 |
| 429 | 3300014326 | Ga0157380_12925422 | Ga0157380_129254222 | 129 |
| 430 | 3300014326 | Ga0157380_13293333 | Ga0157380_132933331 | 129 |
| 431 | 3300014497 | Ga0182008_10027386 | Ga0182008_100273862 | 129 |
| 432 | 3300014968 | Ga0157379_10027510 | Ga0157379_100275104 | 129 |
| 433 | 3300014968 | Ga0157379_10117175 | Ga0157379_101171754 | 129 |
| 434 | 3300014968 | Ga0157379_11296326 | Ga0157379_112963262 | 129 |
| 435 | 3300014968 | Ga0157379_11624045 | Ga0157379_116240452 | 129 |
| 436 | 3300014969 | Ga0157376_10136727 | Ga0157376_101367272 | 129 |
| 437 | 3300014969 | Ga0157376_10268214 | Ga0157376_102682142 | 129 |
| 438 | 3300014969 | Ga0157376_10366273 | Ga0157376_103662732 | 129 |
| 439 | 3300014969 | Ga0157376_10774006 | Ga0157376_107740061 | 129 |
| 440 | 3300017792 | Ga0163161_10088631 | Ga0163161_100886312 | 129 |
| 441 | 3300017792 | Ga0163161_10647377 | Ga0163161_106473771 | 129 |
| 442 | 3300020082 | Ga0206353_10361816 | Ga0206353_103618161 | 129 |
| 443 | 3300020610 | Ga0154015_1156125 | Ga0154015_11561252 | 129 |
| 444 | 3300021361 | Ga0213872_10036033 | Ga0213872_100360332 | 129 |
| 445 | 3300021441 | Ga0213871_10311541 | Ga0213871_103115411 | 129 |
| 446 | 3300025272 | Ga0209455_1008380 | Ga0209455_10083804 | 129 |
| 447 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013887 | 129 |
| 448 | 3300025321 | Ga0207656_10068548 | Ga0207656_100685482 | 129 |
| 449 | 3300025885 | Ga0207653_10073529 | Ga0207653_100735292 | 129 |
| 450 | 3300025885 | Ga0207653_10075550 | Ga0207653_100755502 | 129 |
| 451 | 3300025903 | Ga0207680_10035901 | Ga0207680_100359012 | 129 |
| 452 | 3300025903 | Ga0207680_11312866 | Ga0207680_113128661 | 129 |
| 453 | 3300025904 | Ga0207647_10069690 | Ga0207647_100696902 | 129 |
| 454 | 3300025905 | Ga0207685_10002550 | Ga0207685_100025502 | 129 |
| 455 | 3300025907 | Ga0207645_11026796 | Ga0207645_110267961 | 129 |
| 456 | 3300025909 | Ga0207705_10004936 | Ga0207705_1000493612 | 129 |
| 457 | 3300025909 | Ga0207705_10035805 | Ga0207705_100358052 | 129 |
| 458 | 3300025909 | Ga0207705_10591827 | Ga0207705_105918272 | 129 |
| 459 | 3300025912 | Ga0207707_10010230 | Ga0207707_1001023012 | 129 |
| 460 | 3300025912 | Ga0207707_10038191 | Ga0207707_100381912 | 129 |
| 461 | 3300025912 | Ga0207707_10056826 | Ga0207707_100568264 | 129 |
| 462 | 3300025912 | Ga0207707_10115614 | Ga0207707_101156143 | 129 |
| 463 | 3300025912 | Ga0207707_10156822 | Ga0207707_101568223 | 129 |
| 464 | 3300025913 | Ga0207695_10000575 | Ga0207695_1000057540 | 129 |
| 465 | 3300025913 | Ga0207695_10259669 | Ga0207695_102596693 | 129 |
| 466 | 3300025913 | Ga0207695_10579178 | Ga0207695_105791782 | 129 |
| 467 | 3300025913 | Ga0207695_10752667 | Ga0207695_107526672 | 129 |
| 468 | 3300025913 | Ga0207695_10863779 | Ga0207695_108637791 | 129 |
| 469 | 3300025914 | Ga0207671_10401373 | Ga0207671_104013732 | 129 |
| 470 | 3300025915 | Ga0207693_10275682 | Ga0207693_102756822 | 129 |
| 471 | 3300025917 | Ga0207660_10000537 | Ga0207660_1000053733 | 129 |
| 472 | 3300025917 | Ga0207660_10003004 | Ga0207660_1000300419 | 129 |
| 473 | 3300025917 | Ga0207660_10052376 | Ga0207660_100523762 | 129 |
| 474 | 3300025917 | Ga0207660_10146738 | Ga0207660_101467383 | 129 |
| 475 | 3300025917 | Ga0207660_10155049 | Ga0207660_101550493 | 129 |
| 476 | 3300025918 | Ga0207662_10356421 | Ga0207662_103564212 | 129 |
| 477 | 3300025919 | Ga0207657_10006388 | Ga0207657_1000638813 | 129 |
| 478 | 3300025919 | Ga0207657_10021181 | Ga0207657_100211812 | 129 |
| 479 | 3300025919 | Ga0207657_10100998 | Ga0207657_101009982 | 129 |
| 480 | 3300025919 | Ga0207657_10290398 | Ga0207657_102903982 | 129 |
| 481 | 3300025920 | Ga0207649_11136592 | Ga0207649_111365922 | 129 |
| 482 | 3300025921 | Ga0207652_10045523 | Ga0207652_100455232 | 129 |
| 483 | 3300025921 | Ga0207652_10048851 | Ga0207652_100488514 | 129 |
| 484 | 3300025921 | Ga0207652_10116633 | Ga0207652_101166334 | 129 |
| 485 | 3300025921 | Ga0207652_10154260 | Ga0207652_101542603 | 129 |
| 486 | 3300025921 | Ga0207652_10546380 | Ga0207652_105463801 | 129 |
| 487 | 3300025922 | Ga0207646_10178105 | Ga0207646_101781052 | 129 |
| 488 | 3300025923 | Ga0207681_10078471 | Ga0207681_100784713 | 129 |
| 489 | 3300025923 | Ga0207681_10191943 | Ga0207681_101919432 | 129 |
| 490 | 3300025924 | Ga0207694_10021191 | Ga0207694_100211916 | 129 |
| 491 | 3300025924 | Ga0207694_10279826 | Ga0207694_102798262 | 129 |
| 492 | 3300025924 | Ga0207694_10581570 | Ga0207694_105815702 | 129 |
| 493 | 3300025927 | Ga0207687_10155570 | Ga0207687_101555702 | 129 |
| 494 | 3300025927 | Ga0207687_11507210 | Ga0207687_115072101 | 129 |
| 495 | 3300025928 | Ga0207700_11264045 | Ga0207700_112640452 | 129 |
| 496 | 3300025928 | Ga0207700_12009809 | Ga0207700_120098091 | 129 |
| 497 | 3300025929 | Ga0207664_10000478 | Ga0207664_1000047827 | 129 |
| 498 | 3300025929 | Ga0207664_11336705 | Ga0207664_113367051 | 129 |
| 499 | 3300025929 | Ga0207664_11404239 | Ga0207664_114042391 | 129 |
| 500 | 3300025931 | Ga0207644_10420732 | Ga0207644_104207322 | 129 |
| 501 | 3300025932 | Ga0207690_10000322 | Ga0207690_100003226 | 129 |
| 502 | 3300025932 | Ga0207690_10008862 | Ga0207690_100088625 | 129 |
| 503 | 3300025932 | Ga0207690_10008933 | Ga0207690_100089338 | 129 |
| 504 | 3300025933 | Ga0207706_10025334 | Ga0207706_100253343 | 129 |
| 505 | 3300025933 | Ga0207706_10531531 | Ga0207706_105315312 | 129 |
| 506 | 3300025933 | Ga0207706_10548571 | Ga0207706_105485711 | 129 |
| 507 | 3300025933 | Ga0207706_11004057 | Ga0207706_110040572 | 129 |
| 508 | 3300025933 | Ga0207706_11532526 | Ga0207706_115325261 | 129 |
| 509 | 3300025935 | Ga0207709_10384088 | Ga0207709_103840882 | 129 |
| 510 | 3300025936 | Ga0207670_10396942 | Ga0207670_103969422 | 129 |
| 511 | 3300025940 | Ga0207691_10750320 | Ga0207691_107503202 | 129 |
| 512 | 3300025941 | Ga0207711_10009066 | Ga0207711_100090669 | 129 |
| 513 | 3300025942 | Ga0207689_10030241 | Ga0207689_100302415 | 129 |
| 514 | 3300025942 | Ga0207689_10221147 | Ga0207689_102211473 | 129 |
| 515 | 3300025944 | Ga0207661_10058611 | Ga0207661_100586114 | 129 |
| 516 | 3300025945 | Ga0207679_11662135 | Ga0207679_116621351 | 129 |
| 517 | 3300025945 | Ga0207679_11747271 | Ga0207679_117472711 | 129 |
| 518 | 3300025949 | Ga0207667_10026409 | Ga0207667_100264093 | 129 |
| 519 | 3300025949 | Ga0207667_10057429 | Ga0207667_100574295 | 129 |
| 520 | 3300025949 | Ga0207667_10063505 | Ga0207667_100635054 | 129 |
| 521 | 3300025949 | Ga0207667_10351288 | Ga0207667_103512883 | 129 |
| 522 | 3300025949 | Ga0207667_10411725 | Ga0207667_104117252 | 129 |
| 523 | 3300025960 | Ga0207651_10174855 | Ga0207651_101748552 | 129 |
| 524 | 3300025961 | Ga0207712_10003369 | Ga0207712_100033695 | 129 |
| 525 | 3300025961 | Ga0207712_10246693 | Ga0207712_102466932 | 129 |
| 526 | 3300025972 | Ga0207668_10098919 | Ga0207668_100989192 | 129 |
| 527 | 3300025972 | Ga0207668_10456132 | Ga0207668_104561322 | 129 |
| 528 | 3300025981 | Ga0207640_10503971 | Ga0207640_105039712 | 129 |
| 529 | 3300025986 | Ga0207658_10031844 | Ga0207658_100318443 | 129 |
| 530 | 3300025986 | Ga0207658_10231702 | Ga0207658_102317022 | 129 |
| 531 | 3300026023 | Ga0207677_10646154 | Ga0207677_106461542 | 129 |
| 532 | 3300026023 | Ga0207677_11091649 | Ga0207677_110916491 | 129 |
| 533 | 3300026035 | Ga0207703_10246380 | Ga0207703_102463802 | 129 |
| 534 | 3300026035 | Ga0207703_10644001 | Ga0207703_106440012 | 129 |
| 535 | 3300026035 | Ga0207703_10784666 | Ga0207703_107846661 | 129 |
| 536 | 3300026041 | Ga0207639_10019252 | Ga0207639_100192526 | 129 |
| 537 | 3300026041 | Ga0207639_10371523 | Ga0207639_103715232 | 129 |
| 538 | 3300026041 | Ga0207639_10734826 | Ga0207639_107348262 | 129 |
| 539 | 3300026041 | Ga0207639_11620230 | Ga0207639_116202302 | 129 |
| 540 | 3300026067 | Ga0207678_10000118 | Ga0207678_1000011834 | 129 |
| 541 | 3300026067 | Ga0207678_10001998 | Ga0207678_100019988 | 129 |
| 542 | 3300026067 | Ga0207678_10092917 | Ga0207678_100929172 | 129 |
| 543 | 3300026067 | Ga0207678_10568602 | Ga0207678_105686022 | 129 |
| 544 | 3300026075 | Ga0207708_10001023 | Ga0207708_1000102326 | 129 |
| 545 | 3300026075 | Ga0207708_10079350 | Ga0207708_100793501 | 129 |
| 546 | 3300026075 | Ga0207708_10660023 | Ga0207708_106600231 | 129 |
| 547 | 3300026075 | Ga0207708_10707224 | Ga0207708_107072242 | 129 |
| 548 | 3300026075 | Ga0207708_11505701 | Ga0207708_115057011 | 129 |
| 549 | 3300026078 | Ga0207702_10981532 | Ga0207702_109815322 | 129 |
| 550 | 3300026088 | Ga0207641_10031526 | Ga0207641_100315262 | 129 |
| 551 | 3300026088 | Ga0207641_10064762 | Ga0207641_100647622 | 129 |
| 552 | 3300026088 | Ga0207641_10576200 | Ga0207641_105762002 | 129 |
| 553 | 3300026089 | Ga0207648_10099185 | Ga0207648_100991852 | 129 |
| 554 | 3300026089 | Ga0207648_10217728 | Ga0207648_102177282 | 129 |
| 555 | 3300026089 | Ga0207648_10982180 | Ga0207648_109821801 | 129 |
| 556 | 3300026089 | Ga0207648_11278503 | Ga0207648_112785032 | 129 |
| 557 | 3300026095 | Ga0207676_10147003 | Ga0207676_101470032 | 129 |
| 558 | 3300026095 | Ga0207676_11589531 | Ga0207676_115895312 | 129 |
| 559 | 3300026116 | Ga0207674_10040450 | Ga0207674_100404506 | 129 |
| 560 | 3300026116 | Ga0207674_10066996 | Ga0207674_100669962 | 129 |
| 561 | 3300026116 | Ga0207674_10145952 | Ga0207674_101459523 | 129 |
| 562 | 3300026116 | Ga0207674_10430144 | Ga0207674_104301442 | 129 |
| 563 | 3300026116 | Ga0207674_11534436 | Ga0207674_115344361 | 129 |
| 564 | 3300026118 | Ga0207675_100022568 | Ga0207675_1000225683 | 129 |
| 565 | 3300026118 | Ga0207675_100066743 | Ga0207675_1000667433 | 129 |
| 566 | 3300026118 | Ga0207675_100559964 | Ga0207675_1005599642 | 129 |
| 567 | 3300026118 | Ga0207675_101024505 | Ga0207675_1010245051 | 129 |
| 568 | 3300026121 | Ga0207683_10190947 | Ga0207683_101909472 | 129 |
| 569 | 3300026121 | Ga0207683_10337170 | Ga0207683_103371702 | 129 |
| 570 | 3300026121 | Ga0207683_10432369 | Ga0207683_104323692 | 129 |
| 571 | 3300026142 | Ga0207698_10522792 | Ga0207698_105227922 | 129 |
| 572 | 3300026142 | Ga0207698_10904180 | Ga0207698_109041801 | 129 |
| 573 | 3300027378 | Ga0209981_1000043 | Ga0209981_100004313 | 129 |
| 574 | 3300027543 | Ga0209999_1007077 | Ga0209999_10070772 | 129 |
| 575 | 3300027665 | Ga0209983_1050968 | Ga0209983_10509682 | 129 |
| 576 | 3300027866 | Ga0209813_10054754 | Ga0209813_100547543 | 129 |
| 577 | 3300027907 | Ga0207428_10007316 | Ga0207428_100073164 | 129 |
| 578 | 3300027907 | Ga0207428_10023296 | Ga0207428_100232965 | 129 |
| 579 | 3300027907 | Ga0207428_10156661 | Ga0207428_101566613 | 129 |
| 580 | 3300027907 | Ga0207428_10829115 | Ga0207428_108291151 | 129 |
| 581 | 3300028379 | Ga0268266_10000106 | Ga0268266_1000010622 | 129 |
| 582 | 3300028379 | Ga0268266_10000557 | Ga0268266_1000055726 | 129 |
| 583 | 3300028379 | Ga0268266_10233432 | Ga0268266_102334322 | 129 |
| 584 | 3300028379 | Ga0268266_11790024 | Ga0268266_117900241 | 129 |
| 585 | 3300028380 | Ga0268265_10004169 | Ga0268265_1000416917 | 129 |
| 586 | 3300028380 | Ga0268265_10052380 | Ga0268265_100523802 | 129 |
| 587 | 3300028380 | Ga0268265_10775640 | Ga0268265_107756402 | 129 |
| 588 | 3300028380 | Ga0268265_12266033 | Ga0268265_122660332 | 129 |
| 589 | 3300028381 | Ga0268264_10002325 | Ga0268264_1000232528 | 129 |
| 590 | 3300028381 | Ga0268264_10005719 | Ga0268264_1000571919 | 129 |
| 591 | 3300028381 | Ga0268264_10201865 | Ga0268264_102018652 | 129 |
| 592 | 3300028381 | Ga0268264_10349240 | Ga0268264_103492401 | 129 |
| 593 | 3300028563 | Ga0265319_1102853 | Ga0265319_11028532 | 129 |
| 594 | 3300028573 | Ga0265334_10127982 | Ga0265334_101279822 | 129 |
| 595 | 3300028577 | Ga0265318_10004788 | Ga0265318_1000478812 | 129 |
| 596 | 3300028666 | Ga0265336_10029236 | Ga0265336_100292362 | 129 |
| 597 | 3300028786 | Ga0307517_10012557 | Ga0307517_100125577 | 129 |
| 598 | 3300028794 | Ga0307515_10153824 | Ga0307515_101538244 | 129 |
| 599 | 3300028794 | Ga0307515_10173473 | Ga0307515_101734734 | 129 |
| 600 | 3300028800 | Ga0265338_10002896 | Ga0265338_1000289621 | 129 |
| 601 | 3300028800 | Ga0265338_10046965 | Ga0265338_100469652 | 129 |
| 602 | 3300028800 | Ga0265338_10096847 | Ga0265338_100968475 | 129 |
| 603 | 3300028800 | Ga0265338_10156776 | Ga0265338_101567762 | 129 |
| 604 | 3300028800 | Ga0265338_10170295 | Ga0265338_101702952 | 129 |
| 605 | 3300028800 | Ga0265338_10664129 | Ga0265338_106641292 | 129 |
| 606 | 3300028800 | Ga0265338_11063122 | Ga0265338_110631221 | 129 |
| 607 | 3300030878 | Ga0265770_1041356 | Ga0265770_10413562 | 129 |
| 608 | 3300031235 | Ga0265330_10077828 | Ga0265330_100778282 | 129 |
| 609 | 3300031238 | Ga0265332_10033404 | Ga0265332_100334042 | 129 |
| 610 | 3300031239 | Ga0265328_10157031 | Ga0265328_101570312 | 129 |
| 611 | 3300031239 | Ga0265328_10296701 | Ga0265328_102967011 | 129 |
| 612 | 3300031240 | Ga0265320_10057316 | Ga0265320_100573161 | 129 |
| 613 | 3300031240 | Ga0265320_10355914 | Ga0265320_103559142 | 129 |
| 614 | 3300031241 | Ga0265325_10008115 | Ga0265325_100081155 | 129 |
| 615 | 3300031241 | Ga0265325_10146029 | Ga0265325_101460292 | 129 |
| 616 | 3300031242 | Ga0265329_10051749 | Ga0265329_100517492 | 129 |
| 617 | 3300031249 | Ga0265339_10063241 | Ga0265339_100632413 | 129 |
| 618 | 3300031249 | Ga0265339_10205030 | Ga0265339_102050302 | 129 |
| 619 | 3300031250 | Ga0265331_10033733 | Ga0265331_100337334 | 129 |
| 620 | 3300031250 | Ga0265331_10035730 | Ga0265331_100357303 | 129 |
| 621 | 3300031250 | Ga0265331_10058532 | Ga0265331_100585321 | 129 |
| 622 | 3300031250 | Ga0265331_10063163 | Ga0265331_100631632 | 129 |
| 623 | 3300031344 | Ga0265316_10075091 | Ga0265316_100750913 | 129 |
| 624 | 3300031344 | Ga0265316_10100937 | Ga0265316_101009372 | 129 |
| 625 | 3300031344 | Ga0265316_10748816 | Ga0265316_107488162 | 129 |
| 626 | 3300031344 | Ga0265316_10886912 | Ga0265316_108869122 | 129 |
| 627 | 3300031456 | Ga0307513_10002446 | Ga0307513_1000244619 | 129 |
| 628 | 3300031456 | Ga0307513_10009092 | Ga0307513_100090926 | 129 |
| 629 | 3300031456 | Ga0307513_10285642 | Ga0307513_102856422 | 129 |
| 630 | 3300031456 | Ga0307513_10387495 | Ga0307513_103874952 | 129 |
| 631 | 3300031548 | Ga0307408_101933520 | Ga0307408_1019335201 | 129 |
| 632 | 3300031595 | Ga0265313_10006418 | Ga0265313_100064188 | 129 |
| 633 | 3300031595 | Ga0265313_10011787 | Ga0265313_100117872 | 129 |
| 634 | 3300031595 | Ga0265313_10081099 | Ga0265313_100810992 | 129 |
| 635 | 3300031595 | Ga0265313_10093517 | Ga0265313_100935172 | 129 |
| 636 | 3300031595 | Ga0265313_10197474 | Ga0265313_101974742 | 129 |
| 637 | 3300031595 | Ga0265313_10328556 | Ga0265313_103285562 | 129 |
| 638 | 3300031691 | Ga0316579_10545452 | Ga0316579_105454521 | 129 |
| 639 | 3300031711 | Ga0265314_10037136 | Ga0265314_100371364 | 129 |
| 640 | 3300031711 | Ga0265314_10049812 | Ga0265314_100498124 | 129 |
| 641 | 3300031711 | Ga0265314_10063782 | Ga0265314_100637822 | 129 |
| 642 | 3300031711 | Ga0265314_10081934 | Ga0265314_100819342 | 129 |
| 643 | 3300031711 | Ga0265314_10373438 | Ga0265314_103734381 | 129 |
| 644 | 3300031712 | Ga0265342_10063846 | Ga0265342_100638463 | 129 |
| 645 | 3300031712 | Ga0265342_10086286 | Ga0265342_100862863 | 129 |
| 646 | 3300031727 | Ga0316576_10011989 | Ga0316576_100119894 | 129 |
| 647 | 3300031728 | Ga0316578_10084150 | Ga0316578_100841503 | 129 |
| 648 | 3300031730 | Ga0307516_10001565 | Ga0307516_1000156520 | 129 |
| 649 | 3300031730 | Ga0307516_10104724 | Ga0307516_101047242 | 129 |
| 650 | 3300031731 | Ga0307405_10438305 | Ga0307405_104383052 | 129 |
| 651 | 3300031731 | Ga0307405_10942466 | Ga0307405_109424662 | 129 |
| 652 | 3300031733 | Ga0316577_10030400 | Ga0316577_100304003 | 129 |
| 653 | 3300031733 | Ga0316577_10663423 | Ga0316577_106634231 | 129 |
| 654 | 3300031824 | Ga0307413_10122230 | Ga0307413_101222302 | 129 |
| 655 | 3300031824 | Ga0307413_10485172 | Ga0307413_104851722 | 129 |
| 656 | 3300031852 | Ga0307410_11498005 | Ga0307410_114980051 | 129 |
| 657 | 3300031901 | Ga0307406_10327963 | Ga0307406_103279632 | 129 |
| 658 | 3300031911 | Ga0307412_11212886 | Ga0307412_112128862 | 129 |
| 659 | 3300031911 | Ga0307412_11396599 | Ga0307412_113965991 | 129 |
| 660 | 3300031911 | Ga0307412_11859440 | Ga0307412_118594401 | 129 |
| 661 | 3300031995 | Ga0307409_100035784 | Ga0307409_1000357843 | 129 |
| 662 | 3300031995 | Ga0307409_100050696 | Ga0307409_1000506963 | 129 |
| 663 | 3300031995 | Ga0307409_100573334 | Ga0307409_1005733342 | 129 |
| 664 | 3300032002 | Ga0307416_101912685 | Ga0307416_1019126852 | 129 |
| 665 | 3300032004 | Ga0307414_10097082 | Ga0307414_100970822 | 129 |
| 666 | 3300032004 | Ga0307414_10673833 | Ga0307414_106738332 | 129 |
| 667 | 3300032004 | Ga0307414_10877295 | Ga0307414_108772951 | 129 |
| 668 | 3300032005 | Ga0307411_10075136 | Ga0307411_100751364 | 129 |
| 669 | 3300032126 | Ga0307415_100169025 | Ga0307415_1001690252 | 129 |
| 670 | 3300033180 | Ga0307510_10028447 | Ga0307510_100284474 | 129 |
| 671 | 3300033180 | Ga0307510_10168985 | Ga0307510_101689852 | 129 |
| 672 | 3300033180 | Ga0307510_10348817 | Ga0307510_103488172 | 129 |
| 673 | 3300033180 | Ga0307510_10417455 | Ga0307510_104174551 | 129 |
| 674 | 3300033541 | Ga0316596_1001896 | Ga0316596_10018964 | 129 |
| 675 | 3300034818 | Ga0373950_0003924 | Ga0373950_0003924_149_553 | 129 |
| 676 | 3300034818 | Ga0373950_0098931 | Ga0373950_0098931_171_575 | 129 |
| 677 | 3300034819 | Ga0373958_0038915 | Ga0373958_0038915_213_617 | 129 |
| 678 | 3300034820 | Ga0373959_0073071 | Ga0373959_0073071_44_448 | 129 |
| 679 | 3300035084 | Ga0373928_0039569 | Ga0373928_0039569_191_580 | 129 |
| 680 | 3300035085 | Ga0373929_0131098 | Ga0373929_0131098_227_631 | 129 |
| 681 | 3300035088 | Ga0373940_0038650 | Ga0373940_0038650_584_988 | 129 |
| 682 | 3300035088 | Ga0373940_0075564 | Ga0373940_0075564_511_930 | 129 |
| 683 | 3300035090 | Ga0373949_0042118 | Ga0373949_0042118_510_914 | 129 |
| 684 | 3300035091 | Ga0373951_0041827 | Ga0373951_0041827_37_441 | 129 |
| 685 | 3300035092 | Ga0373952_0003002 | Ga0373952_0003002_1544_1948 | 129 |
| 686 | 3300035092 | Ga0373952_0011057 | Ga0373952_0011057_1117_1521 | 129 |
| 687 | 3300035113 | Ga0373936_0102330 | Ga0373936_0102330_583_972 | 129 |
| 688 | 3300035114 | Ga0373939_0010321 | Ga0373939_0010321_971_1375 | 129 |
| 689 | 3300035114 | Ga0373939_0052644 | Ga0373939_0052644_575_979 | 129 |
| 690 | 3300035115 | Ga0373941_0149178 | Ga0373941_0149178_85_489 | 129 |
| 691 | 3300035116 | Ga0373945_0233133 | Ga0373945_0233133_45_455 | 129 |
| 692 | 3300035116 | Ga0373945_0346528 | Ga0373945_0346528_20_427 | 129 |
| 693 | 3300035117 | Ga0373953_0007154 | Ga0373953_0007154_945_1349 | 129 |
| 694 | 3300035118 | Ga0373954_0129176 | Ga0373954_0129176_585_989 | 129 |
| 695 | 3300035119 | Ga0373956_0193735 | Ga0373956_0193735_261_668 | 129 |
| 696 | 3300035121 | Ga0373960_0014902 | Ga0373960_0014902_817_1221 | 129 |
| 697 | 3300035170 | Ga0373943_0260156 | Ga0373943_0260156_391_798 | 129 |
| 698 | 3300035172 | Ga0373955_0085689 | Ga0373955_0085689_472_876 | 129 |
| 699 | 3300035207 | Ga0373942_0014138 | Ga0373942_0014138_360_764 | 129 |
| 700 | 3300035207 | Ga0373942_0073387 | Ga0373942_0073387_490_894 | 129 |
| 701 | 3300035241 | Ga0373961_0008082 | Ga0373961_0008082_1693_2097 | 129 |
| 702 | 3300035241 | Ga0373961_0074440 | Ga0373961_0074440_448_852 | 129 |
| 703 | 3300035241 | Ga0373961_0183781 | Ga0373961_0183781_161_565 | 129 |
| 704 | 3300035242 | Ga0373962_0004031 | Ga0373962_0004031_1093_1497 | 129 |
| 705 | 3300035242 | Ga0373962_0012560 | Ga0373962_0012560_903_1307 | 129 |
| 706 | 3300035242 | Ga0373962_0261189 | Ga0373962_0261189_164_568 | 129 |
| 707 | 3300035398 | Ga0316574_0302208 | Ga0316574_0302208_368_763 | 129 |
| 708 | 3300035398 | Ga0316574_0581708 | Ga0316574_0581708_36_431 | 129 |
| 709 | 3300035691 | Ga0373931_0002939 | Ga0373931_0002939_2060_2464 | 129 |
| 710 | 3300035691 | Ga0373931_0005200 | Ga0373931_0005200_3569_3973 | 129 |
| 711 | 3300035691 | Ga0373931_0711394 | Ga0373931_0711394_170_559 | 129 |
| 712 | 3300035692 | Ga0373935_0136168 | Ga0373935_0136168_628_1017 | 129 |
| 713 | 3300035692 | Ga0373935_0690433 | Ga0373935_0690433_293_703 | 129 |
| 714 | 3300035695 | Ga0373927_0000479 | Ga0373927_0000479_16831_17220 | 129 |
| 715 | 3300035695 | Ga0373927_0162569 | Ga0373927_0162569_137_544 | 129 |
| 716 | 3300035695 | Ga0373927_0188819 | Ga0373927_0188819_753_1163 | 129 |
| 717 | 3300035724 | Ga0373933_0600353 | Ga0373933_0600353_236_625 | 129 |
| 718 | 3300035725 | Ga0373947_0052110 | Ga0373947_0052110_1441_1848 | 129 |
| 719 | 3300035725 | Ga0373947_0480313 | Ga0373947_0480313_185_592 | 129 |
| 720 | 3300035725 | Ga0373947_0515441 | Ga0373947_0515441_285_695 | 129 |
| 721 | 3300036401 | Ga0373937_0143345 | Ga0373937_0143345_1043_1447 | 129 |
| 722 | 3300036647 | Ga0316582_0065073 | Ga0316582_0065073_104_499 | 129 |
| 723 | 3300036712 | Ga0316584_0060375 | Ga0316584_0060375_342_737 | 129 |
| 724 | 3300037068 | Ga0373925_0000023 | Ga0373925_0000023_2926_3315 | 129 |
| 725 | 3300037068 | Ga0373925_0310107 | Ga0373925_0310107_205_594 | 129 |
| 726 | 3300037068 | Ga0373925_0557184 | Ga0373925_0557184_286_675 | 129 |
| 727 | 3300037068 | Ga0373925_1295228 | Ga0373925_1295228_19_408 | 129 |
| 728 | 3300037312 | Ga0395899_0004948 | Ga0395899_0004948_2773_3171 | 129 |
| 729 | 3300037312 | Ga0395899_0135860 | Ga0395899_0135860_424_825 | 129 |
| 730 | 3300037418 | Ga0395900_0054207 | Ga0395900_0054207_3591_3989 | 129 |
| 731 | 3300037418 | Ga0395900_0118387 | Ga0395900_0118387_659_1060 | 129 |
| 732 | 3300037418 | Ga0395900_0294566 | Ga0395900_0294566_973_1377 | 129 |
| 733 | 3300037466 | Ga0395898_0003055 | Ga0395898_0003055_9997_10395 | 129 |
| 734 | 3300037466 | Ga0395898_0086433 | Ga0395898_0086433_1758_2159 | 129 |
| 735 | 3300037466 | Ga0395898_0130907 | Ga0395898_0130907_851_1255 | 129 |
| 736 | 3300037466 | Ga0395898_0141060 | Ga0395898_0141060_972_1373 | 129 |
| 737 | 3300038443 | Ga0395901_0012391 | Ga0395901_0012391_6931_7329 | 129 |
| 738 | 3300038443 | Ga0395901_0250996 | Ga0395901_0250996_361_750 | 129 |
| 739 | 3300038443 | Ga0395901_0270554 | Ga0395901_0270554_1291_1695 | 129 |
| 740 | 3300038443 | Ga0395901_0493640 | Ga0395901_0493640_791_1192 | 129 |
| 741 | 3300038726 | Ga0400490_05556 | Ga0400490_05556_190_579 | 129 |
| 742 | 3300038735 | Ga0400485_18010 | Ga0400485_18010_181_570 | 129 |
| 743 | 3300038735 | Ga0400485_18067 | Ga0400485_18067_2691_3080 | 129 |
| 744 | 3300038741 | Ga0400488_60863 | Ga0400488_60863_827_1216 | 129 |
| 745 | 3300038742 | Ga0400486_19626 | Ga0400486_19626_1085_1474 | 129 |
| 746 | 3300038742 | Ga0400486_26804 | Ga0400486_26804_984_1373 | 129 |
| 747 | 3300039062 | Ga0400483_275193 | Ga0400483_275193_141_530 | 129 |
| 748 | 3300039437 | Ga0436365_0367003 | Ga0436365_0367003_955_1362 | 129 |
| 749 | 3300039437 | Ga0436365_1281228 | Ga0436365_1281228_1602_1991 | 129 |
| 750 | 3300039447 | Ga0436361_0953537 | Ga0436361_0953537_30481_30870 | 129 |
| 751 | 3300039450 | Ga0436363_0491191 | Ga0436363_0491191_273_662 | 129 |
| 752 | 3300039453 | Ga0436362_0512929 | Ga0436362_0512929_39_446 | 129 |
| 753 | 3300039453 | Ga0436362_0526223 | Ga0436362_0526223_82_489 | 129 |
| 754 | 3300041413 | Ga0439465_0041536 | Ga0439465_0041536_281_670 | 129 |
| 755 | 3300041413 | Ga0439465_0056207 | Ga0439465_0056207_15_422 | 129 |
| 756 | 3300041444 | Ga0451790_24623 | Ga0451790_24623_85_474 | 129 |
| 757 | 3300041453 | Ga0451797_1305445 | Ga0451797_1305445_517_906 | 129 |
| 758 | 3300041456 | Ga0451795_0820506 | Ga0451795_0820506_94_483 | 129 |
| 759 | 3300041459 | Ga0451800_0177595 | Ga0451800_0177595_80_481 | 129 |
| 760 | 3300041496 | Ga0451839_1312103 | Ga0451839_1312103_310_699 | 129 |
| 761 | 3300041502 | Ga0451846_63244 | Ga0451846_63244_152_541 | 129 |
| 762 | 3300041507 | Ga0451851_0517789 | Ga0451851_0517789_48_449 | 129 |
| 763 | 3300042005 | Ga0439448_0302565 | Ga0439448_0302565_140_544 | 129 |
| 764 | 3300042137 | Ga0450902_006870 | Ga0450902_006870_409_816 | 129 |
| 765 | 3300044656 | Ga0466969_0224559 | Ga0466969_0224559_144_533 | 129 |
| 766 | 3300044684 | Ga0466966_0067594 | Ga0466966_0067594_146_535 | 129 |
| 767 | 3300044694 | Ga0466963_0052778 | Ga0466963_0052778_1431_1820 | 129 |
| 768 | 3300044694 | Ga0466963_0274798 | Ga0466963_0274798_23_427 | 129 |
| 769 | 3300044712 | Ga0453684_0022894 | Ga0453684_0022894_6137_6532 | 129 |
| 770 | 3300044842 | Ga0466957_0042883 | Ga0466957_0042883_783_1172 | 129 |
| 771 | 3300044842 | Ga0466957_0176495 | Ga0466957_0176495_653_1057 | 129 |
| 772 | 3300044842 | Ga0466957_0337115 | Ga0466957_0337115_394_783 | 129 |
| 773 | 3300044901 | Ga0466960_0094316 | Ga0466960_0094316_413_802 | 129 |
| 774 | 3300045051 | Ga0451576_0003979 | Ga0451576_0003979_6611_7000 | 129 |
| 775 | 3300045836 | Ga0466958_0277112 | Ga0466958_0277112_167_571 | 129 |
| 776 | 3300045836 | Ga0466958_0418373 | Ga0466958_0418373_257_646 | 129 |
| 777 | 3300045976 | Ga0466967_0148237 | Ga0466967_0148237_1331_1735 | 129 |
| 778 | 3300045976 | Ga0466967_0928017 | Ga0466967_0928017_36_440 | 129 |
| 779 | 3300045976 | Ga0466967_1031331 | Ga0466967_1031331_137_526 | 129 |
| 780 | 3300046453 | Ga0495627_000399 | Ga0495627_000399_14540_14929 | 129 |
| 781 | 3300046459 | Ga0495629_0392276 | Ga0495629_0392276_343_753 | 129 |
| 782 | 3300046460 | Ga0495638_0247288 | Ga0495638_0247288_484_873 | 129 |
| 783 | 3300046460 | Ga0495638_0278505 | Ga0495638_0278505_29_418 | 129 |
| 784 | 3300046460 | Ga0495638_0451268 | Ga0495638_0451268_177_566 | 129 |
| 785 | 3300046460 | Ga0495638_0649888 | Ga0495638_0649888_55_444 | 129 |
| 786 | 3300046463 | Ga0495653_0606452 | Ga0495653_0606452_28_432 | 129 |
| 787 | 3300046474 | Ga0495605_0136067 | Ga0495605_0136067_353_742 | 129 |
| 788 | 3300046475 | Ga0495639_0574932 | Ga0495639_0574932_20_430 | 129 |
| 789 | 3300046491 | Ga0495584_0027432 | Ga0495584_0027432_1842_2246 | 129 |
| 790 | 3300046491 | Ga0495584_0233145 | Ga0495584_0233145_281_685 | 129 |
| 791 | 3300046506 | Ga0495583_0048649 | Ga0495583_0048649_562_951 | 129 |
| 792 | 3300046512 | Ga0495610_0307179 | Ga0495610_0307179_91_480 | 129 |
| 793 | 3300046516 | Ga0495628_0966317 | Ga0495628_0966317_158_562 | 129 |
| 794 | 3300046519 | Ga0495632_0083729 | Ga0495632_0083729_962_1351 | 129 |
| 795 | 3300046520 | Ga0495637_0367090 | Ga0495637_0367090_88_492 | 129 |
| 796 | 3300046524 | Ga0495648_0206971 | Ga0495648_0206971_194_583 | 129 |
| 797 | 3300046528 | Ga0495642_0075799 | Ga0495642_0075799_611_1000 | 129 |
| 798 | 3300046529 | Ga0495652_0050149 | Ga0495652_0050149_1529_1933 | 129 |
| 799 | 3300046533 | Ga0495640_0447182 | Ga0495640_0447182_78_482 | 129 |
| 800 | 3300046536 | Ga0495587_0740903 | Ga0495587_0740903_30_419 | 129 |
| 801 | 3300046538 | Ga0495609_0061486 | Ga0495609_0061486_427_816 | 129 |
| 802 | 3300046558 | Ga0495633_0000510 | Ga0495633_0000510_35340_35729 | 129 |
| 803 | 3300046558 | Ga0495633_0161794 | Ga0495633_0161794_309_698 | 129 |
| 804 | 3300046559 | Ga0495667_0103734 | Ga0495667_0103734_732_1136 | 129 |
| 805 | 3300046615 | Ga0495656_0523824 | Ga0495656_0523824_30_434 | 129 |
| 806 | 3300046648 | Ga0495611_0076340 | Ga0495611_0076340_852_1241 | 129 |
| 807 | 3300046660 | Ga0495625_0087377 | Ga0495625_0087377_708_1097 | 129 |
| 808 | 3300046664 | Ga0495659_0038300 | Ga0495659_0038300_1267_1671 | 129 |
| 809 | 3300046674 | Ga0495588_0504029 | Ga0495588_0504029_160_549 | 129 |
| 810 | 3300046680 | Ga0495646_0590075 | Ga0495646_0590075_141_548 | 129 |
| 811 | 3300046683 | Ga0495658_0291721 | Ga0495658_0291721_434_823 | 129 |
| 812 | 3300046684 | Ga0495669_0175551 | Ga0495669_0175551_529_918 | 129 |
| 813 | 3300046684 | Ga0495669_0185650 | Ga0495669_0185650_17_406 | 129 |
| 814 | 3300046692 | Ga0495671_0129761 | Ga0495671_0129761_295_684 | 129 |
| 815 | 3300046694 | Ga0495649_0050668 | Ga0495649_0050668_1004_1393 | 129 |
| 816 | 3300046794 | Ga0495589_0086629 | Ga0495589_0086629_137_526 | 129 |
| 817 | 3300047317 | Ga0495604_0027202 | Ga0495604_0027202_1014_1418 | 129 |
| 818 | 3300047317 | Ga0495604_0536468 | Ga0495604_0536468_317_724 | 129 |
| 819 | 3300047318 | Ga0495636_0052191 | Ga0495636_0052191_844_1233 | 129 |
| 820 | 3300047319 | Ga0495674_0802390 | Ga0495674_0802390_211_600 | 129 |
| 821 | 3300047323 | Ga0495683_0031924 | Ga0495683_0031924_1204_1593 | 129 |
| 822 | 3300047445 | Ga0495677_0143449 | Ga0495677_0143449_58_447 | 129 |
| 823 | 3300047446 | Ga0495679_017960 | Ga0495679_017960_641_1030 | 129 |
| 824 | 3300047446 | Ga0495679_195562 | Ga0495679_195562_57_446 | 129 |
| 825 | 3300047447 | Ga0495685_082832 | Ga0495685_082832_99_488 | 129 |
| 826 | 3300047469 | Ga0495673_0000189 | Ga0495673_0000189_87295_87684 | 129 |
| 827 | 3300047469 | Ga0495673_0158617 | Ga0495673_0158617_87_476 | 129 |
| 828 | 3300047471 | Ga0495684_0922227 | Ga0495684_0922227_49_456 | 129 |
| 829 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_322864_323265 | 129 |
| 830 | 3300048903 | Ga0496100_0093096 | Ga0496100_0093096_1284_1688 | 129 |
| 831 | 3300048903 | Ga0496100_0215715 | Ga0496100_0215715_255_659 | 129 |
| 832 | 3300048903 | Ga0496100_0436428 | Ga0496100_0436428_286_690 | 129 |
| 833 | 3300048904 | Ga0496101_0044118 | Ga0496101_0044118_1684_2094 | 129 |
| 834 | 3300048904 | Ga0496101_0122223 | Ga0496101_0122223_1131_1520 | 129 |
| 835 | 3300048904 | Ga0496101_0139715 | Ga0496101_0139715_373_777 | 129 |
| 836 | 3300048904 | Ga0496101_0150505 | Ga0496101_0150505_176_580 | 129 |
| 837 | 3300048905 | Ga0496102_0002642 | Ga0496102_0002642_14369_14773 | 129 |
| 838 | 3300048905 | Ga0496102_0015318 | Ga0496102_0015318_2446_2850 | 129 |
| 839 | 3300048905 | Ga0496102_0029392 | Ga0496102_0029392_1532_1921 | 129 |
| 840 | 3300048905 | Ga0496102_0318035 | Ga0496102_0318035_276_680 | 129 |
| 841 | 3300048905 | Ga0496102_0370286 | Ga0496102_0370286_35_439 | 129 |
| 842 | 3300048905 | Ga0496102_0455678 | Ga0496102_0455678_376_780 | 129 |
| 843 | 3300048906 | Ga0496103_0017034 | Ga0496103_0017034_458_862 | 129 |
| 844 | 3300048906 | Ga0496103_0035388 | Ga0496103_0035388_2015_2419 | 129 |
| 845 | 3300048906 | Ga0496103_0169394 | Ga0496103_0169394_570_959 | 129 |
| 846 | 3300048907 | Ga0496104_0051414 | Ga0496104_0051414_1857_2261 | 129 |
| 847 | 3300048907 | Ga0496104_0061755 | Ga0496104_0061755_2814_3218 | 129 |
| 848 | 3300048907 | Ga0496104_0087155 | Ga0496104_0087155_1024_1434 | 129 |
| 849 | 3300048907 | Ga0496104_0609717 | Ga0496104_0609717_99_503 | 129 |
| 850 | 3300048907 | Ga0496104_0932809 | Ga0496104_0932809_257_646 | 129 |
| 851 | 3300048908 | Ga0496105_0038459 | Ga0496105_0038459_1180_1584 | 129 |
| 852 | 3300048908 | Ga0496105_0098467 | Ga0496105_0098467_1666_2070 | 129 |
| 853 | 3300048909 | Ga0496106_0002278 | Ga0496106_0002278_861_1265 | 129 |
| 854 | 3300048909 | Ga0496106_0004608 | Ga0496106_0004608_1419_1823 | 129 |
| 855 | 3300048909 | Ga0496106_0384857 | Ga0496106_0384857_709_1113 | 129 |
| 856 | 3300048910 | Ga0496107_0018263 | Ga0496107_0018263_2523_2927 | 129 |
| 857 | 3300048910 | Ga0496107_0098093 | Ga0496107_0098093_615_1019 | 129 |
| 858 | 3300048910 | Ga0496107_0366440 | Ga0496107_0366440_528_935 | 129 |
| 859 | 3300048910 | Ga0496107_0678626 | Ga0496107_0678626_228_617 | 129 |
| 860 | 3300048910 | Ga0496107_0743478 | Ga0496107_0743478_238_645 | 129 |
| 861 | 3300048911 | Ga0496108_0010640 | Ga0496108_0010640_2309_2719 | 129 |
| 862 | 3300048911 | Ga0496108_0100742 | Ga0496108_0100742_1531_1935 | 129 |
| 863 | 3300048911 | Ga0496108_0160553 | Ga0496108_0160553_462_869 | 129 |
| 864 | 3300048912 | Ga0496109_0095451 | Ga0496109_0095451_1418_1807 | 129 |
| 865 | 3300048912 | Ga0496109_0139689 | Ga0496109_0139689_1739_2143 | 129 |
| 866 | 3300048912 | Ga0496109_0223543 | Ga0496109_0223543_568_972 | 129 |
| 867 | 3300048913 | Ga0496110_0018375 | Ga0496110_0018375_3546_3953 | 129 |
| 868 | 3300048913 | Ga0496110_1106175 | Ga0496110_1106175_212_601 | 129 |
| 869 | 3300048914 | Ga0496111_0267272 | Ga0496111_0267272_186_590 | 129 |
| 870 | 3300048914 | Ga0496111_0480506 | Ga0496111_0480506_127_516 | 129 |
| 871 | 3300048915 | Ga0496112_0043241 | Ga0496112_0043241_1449_1838 | 129 |
| 872 | 3300048915 | Ga0496112_0077705 | Ga0496112_0077705_1881_2288 | 129 |
| 873 | 3300048915 | Ga0496112_0400670 | Ga0496112_0400670_226_630 | 129 |
| 874 | 3300048915 | Ga0496112_1692895 | Ga0496112_1692895_83_493 | 129 |
| 875 | 3300048916 | Ga0496113_0464420 | Ga0496113_0464420_451_858 | 129 |
| 876 | 3300048916 | Ga0496113_0990499 | Ga0496113_0990499_237_647 | 129 |
| 877 | 3300048916 | Ga0496113_1518333 | Ga0496113_1518333_11_415 | 129 |
| 878 | 3300048917 | Ga0496114_0148509 | Ga0496114_0148509_253_657 | 129 |
| 879 | 3300048917 | Ga0496114_0389759 | Ga0496114_0389759_495_899 | 129 |
| 880 | 3300048917 | Ga0496114_0765310 | Ga0496114_0765310_61_450 | 129 |
| 881 | 3300048918 | Ga0496115_0001049 | Ga0496115_0001049_7973_8362 | 129 |
| 882 | 3300048918 | Ga0496115_0001671 | Ga0496115_0001671_180_584 | 129 |
| 883 | 3300048918 | Ga0496115_0003309 | Ga0496115_0003309_904_1293 | 129 |
| 884 | 3300048918 | Ga0496115_0017590 | Ga0496115_0017590_921_1325 | 129 |
| 885 | 3300048918 | Ga0496115_0032794 | Ga0496115_0032794_2200_2610 | 129 |
| 886 | 3300048918 | Ga0496115_0098395 | Ga0496115_0098395_1818_2207 | 129 |
| 887 | 3300048919 | Ga0496116_0078632 | Ga0496116_0078632_1600_1989 | 129 |
| 888 | 3300048924 | Ga0496121_0006108 | Ga0496121_0006108_1262_1669 | 129 |
| 889 | 3300048925 | Ga0496122_0035977 | Ga0496122_0035977_1802_2191 | 129 |
| 890 | 3300048926 | Ga0496123_0000699 | Ga0496123_0000699_4663_5052 | 129 |
| 891 | 3300048927 | Ga0496124_0119515 | Ga0496124_0119515_614_1021 | 129 |
| 892 | 3300048927 | Ga0496124_0387394 | Ga0496124_0387394_446_835 | 129 |
| 893 | 3300048927 | Ga0496124_0933360 | Ga0496124_0933360_73_462 | 129 |
| 894 | 3300048928 | Ga0496125_0011137 | Ga0496125_0011137_4837_5226 | 129 |
| 895 | 3300048929 | Ga0496126_0031566 | Ga0496126_0031566_880_1281 | 129 |
| 896 | 3300048929 | Ga0496126_0680280 | Ga0496126_0680280_132_536 | 129 |
| 897 | 3300048929 | Ga0496126_0685237 | Ga0496126_0685237_310_699 | 129 |
| 898 | 3300048929 | Ga0496126_0913724 | Ga0496126_0913724_78_482 | 129 |
| 899 | 3300049128 | Ga0501308_027199 | Ga0501308_027199_298_687 | 129 |
| 900 | 3300049130 | Ga0501310_068948 | Ga0501310_068948_78_467 | 129 |
| 901 | 3300049131 | Ga0501341_00973 | Ga0501341_00973_891_1280 | 129 |
| 902 | 3300049162 | Ga0501307_005363 | Ga0501307_005363_794_1183 | 129 |
| 903 | 3300049459 | Ga0495678_005745 | Ga0495678_005745_5206_5595 | 129 |
| 904 | 3300049527 | Ga0501311_001594 | Ga0501311_001594_1243_1647 | 129 |
| 905 | 3300049527 | Ga0501311_004336 | Ga0501311_004336_434_823 | 129 |
| 906 | 3300049531 | Ga0501315_018380 | Ga0501315_018380_467_856 | 129 |
| 907 | 3300049534 | Ga0501318_005621 | Ga0501318_005621_422_811 | 129 |
| 908 | 3300049535 | Ga0501319_000156 | Ga0501319_000156_575_964 | 129 |
| 909 | 3300049539 | Ga0501323_008595 | Ga0501323_008595_33_422 | 129 |
| 910 | 3300049539 | Ga0501323_011490 | Ga0501323_011490_215_604 | 129 |
| 911 | 3300049539 | Ga0501323_070165 | Ga0501323_070165_66_455 | 129 |
| 912 | 3300049568 | Ga0501031_0122081 | Ga0501031_0122081_1112_1513 | 129 |
| 913 | 3300049569 | Ga0501032_0289863 | Ga0501032_0289863_253_654 | 129 |
| 914 | 3300049569 | Ga0501032_0328982 | Ga0501032_0328982_458_859 | 129 |
| 915 | 3300049569 | Ga0501032_0511585 | Ga0501032_0511585_349_750 | 129 |
| 916 | 3300049569 | Ga0501032_0669897 | Ga0501032_0669897_125_523 | 129 |
| 917 | 3300049570 | Ga0501033_0012917 | Ga0501033_0012917_5823_6221 | 129 |
| 918 | 3300049570 | Ga0501033_0082082 | Ga0501033_0082082_211_609 | 129 |
| 919 | 3300049570 | Ga0501033_0094343 | Ga0501033_0094343_186_590 | 129 |
| 920 | 3300049570 | Ga0501033_0129530 | Ga0501033_0129530_136_534 | 129 |
| 921 | 3300049570 | Ga0501033_0226014 | Ga0501033_0226014_82_483 | 129 |
| 922 | 3300049570 | Ga0501033_0270110 | Ga0501033_0270110_444_845 | 129 |
| 923 | 3300049570 | Ga0501033_0515904 | Ga0501033_0515904_301_705 | 129 |
| 924 | 3300049570 | Ga0501033_0571565 | Ga0501033_0571565_259_660 | 129 |
| 925 | 3300049570 | Ga0501033_0922255 | Ga0501033_0922255_162_566 | 129 |
| 926 | 3300049571 | Ga0501034_0000208 | Ga0501034_0000208_29434_29832 | 129 |
| 927 | 3300049571 | Ga0501034_0009460 | Ga0501034_0009460_8344_8745 | 129 |
| 928 | 3300049571 | Ga0501034_0123530 | Ga0501034_0123530_1522_1923 | 129 |
| 929 | 3300049571 | Ga0501034_0181982 | Ga0501034_0181982_1178_1567 | 129 |
| 930 | 3300049571 | Ga0501034_0202292 | Ga0501034_0202292_1007_1405 | 129 |
| 931 | 3300049571 | Ga0501034_0213528 | Ga0501034_0213528_1269_1670 | 129 |
| 932 | 3300049571 | Ga0501034_0357812 | Ga0501034_0357812_853_1260 | 129 |
| 933 | 3300049571 | Ga0501034_0442181 | Ga0501034_0442181_562_963 | 129 |
| 934 | 3300049571 | Ga0501034_0598496 | Ga0501034_0598496_487_876 | 129 |
| 935 | 3300049571 | Ga0501034_0606783 | Ga0501034_0606783_183_590 | 129 |
| 936 | 3300049571 | Ga0501034_0643494 | Ga0501034_0643494_27_428 | 129 |
| 937 | 3300049571 | Ga0501034_1619741 | Ga0501034_1619741_29_418 | 129 |
| 938 | 3300049572 | Ga0501036_0072449 | Ga0501036_0072449_710_1108 | 129 |
| 939 | 3300049572 | Ga0501036_0076785 | Ga0501036_0076785_591_992 | 129 |
| 940 | 3300049572 | Ga0501036_0401367 | Ga0501036_0401367_618_1013 | 129 |
| 941 | 3300049572 | Ga0501036_0437121 | Ga0501036_0437121_513_911 | 129 |
| 942 | 3300049572 | Ga0501036_0450143 | Ga0501036_0450143_230_631 | 129 |
| 943 | 3300049572 | Ga0501036_0599766 | Ga0501036_0599766_166_567 | 129 |
| 944 | 3300049572 | Ga0501036_0708953 | Ga0501036_0708953_401_799 | 129 |
| 945 | 3300049572 | Ga0501036_0806694 | Ga0501036_0806694_215_604 | 129 |
| 946 | 3300049572 | Ga0501036_1141308 | Ga0501036_1141308_129_518 | 129 |
| 947 | 3300049572 | Ga0501036_1433706 | Ga0501036_1433706_118_519 | 129 |
| 948 | 3300049573 | Ga0501037_0005168 | Ga0501037_0005168_4189_4587 | 129 |
| 949 | 3300049573 | Ga0501037_0418622 | Ga0501037_0418622_383_784 | 129 |
| 950 | 3300049573 | Ga0501037_0684765 | Ga0501037_0684765_125_523 | 129 |
| 951 | 3300049574 | Ga0501038_0009962 | Ga0501038_0009962_7557_7955 | 129 |
| 952 | 3300049574 | Ga0501038_0269357 | Ga0501038_0269357_581_979 | 129 |
| 953 | 3300049574 | Ga0501038_0485697 | Ga0501038_0485697_526_927 | 129 |
| 954 | 3300049574 | Ga0501038_0525631 | Ga0501038_0525631_274_663 | 129 |
| 955 | 3300049574 | Ga0501038_0636953 | Ga0501038_0636953_110_511 | 129 |
| 956 | 3300049574 | Ga0501038_0661597 | Ga0501038_0661597_143_544 | 129 |
| 957 | 3300049574 | Ga0501038_0732930 | Ga0501038_0732930_145_534 | 129 |
| 958 | 3300049575 | Ga0501039_0000072 | Ga0501039_0000072_60601_60999 | 129 |
| 959 | 3300049575 | Ga0501039_0166307 | Ga0501039_0166307_361_762 | 129 |
| 960 | 3300049575 | Ga0501039_0450135 | Ga0501039_0450135_182_583 | 129 |
| 961 | 3300049575 | Ga0501039_0547576 | Ga0501039_0547576_31_432 | 129 |
| 962 | 3300049575 | Ga0501039_0613820 | Ga0501039_0613820_129_533 | 129 |
| 963 | 3300049575 | Ga0501039_0681252 | Ga0501039_0681252_132_521 | 129 |
| 964 | 3300049575 | Ga0501039_0769915 | Ga0501039_0769915_190_591 | 129 |
| 965 | 3300049575 | Ga0501039_1145568 | Ga0501039_1145568_152_553 | 129 |
| 966 | 3300049576 | Ga0501040_0378603 | Ga0501040_0378603_392_793 | 129 |
| 967 | 3300049576 | Ga0501040_0550938 | Ga0501040_0550938_395_796 | 129 |
| 968 | 3300049576 | Ga0501040_0655701 | Ga0501040_0655701_185_574 | 129 |
| 969 | 3300049577 | Ga0501041_0118391 | Ga0501041_0118391_257_661 | 129 |
| 970 | 3300049577 | Ga0501041_0509396 | Ga0501041_0509396_288_677 | 129 |
| 971 | 3300049578 | Ga0501042_0447496 | Ga0501042_0447496_406_807 | 129 |
| 972 | 3300049578 | Ga0501042_0768679 | Ga0501042_0768679_127_528 | 129 |
| 973 | 3300049578 | Ga0501042_1000071 | Ga0501042_1000071_100_489 | 129 |
| 974 | 3300049578 | Ga0501042_1088683 | Ga0501042_1088683_147_545 | 129 |
| 975 | 3300049579 | Ga0501043_0172568 | Ga0501043_0172568_362_766 | 129 |
| 976 | 3300049579 | Ga0501043_0411029 | Ga0501043_0411029_346_747 | 129 |
| 977 | 3300049579 | Ga0501043_0538625 | Ga0501043_0538625_186_584 | 129 |
| 978 | 3300049579 | Ga0501043_0651224 | Ga0501043_0651224_328_729 | 129 |
| 979 | 3300049579 | Ga0501043_0987574 | Ga0501043_0987574_35_439 | 129 |
| 980 | 3300049579 | Ga0501043_0990134 | Ga0501043_0990134_38_436 | 129 |
| 981 | 3300049580 | Ga0501046_0000045 | Ga0501046_0000045_13888_14289 | 129 |
| 982 | 3300049580 | Ga0501046_0004977 | Ga0501046_0004977_10309_10710 | 129 |
| 983 | 3300049580 | Ga0501046_0016665 | Ga0501046_0016665_5016_5414 | 129 |
| 984 | 3300049580 | Ga0501046_0021690 | Ga0501046_0021690_4046_4447 | 129 |
| 985 | 3300049580 | Ga0501046_0171333 | Ga0501046_0171333_283_684 | 129 |
| 986 | 3300049580 | Ga0501046_0180748 | Ga0501046_0180748_927_1331 | 129 |
| 987 | 3300049580 | Ga0501046_0313286 | Ga0501046_0313286_303_701 | 129 |
| 988 | 3300049580 | Ga0501046_0333543 | Ga0501046_0333543_551_955 | 129 |
| 989 | 3300049581 | Ga0501047_0001212 | Ga0501047_0001212_9426_9824 | 129 |
| 990 | 3300049581 | Ga0501047_0014860 | Ga0501047_0014860_1829_2230 | 129 |
| 991 | 3300049581 | Ga0501047_0046064 | Ga0501047_0046064_228_629 | 129 |
| 992 | 3300049581 | Ga0501047_0334586 | Ga0501047_0334586_916_1305 | 129 |
| 993 | 3300049581 | Ga0501047_0538509 | Ga0501047_0538509_539_937 | 129 |
| 994 | 3300049581 | Ga0501047_1019154 | Ga0501047_1019154_168_572 | 129 |
| 995 | 3300049581 | Ga0501047_1069360 | Ga0501047_1069360_186_575 | 129 |
| 996 | 3300049582 | Ga0501048_0000501 | Ga0501048_0000501_6162_6560 | 129 |
| 997 | 3300049582 | Ga0501048_0082989 | Ga0501048_0082989_1591_1992 | 129 |
| 998 | 3300049582 | Ga0501048_0312882 | Ga0501048_0312882_370_759 | 129 |
| 999 | 3300049583 | Ga0501067_0001102 | Ga0501067_0001102_9244_9642 | 129 |
| 1000 | 3300049583 | Ga0501067_0008019 | Ga0501067_0008019_4525_4914 | 129 |
| 1001 | 3300049583 | Ga0501067_0073295 | Ga0501067_0073295_274_675 | 129 |
| 1002 | 3300049583 | Ga0501067_0124203 | Ga0501067_0124203_897_1298 | 129 |
| 1003 | 3300049583 | Ga0501067_0283029 | Ga0501067_0283029_455_859 | 129 |
| 1004 | 3300049583 | Ga0501067_0311891 | Ga0501067_0311891_384_785 | 129 |
| 1005 | 3300049584 | Ga0501068_0251126 | Ga0501068_0251126_716_1105 | 129 |
| 1006 | 3300049584 | Ga0501068_0532634 | Ga0501068_0532634_221_622 | 129 |
| 1007 | 3300049585 | Ga0501069_0071224 | Ga0501069_0071224_1139_1540 | 129 |
| 1008 | 3300049585 | Ga0501069_0132004 | Ga0501069_0132004_803_1192 | 129 |
| 1009 | 3300049585 | Ga0501069_0175997 | Ga0501069_0175997_704_1108 | 129 |
| 1010 | 3300049585 | Ga0501069_0468363 | Ga0501069_0468363_44_451 | 129 |
| 1011 | 3300049586 | Ga0501070_0016943 | Ga0501070_0016943_4896_5294 | 129 |
| 1012 | 3300049586 | Ga0501070_0160366 | Ga0501070_0160366_1123_1512 | 129 |
| 1013 | 3300049586 | Ga0501070_0390283 | Ga0501070_0390283_313_714 | 129 |
| 1014 | 3300049586 | Ga0501070_0432667 | Ga0501070_0432667_358_759 | 129 |
| 1015 | 3300049586 | Ga0501070_0462200 | Ga0501070_0462200_334_729 | 129 |
| 1016 | 3300049586 | Ga0501070_0547289 | Ga0501070_0547289_70_471 | 129 |
| 1017 | 3300049586 | Ga0501070_0603528 | Ga0501070_0603528_64_465 | 129 |
| 1018 | 3300049586 | Ga0501070_0798815 | Ga0501070_0798815_215_619 | 129 |
| 1019 | 3300049586 | Ga0501070_0919529 | Ga0501070_0919529_184_585 | 129 |
| 1020 | 3300049587 | Ga0501071_0034272 | Ga0501071_0034272_947_1348 | 129 |
| 1021 | 3300049587 | Ga0501071_0436307 | Ga0501071_0436307_300_689 | 129 |
| 1022 | 3300049587 | Ga0501071_0638969 | Ga0501071_0638969_286_690 | 129 |
| 1023 | 3300049587 | Ga0501071_1171802 | Ga0501071_1171802_187_582 | 129 |
| 1024 | 3300049587 | Ga0501071_1248804 | Ga0501071_1248804_80_469 | 129 |
| 1025 | 3300049588 | Ga0501072_0147528 | Ga0501072_0147528_1265_1666 | 129 |
| 1026 | 3300049588 | Ga0501072_0163516 | Ga0501072_0163516_719_1120 | 129 |
| 1027 | 3300049588 | Ga0501072_0208507 | Ga0501072_0208507_194_595 | 129 |
| 1028 | 3300049588 | Ga0501072_0482486 | Ga0501072_0482486_534_923 | 129 |
| 1029 | 3300049588 | Ga0501072_0526950 | Ga0501072_0526950_58_465 | 129 |
| 1030 | 3300049588 | Ga0501072_1150109 | Ga0501072_1150109_55_465 | 129 |
| 1031 | 3300049588 | Ga0501072_1525348 | Ga0501072_1525348_41_448 | 129 |
| 1032 | 3300049589 | Ga0501073_0024093 | Ga0501073_0024093_3153_3542 | 129 |
| 1033 | 3300049589 | Ga0501073_0029749 | Ga0501073_0029749_3236_3637 | 129 |
| 1034 | 3300049589 | Ga0501073_0076482 | Ga0501073_0076482_1625_2023 | 129 |
| 1035 | 3300049589 | Ga0501073_0350204 | Ga0501073_0350204_16_417 | 129 |
| 1036 | 3300049589 | Ga0501073_0429999 | Ga0501073_0429999_11_412 | 129 |
| 1037 | 3300049589 | Ga0501073_0586976 | Ga0501073_0586976_17_418 | 129 |
| 1038 | 3300049589 | Ga0501073_0875787 | Ga0501073_0875787_174_578 | 129 |
| 1039 | 3300049590 | Ga0501074_0012386 | Ga0501074_0012386_4861_5262 | 129 |
| 1040 | 3300049590 | Ga0501074_0261439 | Ga0501074_0261439_359_748 | 129 |
| 1041 | 3300049590 | Ga0501074_0467707 | Ga0501074_0467707_76_480 | 129 |
| 1042 | 3300049590 | Ga0501074_0583602 | Ga0501074_0583602_252_656 | 129 |
| 1043 | 3300049590 | Ga0501074_0742033 | Ga0501074_0742033_268_672 | 129 |
| 1044 | 3300049591 | Ga0501075_0062889 | Ga0501075_0062889_1197_1598 | 129 |
| 1045 | 3300049591 | Ga0501075_0178154 | Ga0501075_0178154_124_525 | 129 |
| 1046 | 3300049591 | Ga0501075_0244635 | Ga0501075_0244635_683_1084 | 129 |
| 1047 | 3300049591 | Ga0501075_1269028 | Ga0501075_1269028_49_438 | 129 |
| 1048 | 3300049592 | Ga0501076_0217802 | Ga0501076_0217802_522_923 | 129 |
| 1049 | 3300049592 | Ga0501076_0368912 | Ga0501076_0368912_46_438 | 129 |
| 1050 | 3300049592 | Ga0501076_0571613 | Ga0501076_0571613_18_422 | 129 |
| 1051 | 3300049592 | Ga0501076_0606309 | Ga0501076_0606309_348_737 | 129 |
| 1052 | 3300049592 | Ga0501076_1397253 | Ga0501076_1397253_50_460 | 129 |
| 1053 | 3300049593 | Ga0501077_0007051 | Ga0501077_0007051_479_880 | 129 |
| 1054 | 3300049593 | Ga0501077_0067662 | Ga0501077_0067662_233_634 | 129 |
| 1055 | 3300049593 | Ga0501077_0072576 | Ga0501077_0072576_1528_1917 | 129 |
| 1056 | 3300049593 | Ga0501077_0334534 | Ga0501077_0334534_498_902 | 129 |
| 1057 | 3300049593 | Ga0501077_0609326 | Ga0501077_0609326_196_597 | 129 |
| 1058 | 3300049593 | Ga0501077_0695917 | Ga0501077_0695917_99_506 | 129 |
| 1059 | 3300049671 | Ga0501238_001704 | Ga0501238_001704_509_898 | 129 |
| 1060 | 3300049741 | Ga0501079_0022217 | Ga0501079_0022217_3220_3621 | 129 |
| 1061 | 3300049741 | Ga0501079_0085229 | Ga0501079_0085229_710_1114 | 129 |
| 1062 | 3300049741 | Ga0501079_0757933 | Ga0501079_0757933_61_465 | 129 |
| 1063 | 3300049741 | Ga0501079_0782294 | Ga0501079_0782294_264_665 | 129 |
| 1064 | 3300049742 | Ga0501080_0000005 | Ga0501080_0000005_153758_154156 | 129 |
| 1065 | 3300049742 | Ga0501080_0010846 | Ga0501080_0010846_7152_7553 | 129 |
| 1066 | 3300049742 | Ga0501080_0188525 | Ga0501080_0188525_558_959 | 129 |
| 1067 | 3300049742 | Ga0501080_0615338 | Ga0501080_0615338_80_481 | 129 |
| 1068 | 3300049743 | Ga0501081_0042743 | Ga0501081_0042743_984_1388 | 129 |
| 1069 | 3300049743 | Ga0501081_0113773 | Ga0501081_0113773_715_1116 | 129 |
| 1070 | 3300049743 | Ga0501081_0433895 | Ga0501081_0433895_35_439 | 129 |
| 1071 | 3300049743 | Ga0501081_0935444 | Ga0501081_0935444_49_438 | 129 |
| 1072 | 3300049743 | Ga0501081_1054618 | Ga0501081_1054618_80_484 | 129 |
| 1073 | 3300049744 | Ga0501083_0114508 | Ga0501083_0114508_546_947 | 129 |
| 1074 | 3300049744 | Ga0501083_0225221 | Ga0501083_0225221_781_1182 | 129 |
| 1075 | 3300049744 | Ga0501083_1087282 | Ga0501083_1087282_33_422 | 129 |
| 1076 | 3300049822 | Ga0501035_0000049 | Ga0501035_0000049_32902_33300 | 129 |
| 1077 | 3300049822 | Ga0501035_0030043 | Ga0501035_0030043_4405_4803 | 129 |
| 1078 | 3300049822 | Ga0501035_0113525 | Ga0501035_0113525_575_979 | 129 |
| 1079 | 3300049822 | Ga0501035_0351623 | Ga0501035_0351623_827_1216 | 129 |
| 1080 | 3300049822 | Ga0501035_0415470 | Ga0501035_0415470_682_1083 | 129 |
| 1081 | 3300049822 | Ga0501035_0696089 | Ga0501035_0696089_94_495 | 129 |
| 1082 | 3300049822 | Ga0501035_0804700 | Ga0501035_0804700_140_538 | 129 |
| 1083 | 3300049823 | Ga0501044_0000030 | Ga0501044_0000030_60662_61060 | 129 |
| 1084 | 3300049823 | Ga0501044_0027898 | Ga0501044_0027898_4909_5310 | 129 |
| 1085 | 3300049823 | Ga0501044_0237864 | Ga0501044_0237864_312_713 | 129 |
| 1086 | 3300049823 | Ga0501044_0272626 | Ga0501044_0272626_841_1230 | 129 |
| 1087 | 3300049823 | Ga0501044_0321454 | Ga0501044_0321454_210_611 | 129 |
| 1088 | 3300049823 | Ga0501044_0419727 | Ga0501044_0419727_150_539 | 129 |
| 1089 | 3300049823 | Ga0501044_0462733 | Ga0501044_0462733_147_545 | 129 |
| 1090 | 3300049823 | Ga0501044_0469605 | Ga0501044_0469605_680_1069 | 129 |
| 1091 | 3300049823 | Ga0501044_0666789 | Ga0501044_0666789_402_791 | 129 |
| 1092 | 3300049823 | Ga0501044_0793535 | Ga0501044_0793535_88_489 | 129 |
| 1093 | 3300049824 | Ga0501045_0026586 | Ga0501045_0026586_161_562 | 129 |
| 1094 | 3300049824 | Ga0501045_0110710 | Ga0501045_0110710_525_923 | 129 |
| 1095 | 3300049824 | Ga0501045_0388511 | Ga0501045_0388511_409_810 | 129 |
| 1096 | 3300049824 | Ga0501045_0462869 | Ga0501045_0462869_251_655 | 129 |
| 1097 | 3300049824 | Ga0501045_0610950 | Ga0501045_0610950_291_698 | 129 |
| 1098 | 3300050492 | nmdc:mga0yw44_205378_c1 | nmdc:mga0yw44_205378_c1_735_1124 | 129 |
| 1099 | 3300050492 | nmdc:mga0yw44_319256_c1 | nmdc:mga0yw44_319256_c1_32_433 | 129 |
| 1100 | 3300050493 | nmdc:mga0k408_36414_c1 | nmdc:mga0k408_36414_c1_1801_2190 | 129 |
| 1101 | 3300050494 | nmdc:mga06z11_14438_c1 | nmdc:mga06z11_14438_c1_177_566 | 129 |
| 1102 | 3300050495 | nmdc:mga04h51_2833_c1 | nmdc:mga04h51_2833_c1_152_541 | 129 |
| 1103 | 3300050496 | nmdc:mga07m45_231865_c1 | nmdc:mga07m45_231865_c1_540_929 | 129 |
| 1104 | 3300050507 | nmdc:mga05p37_1596261_c1 | nmdc:mga05p37_1596261_c1_123_527 | 129 |
| 1105 | 3300050507 | nmdc:mga05p37_172193_c1 | nmdc:mga05p37_172193_c1_468_872 | 129 |
| 1106 | 3300050507 | nmdc:mga05p37_236239_c1 | nmdc:mga05p37_236239_c1_1424_1828 | 129 |
| 1107 | 3300050507 | nmdc:mga05p37_317241_c1 | nmdc:mga05p37_317241_c1_1363_1767 | 129 |
| 1108 | 3300050507 | nmdc:mga05p37_56603_c1 | nmdc:mga05p37_56603_c1_3670_4074 | 129 |
| 1109 | 3300050507 | nmdc:mga05p37_780216_c1 | nmdc:mga05p37_780216_c1_555_959 | 129 |
| 1110 | 3300050508 | nmdc:mga09592_165761_c1 | nmdc:mga09592_165761_c1_1472_1876 | 129 |
| 1111 | 3300050509 | nmdc:mga0qj67_186404_c1 | nmdc:mga0qj67_186404_c1_404_808 | 129 |
| 1112 | 3300050509 | nmdc:mga0qj67_4050_c1 | nmdc:mga0qj67_4050_c1_7796_8200 | 129 |
| 1113 | 3300050510 | nmdc:mga06r32_385104_c1 | nmdc:mga06r32_385104_c1_398_802 | 129 |
| 1114 | 3300050510 | nmdc:mga06r32_650083_c1 | nmdc:mga06r32_650083_c1_201_605 | 129 |
| 1115 | 3300050510 | nmdc:mga06r32_671829_c1 | nmdc:mga06r32_671829_c1_308_712 | 129 |
| 1116 | 3300050511 | nmdc:mga08y16_1220500_c1 | nmdc:mga08y16_1220500_c1_293_697 | 129 |
| 1117 | 3300050511 | nmdc:mga08y16_174191_c1 | nmdc:mga08y16_174191_c1_1009_1413 | 129 |
| 1118 | 3300050511 | nmdc:mga08y16_29815_c1 | nmdc:mga08y16_29815_c1_673_1077 | 129 |
| 1119 | 3300050511 | nmdc:mga08y16_31334_c1 | nmdc:mga08y16_31334_c1_4929_5330 | 129 |
| 1120 | 3300050511 | nmdc:mga08y16_45619_c1 | nmdc:mga08y16_45619_c1_3838_4242 | 129 |
| 1121 | 3300050511 | nmdc:mga08y16_867444_c1 | nmdc:mga08y16_867444_c1_43_447 | 129 |
| 1122 | 3300050512 | nmdc:mga0n895_173736_c1 | nmdc:mga0n895_173736_c1_1693_2100 | 129 |
| 1123 | 3300050512 | nmdc:mga0n895_2833_c1 | nmdc:mga0n895_2833_c1_12360_12764 | 129 |
| 1124 | 3300050512 | nmdc:mga0n895_400566_c1 | nmdc:mga0n895_400566_c1_757_1161 | 129 |
| 1125 | 3300050513 | nmdc:mga0rr50_38822_c1 | nmdc:mga0rr50_38822_c1_829_1236 | 129 |
| 1126 | 3300050513 | nmdc:mga0rr50_970250_c1 | nmdc:mga0rr50_970250_c1_13_420 | 129 |
| 1127 | 3300050514 | nmdc:mga08x19_522658_c1 | nmdc:mga08x19_522658_c1_240_647 | 129 |
| 1128 | 3300050515 | nmdc:mga0a205_2479_c1 | nmdc:mga0a205_2479_c1_15137_15541 | 129 |
| 1129 | 3300050515 | nmdc:mga0a205_396682_c1 | nmdc:mga0a205_396682_c1_127_531 | 129 |
| 1130 | 3300050515 | nmdc:mga0a205_685731_c1 | nmdc:mga0a205_685731_c1_199_606 | 129 |
| 1131 | 3300053077 | Ga0495601_0194481 | Ga0495601_0194481_152_541 | 129 |
| 1132 | 3300053078 | Ga0495612_0018232 | Ga0495612_0018232_652_1056 | 129 |
| 1133 | 3300053084 | Ga0495595_0051526 | Ga0495595_0051526_1263_1667 | 129 |
| 1134 | 3300053085 | Ga0495619_0057702 | Ga0495619_0057702_127_534 | 129 |
| 1135 | 3300053085 | Ga0495619_0125055 | Ga0495619_0125055_416_820 | 129 |
| 1136 | 3300053085 | Ga0495619_0578918 | Ga0495619_0578918_241_630 | 129 |
| 1137 | 3300053086 | Ga0500578_0000459 | Ga0500578_0000459_24491_24880 | 129 |
| 1138 | 3300053087 | Ga0500643_001398 | Ga0500643_001398_9731_10120 | 129 |
| 1139 | 3300053087 | Ga0500643_002694 | Ga0500643_002694_3326_3715 | 129 |
| 1140 | 3300053088 | Ga0500644_0163011 | Ga0500644_0163011_208_597 | 129 |
| 1141 | 3300053092 | Ga0500583_0162063 | Ga0500583_0162063_658_1047 | 129 |
| 1142 | 3300053096 | Ga0500641_0097697 | Ga0500641_0097697_715_1104 | 129 |
| 1143 | 3300053102 | Ga0500554_070188 | Ga0500554_070188_577_966 | 129 |
| 1144 | 3300053104 | Ga0500556_0000636 | Ga0500556_0000636_14497_14904 | 129 |
| 1145 | 3300053108 | Ga0500562_003308 | Ga0500562_003308_440_829 | 129 |
| 1146 | 3300053111 | Ga0500572_000706 | Ga0500572_000706_1020_1409 | 129 |
| 1147 | 3300053118 | Ga0500594_0123906 | Ga0500594_0123906_231_620 | 129 |
| 1148 | 3300053118 | Ga0500594_0160110 | Ga0500594_0160110_265_672 | 129 |
| 1149 | 3300053119 | Ga0500595_071208 | Ga0500595_071208_550_957 | 129 |
| 1150 | 3300053122 | Ga0500608_000084 | Ga0500608_000084_21914_22303 | 129 |
| 1151 | 3300053123 | Ga0500614_032376 | Ga0500614_032376_146_535 | 129 |
| 1152 | 3300053125 | Ga0500618_000395 | Ga0500618_000395_4592_4981 | 129 |
| 1153 | 3300053130 | Ga0500642_0080981 | Ga0500642_0080981_439_828 | 129 |
| 1154 | 3300053136 | Ga0500559_0000113 | Ga0500559_0000113_47375_47764 | 129 |
| 1155 | 3300053136 | Ga0500559_0001398 | Ga0500559_0001398_12505_12894 | 129 |
| 1156 | 3300053136 | Ga0500559_0179035 | Ga0500559_0179035_62_451 | 129 |
| 1157 | 3300053140 | Ga0500573_0040077 | Ga0500573_0040077_792_1181 | 129 |
| 1158 | 3300053142 | Ga0500577_0017824 | Ga0500577_0017824_862_1251 | 129 |
| 1159 | 3300053142 | Ga0500577_0279280 | Ga0500577_0279280_245_634 | 129 |
| 1160 | 3300053146 | Ga0500588_0375719 | Ga0500588_0375719_38_427 | 129 |
| 1161 | 3300053148 | Ga0500590_305366 | Ga0500590_305366_62_451 | 129 |
| 1162 | 3300053151 | Ga0500604_0065300 | Ga0500604_0065300_570_959 | 129 |
| 1163 | 3300053153 | Ga0500616_0003259 | Ga0500616_0003259_1879_2286 | 129 |
| 1164 | 3300053156 | Ga0500622_0019916 | Ga0500622_0019916_2713_3102 | 129 |
| 1165 | 3300053160 | Ga0500633_0184725 | Ga0500633_0184725_89_478 | 129 |
| 1166 | 3300053161 | Ga0500634_0157358 | Ga0500634_0157358_519_908 | 129 |
| 1167 | 3300053163 | Ga0500639_075340 | Ga0500639_075340_194_583 | 129 |
| 1168 | 3300053727 | Ga0500611_095561 | Ga0500611_095561_346_735 | 129 |
| 1169 | 3300053727 | Ga0500611_100892 | Ga0500611_100892_244_633 | 129 |
| 1170 | 3300053730 | Ga0500645_010383 | Ga0500645_010383_576_983 | 129 |
| 1171 | 3300053731 | Ga0500609_054154 | Ga0500609_054154_63_452 | 129 |
| 1172 | 3300054114 | Ga0501084_0006267 | Ga0501084_0006267_8763_9164 | 129 |
| 1173 | 3300054114 | Ga0501084_0141553 | Ga0501084_0141553_417_806 | 129 |
| 1174 | 3300054114 | Ga0501084_0184188 | Ga0501084_0184188_761_1165 | 129 |
| 1175 | 3300054114 | Ga0501084_0289759 | Ga0501084_0289759_812_1213 | 129 |
| 1176 | 3300054114 | Ga0501084_0299474 | Ga0501084_0299474_755_1156 | 129 |
| 1177 | 3300054114 | Ga0501084_0663744 | Ga0501084_0663744_392_790 | 129 |
| 1178 | 3300054114 | Ga0501084_0770388 | Ga0501084_0770388_321_725 | 129 |
| 1179 | 3300054114 | Ga0501084_0977468 | Ga0501084_0977468_35_436 | 129 |
| 1180 | 3300059477 | Ga0587084_083583 | Ga0587084_083583_181_570 | 129 |
| 1181 | 3300059478 | Ga0587093_042853 | Ga0587093_042853_21_410 | 129 |
| 1182 | 3300059492 | Ga0587073_0232585 | Ga0587073_0232585_40_450 | 129 |
| 1183 | 3300059505 | Ga0587083_0074098 | Ga0587083_0074098_250_639 | 129 |
| 1184 | 3300059508 | Ga0587088_128227 | Ga0587088_128227_136_525 | 129 |
| 1185 | 3300059510 | Ga0587090_058580 | Ga0587090_058580_42_437 | 129 |
| 1186 | 3300059512 | Ga0587092_027629 | Ga0587092_027629_79_468 | 129 |
| 1187 | 3300059512 | Ga0587092_098355 | Ga0587092_098355_106_495 | 129 |
| 1188 | 3300059513 | Ga0587094_025516 | Ga0587094_025516_471_860 | 129 |
| 1189 | 3300059604 | Ga0587098_005909 | Ga0587098_005909_93_482 | 129 |
| 1190 | 3300059605 | Ga0587106_000505 | Ga0587106_000505_1476_1865 | 129 |
| 1191 | 3300059605 | Ga0587106_102105 | Ga0587106_102105_120_509 | 129 |
| 1192 | 3300059607 | Ga0587125_013034 | Ga0587125_013034_59_448 | 129 |
| 1193 | 3300059608 | Ga0587129_004972 | Ga0587129_004972_16_405 | 129 |
| 1194 | 3300059623 | Ga0587101_067023 | Ga0587101_067023_11_400 | 129 |
| 1195 | 3300059623 | Ga0587101_149138 | Ga0587101_149138_35_424 | 129 |
| 1196 | 3300059645 | Ga0587076_050589 | Ga0587076_050589_83_472 | 129 |
| 1197 | 3300059646 | Ga0587078_026257 | Ga0587078_026257_48_437 | 129 |
| 1198 | 3300059652 | Ga0587107_011200 | Ga0587107_011200_59_448 | 129 |
| 1199 | 3300060346 | Ga0587111_0253784 | Ga0587111_0253784_13_402 | 129 |
| 1200 | 3300060353 | Ga0501082_0030302 | Ga0501082_0030302_3313_3714 | 129 |
| 1201 | 3300060353 | Ga0501082_0069663 | Ga0501082_0069663_980_1381 | 129 |
| 1202 | 3300060353 | Ga0501082_0088119 | Ga0501082_0088119_844_1242 | 129 |
| 1203 | 3300060353 | Ga0501082_0114130 | Ga0501082_0114130_570_974 | 129 |
| 1204 | 3300060353 | Ga0501082_0136753 | Ga0501082_0136753_842_1243 | 129 |
| 1205 | 3300060353 | Ga0501082_0665513 | Ga0501082_0665513_411_800 | 129 |
| 1206 | 3300060353 | Ga0501082_0997369 | Ga0501082_0997369_283_684 | 129 |
| 1207 | 3300060353 | Ga0501082_1046130 | Ga0501082_1046130_155_559 | 129 |
| 1208 | 3300060353 | Ga0501082_1561408 | Ga0501082_1561408_44_448 | 129 |
| 1209 | 3300060353 | Ga0501082_1692524 | Ga0501082_1692524_130_531 | 129 |
| 1210 | 3300061734 | Ga0530510_0066947 | Ga0530510_0066947_1991_2392 | 129 |
| 1211 | 3300061734 | Ga0530510_0118926 | Ga0530510_0118926_686_1087 | 129 |
| 1212 | 3300061734 | Ga0530510_0182254 | Ga0530510_0182254_258_659 | 129 |
| 1213 | 3300061734 | Ga0530510_0877165 | Ga0530510_0877165_94_495 | 129 |
| 1214 | 3300061734 | Ga0530510_0997585 | Ga0530510_0997585_34_423 | 129 |
| 1215 | 3300001979 | JGI24740J21852_10057967 | JGI24740J21852_100579672 | 130 |
| 1216 | 3300003214 | JGI25165J46597_1001315 | JGI25165J46597_10013152 | 130 |
| 1217 | 3300005330 | Ga0070690_100186523 | Ga0070690_1001865232 | 130 |
| 1218 | 3300005334 | Ga0068869_100008437 | Ga0068869_1000084375 | 130 |
| 1219 | 3300005334 | Ga0068869_100544084 | Ga0068869_1005440841 | 130 |
| 1220 | 3300005335 | Ga0070666_10264260 | Ga0070666_102642603 | 130 |
| 1221 | 3300005338 | Ga0068868_100602383 | Ga0068868_1006023832 | 130 |
| 1222 | 3300005338 | Ga0068868_101136364 | Ga0068868_1011363641 | 130 |
| 1223 | 3300005338 | Ga0068868_101894648 | Ga0068868_1018946481 | 130 |
| 1224 | 3300005339 | Ga0070660_100061987 | Ga0070660_1000619872 | 130 |
| 1225 | 3300005341 | Ga0070691_10140140 | Ga0070691_101401401 | 130 |
| 1226 | 3300005344 | Ga0070661_100246457 | Ga0070661_1002464572 | 130 |
| 1227 | 3300005344 | Ga0070661_101866016 | Ga0070661_1018660161 | 130 |
| 1228 | 3300005347 | Ga0070668_100443671 | Ga0070668_1004436711 | 130 |
| 1229 | 3300005353 | Ga0070669_101011062 | Ga0070669_1010110622 | 130 |
| 1230 | 3300005354 | Ga0070675_101001736 | Ga0070675_1010017362 | 130 |
| 1231 | 3300005355 | Ga0070671_100110233 | Ga0070671_1001102331 | 130 |
| 1232 | 3300005355 | Ga0070671_101004691 | Ga0070671_1010046912 | 130 |
| 1233 | 3300005365 | Ga0070688_100187724 | Ga0070688_1001877242 | 130 |
| 1234 | 3300005365 | Ga0070688_101421598 | Ga0070688_1014215981 | 130 |
| 1235 | 3300005367 | Ga0070667_100209903 | Ga0070667_1002099033 | 130 |
| 1236 | 3300005367 | Ga0070667_101130230 | Ga0070667_1011302301 | 130 |
| 1237 | 3300005436 | Ga0070713_100708019 | Ga0070713_1007080191 | 130 |
| 1238 | 3300005438 | Ga0070701_10216281 | Ga0070701_102162811 | 130 |
| 1239 | 3300005441 | Ga0070700_100800876 | Ga0070700_1008008762 | 130 |
| 1240 | 3300005456 | Ga0070678_100483807 | Ga0070678_1004838071 | 130 |
| 1241 | 3300005457 | Ga0070662_100141547 | Ga0070662_1001415472 | 130 |
| 1242 | 3300005459 | Ga0068867_100209008 | Ga0068867_1002090082 | 130 |
| 1243 | 3300005459 | Ga0068867_100572102 | Ga0068867_1005721022 | 130 |
| 1244 | 3300005544 | Ga0070686_100334643 | Ga0070686_1003346432 | 130 |
| 1245 | 3300005544 | Ga0070686_100502805 | Ga0070686_1005028052 | 130 |
| 1246 | 3300005548 | Ga0070665_100026249 | Ga0070665_1000262494 | 130 |
| 1247 | 3300005549 | Ga0070704_101620467 | Ga0070704_1016204671 | 130 |
| 1248 | 3300005563 | Ga0068855_100137813 | Ga0068855_1001378133 | 130 |
| 1249 | 3300005564 | Ga0070664_101506345 | Ga0070664_1015063452 | 130 |
| 1250 | 3300005615 | Ga0070702_101822182 | Ga0070702_1018221821 | 130 |
| 1251 | 3300005616 | Ga0068852_100576541 | Ga0068852_1005765412 | 130 |
| 1252 | 3300005618 | Ga0068864_102048436 | Ga0068864_1020484361 | 130 |
| 1253 | 3300005718 | Ga0068866_10209421 | Ga0068866_102094212 | 130 |
| 1254 | 3300005841 | Ga0068863_100983699 | Ga0068863_1009836992 | 130 |
| 1255 | 3300005842 | Ga0068858_100012099 | Ga0068858_1000120994 | 130 |
| 1256 | 3300006028 | Ga0070717_11373621 | Ga0070717_113736211 | 130 |
| 1257 | 3300006195 | Ga0075366_10044076 | Ga0075366_100440763 | 130 |
| 1258 | 3300006237 | Ga0097621_100003892 | Ga0097621_10000389212 | 130 |
| 1259 | 3300006237 | Ga0097621_100679452 | Ga0097621_1006794522 | 130 |
| 1260 | 3300006358 | Ga0068871_100532121 | Ga0068871_1005321212 | 130 |
| 1261 | 3300006358 | Ga0068871_100605847 | Ga0068871_1006058472 | 130 |
| 1262 | 3300007788 | Ga0099795_10246029 | Ga0099795_102460292 | 130 |
| 1263 | 3300009093 | Ga0105240_10811134 | Ga0105240_108111342 | 130 |
| 1264 | 3300009098 | Ga0105245_11199584 | Ga0105245_111995841 | 130 |
| 1265 | 3300009098 | Ga0105245_12327652 | Ga0105245_123276522 | 130 |
| 1266 | 3300009101 | Ga0105247_10741764 | Ga0105247_107417642 | 130 |
| 1267 | 3300009148 | Ga0105243_10624585 | Ga0105243_106245852 | 130 |
| 1268 | 3300009176 | Ga0105242_11429425 | Ga0105242_114294251 | 130 |
| 1269 | 3300009177 | Ga0105248_10239747 | Ga0105248_102397472 | 130 |
| 1270 | 3300009551 | Ga0105238_11994332 | Ga0105238_119943321 | 130 |
| 1271 | 3300010375 | Ga0105239_12960839 | Ga0105239_129608392 | 130 |
| 1272 | 3300013296 | Ga0157374_10609235 | Ga0157374_106092352 | 130 |
| 1273 | 3300013297 | Ga0157378_10618473 | Ga0157378_106184732 | 130 |
| 1274 | 3300013308 | Ga0157375_12522197 | Ga0157375_125221971 | 130 |
| 1275 | 3300014968 | Ga0157379_10206026 | Ga0157379_102060262 | 130 |
| 1276 | 3300014969 | Ga0157376_11520995 | Ga0157376_115209951 | 130 |
| 1277 | 3300021361 | Ga0213872_10363622 | Ga0213872_103636222 | 130 |
| 1278 | 3300025231 | Ga0207427_104861 | Ga0207427_1048612 | 130 |
| 1279 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013750 | 130 |
| 1280 | 3300025899 | Ga0207642_10465669 | Ga0207642_104656692 | 130 |
| 1281 | 3300025900 | Ga0207710_10206345 | Ga0207710_102063452 | 130 |
| 1282 | 3300025903 | Ga0207680_10193851 | Ga0207680_101938513 | 130 |
| 1283 | 3300025903 | Ga0207680_10294370 | Ga0207680_102943701 | 130 |
| 1284 | 3300025907 | Ga0207645_10027676 | Ga0207645_100276765 | 130 |
| 1285 | 3300025908 | Ga0207643_10321808 | Ga0207643_103218082 | 130 |
| 1286 | 3300025909 | Ga0207705_10076496 | Ga0207705_100764963 | 130 |
| 1287 | 3300025912 | Ga0207707_10484945 | Ga0207707_104849451 | 130 |
| 1288 | 3300025913 | Ga0207695_10403007 | Ga0207695_104030072 | 130 |
| 1289 | 3300025914 | Ga0207671_10705708 | Ga0207671_107057082 | 130 |
| 1290 | 3300025919 | Ga0207657_10083597 | Ga0207657_100835972 | 130 |
| 1291 | 3300025926 | Ga0207659_11379701 | Ga0207659_113797011 | 130 |
| 1292 | 3300025927 | Ga0207687_10527637 | Ga0207687_105276372 | 130 |
| 1293 | 3300025927 | Ga0207687_10625466 | Ga0207687_106254662 | 130 |
| 1294 | 3300025927 | Ga0207687_10945196 | Ga0207687_109451961 | 130 |
| 1295 | 3300025928 | Ga0207700_10719333 | Ga0207700_107193332 | 130 |
| 1296 | 3300025931 | Ga0207644_10078687 | Ga0207644_100786872 | 130 |
| 1297 | 3300025933 | Ga0207706_10205402 | Ga0207706_102054022 | 130 |
| 1298 | 3300025935 | Ga0207709_10007982 | Ga0207709_100079822 | 130 |
| 1299 | 3300025936 | Ga0207670_10366911 | Ga0207670_103669112 | 130 |
| 1300 | 3300025940 | Ga0207691_10350676 | Ga0207691_103506762 | 130 |
| 1301 | 3300025942 | Ga0207689_10013634 | Ga0207689_100136346 | 130 |
| 1302 | 3300025942 | Ga0207689_10442129 | Ga0207689_104421292 | 130 |
| 1303 | 3300025944 | Ga0207661_10519997 | Ga0207661_105199972 | 130 |
| 1304 | 3300025944 | Ga0207661_11055193 | Ga0207661_110551932 | 130 |
| 1305 | 3300025945 | Ga0207679_10981191 | Ga0207679_109811912 | 130 |
| 1306 | 3300025949 | Ga0207667_10589684 | Ga0207667_105896842 | 130 |
| 1307 | 3300025960 | Ga0207651_10027205 | Ga0207651_100272052 | 130 |
| 1308 | 3300025972 | Ga0207668_10222061 | Ga0207668_102220612 | 130 |
| 1309 | 3300025981 | Ga0207640_11840477 | Ga0207640_118404772 | 130 |
| 1310 | 3300025986 | Ga0207658_10420427 | Ga0207658_104204271 | 130 |
| 1311 | 3300025986 | Ga0207658_10593453 | Ga0207658_105934532 | 130 |
| 1312 | 3300025986 | Ga0207658_11283616 | Ga0207658_112836162 | 130 |
| 1313 | 3300026035 | Ga0207703_10124896 | Ga0207703_101248964 | 130 |
| 1314 | 3300026067 | Ga0207678_10750054 | Ga0207678_107500541 | 130 |
| 1315 | 3300026089 | Ga0207648_10025631 | Ga0207648_100256315 | 130 |
| 1316 | 3300026089 | Ga0207648_10625804 | Ga0207648_106258041 | 130 |
| 1317 | 3300026121 | Ga0207683_10566477 | Ga0207683_105664772 | 130 |
| 1318 | 3300026142 | Ga0207698_10443331 | Ga0207698_104433313 | 130 |
| 1319 | 3300026142 | Ga0207698_10834411 | Ga0207698_108344112 | 130 |
| 1320 | 3300028379 | Ga0268266_10178394 | Ga0268266_101783942 | 130 |
| 1321 | 3300028380 | Ga0268265_10593862 | Ga0268265_105938622 | 130 |
| 1322 | 3300028381 | Ga0268264_12263184 | Ga0268264_122631842 | 130 |
| 1323 | 3300031456 | Ga0307513_10600403 | Ga0307513_106004031 | 130 |
| 1324 | 3300031507 | Ga0307509_10386543 | Ga0307509_103865432 | 130 |
| 1325 | 3300031616 | Ga0307508_10171057 | Ga0307508_101710573 | 130 |
| 1326 | 3300031824 | Ga0307413_11365589 | Ga0307413_113655891 | 130 |
| 1327 | 3300031901 | Ga0307406_10505848 | Ga0307406_105058482 | 130 |
| 1328 | 3300033180 | Ga0307510_10540988 | Ga0307510_105409881 | 130 |
| 1329 | 3300034957 | Ga0373938_0026082 | Ga0373938_0026082_486_896 | 130 |
| 1330 | 3300035695 | Ga0373927_0964677 | Ga0373927_0964677_18_428 | 130 |
| 1331 | 3300035724 | Ga0373933_0554236 | Ga0373933_0554236_213_623 | 130 |
| 1332 | 3300036401 | Ga0373937_0228037 | Ga0373937_0228037_982_1392 | 130 |
| 1333 | 3300037471 | Ga0395905_1052736 | Ga0395905_1052736_202_615 | 130 |
| 1334 | 3300037471 | Ga0395905_1413361 | Ga0395905_1413361_167_559 | 130 |
| 1335 | 3300039438 | Ga0436360_0387015 | Ga0436360_0387015_325_735 | 130 |
| 1336 | 3300039450 | Ga0436363_1304811 | Ga0436363_1304811_40_450 | 130 |
| 1337 | 3300041459 | Ga0451800_1326835 | Ga0451800_1326835_76_486 | 130 |
| 1338 | 3300041507 | Ga0451851_1169255 | Ga0451851_1169255_39_449 | 130 |
| 1339 | 3300046455 | Ga0495603_0502067 | Ga0495603_0502067_185_595 | 130 |
| 1340 | 3300046457 | Ga0495590_0136108 | Ga0495590_0136108_318_728 | 130 |
| 1341 | 3300046492 | Ga0495585_0066533 | Ga0495585_0066533_941_1351 | 130 |
| 1342 | 3300046507 | Ga0495606_0032036 | Ga0495606_0032036_2675_3088 | 130 |
| 1343 | 3300046514 | Ga0495618_0184469 | Ga0495618_0184469_73_483 | 130 |
| 1344 | 3300046517 | Ga0495630_0702144 | Ga0495630_0702144_261_671 | 130 |
| 1345 | 3300046519 | Ga0495632_0079274 | Ga0495632_0079274_625_1035 | 130 |
| 1346 | 3300046523 | Ga0495644_0251560 | Ga0495644_0251560_41_451 | 130 |
| 1347 | 3300046530 | Ga0495654_0060993 | Ga0495654_0060993_129_539 | 130 |
| 1348 | 3300046533 | Ga0495640_0240079 | Ga0495640_0240079_514_924 | 130 |
| 1349 | 3300046535 | Ga0495586_0376981 | Ga0495586_0376981_279_689 | 130 |
| 1350 | 3300046557 | Ga0495622_0005663 | Ga0495622_0005663_4637_5047 | 130 |
| 1351 | 3300046615 | Ga0495656_0073584 | Ga0495656_0073584_404_814 | 130 |
| 1352 | 3300046648 | Ga0495611_0428415 | Ga0495611_0428415_65_478 | 130 |
| 1353 | 3300046660 | Ga0495625_0020239 | Ga0495625_0020239_1702_2112 | 130 |
| 1354 | 3300046665 | Ga0495661_0128758 | Ga0495661_0128758_462_872 | 130 |
| 1355 | 3300046689 | Ga0495613_0229804 | Ga0495613_0229804_301_711 | 130 |
| 1356 | 3300047318 | Ga0495636_0103531 | Ga0495636_0103531_803_1213 | 130 |
| 1357 | 3300047321 | Ga0495676_0264279 | Ga0495676_0264279_157_567 | 130 |
| 1358 | 3300048090 | Ga0495615_0221308 | Ga0495615_0221308_111_521 | 130 |
| 1359 | 3300048905 | Ga0496102_0294433 | Ga0496102_0294433_870_1262 | 130 |
| 1360 | 3300048906 | Ga0496103_0209716 | Ga0496103_0209716_650_1042 | 130 |
| 1361 | 3300048910 | Ga0496107_0973644 | Ga0496107_0973644_16_408 | 130 |
| 1362 | 3300048917 | Ga0496114_0855636 | Ga0496114_0855636_60_461 | 130 |
| 1363 | 3300048920 | Ga0496117_0146665 | Ga0496117_0146665_584_976 | 130 |
| 1364 | 3300048924 | Ga0496121_0253153 | Ga0496121_0253153_97_489 | 130 |
| 1365 | 3300048929 | Ga0496126_0094915 | Ga0496126_0094915_815_1207 | 130 |
| 1366 | 3300049460 | Ga0495682_0189414 | Ga0495682_0189414_131_541 | 130 |
| 1367 | 3300049527 | Ga0501311_014284 | Ga0501311_014284_33_434 | 130 |
| 1368 | 3300049572 | Ga0501036_0815168 | Ga0501036_0815168_149_571 | 130 |
| 1369 | 3300049574 | Ga0501038_0000069 | Ga0501038_0000069_60749_61174 | 130 |
| 1370 | 3300049574 | Ga0501038_0402943 | Ga0501038_0402943_537_929 | 130 |
| 1371 | 3300049583 | Ga0501067_0592349 | Ga0501067_0592349_143_553 | 130 |
| 1372 | 3300049589 | Ga0501073_0213301 | Ga0501073_0213301_845_1258 | 130 |
| 1373 | 3300049589 | Ga0501073_0460050 | Ga0501073_0460050_40_456 | 130 |
| 1374 | 3300049742 | Ga0501080_0517088 | Ga0501080_0517088_142_555 | 130 |
| 1375 | 3300050493 | nmdc:mga0k408_139435_c1 | nmdc:mga0k408_139435_c1_218_610 | 130 |
| 1376 | 3300050509 | nmdc:mga0qj67_344652_c1 | nmdc:mga0qj67_344652_c1_504_917 | 130 |
| 1377 | 3300050516 | nmdc:mga0sz30_24066_c1 | nmdc:mga0sz30_24066_c1_807_1199 | 130 |
| 1378 | 3300053080 | Ga0500635_0031075 | Ga0500635_0031075_586_996 | 130 |
| 1379 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_34002_34412 | 130 |
| 1380 | 3300053094 | Ga0500566_0487259 | Ga0500566_0487259_52_462 | 130 |
| 1381 | 3300053097 | Ga0500648_374559 | Ga0500648_374559_37_447 | 130 |
| 1382 | 3300053103 | Ga0500555_050120 | Ga0500555_050120_217_627 | 130 |
| 1383 | 3300053105 | Ga0500557_217408 | Ga0500557_217408_107_499 | 130 |
| 1384 | 3300053119 | Ga0500595_030639 | Ga0500595_030639_136_546 | 130 |
| 1385 | 3300053119 | Ga0500595_109071 | Ga0500595_109071_126_599 | 130 |
| 1386 | 3300053120 | Ga0500597_331540 | Ga0500597_331540_125_535 | 130 |
| 1387 | 3300053136 | Ga0500559_0084588 | Ga0500559_0084588_1018_1428 | 130 |
| 1388 | 3300053153 | Ga0500616_0054505 | Ga0500616_0054505_44_436 | 130 |
| 1389 | 3300053163 | Ga0500639_120431 | Ga0500639_120431_38_448 | 130 |
| 1390 | 3300053735 | Ga0500596_028037 | Ga0500596_028037_322_732 | 130 |
| 1391 | 3300059493 | Ga0587077_194132 | Ga0587077_194132_105_503 | 130 |
| 1392 | 3300059503 | Ga0587080_066164 | Ga0587080_066164_198_590 | 130 |
| 1393 | 3300059623 | Ga0587101_027562 | Ga0587101_027562_50_442 | 130 |
| 1394 | 3300059623 | Ga0587101_118593 | Ga0587101_118593_75_470 | 130 |
| 1395 | 3300059623 | Ga0587101_135185 | Ga0587101_135185_36_428 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9507 | 17 | 116 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9498 | 17 | 108 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9399 | 17 | 108 |
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9326 | 17 | 116 |
| 4v48-assembly1.cif.gz_BK | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.924 | 14 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P55138_1_114_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8777 | 19 | 47 | 3.30.420.40 |
| af_A0A1D6DWZ1_6_279_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8454 | 24 | 47 | 3.30.420.40 |
| 4qs2K00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8357 | 18 | 126 | 3.30.420.80 |
| af_C0P5F8_195_302_3.30.420.100 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.8108 | 20 | 106 | 3.30.420.100 |
| af_P9WH65_1_139_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8077 | 1 | 130 | 3.30.420.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0RPL5-F1-model_v4 | 30S ribosomal protein S11 | 0.9448 | 22 | 109 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A0G1UXB4-F1-model_v4 | Small ribosomal subunit protein uS11 | 0.9326 | 18 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0008168 GO:0019843 GO:0032259 GO:1990904 |
| AF-A0A3D0RPL5-F1-model_v4 | 30S ribosomal protein S11 | 0.9245 | 22 | 109 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2E1U474-F1-model_v4 | 30S ribosomal protein S11 | 0.9239 | 12 | 89 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7J9GWT2-F1-model_v4 | Ribosomal protein S11 | 0.9233 | 17 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar