F493624

General Info

Members Datasets Scaffolds Average Seq Length
1395 554 1390 132

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_109071|Ga0500595_109071_126_599
Length 157
Sequence VPFFGANNGFRLRLNEAWSNDGMAKEATAAGRGGKVKKREKKNITSGVAHVNASFNNTMITITDAQGNTIAWSSSGTKGFKGSRKSTPYAAQMAAEDAGKKAQEHGMKVLEVEVCGPGSGRESALRALQAVGFQITSIRDVTPIPHNGCRPRKRRRV

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
3 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2909042592 Labrys sp. LIt4 Isolate Nodule
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002864 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
157 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
158 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
227 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
228 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
229 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
234 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
239 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
250 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
254 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
270 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
271 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
272 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
273 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
274 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
275 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
276 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
277 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
278 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
287 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
290 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
291 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
292 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
308 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
309 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
310 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
311 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
318 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
319 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
320 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
321 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
322 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
323 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
324 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
325 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
326 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
327 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
328 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
329 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
330 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
331 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
332 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
337 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
342 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
343 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
344 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
345 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
348 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
353 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
354 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
361 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
392 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
393 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
456 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
457 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
458 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
459 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
463 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
464 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
465 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
466 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
469 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
473 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
478 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
479 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
480 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
481 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
482 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
483 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
484 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
485 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
486 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
487 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
488 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
489 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
490 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
491 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
492 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
493 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
494 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
495 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
496 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
497 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
498 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
499 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
500 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
501 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
502 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
503 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
504 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
505 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
506 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
507 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
508 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
509 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
510 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
511 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
512 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
513 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
514 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
515 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
516 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
517 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
518 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
519 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
520 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
523 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
524 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
525 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
526 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
527 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
528 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
529 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
530 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
531 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
554 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.9
Metatranscriptomes 6.74
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0.14
Rhizoplane 4.73
Rhizosphere 85.09
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10057967 3300001979 Bacteria 1079
2 JGI24740J21852_10130414 3300001979 Bacteria 628
3 Ga0006764J43180_108466 3300002864 Bacteria 798
4 Ga0006778J45830_1008131 3300003162 Bacteria 1176
5 Ga0006778J45830_1018080 3300003162 Bacteria 921
6 Ga0006778J45830_1049198 3300003162 Bacteria 1027
7 Ga0006759J45824_1022394 3300003163 Bacteria 1050
8 Ga0006759J45824_1022824 3300003163 Bacteria 2259
9 JGI25165J46597_1001315 3300003214 Bacteria 14050
10 JGI25153J46596_10000830 3300003215 Bacteria 18874
11 Ga0006758J48902_1033810 3300003300 Bacteria 636
12 Ga0006770J48903_1012980 3300003305 Bacteria 2736
13 Ga0006770J48903_1025503 3300003305 Bacteria 958
14 Ga0006777J48905_1011379 3300003308 Bacteria 3133
15 Ga0007427J51700_105947 3300003559 Bacteria 1540
16 Ga0007427J51700_106632 3300003559 Bacteria 1423
17 Ga0006781J51513_1004232 3300003568 Bacteria 1387
18 Ga0007410J51695_1014171 3300003574 Bacteria 841
19 Ga0007410J51695_1020352 3300003574 Bacteria 927
20 Ga0007409J51694_1008637 3300003575 Bacteria 1402
21 Ga0007416J51690_1009570 3300003577 Bacteria 1874
22 Ga0006562J51391_1036321 3300003578 Bacteria 2102
23 Ga0007429J51699_1016068 3300003579 Bacteria 1206
24 Ga0007429J51699_1033775 3300003579 Bacteria 1336
25 JGI25404J52841_10015764 3300003659 Bacteria 1639
26 Ga0032354_1001326 3300003693 Bacteria 1584
27 Ga0032354_1016125 3300003693 Bacteria 1404
28 Ga0006780_1014704 3300003735 Bacteria 1986
29 JGI25405J52794_10077812 3300003911 Bacteria 728
30 Ga0058863_11718014 3300004799 Bacteria 681
31 Ga0058860_10041150 3300004801 Bacteria 1260
32 Ga0058862_10033415 3300004803 Bacteria 868
33 Ga0065715_10035160 3300005293 Bacteria 1531
34 Ga0070658_10003455 3300005327 Bacteria 12992
35 Ga0070683_100084749 3300005329 Bacteria 2969
36 Ga0070690_100186523 3300005330 Bacteria 1436
37 Ga0068869_100008437 3300005334 Bacteria 6643
38 Ga0068869_100092987 3300005334 Bacteria 2271
39 Ga0068869_100100452 3300005334 Bacteria 2188
40 Ga0068869_100544084 3300005334 Bacteria 974
41 Ga0068869_102057784 3300005334 Bacteria 513
42 Ga0070666_10021121 3300005335 Bacteria 4218
43 Ga0070666_10137163 3300005335 Bacteria 1703
44 Ga0070666_10264260 3300005335 Bacteria 1220
45 Ga0070680_100069250 3300005336 Bacteria 2897
46 Ga0070680_100107819 3300005336 Bacteria 2317
47 Ga0070680_100192763 3300005336 Bacteria 1717
48 Ga0070680_100268121 3300005336 Bacteria 1445
49 Ga0070680_100342469 3300005336 Bacteria 1270
50 Ga0070682_100016529 3300005337 Bacteria 4291
51 Ga0068868_100029525 3300005338 Bacteria 4199
52 Ga0068868_100602383 3300005338 Bacteria 973
53 Ga0068868_101136364 3300005338 Bacteria 720
54 Ga0068868_101167888 3300005338 Bacteria 711
55 Ga0068868_101354080 3300005338 Bacteria 663
56 Ga0068868_101894648 3300005338 Bacteria 564
57 Ga0070660_100023123 3300005339 Bacteria 4603
58 Ga0070660_100061987 3300005339 Bacteria 2904
59 Ga0070660_100084309 3300005339 Bacteria 2497
60 Ga0070660_100140899 3300005339 Bacteria 1934
61 Ga0070689_101758028 3300005340 Bacteria 565
62 Ga0070691_10014834 3300005341 Bacteria 3577
63 Ga0070691_10140140 3300005341 Bacteria 1232
64 Ga0070687_100219327 3300005343 Bacteria 1164
65 Ga0070661_100246457 3300005344 Bacteria 1377
66 Ga0070661_101866016 3300005344 Bacteria 511
67 Ga0070692_10012203 3300005345 Bacteria 3968
68 Ga0070692_10069116 3300005345 Bacteria 1878
69 Ga0070668_100043015 3300005347 Bacteria 3463
70 Ga0070668_100443671 3300005347 Bacteria 1114
71 Ga0070668_101463004 3300005347 Bacteria 624
72 Ga0070669_100192007 3300005353 Bacteria 1602
73 Ga0070669_101011062 3300005353 Bacteria 713
74 Ga0070675_100372422 3300005354 Bacteria 1270
75 Ga0070675_101001736 3300005354 Bacteria 767
76 Ga0070671_100110233 3300005355 Bacteria 2312
77 Ga0070671_100719742 3300005355 Bacteria 866
78 Ga0070671_101004691 3300005355 Bacteria 731
79 Ga0070673_100150421 3300005364 Bacteria 1971
80 Ga0070673_100657775 3300005364 Bacteria 959
81 Ga0070688_100101145 3300005365 Bacteria 1901
82 Ga0070688_100187724 3300005365 Bacteria 1438
83 Ga0070688_101421598 3300005365 Bacteria 563
84 Ga0070659_100018614 3300005366 Bacteria 5242
85 Ga0070659_100406858 3300005366 Bacteria 1149
86 Ga0070667_100028269 3300005367 Bacteria 4668
87 Ga0070667_100055820 3300005367 Bacteria 3335
88 Ga0070667_100209903 3300005367 Bacteria 1730
89 Ga0070667_100449117 3300005367 Bacteria 1178
90 Ga0070667_101130230 3300005367 Bacteria 732
91 Ga0070667_101319560 3300005367 Bacteria 676
92 Ga0070703_10121833 3300005406 Bacteria 947
93 Ga0070709_10599618 3300005434 Bacteria 848
94 Ga0070714_100000676 3300005435 Bacteria 24155
95 Ga0070713_100708019 3300005436 Bacteria 962
96 Ga0070701_10012091 3300005438 Bacteria 3881
97 Ga0070701_10216281 3300005438 Bacteria 1141
98 Ga0070701_10382880 3300005438 Bacteria 887
99 Ga0070705_100000459 3300005440 Bacteria 23431
100 Ga0070705_100942308 3300005440 Bacteria 697
101 Ga0070700_100035635 3300005441 Bacteria 3012
102 Ga0070700_100159447 3300005441 Bacteria 1551
103 Ga0070700_100800876 3300005441 Bacteria 759
104 Ga0070694_100025303 3300005444 Bacteria 3840
105 Ga0070694_100186460 3300005444 Bacteria 1537
106 Ga0070708_101280534 3300005445 Bacteria 685
107 Ga0070663_100001615 3300005455 Bacteria 12447
108 Ga0070663_100014346 3300005455 Bacteria 5084
109 Ga0070663_100355644 3300005455 Bacteria 1187
110 Ga0070663_100439838 3300005455 Bacteria 1073
111 Ga0070663_100763531 3300005455 Bacteria 826
112 Ga0070678_100044559 3300005456 Bacteria 3169
113 Ga0070678_100061831 3300005456 Bacteria 2762
114 Ga0070678_100224282 3300005456 Bacteria 1563
115 Ga0070678_100483807 3300005456 Bacteria 1089
116 Ga0070678_100731174 3300005456 Bacteria 894
117 Ga0070678_101715828 3300005456 Bacteria 591
118 Ga0070662_100084838 3300005457 Bacteria 2366
119 Ga0070662_100141547 3300005457 Bacteria 1865
120 Ga0070681_10007102 3300005458 Bacteria 10905
121 Ga0070681_10015119 3300005458 Bacteria 7677
122 Ga0070681_10029516 3300005458 Bacteria 5508
123 Ga0070681_10058942 3300005458 Bacteria 3819
124 Ga0070681_10071358 3300005458 Bacteria 3437
125 Ga0070681_10257706 3300005458 Bacteria 1656
126 Ga0070681_10580881 3300005458 Bacteria 1034
127 Ga0070681_10709552 3300005458 Bacteria 922
128 Ga0070681_11263045 3300005458 Bacteria 661
129 Ga0068867_100209008 3300005459 Bacteria 1566
130 Ga0068867_100572102 3300005459 Bacteria 981
131 Ga0068867_100916634 3300005459 Bacteria 789
132 Ga0068867_100940904 3300005459 Bacteria 780
133 Ga0068867_100990164 3300005459 Bacteria 762
134 Ga0070707_100257272 3300005468 Bacteria 1699
135 Ga0070698_100204506 3300005471 Bacteria 1910
136 Ga0070699_100000540 3300005518 Bacteria 35757
137 Ga0070679_100014413 3300005530 Bacteria 7593
138 Ga0070679_100047434 3300005530 Bacteria 4282
139 Ga0070679_100081241 3300005530 Bacteria 3230
140 Ga0070679_100331407 3300005530 Bacteria 1470
141 Ga0070679_100509180 3300005530 Bacteria 1148
142 Ga0070679_101293727 3300005530 Bacteria 675
143 Ga0070697_100011184 3300005536 Bacteria 7013
144 Ga0068853_100022760 3300005539 Bacteria 5237
145 Ga0068853_100043552 3300005539 Bacteria 3840
146 Ga0068853_100408744 3300005539 Bacteria 1271
147 Ga0068853_100954509 3300005539 Bacteria 824
148 Ga0068853_100991632 3300005539 Bacteria 808
149 Ga0070672_100288069 3300005543 Bacteria 1390
150 Ga0070686_100183555 3300005544 Bacteria 1488
151 Ga0070686_100334643 3300005544 Bacteria 1133
152 Ga0070686_100502805 3300005544 Bacteria 941
153 Ga0070686_100593463 3300005544 Bacteria 872
154 Ga0070695_100024268 3300005545 Bacteria 3734
155 Ga0070695_100964424 3300005545 Bacteria 692
156 Ga0070696_100000156 3300005546 Bacteria 38002
157 Ga0070696_100103413 3300005546 Bacteria 2044
158 Ga0070696_100317609 3300005546 Bacteria 1198
159 Ga0070693_100012485 3300005547 Bacteria 4300
160 Ga0070665_100000121 3300005548 Bacteria 147683
161 Ga0070665_100023111 3300005548 Bacteria 6262
162 Ga0070665_100026249 3300005548 Bacteria 5866
163 Ga0070665_100684034 3300005548 Bacteria 1039
164 Ga0070704_100001256 3300005549 Bacteria 13362
165 Ga0070704_101620467 3300005549 Bacteria 597
166 Ga0068855_100028006 3300005563 Bacteria 6741
167 Ga0068855_100046653 3300005563 Bacteria 5121
168 Ga0068855_100071894 3300005563 Bacteria 4021
169 Ga0068855_100073423 3300005563 Bacteria 3974
170 Ga0068855_100137813 3300005563 Bacteria 2783
171 Ga0068855_100171503 3300005563 Bacteria 2457
172 Ga0068855_100716568 3300005563 Bacteria 1069
173 Ga0070664_100347391 3300005564 Bacteria 1349
174 Ga0070664_101506345 3300005564 Bacteria 636
175 Ga0068857_100020659 3300005577 Bacteria 5795
176 Ga0068857_100031465 3300005577 Bacteria 4689
177 Ga0068857_100095785 3300005577 Bacteria 2660
178 Ga0068857_100122566 3300005577 Bacteria 2342
179 Ga0068857_102105737 3300005577 Bacteria 554
180 Ga0068854_100724080 3300005578 Bacteria 861
181 Ga0068856_100435995 3300005614 Bacteria 1330
182 Ga0068856_101518382 3300005614 Bacteria 684
183 Ga0070702_100047118 3300005615 Bacteria 2447
184 Ga0070702_100257669 3300005615 Bacteria 1186
185 Ga0070702_100844818 3300005615 Bacteria 712
186 Ga0070702_100996528 3300005615 Bacteria 663
187 Ga0070702_101822182 3300005615 Bacteria 509
188 Ga0068852_100386755 3300005616 Bacteria 1373
189 Ga0068852_100576541 3300005616 Bacteria 1128
190 Ga0068852_100992990 3300005616 Bacteria 858
191 Ga0068852_102000957 3300005616 Bacteria 601
192 Ga0068859_100005627 3300005617 Bacteria 12773
193 Ga0068859_100243742 3300005617 Bacteria 1887
194 Ga0068859_100440943 3300005617 Bacteria 1398
195 Ga0068864_100013728 3300005618 Bacteria 6719
196 Ga0068864_100156071 3300005618 Bacteria 2071
197 Ga0068864_100464393 3300005618 Bacteria 1213
198 Ga0068864_102048436 3300005618 Bacteria 579
199 Ga0068866_10209421 3300005718 Bacteria 1170
200 Ga0068866_11087899 3300005718 Bacteria 572
201 Ga0068861_100057102 3300005719 Bacteria 2981
202 Ga0068861_100060641 3300005719 Bacteria 2900
203 Ga0068861_100168742 3300005719 Bacteria 1812
204 Ga0068861_100219088 3300005719 Bacteria 1607
205 Ga0068861_100710333 3300005719 Bacteria 935
206 Ga0068870_10394820 3300005840 Bacteria 899
207 Ga0068863_100064279 3300005841 Bacteria 3471
208 Ga0068863_100757821 3300005841 Bacteria 967
209 Ga0068863_100787247 3300005841 Bacteria 948
210 Ga0068863_100983699 3300005841 Bacteria 846
211 Ga0068858_100012099 3300005842 Bacteria 8133
212 Ga0068858_100135230 3300005842 Bacteria 2313
213 Ga0068858_101440710 3300005842 Bacteria 679
214 Ga0068860_100006701 3300005843 Bacteria 11559
215 Ga0068860_100242218 3300005843 Bacteria 1754
216 Ga0068860_100359325 3300005843 Bacteria 1434
217 Ga0068862_100034875 3300005844 Bacteria 4259
218 Ga0068862_101342016 3300005844 Bacteria 717
219 Ga0068862_101436671 3300005844 Bacteria 694
220 Ga0081455_10001008 3300005937 Bacteria 35646
221 Ga0081455_10251889 3300005937 Bacteria 1291
222 Ga0081540_1000645 3300005983 Bacteria 33098
223 Ga0081540_1006488 3300005983 Bacteria 8508
224 Ga0081540_1120111 3300005983 Bacteria 1092
225 Ga0081540_1217922 3300005983 Bacteria 681
226 Ga0081539_10028584 3300005985 Bacteria 3502
227 Ga0081539_10052221 3300005985 Bacteria 2297
228 Ga0070717_11373621 3300006028 Bacteria 642
229 Ga0075365_10050909 3300006038 Bacteria 2734
230 Ga0075368_10002415 3300006042 Bacteria 6093
231 Ga0075363_100093378 3300006048 Bacteria 1658
232 Ga0075363_100180519 3300006048 Bacteria 1201
233 Ga0075364_10360052 3300006051 Bacteria 992
234 Ga0070715_10072145 3300006163 Bacteria 1545
235 Ga0070712_100461985 3300006175 Bacteria 1059
236 Ga0075362_10206673 3300006177 Bacteria 957
237 Ga0075367_10207325 3300006178 Bacteria 1225
238 Ga0075366_10043441 3300006195 Bacteria 2663
239 Ga0075366_10044076 3300006195 Bacteria 2644
240 Ga0075366_10347162 3300006195 Bacteria 910
241 Ga0097621_100003892 3300006237 Bacteria 10347
242 Ga0097621_100291285 3300006237 Bacteria 1439
243 Ga0097621_100339957 3300006237 Bacteria 1333
244 Ga0097621_100679452 3300006237 Bacteria 946
245 Ga0097621_101148182 3300006237 Bacteria 731
246 Ga0075370_10121056 3300006353 Bacteria 1523
247 Ga0068871_100064267 3300006358 Bacteria 3004
248 Ga0068871_100532121 3300006358 Bacteria 1062
249 Ga0068871_100605847 3300006358 Bacteria 996
250 Ga0068871_100760895 3300006358 Bacteria 891
251 Ga0075428_100121619 3300006844 Bacteria 2843
252 Ga0075428_100277033 3300006844 Bacteria 1805
253 Ga0075428_100337512 3300006844 Bacteria 1618
254 Ga0075428_100677028 3300006844 Bacteria 1099
255 Ga0075428_100809363 3300006844 Bacteria 996
256 Ga0075430_100025465 3300006846 Bacteria 5033
257 Ga0075430_100625942 3300006846 Bacteria 888
258 Ga0075431_100004125 3300006847 Bacteria 14184
259 Ga0075431_100014343 3300006847 Bacteria 8015
260 Ga0075431_100137414 3300006847 Bacteria 2520
261 Ga0075431_100204143 3300006847 Bacteria 2021
262 Ga0075431_100372131 3300006847 Bacteria 1434
263 Ga0075433_10001194 3300006852 Bacteria 18909
264 Ga0075433_10455435 3300006852 Bacteria 1128
265 Ga0075434_100002309 3300006871 Bacteria 16689
266 Ga0075434_100005901 3300006871 Bacteria 11197
267 Ga0075434_100489510 3300006871 Bacteria 1251
268 Ga0075434_102039620 3300006871 Bacteria 579
269 Ga0075429_100184313 3300006880 Bacteria 1829
270 Ga0075429_100230456 3300006880 Bacteria 1622
271 Ga0075429_100994062 3300006880 Bacteria 733
272 Ga0075436_100627444 3300006914 Bacteria 793
273 Ga0097620_100005627 3300006931 Bacteria 12773
274 Ga0097620_100243755 3300006931 Bacteria 1887
275 Ga0097620_100440942 3300006931 Bacteria 1398
276 Ga0075435_100084480 3300007076 Bacteria 2612
277 Ga0075435_100178503 3300007076 Bacteria 1794
278 Ga0099795_10246029 3300007788 Bacteria 770
279 Ga0105251_10178396 3300009011 Bacteria 957
280 Ga0105240_10473595 3300009093 Bacteria 1397
281 Ga0105240_10811134 3300009093 Bacteria 1013
282 Ga0105240_10872993 3300009093 Bacteria 969
283 Ga0111539_10009902 3300009094 Bacteria 12026
284 Ga0111539_10102489 3300009094 Bacteria 3359
285 Ga0111539_10159827 3300009094 Bacteria 2635
286 Ga0111539_10186305 3300009094 Bacteria 2423
287 Ga0111539_12497493 3300009094 Bacteria 599
288 Ga0105245_10271673 3300009098 Bacteria 1654
289 Ga0105245_11199584 3300009098 Bacteria 807
290 Ga0105245_12327652 3300009098 Bacteria 589
291 Ga0105247_10265933 3300009101 Bacteria 1178
292 Ga0105247_10741764 3300009101 Bacteria 743
293 Ga0114129_10052649 3300009147 Bacteria 5713
294 Ga0114129_10115748 3300009147 Bacteria 3695
295 Ga0114129_10307258 3300009147 Bacteria 2112
296 Ga0114129_10532331 3300009147 Bacteria 1531
297 Ga0105243_10005642 3300009148 Bacteria 9744
298 Ga0105243_10185163 3300009148 Bacteria 1814
299 Ga0105243_10424620 3300009148 Bacteria 1241
300 Ga0105243_10624585 3300009148 Bacteria 1041
301 Ga0105241_10853785 3300009174 Bacteria 842
302 Ga0105242_11429425 3300009176 Bacteria 720
303 Ga0105248_10048814 3300009177 Bacteria 4747
304 Ga0105248_10239747 3300009177 Bacteria 2041
305 Ga0105237_10343233 3300009545 Bacteria 1497
306 Ga0105238_10014386 3300009551 Bacteria 7997
307 Ga0105238_10037395 3300009551 Bacteria 4935
308 Ga0105238_11994332 3300009551 Bacteria 614
309 Ga0105238_12979379 3300009551 Bacteria 509
310 Ga0105249_10010481 3300009553 Bacteria 8143
311 Ga0105249_10232087 3300009553 Bacteria 1820
312 Ga0105249_10504662 3300009553 Bacteria 1255
313 Ga0105249_10629910 3300009553 Bacteria 1129
314 Ga0105249_12646345 3300009553 Bacteria 574
315 Ga0105239_10077772 3300010375 Bacteria 3651
316 Ga0105239_10152056 3300010375 Bacteria 2583
317 Ga0105239_10154786 3300010375 Bacteria 2560
318 Ga0105239_10442559 3300010375 Bacteria 1474
319 Ga0105239_11042557 3300010375 Bacteria 941
320 Ga0105239_12960839 3300010375 Bacteria 554
321 Ga0105246_10008563 3300011119 Bacteria 6291
322 Ga0105246_10257174 3300011119 Bacteria 1389
323 Ga0105246_10608919 3300011119 Bacteria 945
324 Ga0105246_10610720 3300011119 Bacteria 944
325 Ga0157373_11389966 3300013100 Bacteria 533
326 Ga0157371_10018600 3300013102 Bacteria 5133
327 Ga0157370_10029081 3300013104 Bacteria 5429
328 Ga0157370_10096703 3300013104 Bacteria 2770
329 Ga0157370_10141347 3300013104 Bacteria 2243
330 Ga0157370_10231765 3300013104 Bacteria 1709
331 Ga0157369_10032567 3300013105 Bacteria 5731
332 Ga0157369_10356738 3300013105 Bacteria 1518
333 Ga0157374_10534851 3300013296 Bacteria 1179
334 Ga0157374_10609235 3300013296 Bacteria 1102
335 Ga0157378_10357095 3300013297 Bacteria 1429
336 Ga0157378_10540698 3300013297 Bacteria 1169
337 Ga0157378_10618473 3300013297 Bacteria 1096
338 Ga0157378_10845320 3300013297 Bacteria 943
339 Ga0163162_10338990 3300013306 Bacteria 1636
340 Ga0163162_11195020 3300013306 Bacteria 863
341 Ga0157372_12584690 3300013307 Bacteria 583
342 Ga0157372_12638887 3300013307 Bacteria 576
343 Ga0157375_10116435 3300013308 Bacteria 2777
344 Ga0157375_10859984 3300013308 Bacteria 1053
345 Ga0157375_11491023 3300013308 Bacteria 798
346 Ga0157375_11857261 3300013308 Bacteria 715
347 Ga0157375_12522197 3300013308 Bacteria 614
348 Ga0157375_12550657 3300013308 Bacteria 611
349 Ga0157375_12925126 3300013308 Bacteria 571
350 Ga0163163_10169829 3300014325 Bacteria 2227
351 Ga0163163_10329470 3300014325 Bacteria 1581
352 Ga0163163_11289895 3300014325 Bacteria 792
353 Ga0163163_12852432 3300014325 Bacteria 539
354 Ga0157380_10009306 3300014326 Bacteria 7035
355 Ga0157380_10198955 3300014326 Bacteria 1776
356 Ga0157380_10293021 3300014326 Bacteria 1495
357 Ga0157380_11627094 3300014326 Bacteria 702
358 Ga0157380_12925422 3300014326 Bacteria 544
359 Ga0157380_13293333 3300014326 Bacteria 516
360 Ga0182008_10027386 3300014497 Bacteria 2888
361 Ga0157377_10578754 3300014745 Bacteria 797
362 Ga0157379_10027510 3300014968 Bacteria 5063
363 Ga0157379_10117175 3300014968 Bacteria 2396
364 Ga0157379_10206026 3300014968 Bacteria 1779
365 Ga0157379_11296326 3300014968 Bacteria 703
366 Ga0157379_11624045 3300014968 Bacteria 632
367 Ga0157376_10136727 3300014969 Bacteria 2194
368 Ga0157376_10268214 3300014969 Bacteria 1602
369 Ga0157376_10366273 3300014969 Bacteria 1384
370 Ga0157376_10672713 3300014969 Bacteria 1038
371 Ga0157376_10774006 3300014969 Bacteria 971
372 Ga0157376_11520995 3300014969 Bacteria 702
373 Ga0163161_10088631 3300017792 Bacteria 2287
374 Ga0163161_10647377 3300017792 Bacteria 875
375 Ga0206353_10361816 3300020082 Bacteria 662
376 Ga0154015_1156125 3300020610 Bacteria 1061
377 Ga0213872_10036033 3300021361 Bacteria 2261
378 Ga0213872_10363622 3300021361 Bacteria 592
379 Ga0213876_10003406 3300021384 Bacteria 9099
380 Ga0213871_10311541 3300021441 Bacteria 510
381 Ga0256744_117912 3300023309 Bacteria 1150
382 Ga0256720_148736 3300023438 Bacteria 626
383 Ga0207427_104861 3300025231 Bacteria 2078
384 Ga0209233_1000013 3300025261 Bacteria 1013785
385 Ga0209455_1008380 3300025272 Bacteria 2813
386 Ga0209758_1000013 3300025297 Bacteria 873003
387 Ga0207656_10068548 3300025321 Bacteria 1572
388 Ga0207653_10073529 3300025885 Bacteria 1172
389 Ga0207653_10075550 3300025885 Bacteria 1158
390 Ga0207642_10465669 3300025899 Bacteria 768
391 Ga0207710_10206345 3300025900 Bacteria 972
392 Ga0207680_10035901 3300025903 Bacteria 2851
393 Ga0207680_10193851 3300025903 Bacteria 1381
394 Ga0207680_10294370 3300025903 Bacteria 1130
395 Ga0207680_11312866 3300025903 Bacteria 514
396 Ga0207647_10069690 3300025904 Bacteria 2126
397 Ga0207685_10002550 3300025905 Bacteria 4204
398 Ga0207645_10027676 3300025907 Bacteria 3659
399 Ga0207645_11026796 3300025907 Bacteria 558
400 Ga0207643_10321808 3300025908 Bacteria 966
401 Ga0207705_10004936 3300025909 Bacteria 10013
402 Ga0207705_10035805 3300025909 Bacteria 3551
403 Ga0207705_10076496 3300025909 Bacteria 2433
404 Ga0207705_10591827 3300025909 Bacteria 862
405 Ga0207707_10010230 3300025912 Bacteria 8144
406 Ga0207707_10014060 3300025912 Bacteria 6977
407 Ga0207707_10038191 3300025912 Bacteria 4196
408 Ga0207707_10056826 3300025912 Bacteria 3405
409 Ga0207707_10115614 3300025912 Bacteria 2344
410 Ga0207707_10156822 3300025912 Bacteria 1991
411 Ga0207707_10161372 3300025912 Bacteria 1960
412 Ga0207707_10484945 3300025912 Bacteria 1056
413 Ga0207695_10000575 3300025913 Bacteria 74997
414 Ga0207695_10259669 3300025913 Bacteria 1635
415 Ga0207695_10403007 3300025913 Bacteria 1252
416 Ga0207695_10579178 3300025913 Bacteria 1004
417 Ga0207695_10752667 3300025913 Bacteria 855
418 Ga0207695_10863779 3300025913 Bacteria 785
419 Ga0207671_10401373 3300025914 Bacteria 1090
420 Ga0207671_10705708 3300025914 Bacteria 802
421 Ga0207693_10275682 3300025915 Bacteria 1318
422 Ga0207660_10000537 3300025917 Bacteria 25426
423 Ga0207660_10003004 3300025917 Bacteria 11039
424 Ga0207660_10052376 3300025917 Bacteria 2905
425 Ga0207660_10146738 3300025917 Bacteria 1809
426 Ga0207660_10155049 3300025917 Bacteria 1763
427 Ga0207662_10130312 3300025918 Bacteria 1585
428 Ga0207662_10356421 3300025918 Bacteria 983
429 Ga0207657_10006388 3300025919 Bacteria 12240
430 Ga0207657_10021181 3300025919 Bacteria 6124
431 Ga0207657_10083597 3300025919 Bacteria 2678
432 Ga0207657_10100998 3300025919 Bacteria 2394
433 Ga0207657_10290398 3300025919 Bacteria 1297
434 Ga0207649_11136592 3300025920 Bacteria 617
435 Ga0207652_10045523 3300025921 Bacteria 3741
436 Ga0207652_10048851 3300025921 Bacteria 3619
437 Ga0207652_10116633 3300025921 Bacteria 2372
438 Ga0207652_10154260 3300025921 Bacteria 2057
439 Ga0207652_10271075 3300025921 Bacteria 1531
440 Ga0207652_10546380 3300025921 Bacteria 1041
441 Ga0207646_10178105 3300025922 Bacteria 1920
442 Ga0207681_10078471 3300025923 Bacteria 2324
443 Ga0207681_10191943 3300025923 Bacteria 1563
444 Ga0207694_10021191 3300025924 Bacteria 4923
445 Ga0207694_10279826 3300025924 Bacteria 1370
446 Ga0207694_10581570 3300025924 Bacteria 941
447 Ga0207659_11379701 3300025926 Bacteria 604
448 Ga0207687_10155570 3300025927 Bacteria 1749
449 Ga0207687_10527637 3300025927 Bacteria 988
450 Ga0207687_10625466 3300025927 Bacteria 909
451 Ga0207687_10945196 3300025927 Bacteria 738
452 Ga0207687_11507210 3300025927 Bacteria 578
453 Ga0207700_10719333 3300025928 Bacteria 892
454 Ga0207700_11264045 3300025928 Bacteria 658
455 Ga0207700_12009809 3300025928 Bacteria 505
456 Ga0207664_10000478 3300025929 Bacteria 28408
457 Ga0207664_11336705 3300025929 Bacteria 637
458 Ga0207664_11404239 3300025929 Bacteria 619
459 Ga0207644_10078687 3300025931 Bacteria 2431
460 Ga0207644_10420732 3300025931 Bacteria 1094
461 Ga0207690_10000322 3300025932 Bacteria 32043
462 Ga0207690_10008862 3300025932 Bacteria 5970
463 Ga0207690_10008933 3300025932 Bacteria 5948
464 Ga0207690_10232426 3300025932 Bacteria 1416
465 Ga0207706_10025334 3300025933 Bacteria 5315
466 Ga0207706_10205402 3300025933 Bacteria 1727
467 Ga0207706_10531531 3300025933 Bacteria 1013
468 Ga0207706_10548571 3300025933 Bacteria 995
469 Ga0207706_11004057 3300025933 Bacteria 701
470 Ga0207706_11532526 3300025933 Bacteria 542
471 Ga0207709_10007982 3300025935 Bacteria 5862
472 Ga0207709_10384088 3300025935 Bacteria 1069
473 Ga0207670_10366911 3300025936 Bacteria 1144
474 Ga0207670_10396942 3300025936 Bacteria 1102
475 Ga0207691_10350676 3300025940 Bacteria 1263
476 Ga0207691_10750320 3300025940 Bacteria 822
477 Ga0207711_10009066 3300025941 Bacteria 8311
478 Ga0207689_10013634 3300025942 Bacteria 6930
479 Ga0207689_10030241 3300025942 Bacteria 4513
480 Ga0207689_10221147 3300025942 Bacteria 1564
481 Ga0207689_10442129 3300025942 Bacteria 1086
482 Ga0207661_10058611 3300025944 Bacteria 3099
483 Ga0207661_10519997 3300025944 Bacteria 1088
484 Ga0207661_11055193 3300025944 Bacteria 748
485 Ga0207679_10981191 3300025945 Bacteria 774
486 Ga0207679_11662135 3300025945 Bacteria 585
487 Ga0207679_11747271 3300025945 Bacteria 569
488 Ga0207667_10026409 3300025949 Bacteria 6345
489 Ga0207667_10057429 3300025949 Bacteria 4085
490 Ga0207667_10063505 3300025949 Bacteria 3858
491 Ga0207667_10351288 3300025949 Bacteria 1504
492 Ga0207667_10411725 3300025949 Bacteria 1376
493 Ga0207667_10466180 3300025949 Bacteria 1283
494 Ga0207667_10589684 3300025949 Bacteria 1121
495 Ga0207651_10027205 3300025960 Bacteria 3588
496 Ga0207651_10174855 3300025960 Bacteria 1697
497 Ga0207712_10003369 3300025961 Bacteria 10107
498 Ga0207712_10246693 3300025961 Bacteria 1441
499 Ga0207668_10098919 3300025972 Bacteria 2162
500 Ga0207668_10222061 3300025972 Bacteria 1518
501 Ga0207668_10456132 3300025972 Bacteria 1092
502 Ga0207640_10503971 3300025981 Bacteria 1009
503 Ga0207640_11840477 3300025981 Bacteria 547
504 Ga0207658_10031844 3300025986 Bacteria 3749
505 Ga0207658_10231702 3300025986 Bacteria 1559
506 Ga0207658_10420427 3300025986 Bacteria 1178
507 Ga0207658_10593453 3300025986 Bacteria 994
508 Ga0207658_11283616 3300025986 Bacteria 669
509 Ga0207677_10646154 3300026023 Bacteria 933
510 Ga0207677_11091649 3300026023 Bacteria 727
511 Ga0207703_10124896 3300026035 Bacteria 2214
512 Ga0207703_10246380 3300026035 Bacteria 1609
513 Ga0207703_10644001 3300026035 Bacteria 1005
514 Ga0207703_10784666 3300026035 Bacteria 909
515 Ga0207703_12344404 3300026035 Bacteria 509
516 Ga0207639_10019252 3300026041 Bacteria 4866
517 Ga0207639_10117451 3300026041 Bacteria 2180
518 Ga0207639_10371523 3300026041 Bacteria 1282
519 Ga0207639_10734826 3300026041 Bacteria 917
520 Ga0207639_11620230 3300026041 Bacteria 607
521 Ga0207678_10000118 3300026067 Bacteria 65608
522 Ga0207678_10001998 3300026067 Bacteria 18570
523 Ga0207678_10092917 3300026067 Bacteria 2578
524 Ga0207678_10568602 3300026067 Bacteria 992
525 Ga0207678_10750054 3300026067 Bacteria 861
526 Ga0207708_10001023 3300026075 Bacteria 20938
527 Ga0207708_10079350 3300026075 Bacteria 2521
528 Ga0207708_10660023 3300026075 Bacteria 891
529 Ga0207708_10707224 3300026075 Bacteria 862
530 Ga0207708_11505701 3300026075 Bacteria 591
531 Ga0207702_10981532 3300026078 Bacteria 838
532 Ga0207641_10031526 3300026088 Bacteria 4397
533 Ga0207641_10064762 3300026088 Bacteria 3125
534 Ga0207641_10576200 3300026088 Bacteria 1100
535 Ga0207648_10025631 3300026089 Bacteria 5250
536 Ga0207648_10099185 3300026089 Bacteria 2551
537 Ga0207648_10217728 3300026089 Bacteria 1696
538 Ga0207648_10625804 3300026089 Bacteria 993
539 Ga0207648_10982180 3300026089 Bacteria 790
540 Ga0207648_11278503 3300026089 Bacteria 689
541 Ga0207676_10147003 3300026095 Bacteria 2025
542 Ga0207676_11589531 3300026095 Bacteria 651
543 Ga0207674_10038880 3300026116 Bacteria 4935
544 Ga0207674_10040450 3300026116 Bacteria 4829
545 Ga0207674_10066996 3300026116 Bacteria 3615
546 Ga0207674_10145952 3300026116 Bacteria 2325
547 Ga0207674_10430144 3300026116 Bacteria 1276
548 Ga0207674_11534436 3300026116 Bacteria 635
549 Ga0207675_100022568 3300026118 Bacteria 5859
550 Ga0207675_100066743 3300026118 Bacteria 3363
551 Ga0207675_100559964 3300026118 Bacteria 1143
552 Ga0207675_101024505 3300026118 Bacteria 844
553 Ga0207683_10190947 3300026121 Bacteria 1860
554 Ga0207683_10337170 3300026121 Bacteria 1382
555 Ga0207683_10432369 3300026121 Bacteria 1213
556 Ga0207683_10522017 3300026121 Bacteria 1097
557 Ga0207683_10566477 3300026121 Bacteria 1051
558 Ga0207698_10443331 3300026142 Bacteria 1251
559 Ga0207698_10522792 3300026142 Bacteria 1158
560 Ga0207698_10834411 3300026142 Bacteria 926
561 Ga0207698_10904180 3300026142 Bacteria 890
562 Ga0209981_1000043 3300027378 Bacteria 12361
563 Ga0209999_1007077 3300027543 Bacteria 2016
564 Ga0209983_1050968 3300027665 Bacteria 906
565 Ga0209813_10054754 3300027866 Bacteria 1258
566 Ga0207428_10007316 3300027907 Bacteria 10081
567 Ga0207428_10023296 3300027907 Bacteria 5209
568 Ga0207428_10156661 3300027907 Bacteria 1732
569 Ga0207428_10829115 3300027907 Bacteria 656
570 Ga0268266_10000106 3300028379 Bacteria 175109
571 Ga0268266_10000557 3300028379 Bacteria 51935
572 Ga0268266_10178394 3300028379 Bacteria 1932
573 Ga0268266_10233432 3300028379 Bacteria 1695
574 Ga0268266_11790024 3300028379 Bacteria 589
575 Ga0268265_10004169 3300028380 Bacteria 10121
576 Ga0268265_10052380 3300028380 Bacteria 3086
577 Ga0268265_10593862 3300028380 Bacteria 1057
578 Ga0268265_10775640 3300028380 Bacteria 932
579 Ga0268265_12266033 3300028380 Bacteria 550
580 Ga0268264_10002325 3300028381 Bacteria 16817
581 Ga0268264_10005719 3300028381 Bacteria 10538
582 Ga0268264_10201865 3300028381 Bacteria 1820
583 Ga0268264_10349240 3300028381 Bacteria 1407
584 Ga0268264_12263184 3300028381 Bacteria 551
585 Ga0265319_1102853 3300028563 Bacteria 896
586 Ga0265334_10127982 3300028573 Bacteria 905
587 Ga0265318_10004788 3300028577 Bacteria 6480
588 Ga0265336_10029236 3300028666 Bacteria 1720
589 Ga0307517_10012557 3300028786 Bacteria 11610
590 Ga0307515_10153824 3300028794 Bacteria 2387
591 Ga0307515_10173473 3300028794 Bacteria 2137
592 Ga0265338_10002896 3300028800 Bacteria 24981
593 Ga0265338_10046965 3300028800 Bacteria 3949
594 Ga0265338_10096847 3300028800 Bacteria 2419
595 Ga0265338_10156776 3300028800 Bacteria 1763
596 Ga0265338_10170295 3300028800 Bacteria 1671
597 Ga0265338_10664129 3300028800 Bacteria 722
598 Ga0265338_11063122 3300028800 Bacteria 546
599 Ga0310981_1020365 3300029285 Bacteria 861
600 Ga0310981_1053128 3300029285 Bacteria 1261
601 Ga0265770_1041356 3300030878 Bacteria 807
602 Ga0265761_105604 3300030889 Bacteria 659
603 Ga0265330_10077828 3300031235 Bacteria 1431
604 Ga0265332_10033404 3300031238 Bacteria 2239
605 Ga0265328_10157031 3300031239 Bacteria 857
606 Ga0265328_10296701 3300031239 Bacteria 624
607 Ga0265320_10057316 3300031240 Bacteria 1869
608 Ga0265320_10355914 3300031240 Bacteria 647
609 Ga0265325_10008115 3300031241 Bacteria 6223
610 Ga0265325_10146029 3300031241 Bacteria 1122
611 Ga0265329_10051749 3300031242 Bacteria 1307
612 Ga0265339_10063241 3300031249 Bacteria 1988
613 Ga0265339_10205030 3300031249 Bacteria 971
614 Ga0265331_10033733 3300031250 Bacteria 2530
615 Ga0265331_10035730 3300031250 Bacteria 2443
616 Ga0265331_10058532 3300031250 Bacteria 1824
617 Ga0265331_10063163 3300031250 Bacteria 1745
618 Ga0265316_10075091 3300031344 Bacteria 2600
619 Ga0265316_10100937 3300031344 Bacteria 2193
620 Ga0265316_10748816 3300031344 Bacteria 687
621 Ga0265316_10886912 3300031344 Bacteria 623
622 Ga0307513_10002446 3300031456 Bacteria 25748
623 Ga0307513_10009092 3300031456 Bacteria 12594
624 Ga0307513_10285642 3300031456 Bacteria 1425
625 Ga0307513_10387495 3300031456 Bacteria 1135
626 Ga0307513_10600403 3300031456 Bacteria 810
627 Ga0307509_10386543 3300031507 Bacteria 1111
628 Ga0307408_101933520 3300031548 Bacteria 566
629 Ga0265313_10006418 3300031595 Bacteria 8329
630 Ga0265313_10011787 3300031595 Bacteria 5406
631 Ga0265313_10081099 3300031595 Bacteria 1473
632 Ga0265313_10093517 3300031595 Bacteria 1345
633 Ga0265313_10197474 3300031595 Bacteria 838
634 Ga0265313_10328556 3300031595 Bacteria 609
635 Ga0307508_10171057 3300031616 Bacteria 1776
636 Ga0316579_10545452 3300031691 Bacteria 561
637 Ga0265314_10037136 3300031711 Bacteria 3533
638 Ga0265314_10049812 3300031711 Bacteria 2929
639 Ga0265314_10063782 3300031711 Bacteria 2498
640 Ga0265314_10081934 3300031711 Bacteria 2124
641 Ga0265314_10373438 3300031711 Bacteria 778
642 Ga0265342_10063846 3300031712 Bacteria 2163
643 Ga0265342_10086286 3300031712 Bacteria 1805
644 Ga0316576_10011989 3300031727 Bacteria 5706
645 Ga0316578_10084150 3300031728 Bacteria 1895
646 Ga0307516_10001565 3300031730 Bacteria 31484
647 Ga0307516_10104724 3300031730 Bacteria 2641
648 Ga0307405_10438305 3300031731 Bacteria 1033
649 Ga0307405_10942466 3300031731 Bacteria 733
650 Ga0316577_10030400 3300031733 Bacteria 3016
651 Ga0316577_10663423 3300031733 Bacteria 593
652 Ga0307413_10122230 3300031824 Bacteria 1766
653 Ga0307413_10485172 3300031824 Bacteria 989
654 Ga0307413_11365589 3300031824 Bacteria 622
655 Ga0307410_11498005 3300031852 Bacteria 594
656 Ga0307406_10327963 3300031901 Bacteria 1187
657 Ga0307406_10505848 3300031901 Bacteria 980
658 Ga0307406_10572785 3300031901 Bacteria 927
659 Ga0307412_11212886 3300031911 Bacteria 676
660 Ga0307412_11396599 3300031911 Bacteria 633
661 Ga0307412_11859440 3300031911 Bacteria 555
662 Ga0307409_100035784 3300031995 Bacteria 3642
663 Ga0307409_100050696 3300031995 Bacteria 3172
664 Ga0307409_100573334 3300031995 Bacteria 1111
665 Ga0307409_102742855 3300031995 Bacteria 521
666 Ga0307416_101912685 3300032002 Bacteria 696
667 Ga0307414_10097082 3300032004 Bacteria 2206
668 Ga0307414_10673833 3300032004 Bacteria 934
669 Ga0307414_10877295 3300032004 Bacteria 821
670 Ga0307414_10920124 3300032004 Bacteria 802
671 Ga0307411_10075136 3300032005 Bacteria 2306
672 Ga0307415_100169025 3300032126 Bacteria 1703
673 Ga0307510_10028447 3300033180 Bacteria 6383
674 Ga0307510_10168985 3300033180 Bacteria 1769
675 Ga0307510_10348817 3300033180 Bacteria 931
676 Ga0307510_10417455 3300033180 Bacteria 784
677 Ga0307510_10540988 3300033180 Bacteria 610
678 Ga0316596_1001896 3300033541 Bacteria 4374
679 Ga0373950_0003924 3300034818 Bacteria 2159
680 Ga0373950_0098931 3300034818 Bacteria 627
681 Ga0373958_0038915 3300034819 Bacteria 965
682 Ga0373959_0073071 3300034820 Bacteria 778
683 Ga0373938_0026082 3300034957 Bacteria 1221
684 Ga0373928_0039569 3300035084 Bacteria 1078
685 Ga0373929_0131098 3300035085 Bacteria 657
686 Ga0373940_0038650 3300035088 Bacteria 1303
687 Ga0373940_0075564 3300035088 Bacteria 988
688 Ga0373949_0042118 3300035090 Bacteria 1126
689 Ga0373951_0041827 3300035091 Bacteria 1107
690 Ga0373952_0003002 3300035092 Bacteria 3046
691 Ga0373952_0011057 3300035092 Bacteria 1754
692 Ga0373936_0102330 3300035113 Bacteria 1209
693 Ga0373939_0010321 3300035114 Bacteria 2333
694 Ga0373939_0052644 3300035114 Bacteria 1269
695 Ga0373941_0149178 3300035115 Bacteria 856
696 Ga0373941_0339322 3300035115 Bacteria 609
697 Ga0373945_0233133 3300035116 Bacteria 773
698 Ga0373945_0346528 3300035116 Bacteria 643
699 Ga0373953_0007154 3300035117 Bacteria 3723
700 Ga0373954_0129176 3300035118 Bacteria 1229
701 Ga0373956_0193735 3300035119 Bacteria 963
702 Ga0373960_0014902 3300035121 Bacteria 1976
703 Ga0373943_0260156 3300035170 Bacteria 977
704 Ga0373955_0085689 3300035172 Bacteria 1788
705 Ga0373942_0014138 3300035207 Bacteria 1928
706 Ga0373942_0073387 3300035207 Bacteria 1003
707 Ga0373961_0008082 3300035241 Bacteria 2556
708 Ga0373961_0074440 3300035241 Bacteria 1057
709 Ga0373961_0183781 3300035241 Bacteria 729
710 Ga0373962_0004031 3300035242 Bacteria 3538
711 Ga0373962_0012560 3300035242 Bacteria 2136
712 Ga0373962_0261189 3300035242 Bacteria 604
713 Ga0316574_0196185 3300035398 Bacteria 1298
714 Ga0316574_0302208 3300035398 Bacteria 1017
715 Ga0316574_0581708 3300035398 Bacteria 693
716 Ga0373931_0002939 3300035691 Bacteria 7603
717 Ga0373931_0005200 3300035691 Bacteria 6000
718 Ga0373931_0711394 3300035691 Bacteria 664
719 Ga0373935_0136168 3300035692 Bacteria 1655
720 Ga0373935_0690433 3300035692 Bacteria 750
721 Ga0373927_0000479 3300035695 Bacteria 30749
722 Ga0373927_0162569 3300035695 Bacteria 1463
723 Ga0373927_0188819 3300035695 Bacteria 1352
724 Ga0373927_0964677 3300035695 Bacteria 563
725 Ga0373933_0034262 3300035724 Bacteria 2958
726 Ga0373933_0554236 3300035724 Bacteria 754
727 Ga0373933_0600353 3300035724 Bacteria 723
728 Ga0373947_0052110 3300035725 Bacteria 2465
729 Ga0373947_0480313 3300035725 Bacteria 843
730 Ga0373947_0515441 3300035725 Bacteria 813
731 Ga0373937_0006001 3300036401 Bacteria 10455
732 Ga0373937_0143345 3300036401 Bacteria 2235
733 Ga0373937_0228037 3300036401 Bacteria 1754
734 Ga0316582_0065073 3300036647 Bacteria 2347
735 Ga0316584_0060375 3300036712 Bacteria 2839
736 Ga0373925_0000023 3300037068 Bacteria 158881
737 Ga0373925_0310107 3300037068 Bacteria 1275
738 Ga0373925_0557184 3300037068 Bacteria 943
739 Ga0373925_1295228 3300037068 Bacteria 598
740 Ga0395899_0004948 3300037312 Bacteria 10369
741 Ga0395899_0135860 3300037312 Bacteria 1753
742 Ga0395900_0054207 3300037418 Bacteria 4128
743 Ga0395900_0118387 3300037418 Bacteria 2718
744 Ga0395900_0294566 3300037418 Bacteria 1610
745 Ga0395898_0003055 3300037466 Bacteria 18965
746 Ga0395898_0086433 3300037466 Bacteria 3022
747 Ga0395898_0130907 3300037466 Bacteria 2403
748 Ga0395898_0141060 3300037466 Bacteria 2307
749 Ga0395905_1052736 3300037471 Bacteria 717
750 Ga0395905_1413361 3300037471 Bacteria 600
751 Ga0395901_0012391 3300038443 Bacteria 8650
752 Ga0395901_0250996 3300038443 Bacteria 1843
753 Ga0395901_0270554 3300038443 Bacteria 1767
754 Ga0395901_0493640 3300038443 Bacteria 1247
755 Ga0400490_05556 3300038726 Bacteria 1964
756 Ga0400485_18010 3300038735 Bacteria 1587
757 Ga0400485_18067 3300038735 Bacteria 3767
758 Ga0400488_60863 3300038741 Bacteria 2930
759 Ga0400486_19626 3300038742 Bacteria 1540
760 Ga0400486_26804 3300038742 Bacteria 1777
761 Ga0400483_275193 3300039062 Bacteria 1506
762 Ga0436365_0367003 3300039437 Bacteria 1382
763 Ga0436365_0697746 3300039437 Bacteria 24050
764 Ga0436365_1239236 3300039437 Bacteria 18833
765 Ga0436365_1281228 3300039437 Bacteria 2258
766 Ga0436360_0387015 3300039438 Bacteria 831
767 Ga0436360_0559098 3300039438 Bacteria 778
768 Ga0436361_0953537 3300039447 Bacteria 44604
769 Ga0436363_0491191 3300039450 Bacteria 758
770 Ga0436363_1304811 3300039450 Bacteria 720
771 Ga0436362_0512929 3300039453 Bacteria 519
772 Ga0436362_0526223 3300039453 Bacteria 805
773 Ga0436362_0940958 3300039453 Bacteria 802
774 Ga0439447_056999 3300041407 Bacteria 924
775 Ga0439465_0041536 3300041413 Bacteria 1489
776 Ga0439465_0056207 3300041413 Bacteria 1297
777 Ga0451790_24623 3300041444 Bacteria 565
778 Ga0451797_1305445 3300041453 Bacteria 1559
779 Ga0451795_0820506 3300041456 Bacteria 587
780 Ga0451800_0177595 3300041459 Bacteria 577
781 Ga0451800_1326835 3300041459 Bacteria 540
782 Ga0451839_1312103 3300041496 Bacteria 728
783 Ga0451846_63244 3300041502 Bacteria 579
784 Ga0451851_0517789 3300041507 Bacteria 688
785 Ga0451851_1169255 3300041507 Bacteria 512
786 Ga0439433_0046360 3300041999 Bacteria 1019
787 Ga0439448_0302565 3300042005 Bacteria 568
788 Ga0450897_043015 3300042128 Bacteria 534
789 Ga0450902_006870 3300042137 Bacteria 1750
790 Ga0450906_049166 3300042145 Unclassified 744
791 Ga0439435_0308571 3300042436 Bacteria 543
792 Ga0466969_0224559 3300044656 Bacteria 854
793 Ga0466966_0067594 3300044684 Bacteria 2244
794 Ga0466963_0052778 3300044694 Bacteria 2698
795 Ga0466963_0274798 3300044694 Bacteria 1184
796 Ga0453684_0022894 3300044712 Bacteria 9243
797 Ga0466957_0042883 3300044842 Bacteria 2738
798 Ga0466957_0176495 3300044842 Bacteria 1393
799 Ga0466957_0337115 3300044842 Bacteria 1020
800 Ga0466960_0094316 3300044901 Bacteria 1531
801 Ga0451576_0003979 3300045051 Bacteria 19673
802 Ga0466958_0277112 3300045836 Bacteria 1075
803 Ga0466958_0418373 3300045836 Bacteria 866
804 Ga0466967_0148237 3300045976 Bacteria 2190
805 Ga0466967_0928017 3300045976 Bacteria 866
806 Ga0466967_1031331 3300045976 Bacteria 819
807 Ga0495627_000399 3300046453 Bacteria 38947
808 Ga0495627_077937 3300046453 Bacteria 963
809 Ga0495603_0502067 3300046455 Bacteria 695
810 Ga0495590_0136108 3300046457 Bacteria 885
811 Ga0495629_0392276 3300046459 Bacteria 944
812 Ga0495638_0247288 3300046460 Bacteria 984
813 Ga0495638_0278505 3300046460 Bacteria 910
814 Ga0495638_0451268 3300046460 Bacteria 656
815 Ga0495638_0649888 3300046460 Bacteria 513
816 Ga0495653_0606452 3300046463 Bacteria 672
817 Ga0495580_0688532 3300046472 Bacteria 670
818 Ga0495605_0136067 3300046474 Bacteria 1105
819 Ga0495639_0574932 3300046475 Bacteria 578
820 Ga0495584_0027432 3300046491 Bacteria 2886
821 Ga0495584_0233145 3300046491 Bacteria 936
822 Ga0495585_0066533 3300046492 Bacteria 1973
823 Ga0495583_0048649 3300046506 Bacteria 1945
824 Ga0495606_0032036 3300046507 Bacteria 3647
825 Ga0495610_0307179 3300046512 Bacteria 609
826 Ga0495618_0184469 3300046514 Bacteria 1325
827 Ga0495620_0101865 3300046515 Bacteria 1144
828 Ga0495628_0966317 3300046516 Bacteria 588
829 Ga0495630_0702144 3300046517 Bacteria 774
830 Ga0495632_0079274 3300046519 Bacteria 1568
831 Ga0495632_0083729 3300046519 Bacteria 1518
832 Ga0495637_0367090 3300046520 Bacteria 503
833 Ga0495644_0251560 3300046523 Bacteria 686
834 Ga0495648_0206971 3300046524 Bacteria 977
835 Ga0495642_0075799 3300046528 Bacteria 1411
836 Ga0495652_0050149 3300046529 Bacteria 3570
837 Ga0495654_0060993 3300046530 Bacteria 1812
838 Ga0495640_0240079 3300046533 Bacteria 1138
839 Ga0495640_0447182 3300046533 Bacteria 790
840 Ga0495586_0376981 3300046535 Bacteria 816
841 Ga0495587_0740903 3300046536 Bacteria 538
842 Ga0495609_0061486 3300046538 Bacteria 1659
843 Ga0495622_0005663 3300046557 Bacteria 5792
844 Ga0495633_0000510 3300046558 Bacteria 39075
845 Ga0495633_0161794 3300046558 Bacteria 1033
846 Ga0495667_0103734 3300046559 Bacteria 1839
847 Ga0495656_0073584 3300046615 Bacteria 1524
848 Ga0495656_0523824 3300046615 Bacteria 630
849 Ga0495611_0076340 3300046648 Bacteria 1536
850 Ga0495611_0428415 3300046648 Bacteria 604
851 Ga0495625_0020239 3300046660 Bacteria 5143
852 Ga0495625_0087377 3300046660 Bacteria 2161
853 Ga0495659_0038300 3300046664 Bacteria 1702
854 Ga0495661_0128758 3300046665 Bacteria 1390
855 Ga0495588_0504029 3300046674 Bacteria 634
856 Ga0495646_0590075 3300046680 Bacteria 565
857 Ga0495658_0291721 3300046683 Bacteria 1031
858 Ga0495669_0175551 3300046684 Bacteria 1020
859 Ga0495669_0185650 3300046684 Bacteria 991
860 Ga0495613_0229804 3300046689 Bacteria 1300
861 Ga0495671_0129761 3300046692 Bacteria 1229
862 Ga0495649_0050668 3300046694 Bacteria 2252
863 Ga0495589_0086629 3300046794 Bacteria 1521
864 Ga0495604_0027202 3300047317 Bacteria 4551
865 Ga0495604_0536468 3300047317 Bacteria 756
866 Ga0495636_0052191 3300047318 Bacteria 1715
867 Ga0495636_0103531 3300047318 Bacteria 1247
868 Ga0495674_0802390 3300047319 Bacteria 732
869 Ga0495676_0264279 3300047321 Bacteria 1170
870 Ga0495683_0031924 3300047323 Bacteria 2683
871 Ga0495677_0143449 3300047445 Bacteria 917
872 Ga0495679_017960 3300047446 Bacteria 2522
873 Ga0495679_195562 3300047446 Bacteria 533
874 Ga0495685_082832 3300047447 Bacteria 1067
875 Ga0495673_0000189 3300047469 Bacteria 99018
876 Ga0495673_0158617 3300047469 Bacteria 870
877 Ga0495684_0922227 3300047471 Bacteria 561
878 Ga0495686_0000007 3300047472 Bacteria 732622
879 Ga0495615_0221308 3300048090 Bacteria 591
880 Ga0496100_0093096 3300048903 Bacteria 2061
881 Ga0496100_0215715 3300048903 Bacteria 1406
882 Ga0496100_0436428 3300048903 Bacteria 1002
883 Ga0496101_0044118 3300048904 Bacteria 3190
884 Ga0496101_0122223 3300048904 Bacteria 1969
885 Ga0496101_0139715 3300048904 Bacteria 1845
886 Ga0496101_0150505 3300048904 Bacteria 1780
887 Ga0496102_0002642 3300048905 Bacteria 15222
888 Ga0496102_0015318 3300048905 Bacteria 6676
889 Ga0496102_0029392 3300048905 Bacteria 4919
890 Ga0496102_0294433 3300048905 Bacteria 1530
891 Ga0496102_0318035 3300048905 Bacteria 1466
892 Ga0496102_0370286 3300048905 Bacteria 1348
893 Ga0496102_0455678 3300048905 Bacteria 1200
894 Ga0496103_0017034 3300048906 Bacteria 4344
895 Ga0496103_0035388 3300048906 Bacteria 3057
896 Ga0496103_0169394 3300048906 Bacteria 1402
897 Ga0496103_0209716 3300048906 Bacteria 1253
898 Ga0496104_0051414 3300048907 Bacteria 3890
899 Ga0496104_0061755 3300048907 Bacteria 3553
900 Ga0496104_0087155 3300048907 Bacteria 2981
901 Ga0496104_0609717 3300048907 Bacteria 1002
902 Ga0496104_0932809 3300048907 Bacteria 773
903 Ga0496105_0038459 3300048908 Bacteria 3941
904 Ga0496105_0098467 3300048908 Bacteria 2415
905 Ga0496106_0002278 3300048909 Bacteria 14316
906 Ga0496106_0004608 3300048909 Bacteria 10225
907 Ga0496106_0384857 3300048909 Bacteria 1127
908 Ga0496107_0018263 3300048910 Bacteria 4936
909 Ga0496107_0098093 3300048910 Bacteria 2146
910 Ga0496107_0366440 3300048910 Bacteria 1072
911 Ga0496107_0678626 3300048910 Bacteria 758
912 Ga0496107_0743478 3300048910 Bacteria 720
913 Ga0496107_0973644 3300048910 Bacteria 616
914 Ga0496108_0010640 3300048911 Bacteria 7463
915 Ga0496108_0100742 3300048911 Bacteria 2464
916 Ga0496108_0160553 3300048911 Bacteria 1942
917 Ga0496109_0095451 3300048912 Bacteria 2753
918 Ga0496109_0139689 3300048912 Bacteria 2265
919 Ga0496109_0223543 3300048912 Bacteria 1771
920 Ga0496110_0018375 3300048913 Bacteria 5862
921 Ga0496110_1106175 3300048913 Bacteria 700
922 Ga0496111_0267272 3300048914 Bacteria 1269
923 Ga0496111_0480506 3300048914 Bacteria 915
924 Ga0496112_0043241 3300048915 Bacteria 4410
925 Ga0496112_0077705 3300048915 Bacteria 3283
926 Ga0496112_0400670 3300048915 Bacteria 1312
927 Ga0496112_1692895 3300048915 Bacteria 545
928 Ga0496113_0464420 3300048916 Bacteria 1017
929 Ga0496113_0990499 3300048916 Bacteria 662
930 Ga0496113_1518333 3300048916 Bacteria 517
931 Ga0496114_0148509 3300048917 Bacteria 2033
932 Ga0496114_0389759 3300048917 Bacteria 1234
933 Ga0496114_0765310 3300048917 Bacteria 843
934 Ga0496114_0855636 3300048917 Bacteria 790
935 Ga0496115_0001049 3300048918 Bacteria 20043
936 Ga0496115_0001671 3300048918 Bacteria 15949
937 Ga0496115_0003309 3300048918 Bacteria 11572
938 Ga0496115_0017590 3300048918 Bacteria 5470
939 Ga0496115_0032794 3300048918 Bacteria 4099
940 Ga0496115_0098395 3300048918 Bacteria 2396
941 Ga0496116_0078632 3300048919 Bacteria 2056
942 Ga0496117_0146665 3300048920 Bacteria 1404
943 Ga0496120_0067960 3300048923 Bacteria 1967
944 Ga0496121_0006108 3300048924 Bacteria 15150
945 Ga0496121_0253153 3300048924 Bacteria 1220
946 Ga0496121_0258393 3300048924 Bacteria 1204
947 Ga0496122_0035977 3300048925 Bacteria 4015
948 Ga0496122_0188410 3300048925 Bacteria 1220
949 Ga0496123_0000699 3300048926 Bacteria 55169
950 Ga0496124_0119515 3300048927 Bacteria 2108
951 Ga0496124_0387394 3300048927 Bacteria 975
952 Ga0496124_0467131 3300048927 Bacteria 856
953 Ga0496124_0933360 3300048927 Bacteria 523
954 Ga0496125_0011137 3300048928 Bacteria 9019
955 Ga0496125_0110284 3300048928 Bacteria 1996
956 Ga0496126_0031566 3300048929 Bacteria 5002
957 Ga0496126_0094915 3300048929 Bacteria 2617
958 Ga0496126_0680280 3300048929 Bacteria 802
959 Ga0496126_0685237 3300048929 Bacteria 798
960 Ga0496126_0913724 3300048929 Bacteria 665
961 Ga0501308_027199 3300049128 Bacteria 750
962 Ga0501308_046599 3300049128 Bacteria 625
963 Ga0501309_058434 3300049129 Bacteria 617
964 Ga0501310_068948 3300049130 Bacteria 539
965 Ga0501341_00973 3300049131 Bacteria 1351
966 Ga0501307_005363 3300049162 Bacteria 1349
967 Ga0495678_005745 3300049459 Bacteria 6741
968 Ga0495682_0189414 3300049460 Bacteria 730
969 Ga0501311_001594 3300049527 Bacteria 2015
970 Ga0501311_004336 3300049527 Bacteria 1505
971 Ga0501311_014284 3300049527 Bacteria 1012
972 Ga0501314_042818 3300049530 Bacteria 531
973 Ga0501315_016915 3300049531 Bacteria 948
974 Ga0501315_018380 3300049531 Bacteria 921
975 Ga0501316_071005 3300049532 Bacteria 527
976 Ga0501317_006005 3300049533 Bacteria 1321
977 Ga0501317_011743 3300049533 Bacteria 1070
978 Ga0501317_066260 3300049533 Bacteria 602
979 Ga0501317_085576 3300049533 Bacteria 551
980 Ga0501318_005621 3300049534 Bacteria 1251
981 Ga0501318_009292 3300049534 Bacteria 1069
982 Ga0501319_000156 3300049535 Bacteria 2646
983 Ga0501323_008595 3300049539 Bacteria 1188
984 Ga0501323_011490 3300049539 Bacteria 1069
985 Ga0501323_070165 3300049539 Bacteria 560
986 Ga0501325_007275 3300049541 Bacteria 933
987 Ga0501031_0018496 3300049568 Bacteria 4534
988 Ga0501031_0122081 3300049568 Bacteria 1702
989 Ga0501031_0126957 3300049568 Bacteria 1666
990 Ga0501032_0004362 3300049569 Bacteria 10681
991 Ga0501032_0289863 3300049569 Bacteria 1059
992 Ga0501032_0328982 3300049569 Bacteria 986
993 Ga0501032_0511585 3300049569 Bacteria 767
994 Ga0501032_0669897 3300049569 Bacteria 658
995 Ga0501033_0012917 3300049570 Bacteria 6369
996 Ga0501033_0044704 3300049570 Bacteria 3296
997 Ga0501033_0082082 3300049570 Bacteria 2364
998 Ga0501033_0094343 3300049570 Bacteria 2188
999 Ga0501033_0129530 3300049570 Bacteria 1828
1000 Ga0501033_0226014 3300049570 Bacteria 1331
1001 Ga0501033_0270110 3300049570 Bacteria 1202
1002 Ga0501033_0515904 3300049570 Bacteria 826
1003 Ga0501033_0571565 3300049570 Bacteria 777
1004 Ga0501033_0922255 3300049570 Bacteria 586
1005 Ga0501034_0000208 3300049571 Bacteria 111739
1006 Ga0501034_0009460 3300049571 Bacteria 10201
1007 Ga0501034_0063720 3300049571 Bacteria 3700
1008 Ga0501034_0067818 3300049571 Bacteria 3579
1009 Ga0501034_0123530 3300049571 Bacteria 2574
1010 Ga0501034_0181982 3300049571 Bacteria 2066
1011 Ga0501034_0202292 3300049571 Bacteria 1944
1012 Ga0501034_0213528 3300049571 Bacteria 1884
1013 Ga0501034_0357812 3300049571 Bacteria 1387
1014 Ga0501034_0442181 3300049571 Bacteria 1219
1015 Ga0501034_0484804 3300049571 Bacteria 1151
1016 Ga0501034_0598496 3300049571 Bacteria 1008
1017 Ga0501034_0606783 3300049571 Bacteria 999
1018 Ga0501034_0643494 3300049571 Bacteria 962
1019 Ga0501034_1619741 3300049571 Bacteria 520
1020 Ga0501036_0027433 3300049572 Bacteria 4811
1021 Ga0501036_0072449 3300049572 Bacteria 2912
1022 Ga0501036_0076785 3300049572 Bacteria 2826
1023 Ga0501036_0401367 3300049572 Bacteria 1144
1024 Ga0501036_0437121 3300049572 Bacteria 1090
1025 Ga0501036_0450143 3300049572 Bacteria 1073
1026 Ga0501036_0599766 3300049572 Bacteria 913
1027 Ga0501036_0708953 3300049572 Bacteria 831
1028 Ga0501036_0806694 3300049572 Bacteria 773
1029 Ga0501036_0815168 3300049572 Bacteria 768
1030 Ga0501036_1141308 3300049572 Bacteria 636
1031 Ga0501036_1433706 3300049572 Bacteria 559
1032 Ga0501037_0005168 3300049573 Bacteria 9497
1033 Ga0501037_0023671 3300049573 Bacteria 4540
1034 Ga0501037_0029353 3300049573 Bacteria 4063
1035 Ga0501037_0418622 3300049573 Bacteria 917
1036 Ga0501037_0684765 3300049573 Bacteria 683
1037 Ga0501038_0000069 3300049574 Bacteria 84666
1038 Ga0501038_0009962 3300049574 Bacteria 8704
1039 Ga0501038_0269357 3300049574 Bacteria 1343
1040 Ga0501038_0402943 3300049574 Bacteria 1058
1041 Ga0501038_0485697 3300049574 Bacteria 946
1042 Ga0501038_0525631 3300049574 Bacteria 902
1043 Ga0501038_0636953 3300049574 Bacteria 804
1044 Ga0501038_0661597 3300049574 Bacteria 785
1045 Ga0501038_0732930 3300049574 Bacteria 738
1046 Ga0501038_0807937 3300049574 Bacteria 696
1047 Ga0501039_0000072 3300049575 Bacteria 76673
1048 Ga0501039_0014819 3300049575 Bacteria 5962
1049 Ga0501039_0166307 3300049575 Bacteria 1734
1050 Ga0501039_0450135 3300049575 Bacteria 1011
1051 Ga0501039_0547576 3300049575 Bacteria 908
1052 Ga0501039_0613820 3300049575 Bacteria 852
1053 Ga0501039_0648893 3300049575 Bacteria 826
1054 Ga0501039_0681252 3300049575 Bacteria 804
1055 Ga0501039_0769915 3300049575 Bacteria 751
1056 Ga0501039_1145568 3300049575 Bacteria 602
1057 Ga0501040_0085266 3300049576 Bacteria 2192
1058 Ga0501040_0378603 3300049576 Bacteria 1015
1059 Ga0501040_0550938 3300049576 Bacteria 832
1060 Ga0501040_0655701 3300049576 Bacteria 759
1061 Ga0501040_1222801 3300049576 Bacteria 545
1062 Ga0501041_0118391 3300049577 Bacteria 1645
1063 Ga0501041_0509396 3300049577 Bacteria 766
1064 Ga0501041_0590807 3300049577 Bacteria 708
1065 Ga0501042_0016472 3300049578 Bacteria 5073
1066 Ga0501042_0447496 3300049578 Bacteria 937
1067 Ga0501042_0768679 3300049578 Bacteria 701
1068 Ga0501042_1000071 3300049578 Bacteria 609
1069 Ga0501042_1088683 3300049578 Bacteria 583
1070 Ga0501043_0057196 3300049579 Bacteria 3062
1071 Ga0501043_0172568 3300049579 Bacteria 1687
1072 Ga0501043_0411029 3300049579 Bacteria 1021
1073 Ga0501043_0538625 3300049579 Bacteria 869
1074 Ga0501043_0651224 3300049579 Bacteria 774
1075 Ga0501043_0987574 3300049579 Bacteria 600
1076 Ga0501043_0990134 3300049579 Bacteria 599
1077 Ga0501046_0000045 3300049580 Bacteria 144492
1078 Ga0501046_0004977 3300049580 Bacteria 11926
1079 Ga0501046_0005416 3300049580 Bacteria 11410
1080 Ga0501046_0016665 3300049580 Bacteria 6147
1081 Ga0501046_0021690 3300049580 Bacteria 5297
1082 Ga0501046_0171333 3300049580 Bacteria 1629
1083 Ga0501046_0180748 3300049580 Bacteria 1577
1084 Ga0501046_0313286 3300049580 Bacteria 1144
1085 Ga0501046_0333543 3300049580 Bacteria 1103
1086 Ga0501047_0001212 3300049581 Bacteria 25586
1087 Ga0501047_0014860 3300049581 Bacteria 7410
1088 Ga0501047_0046064 3300049581 Bacteria 4216
1089 Ga0501047_0164561 3300049581 Bacteria 2089
1090 Ga0501047_0334586 3300049581 Bacteria 1352
1091 Ga0501047_0407290 3300049581 Bacteria 1192
1092 Ga0501047_0538509 3300049581 Bacteria 992
1093 Ga0501047_1019154 3300049581 Bacteria 641
1094 Ga0501047_1069360 3300049581 Bacteria 620
1095 Ga0501048_0000501 3300049582 Bacteria 27413
1096 Ga0501048_0082989 3300049582 Bacteria 2260
1097 Ga0501048_0089966 3300049582 Bacteria 2165
1098 Ga0501048_0312882 3300049582 Bacteria 1118
1099 Ga0501067_0001102 3300049583 Bacteria 14576
1100 Ga0501067_0008019 3300049583 Bacteria 5865
1101 Ga0501067_0073051 3300049583 Bacteria 1900
1102 Ga0501067_0073295 3300049583 Bacteria 1897
1103 Ga0501067_0124203 3300049583 Bacteria 1437
1104 Ga0501067_0283029 3300049583 Bacteria 923
1105 Ga0501067_0311891 3300049583 Bacteria 876
1106 Ga0501067_0592349 3300049583 Bacteria 622
1107 Ga0501068_0154668 3300049584 Bacteria 1443
1108 Ga0501068_0251126 3300049584 Bacteria 1127
1109 Ga0501068_0532634 3300049584 Bacteria 763
1110 Ga0501068_1061389 3300049584 Bacteria 535
1111 Ga0501069_0004829 3300049585 Bacteria 6980
1112 Ga0501069_0071224 3300049585 Bacteria 1948
1113 Ga0501069_0132004 3300049585 Bacteria 1430
1114 Ga0501069_0175997 3300049585 Bacteria 1236
1115 Ga0501069_0468363 3300049585 Bacteria 750
1116 Ga0501070_0016943 3300049586 Bacteria 6115
1117 Ga0501070_0106653 3300049586 Bacteria 2315
1118 Ga0501070_0160366 3300049586 Bacteria 1854
1119 Ga0501070_0390283 3300049586 Bacteria 1127
1120 Ga0501070_0432667 3300049586 Bacteria 1062
1121 Ga0501070_0462200 3300049586 Bacteria 1022
1122 Ga0501070_0547289 3300049586 Bacteria 927
1123 Ga0501070_0603528 3300049586 Bacteria 875
1124 Ga0501070_0798815 3300049586 Bacteria 741
1125 Ga0501070_0919529 3300049586 Bacteria 682
1126 Ga0501071_0034272 3300049587 Bacteria 3612
1127 Ga0501071_0322356 3300049587 Bacteria 1173
1128 Ga0501071_0436307 3300049587 Bacteria 1002
1129 Ga0501071_0638969 3300049587 Bacteria 819
1130 Ga0501071_1171802 3300049587 Bacteria 594
1131 Ga0501071_1248804 3300049587 Bacteria 574
1132 Ga0501072_0134262 3300049588 Bacteria 1973
1133 Ga0501072_0147528 3300049588 Bacteria 1876
1134 Ga0501072_0163516 3300049588 Bacteria 1776
1135 Ga0501072_0208507 3300049588 Bacteria 1557
1136 Ga0501072_0482486 3300049588 Bacteria 981
1137 Ga0501072_0526950 3300049588 Bacteria 934
1138 Ga0501072_1096059 3300049588 Bacteria 620
1139 Ga0501072_1150109 3300049588 Bacteria 603
1140 Ga0501072_1525348 3300049588 Bacteria 516
1141 Ga0501073_0001669 3300049589 Bacteria 16438
1142 Ga0501073_0024093 3300049589 Bacteria 4370
1143 Ga0501073_0029749 3300049589 Bacteria 3904
1144 Ga0501073_0076482 3300049589 Bacteria 2329
1145 Ga0501073_0213301 3300049589 Bacteria 1334
1146 Ga0501073_0350204 3300049589 Bacteria 1020
1147 Ga0501073_0429999 3300049589 Bacteria 912
1148 Ga0501073_0460050 3300049589 Bacteria 880
1149 Ga0501073_0586976 3300049589 Bacteria 770
1150 Ga0501073_0875787 3300049589 Bacteria 618
1151 Ga0501074_0004453 3300049590 Bacteria 10023
1152 Ga0501074_0012386 3300049590 Bacteria 6199
1153 Ga0501074_0261439 3300049590 Bacteria 1230
1154 Ga0501074_0467707 3300049590 Bacteria 894
1155 Ga0501074_0508823 3300049590 Bacteria 853
1156 Ga0501074_0523107 3300049590 Bacteria 840
1157 Ga0501074_0583602 3300049590 Bacteria 791
1158 Ga0501074_0742033 3300049590 Bacteria 692
1159 Ga0501075_0062889 3300049591 Bacteria 2798
1160 Ga0501075_0178154 3300049591 Bacteria 1622
1161 Ga0501075_0244635 3300049591 Bacteria 1367
1162 Ga0501075_0316490 3300049591 Bacteria 1189
1163 Ga0501075_1269028 3300049591 Bacteria 558
1164 Ga0501076_0217802 3300049592 Bacteria 1560
1165 Ga0501076_0368912 3300049592 Bacteria 1180
1166 Ga0501076_0571613 3300049592 Bacteria 932
1167 Ga0501076_0573295 3300049592 Bacteria 931
1168 Ga0501076_0606309 3300049592 Bacteria 903
1169 Ga0501076_0608996 3300049592 Bacteria 901
1170 Ga0501076_1397253 3300049592 Bacteria 575
1171 Ga0501077_0007051 3300049593 Bacteria 6929
1172 Ga0501077_0067662 3300049593 Bacteria 2264
1173 Ga0501077_0072576 3300049593 Bacteria 2181
1174 Ga0501077_0334534 3300049593 Bacteria 966
1175 Ga0501077_0609326 3300049593 Bacteria 701
1176 Ga0501077_0695917 3300049593 Bacteria 653
1177 Ga0501238_001704 3300049671 Bacteria 2563
1178 Ga0501079_0001478 3300049741 Bacteria 16629
1179 Ga0501079_0022217 3300049741 Bacteria 4863
1180 Ga0501079_0085229 3300049741 Bacteria 2445
1181 Ga0501079_0699080 3300049741 Bacteria 798
1182 Ga0501079_0757933 3300049741 Bacteria 764
1183 Ga0501079_0782294 3300049741 Bacteria 751
1184 Ga0501080_0000005 3300049742 Bacteria 176271
1185 Ga0501080_0010846 3300049742 Bacteria 8339
1186 Ga0501080_0188525 3300049742 Bacteria 1896
1187 Ga0501080_0517088 3300049742 Bacteria 1065
1188 Ga0501080_0615338 3300049742 Bacteria 963
1189 Ga0501080_1520202 3300049742 Bacteria 568
1190 Ga0501081_0042743 3300049743 Bacteria 3106
1191 Ga0501081_0113773 3300049743 Bacteria 1922
1192 Ga0501081_0422688 3300049743 Bacteria 988
1193 Ga0501081_0433895 3300049743 Bacteria 975
1194 Ga0501081_0465185 3300049743 Bacteria 940
1195 Ga0501081_0935444 3300049743 Bacteria 654
1196 Ga0501081_1054618 3300049743 Bacteria 615
1197 Ga0501083_0022615 3300049744 Bacteria 4362
1198 Ga0501083_0114508 3300049744 Bacteria 1771
1199 Ga0501083_0225221 3300049744 Bacteria 1221
1200 Ga0501083_1014560 3300049744 Bacteria 540
1201 Ga0501083_1087282 3300049744 Bacteria 520
1202 Ga0501035_0000049 3300049822 Bacteria 145684
1203 Ga0501035_0030043 3300049822 Bacteria 4955
1204 Ga0501035_0050699 3300049822 Bacteria 3719
1205 Ga0501035_0113525 3300049822 Bacteria 2373
1206 Ga0501035_0186418 3300049822 Bacteria 1785
1207 Ga0501035_0351623 3300049822 Bacteria 1233
1208 Ga0501035_0415470 3300049822 Bacteria 1117
1209 Ga0501035_0696089 3300049822 Bacteria 820
1210 Ga0501035_0804700 3300049822 Bacteria 750
1211 Ga0501035_1403280 3300049822 Bacteria 535
1212 Ga0501044_0000030 3300049823 Bacteria 173442
1213 Ga0501044_0024878 3300049823 Bacteria 6351
1214 Ga0501044_0027898 3300049823 Bacteria 5959
1215 Ga0501044_0210409 3300049823 Bacteria 1899
1216 Ga0501044_0237864 3300049823 Bacteria 1766
1217 Ga0501044_0272626 3300049823 Bacteria 1627
1218 Ga0501044_0321454 3300049823 Bacteria 1472
1219 Ga0501044_0419727 3300049823 Bacteria 1248
1220 Ga0501044_0462733 3300049823 Bacteria 1173
1221 Ga0501044_0469605 3300049823 Bacteria 1162
1222 Ga0501044_0666789 3300049823 Bacteria 928
1223 Ga0501044_0793535 3300049823 Bacteria 827
1224 Ga0501045_0026586 3300049824 Bacteria 4165
1225 Ga0501045_0068338 3300049824 Bacteria 2610
1226 Ga0501045_0110710 3300049824 Bacteria 2036
1227 Ga0501045_0388511 3300049824 Bacteria 1039
1228 Ga0501045_0462869 3300049824 Bacteria 942
1229 Ga0501045_0610950 3300049824 Bacteria 807
1230 Ga0501045_1139098 3300049824 Bacteria 570
1231 nmdc:mga03683_70319_c1 3300050489 Bacteria 1495
1232 nmdc:mga0yw44_205378_c1 3300050492 Bacteria 1302
1233 nmdc:mga0yw44_319256_c1 3300050492 Bacteria 1043
1234 nmdc:mga0yw44_70411_c1 3300050492 Bacteria 2168
1235 nmdc:mga0k408_139435_c1 3300050493 Bacteria 1442
1236 nmdc:mga0k408_36414_c1 3300050493 Bacteria 2824
1237 nmdc:mga06z11_14438_c1 3300050494 Bacteria 3499
1238 nmdc:mga04h51_2833_c1 3300050495 Bacteria 4152
1239 nmdc:mga07m45_231865_c1 3300050496 Bacteria 1074
1240 nmdc:mga05p37_1596261_c1 3300050507 Bacteria 643
1241 nmdc:mga05p37_172193_c1 3300050507 Bacteria 2640
1242 nmdc:mga05p37_236239_c1 3300050507 Bacteria 2200
1243 nmdc:mga05p37_317241_c1 3300050507 Bacteria 1846
1244 nmdc:mga05p37_56603_c1 3300050507 Bacteria 4828
1245 nmdc:mga05p37_780216_c1 3300050507 Bacteria 1049
1246 nmdc:mga09592_165761_c1 3300050508 Bacteria 1910
1247 nmdc:mga09592_8483_c1 3300050508 Bacteria 8357
1248 nmdc:mga0qj67_186404_c1 3300050509 Bacteria 1686
1249 nmdc:mga0qj67_211251_c1 3300050509 Bacteria 1576
1250 nmdc:mga0qj67_344652_c1 3300050509 Bacteria 1205
1251 nmdc:mga0qj67_4050_c1 3300050509 Bacteria 10619
1252 nmdc:mga06r32_385104_c1 3300050510 Bacteria 1385
1253 nmdc:mga06r32_650083_c1 3300050510 Bacteria 1023
1254 nmdc:mga06r32_660_c1 3300050510 Bacteria 30156
1255 nmdc:mga06r32_671829_c1 3300050510 Bacteria 1003
1256 nmdc:mga08y16_1220500_c1 3300050511 Bacteria 722
1257 nmdc:mga08y16_174191_c1 3300050511 Bacteria 2234
1258 nmdc:mga08y16_29815_c1 3300050511 Bacteria 5745
1259 nmdc:mga08y16_31334_c1 3300050511 Bacteria 5593
1260 nmdc:mga08y16_45619_c1 3300050511 Bacteria 4592
1261 nmdc:mga08y16_867444_c1 3300050511 Bacteria 891
1262 nmdc:mga0n895_173736_c1 3300050512 Bacteria 2186
1263 nmdc:mga0n895_2833_c1 3300050512 Bacteria 13734
1264 nmdc:mga0n895_400566_c1 3300050512 Bacteria 1388
1265 nmdc:mga0rr50_38822_c1 3300050513 Bacteria 3449
1266 nmdc:mga0rr50_970250_c1 3300050513 Bacteria 724
1267 nmdc:mga08x19_522658_c1 3300050514 Bacteria 839
1268 nmdc:mga0a205_2479_c1 3300050515 Bacteria 16274
1269 nmdc:mga0a205_396682_c1 3300050515 Bacteria 1244
1270 nmdc:mga0a205_685731_c1 3300050515 Bacteria 875
1271 nmdc:mga0sz30_24066_c1 3300050516 Bacteria 2483
1272 Ga0495601_0194481 3300053077 Bacteria 1326
1273 Ga0495601_0939069 3300053077 Bacteria 545
1274 Ga0495612_0018232 3300053078 Bacteria 2811
1275 Ga0500635_0031075 3300053080 Bacteria 1726
1276 Ga0495595_0051526 3300053084 Bacteria 1908
1277 Ga0495619_0057702 3300053085 Bacteria 2576
1278 Ga0495619_0125055 3300053085 Bacteria 1764
1279 Ga0495619_0578918 3300053085 Bacteria 769
1280 Ga0500578_0000459 3300053086 Bacteria 49572
1281 Ga0500643_000003 3300053087 Bacteria 876659
1282 Ga0500643_001398 3300053087 Bacteria 13944
1283 Ga0500643_002694 3300053087 Bacteria 8926
1284 Ga0500644_0163011 3300053088 Bacteria 902
1285 Ga0500583_0162063 3300053092 Bacteria 1114
1286 Ga0500566_0487259 3300053094 Bacteria 533
1287 Ga0500641_0097697 3300053096 Bacteria 1258
1288 Ga0500648_374559 3300053097 Bacteria 561
1289 Ga0500554_070188 3300053102 Bacteria 1139
1290 Ga0500555_050120 3300053103 Bacteria 1144
1291 Ga0500556_0000636 3300053104 Bacteria 22036
1292 Ga0500556_0030971 3300053104 Bacteria 1817
1293 Ga0500557_217408 3300053105 Bacteria 609
1294 Ga0500562_003308 3300053108 Bacteria 4029
1295 Ga0500572_000706 3300053111 Bacteria 10831
1296 Ga0500594_0123906 3300053118 Bacteria 813
1297 Ga0500594_0160110 3300053118 Bacteria 727
1298 Ga0500595_030639 3300053119 Bacteria 1810
1299 Ga0500595_071208 3300053119 Bacteria 1031
1300 Ga0500595_109071 3300053119 Bacteria 788
1301 Ga0500597_331540 3300053120 Bacteria 598
1302 Ga0500608_000084 3300053122 Bacteria 38834
1303 Ga0500614_032376 3300053123 Bacteria 1286
1304 Ga0500618_000395 3300053125 Bacteria 30005
1305 Ga0500642_0080981 3300053130 Bacteria 1491
1306 Ga0500658_0113288 3300053134 Bacteria 1196
1307 Ga0500559_0000113 3300053136 Bacteria 63512
1308 Ga0500559_0001398 3300053136 Bacteria 13721
1309 Ga0500559_0045933 3300053136 Bacteria 1914
1310 Ga0500559_0084588 3300053136 Bacteria 1446
1311 Ga0500559_0179035 3300053136 Bacteria 998
1312 Ga0500573_0040077 3300053140 Bacteria 2705
1313 Ga0500577_0017824 3300053142 Bacteria 2270
1314 Ga0500577_0279280 3300053142 Bacteria 728
1315 Ga0500588_0375719 3300053146 Bacteria 541
1316 Ga0500590_305366 3300053148 Bacteria 596
1317 Ga0500604_0065300 3300053151 Bacteria 1151
1318 Ga0500616_0003259 3300053153 Bacteria 12557
1319 Ga0500616_0054505 3300053153 Bacteria 2094
1320 Ga0500616_0062207 3300053153 Bacteria 1929
1321 Ga0500622_0019916 3300053156 Bacteria 3562
1322 Ga0500633_0184725 3300053160 Bacteria 782
1323 Ga0500634_0157358 3300053161 Bacteria 1054
1324 Ga0500639_075340 3300053163 Bacteria 1710
1325 Ga0500639_120431 3300053163 Bacteria 1261
1326 Ga0500611_095561 3300053727 Bacteria 762
1327 Ga0500611_100892 3300053727 Bacteria 747
1328 Ga0500645_010383 3300053730 Bacteria 3083
1329 Ga0500609_054154 3300053731 Bacteria 558
1330 Ga0500596_028037 3300053735 Bacteria 866
1331 Ga0501084_0006267 3300054114 Bacteria 9778
1332 Ga0501084_0042518 3300054114 Bacteria 3801
1333 Ga0501084_0141553 3300054114 Bacteria 2025
1334 Ga0501084_0184188 3300054114 Bacteria 1763
1335 Ga0501084_0289759 3300054114 Bacteria 1383
1336 Ga0501084_0299474 3300054114 Bacteria 1358
1337 Ga0501084_0540805 3300054114 Bacteria 984
1338 Ga0501084_0663744 3300054114 Bacteria 880
1339 Ga0501084_0770388 3300054114 Bacteria 811
1340 Ga0501084_0977468 3300054114 Bacteria 712
1341 Ga0587084_008616 3300059477 Bacteria 1296
1342 Ga0587084_083583 3300059477 Bacteria 622
1343 Ga0587093_042853 3300059478 Bacteria 692
1344 Ga0587073_0232585 3300059492 Bacteria 569
1345 Ga0587077_194132 3300059493 Bacteria 558
1346 Ga0587080_066164 3300059503 Bacteria 714
1347 Ga0587083_0074098 3300059505 Bacteria 797
1348 Ga0587085_162338 3300059506 Bacteria 523
1349 Ga0587088_128227 3300059508 Bacteria 594
1350 Ga0587090_008388 3300059510 Bacteria 1385
1351 Ga0587090_058580 3300059510 Bacteria 725
1352 Ga0587091_150299 3300059511 Bacteria 591
1353 Ga0587092_027629 3300059512 Bacteria 919
1354 Ga0587092_098355 3300059512 Bacteria 600
1355 Ga0587094_025516 3300059513 Bacteria 886
1356 Ga0587098_005909 3300059604 Bacteria 1221
1357 Ga0587106_000505 3300059605 Bacteria 2773
1358 Ga0587106_102105 3300059605 Bacteria 587
1359 Ga0587125_013034 3300059607 Bacteria 894
1360 Ga0587129_004972 3300059608 Bacteria 893
1361 Ga0587101_005062 3300059623 Bacteria 1444
1362 Ga0587101_027562 3300059623 Bacteria 865
1363 Ga0587101_067023 3300059623 Bacteria 653
1364 Ga0587101_118593 3300059623 Bacteria 545
1365 Ga0587101_135185 3300059623 Bacteria 522
1366 Ga0587101_149138 3300059623 Bacteria 505
1367 Ga0587068_011869 3300059641 Bacteria 1322
1368 Ga0587076_050589 3300059645 Bacteria 809
1369 Ga0587078_000294 3300059646 Bacteria 3487
1370 Ga0587078_026257 3300059646 Bacteria 764
1371 Ga0587107_011200 3300059652 Bacteria 1094
1372 Ga0587111_0006810 3300060346 Bacteria 1829
1373 Ga0587111_0253784 3300060346 Bacteria 521
1374 Ga0501082_0006964 3300060353 Bacteria 9766
1375 Ga0501082_0030302 3300060353 Bacteria 4663
1376 Ga0501082_0069663 3300060353 Bacteria 3029
1377 Ga0501082_0088119 3300060353 Bacteria 2678
1378 Ga0501082_0114130 3300060353 Bacteria 2340
1379 Ga0501082_0136753 3300060353 Bacteria 2126
1380 Ga0501082_0665513 3300060353 Bacteria 911
1381 Ga0501082_0997369 3300060353 Bacteria 732
1382 Ga0501082_1046130 3300060353 Bacteria 714
1383 Ga0501082_1561408 3300060353 Bacteria 576
1384 Ga0501082_1692524 3300060353 Bacteria 552
1385 Ga0530510_0021100 3300061734 Bacteria 4635
1386 Ga0530510_0066947 3300061734 Bacteria 2605
1387 Ga0530510_0118926 3300061734 Bacteria 1939
1388 Ga0530510_0182254 3300061734 Bacteria 1557
1389 Ga0530510_0877165 3300061734 Bacteria 685
1390 Ga0530510_0997585 3300061734 Bacteria 641

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_077937 Ga0495627_077937_83_493 121
2 3300005338 Ga0068868_100029525 Ga0068868_1000295255 122
3 3300006358 Ga0068871_100064267 Ga0068871_1000642674 122
4 3300014969 Ga0157376_10672713 Ga0157376_106727132 122
5 3300026121 Ga0207683_10522017 Ga0207683_105220171 122
6 3300053134 Ga0500658_0113288 Ga0500658_0113288_23_436 122
7 3300035724 Ga0373933_0034262 Ga0373933_0034262_1373_1780 123
8 3300036401 Ga0373937_0006001 Ga0373937_0006001_10035_10442 123
9 3300049568 Ga0501031_0126957 Ga0501031_0126957_1059_1451 123
10 3300049571 Ga0501034_0063720 Ga0501034_0063720_1792_2184 123
11 3300049573 Ga0501037_0029353 Ga0501037_0029353_2551_2943 123
12 3300049822 Ga0501035_1403280 Ga0501035_1403280_90_482 123
13 3300049823 Ga0501044_0210409 Ga0501044_0210409_548_940 123
14 3300006048 Ga0075363_100180519 Ga0075363_1001805192 124
15 3300006051 Ga0075364_10360052 Ga0075364_103600522 124
16 3300006177 Ga0075362_10206673 Ga0075362_102066732 124
17 3300021384 Ga0213876_10003406 Ga0213876_100034067 124
18 3300039437 Ga0436365_0697746 Ga0436365_0697746_11088_11498 124
19 3300039437 Ga0436365_1239236 Ga0436365_1239236_9716_10117 124
20 3300050489 nmdc:mga03683_70319_c1 nmdc:mga03683_70319_c1_752_1162 124
21 3300050492 nmdc:mga0yw44_70411_c1 nmdc:mga0yw44_70411_c1_542_952 124
22 iso_pu_bacteria 2524023250 2524609956 124
23 iso_pu_bacteria 2821443989 2821444264 124
24 iso_pu_bacteria 2842333319 2842335144 124
25 iso_pu_bacteria 2844533157 2844539289 124
26 3300049571 Ga0501034_0484804 Ga0501034_0484804_321_719 125
27 3300049822 Ga0501035_0050699 Ga0501035_0050699_1234_1632 125
28 3300053104 Ga0500556_0030971 Ga0500556_0030971_655_1053 125
29 3300049581 Ga0501047_0164561 Ga0501047_0164561_141_536 126
30 iso_pu_bacteria 2909042592 2909043619 126
31 3300005444 Ga0070694_100186460 Ga0070694_1001864601 127
32 3300025918 Ga0207662_10130312 Ga0207662_101303122 127
33 3300035115 Ga0373941_0339322 Ga0373941_0339322_65_463 127
34 3300046472 Ga0495580_0688532 Ga0495580_0688532_101_490 127
35 3300049584 Ga0501068_1061389 Ga0501068_1061389_116_505 127
36 3300002864 Ga0006764J43180_108466 Ga0006764J43180_1084662 128
37 3300003162 Ga0006778J45830_1008131 Ga0006778J45830_10081312 128
38 3300003162 Ga0006778J45830_1018080 Ga0006778J45830_10180801 128
39 3300003162 Ga0006778J45830_1049198 Ga0006778J45830_10491981 128
40 3300003163 Ga0006759J45824_1022394 Ga0006759J45824_10223942 128
41 3300003163 Ga0006759J45824_1022824 Ga0006759J45824_10228241 128
42 3300003300 Ga0006758J48902_1033810 Ga0006758J48902_10338101 128
43 3300003305 Ga0006770J48903_1012980 Ga0006770J48903_10129802 128
44 3300003305 Ga0006770J48903_1025503 Ga0006770J48903_10255032 128
45 3300003308 Ga0006777J48905_1011379 Ga0006777J48905_10113793 128
46 3300003559 Ga0007427J51700_105947 Ga0007427J51700_1059472 128
47 3300003568 Ga0006781J51513_1004232 Ga0006781J51513_10042322 128
48 3300003574 Ga0007410J51695_1014171 Ga0007410J51695_10141711 128
49 3300003574 Ga0007410J51695_1020352 Ga0007410J51695_10203521 128
50 3300003575 Ga0007409J51694_1008637 Ga0007409J51694_10086372 128
51 3300003577 Ga0007416J51690_1009570 Ga0007416J51690_10095702 128
52 3300003579 Ga0007429J51699_1016068 Ga0007429J51699_10160681 128
53 3300003579 Ga0007429J51699_1033775 Ga0007429J51699_10337751 128
54 3300003693 Ga0032354_1001326 Ga0032354_10013263 128
55 3300003735 Ga0006780_1014704 Ga0006780_10147041 128
56 3300004801 Ga0058860_10041150 Ga0058860_100411501 128
57 3300005434 Ga0070709_10599618 Ga0070709_105996181 128
58 3300005458 Ga0070681_10029516 Ga0070681_100295166 128
59 3300005458 Ga0070681_10257706 Ga0070681_102577062 128
60 3300005458 Ga0070681_11263045 Ga0070681_112630451 128
61 3300005530 Ga0070679_101293727 Ga0070679_1012937271 128
62 3300005539 Ga0068853_100043552 Ga0068853_1000435526 128
63 3300005563 Ga0068855_100028006 Ga0068855_1000280067 128
64 3300005577 Ga0068857_100095785 Ga0068857_1000957851 128
65 3300005842 Ga0068858_101440710 Ga0068858_1014407102 128
66 3300006844 Ga0075428_100277033 Ga0075428_1002770333 128
67 3300006846 Ga0075430_100625942 Ga0075430_1006259422 128
68 3300006847 Ga0075431_100004125 Ga0075431_1000041252 128
69 3300006880 Ga0075429_100184313 Ga0075429_1001843134 128
70 3300009093 Ga0105240_10473595 Ga0105240_104735952 128
71 3300009094 Ga0111539_12497493 Ga0111539_124974932 128
72 3300009553 Ga0105249_12646345 Ga0105249_126463452 128
73 3300011119 Ga0105246_10257174 Ga0105246_102571743 128
74 3300013104 Ga0157370_10029081 Ga0157370_100290813 128
75 3300013307 Ga0157372_12638887 Ga0157372_126388872 128
76 3300013308 Ga0157375_12925126 Ga0157375_129251262 128
77 3300014745 Ga0157377_10578754 Ga0157377_105787541 128
78 3300023309 Ga0256744_117912 Ga0256744_1179121 128
79 3300023438 Ga0256720_148736 Ga0256720_1487361 128
80 3300025912 Ga0207707_10014060 Ga0207707_100140605 128
81 3300025912 Ga0207707_10161372 Ga0207707_101613722 128
82 3300025921 Ga0207652_10271075 Ga0207652_102710752 128
83 3300025932 Ga0207690_10232426 Ga0207690_102324262 128
84 3300025949 Ga0207667_10466180 Ga0207667_104661801 128
85 3300026035 Ga0207703_12344404 Ga0207703_123444041 128
86 3300026041 Ga0207639_10117451 Ga0207639_101174513 128
87 3300026116 Ga0207674_10038880 Ga0207674_100388802 128
88 3300029285 Ga0310981_1020365 Ga0310981_10203652 128
89 3300029285 Ga0310981_1053128 Ga0310981_10531282 128
90 3300030889 Ga0265761_105604 Ga0265761_1056042 128
91 3300031901 Ga0307406_10572785 Ga0307406_105727852 128
92 3300031995 Ga0307409_102742855 Ga0307409_1027428551 128
93 3300032004 Ga0307414_10920124 Ga0307414_109201242 128
94 3300035398 Ga0316574_0196185 Ga0316574_0196185_506_898 128
95 3300039438 Ga0436360_0559098 Ga0436360_0559098_322_717 128
96 3300039453 Ga0436362_0940958 Ga0436362_0940958_296_685 128
97 3300041407 Ga0439447_056999 Ga0439447_056999_202_600 128
98 3300041999 Ga0439433_0046360 Ga0439433_0046360_542_940 128
99 3300042128 Ga0450897_043015 Ga0450897_043015_114_515 128
100 3300042145 Ga0450906_049166 Ga0450906_049166_69_461 128
101 3300042436 Ga0439435_0308571 Ga0439435_0308571_89_487 128
102 3300046515 Ga0495620_0101865 Ga0495620_0101865_704_1108 128
103 3300048923 Ga0496120_0067960 Ga0496120_0067960_1225_1623 128
104 3300048924 Ga0496121_0258393 Ga0496121_0258393_657_1061 128
105 3300048925 Ga0496122_0188410 Ga0496122_0188410_793_1191 128
106 3300048927 Ga0496124_0467131 Ga0496124_0467131_145_543 128
107 3300048928 Ga0496125_0110284 Ga0496125_0110284_548_946 128
108 3300049128 Ga0501308_046599 Ga0501308_046599_108_506 128
109 3300049129 Ga0501309_058434 Ga0501309_058434_126_524 128
110 3300049530 Ga0501314_042818 Ga0501314_042818_26_424 128
111 3300049531 Ga0501315_016915 Ga0501315_016915_108_506 128
112 3300049532 Ga0501316_071005 Ga0501316_071005_13_411 128
113 3300049533 Ga0501317_006005 Ga0501317_006005_36_434 128
114 3300049533 Ga0501317_011743 Ga0501317_011743_564_962 128
115 3300049533 Ga0501317_066260 Ga0501317_066260_97_495 128
116 3300049533 Ga0501317_085576 Ga0501317_085576_126_524 128
117 3300049534 Ga0501318_009292 Ga0501318_009292_564_962 128
118 3300049541 Ga0501325_007275 Ga0501325_007275_220_618 128
119 3300049568 Ga0501031_0018496 Ga0501031_0018496_3094_3492 128
120 3300049569 Ga0501032_0004362 Ga0501032_0004362_1067_1465 128
121 3300049570 Ga0501033_0044704 Ga0501033_0044704_658_1056 128
122 3300049571 Ga0501034_0067818 Ga0501034_0067818_880_1278 128
123 3300049572 Ga0501036_0027433 Ga0501036_0027433_2423_2821 128
124 3300049573 Ga0501037_0023671 Ga0501037_0023671_1588_1986 128
125 3300049574 Ga0501038_0807937 Ga0501038_0807937_162_560 128
126 3300049575 Ga0501039_0014819 Ga0501039_0014819_2168_2566 128
127 3300049575 Ga0501039_0648893 Ga0501039_0648893_252_650 128
128 3300049576 Ga0501040_0085266 Ga0501040_0085266_117_515 128
129 3300049576 Ga0501040_1222801 Ga0501040_1222801_45_443 128
130 3300049577 Ga0501041_0590807 Ga0501041_0590807_209_607 128
131 3300049578 Ga0501042_0016472 Ga0501042_0016472_3360_3758 128
132 3300049579 Ga0501043_0057196 Ga0501043_0057196_1466_1864 128
133 3300049580 Ga0501046_0005416 Ga0501046_0005416_955_1353 128
134 3300049581 Ga0501047_0407290 Ga0501047_0407290_658_1056 128
135 3300049582 Ga0501048_0089966 Ga0501048_0089966_679_1077 128
136 3300049583 Ga0501067_0073051 Ga0501067_0073051_823_1221 128
137 3300049584 Ga0501068_0154668 Ga0501068_0154668_612_1010 128
138 3300049585 Ga0501069_0004829 Ga0501069_0004829_3684_4082 128
139 3300049586 Ga0501070_0106653 Ga0501070_0106653_824_1222 128
140 3300049587 Ga0501071_0322356 Ga0501071_0322356_124_522 128
141 3300049588 Ga0501072_0134262 Ga0501072_0134262_438_836 128
142 3300049588 Ga0501072_1096059 Ga0501072_1096059_51_449 128
143 3300049589 Ga0501073_0001669 Ga0501073_0001669_7115_7513 128
144 3300049590 Ga0501074_0004453 Ga0501074_0004453_6285_6683 128
145 3300049590 Ga0501074_0508823 Ga0501074_0508823_406_804 128
146 3300049590 Ga0501074_0523107 Ga0501074_0523107_19_423 128
147 3300049591 Ga0501075_0316490 Ga0501075_0316490_647_1045 128
148 3300049592 Ga0501076_0573295 Ga0501076_0573295_200_598 128
149 3300049592 Ga0501076_0608996 Ga0501076_0608996_98_496 128
150 3300049741 Ga0501079_0001478 Ga0501079_0001478_12493_12891 128
151 3300049741 Ga0501079_0699080 Ga0501079_0699080_147_545 128
152 3300049742 Ga0501080_1520202 Ga0501080_1520202_34_432 128
153 3300049743 Ga0501081_0422688 Ga0501081_0422688_124_522 128
154 3300049743 Ga0501081_0465185 Ga0501081_0465185_96_494 128
155 3300049744 Ga0501083_0022615 Ga0501083_0022615_1683_2081 128
156 3300049744 Ga0501083_1014560 Ga0501083_1014560_44_442 128
157 3300049822 Ga0501035_0186418 Ga0501035_0186418_658_1056 128
158 3300049823 Ga0501044_0024878 Ga0501044_0024878_5792_6190 128
159 3300049824 Ga0501045_0068338 Ga0501045_0068338_1649_2047 128
160 3300049824 Ga0501045_1139098 Ga0501045_1139098_82_480 128
161 3300050508 nmdc:mga09592_8483_c1 nmdc:mga09592_8483_c1_7234_7632 128
162 3300050509 nmdc:mga0qj67_211251_c1 nmdc:mga0qj67_211251_c1_958_1356 128
163 3300050510 nmdc:mga06r32_660_c1 nmdc:mga06r32_660_c1_12814_13212 128
164 3300053077 Ga0495601_0939069 Ga0495601_0939069_95_490 128
165 3300053136 Ga0500559_0045933 Ga0500559_0045933_97_495 128
166 3300053153 Ga0500616_0062207 Ga0500616_0062207_77_469 128
167 3300054114 Ga0501084_0042518 Ga0501084_0042518_3267_3665 128
168 3300054114 Ga0501084_0540805 Ga0501084_0540805_162_560 128
169 3300059477 Ga0587084_008616 Ga0587084_008616_394_792 128
170 3300059506 Ga0587085_162338 Ga0587085_162338_12_410 128
171 3300059510 Ga0587090_008388 Ga0587090_008388_483_881 128
172 3300059511 Ga0587091_150299 Ga0587091_150299_36_431 128
173 3300059623 Ga0587101_005062 Ga0587101_005062_629_1027 128
174 3300059641 Ga0587068_011869 Ga0587068_011869_420_818 128
175 3300059646 Ga0587078_000294 Ga0587078_000294_504_902 128
176 3300060346 Ga0587111_0006810 Ga0587111_0006810_923_1321 128
177 3300060353 Ga0501082_0006964 Ga0501082_0006964_1043_1441 128
178 3300061734 Ga0530510_0021100 Ga0530510_0021100_3780_4178 128
179 3300001979 JGI24740J21852_10130414 JGI24740J21852_101304141 129
180 3300003215 JGI25153J46596_10000830 JGI25153J46596_100008308 129
181 3300003559 Ga0007427J51700_106632 Ga0007427J51700_1066322 129
182 3300003578 Ga0006562J51391_1036321 Ga0006562J51391_10363212 129
183 3300003659 JGI25404J52841_10015764 JGI25404J52841_100157643 129
184 3300003693 Ga0032354_1016125 Ga0032354_10161252 129
185 3300003911 JGI25405J52794_10077812 JGI25405J52794_100778122 129
186 3300004799 Ga0058863_11718014 Ga0058863_117180141 129
187 3300004803 Ga0058862_10033415 Ga0058862_100334151 129
188 3300005293 Ga0065715_10035160 Ga0065715_100351602 129
189 3300005327 Ga0070658_10003455 Ga0070658_100034553 129
190 3300005329 Ga0070683_100084749 Ga0070683_1000847494 129
191 3300005334 Ga0068869_100092987 Ga0068869_1000929872 129
192 3300005334 Ga0068869_100100452 Ga0068869_1001004523 129
193 3300005334 Ga0068869_102057784 Ga0068869_1020577841 129
194 3300005335 Ga0070666_10021121 Ga0070666_100211213 129
195 3300005335 Ga0070666_10137163 Ga0070666_101371632 129
196 3300005336 Ga0070680_100069250 Ga0070680_1000692502 129
197 3300005336 Ga0070680_100107819 Ga0070680_1001078191 129
198 3300005336 Ga0070680_100192763 Ga0070680_1001927632 129
199 3300005336 Ga0070680_100268121 Ga0070680_1002681212 129
200 3300005336 Ga0070680_100342469 Ga0070680_1003424691 129
201 3300005337 Ga0070682_100016529 Ga0070682_1000165295 129
202 3300005338 Ga0068868_101167888 Ga0068868_1011678882 129
203 3300005338 Ga0068868_101354080 Ga0068868_1013540801 129
204 3300005339 Ga0070660_100023123 Ga0070660_1000231232 129
205 3300005339 Ga0070660_100084309 Ga0070660_1000843092 129
206 3300005339 Ga0070660_100140899 Ga0070660_1001408994 129
207 3300005340 Ga0070689_101758028 Ga0070689_1017580281 129
208 3300005341 Ga0070691_10014834 Ga0070691_100148342 129
209 3300005343 Ga0070687_100219327 Ga0070687_1002193271 129
210 3300005345 Ga0070692_10012203 Ga0070692_100122034 129
211 3300005345 Ga0070692_10069116 Ga0070692_100691162 129
212 3300005347 Ga0070668_100043015 Ga0070668_1000430155 129
213 3300005347 Ga0070668_101463004 Ga0070668_1014630041 129
214 3300005353 Ga0070669_100192007 Ga0070669_1001920072 129
215 3300005354 Ga0070675_100372422 Ga0070675_1003724221 129
216 3300005355 Ga0070671_100719742 Ga0070671_1007197421 129
217 3300005364 Ga0070673_100150421 Ga0070673_1001504213 129
218 3300005364 Ga0070673_100657775 Ga0070673_1006577752 129
219 3300005365 Ga0070688_100101145 Ga0070688_1001011452 129
220 3300005366 Ga0070659_100018614 Ga0070659_1000186142 129
221 3300005366 Ga0070659_100406858 Ga0070659_1004068582 129
222 3300005367 Ga0070667_100028269 Ga0070667_1000282695 129
223 3300005367 Ga0070667_100055820 Ga0070667_1000558202 129
224 3300005367 Ga0070667_100449117 Ga0070667_1004491172 129
225 3300005367 Ga0070667_101319560 Ga0070667_1013195601 129
226 3300005406 Ga0070703_10121833 Ga0070703_101218332 129
227 3300005435 Ga0070714_100000676 Ga0070714_10000067612 129
228 3300005438 Ga0070701_10012091 Ga0070701_100120914 129
229 3300005438 Ga0070701_10382880 Ga0070701_103828802 129
230 3300005440 Ga0070705_100000459 Ga0070705_10000045926 129
231 3300005440 Ga0070705_100942308 Ga0070705_1009423081 129
232 3300005441 Ga0070700_100035635 Ga0070700_1000356354 129
233 3300005441 Ga0070700_100159447 Ga0070700_1001594472 129
234 3300005444 Ga0070694_100025303 Ga0070694_1000253034 129
235 3300005445 Ga0070708_101280534 Ga0070708_1012805341 129
236 3300005455 Ga0070663_100001615 Ga0070663_10000161517 129
237 3300005455 Ga0070663_100014346 Ga0070663_1000143462 129
238 3300005455 Ga0070663_100355644 Ga0070663_1003556442 129
239 3300005455 Ga0070663_100439838 Ga0070663_1004398382 129
240 3300005455 Ga0070663_100763531 Ga0070663_1007635311 129
241 3300005456 Ga0070678_100044559 Ga0070678_1000445594 129
242 3300005456 Ga0070678_100061831 Ga0070678_1000618312 129
243 3300005456 Ga0070678_100224282 Ga0070678_1002242822 129
244 3300005456 Ga0070678_100731174 Ga0070678_1007311741 129
245 3300005456 Ga0070678_101715828 Ga0070678_1017158281 129
246 3300005457 Ga0070662_100084838 Ga0070662_1000848382 129
247 3300005458 Ga0070681_10007102 Ga0070681_1000710219 129
248 3300005458 Ga0070681_10015119 Ga0070681_100151197 129
249 3300005458 Ga0070681_10058942 Ga0070681_100589425 129
250 3300005458 Ga0070681_10071358 Ga0070681_100713584 129
251 3300005458 Ga0070681_10580881 Ga0070681_105808812 129
252 3300005458 Ga0070681_10709552 Ga0070681_107095522 129
253 3300005459 Ga0068867_100916634 Ga0068867_1009166342 129
254 3300005459 Ga0068867_100940904 Ga0068867_1009409042 129
255 3300005459 Ga0068867_100990164 Ga0068867_1009901642 129
256 3300005468 Ga0070707_100257272 Ga0070707_1002572722 129
257 3300005471 Ga0070698_100204506 Ga0070698_1002045062 129
258 3300005518 Ga0070699_100000540 Ga0070699_10000054017 129
259 3300005530 Ga0070679_100014413 Ga0070679_1000144134 129
260 3300005530 Ga0070679_100047434 Ga0070679_1000474342 129
261 3300005530 Ga0070679_100081241 Ga0070679_1000812413 129
262 3300005530 Ga0070679_100331407 Ga0070679_1003314072 129
263 3300005530 Ga0070679_100509180 Ga0070679_1005091801 129
264 3300005536 Ga0070697_100011184 Ga0070697_1000111849 129
265 3300005539 Ga0068853_100022760 Ga0068853_1000227602 129
266 3300005539 Ga0068853_100408744 Ga0068853_1004087442 129
267 3300005539 Ga0068853_100954509 Ga0068853_1009545091 129
268 3300005539 Ga0068853_100991632 Ga0068853_1009916322 129
269 3300005543 Ga0070672_100288069 Ga0070672_1002880692 129
270 3300005544 Ga0070686_100183555 Ga0070686_1001835551 129
271 3300005544 Ga0070686_100593463 Ga0070686_1005934631 129
272 3300005545 Ga0070695_100024268 Ga0070695_1000242682 129
273 3300005545 Ga0070695_100964424 Ga0070695_1009644241 129
274 3300005546 Ga0070696_100000156 Ga0070696_10000015625 129
275 3300005546 Ga0070696_100103413 Ga0070696_1001034133 129
276 3300005546 Ga0070696_100317609 Ga0070696_1003176092 129
277 3300005547 Ga0070693_100012485 Ga0070693_1000124855 129
278 3300005548 Ga0070665_100000121 Ga0070665_100000121142 129
279 3300005548 Ga0070665_100023111 Ga0070665_1000231119 129
280 3300005548 Ga0070665_100684034 Ga0070665_1006840341 129
281 3300005549 Ga0070704_100001256 Ga0070704_10000125618 129
282 3300005563 Ga0068855_100046653 Ga0068855_1000466535 129
283 3300005563 Ga0068855_100071894 Ga0068855_1000718942 129
284 3300005563 Ga0068855_100073423 Ga0068855_1000734233 129
285 3300005563 Ga0068855_100171503 Ga0068855_1001715034 129
286 3300005563 Ga0068855_100716568 Ga0068855_1007165682 129
287 3300005564 Ga0070664_100347391 Ga0070664_1003473912 129
288 3300005577 Ga0068857_100020659 Ga0068857_1000206592 129
289 3300005577 Ga0068857_100031465 Ga0068857_1000314656 129
290 3300005577 Ga0068857_100122566 Ga0068857_1001225662 129
291 3300005577 Ga0068857_102105737 Ga0068857_1021057371 129
292 3300005578 Ga0068854_100724080 Ga0068854_1007240802 129
293 3300005614 Ga0068856_100435995 Ga0068856_1004359951 129
294 3300005614 Ga0068856_101518382 Ga0068856_1015183822 129
295 3300005615 Ga0070702_100047118 Ga0070702_1000471183 129
296 3300005615 Ga0070702_100257669 Ga0070702_1002576692 129
297 3300005615 Ga0070702_100844818 Ga0070702_1008448181 129
298 3300005615 Ga0070702_100996528 Ga0070702_1009965281 129
299 3300005616 Ga0068852_100386755 Ga0068852_1003867552 129
300 3300005616 Ga0068852_100992990 Ga0068852_1009929901 129
301 3300005616 Ga0068852_102000957 Ga0068852_1020009571 129
302 3300005617 Ga0068859_100005627 Ga0068859_1000056273 129
303 3300005617 Ga0068859_100243742 Ga0068859_1002437424 129
304 3300005617 Ga0068859_100440943 Ga0068859_1004409431 129
305 3300005618 Ga0068864_100013728 Ga0068864_1000137287 129
306 3300005618 Ga0068864_100156071 Ga0068864_1001560713 129
307 3300005618 Ga0068864_100464393 Ga0068864_1004643932 129
308 3300005718 Ga0068866_11087899 Ga0068866_110878991 129
309 3300005719 Ga0068861_100057102 Ga0068861_1000571024 129
310 3300005719 Ga0068861_100060641 Ga0068861_1000606414 129
311 3300005719 Ga0068861_100168742 Ga0068861_1001687422 129
312 3300005719 Ga0068861_100219088 Ga0068861_1002190882 129
313 3300005719 Ga0068861_100710333 Ga0068861_1007103331 129
314 3300005840 Ga0068870_10394820 Ga0068870_103948202 129
315 3300005841 Ga0068863_100064279 Ga0068863_1000642792 129
316 3300005841 Ga0068863_100757821 Ga0068863_1007578212 129
317 3300005841 Ga0068863_100787247 Ga0068863_1007872471 129
318 3300005842 Ga0068858_100135230 Ga0068858_1001352303 129
319 3300005843 Ga0068860_100006701 Ga0068860_10000670120 129
320 3300005843 Ga0068860_100242218 Ga0068860_1002422183 129
321 3300005843 Ga0068860_100359325 Ga0068860_1003593252 129
322 3300005844 Ga0068862_100034875 Ga0068862_1000348754 129
323 3300005844 Ga0068862_101342016 Ga0068862_1013420162 129
324 3300005844 Ga0068862_101436671 Ga0068862_1014366712 129
325 3300005937 Ga0081455_10001008 Ga0081455_1000100819 129
326 3300005937 Ga0081455_10251889 Ga0081455_102518893 129
327 3300005983 Ga0081540_1000645 Ga0081540_100064526 129
328 3300005983 Ga0081540_1006488 Ga0081540_100648812 129
329 3300005983 Ga0081540_1120111 Ga0081540_11201112 129
330 3300005983 Ga0081540_1217922 Ga0081540_12179222 129
331 3300005985 Ga0081539_10028584 Ga0081539_100285844 129
332 3300005985 Ga0081539_10052221 Ga0081539_100522214 129
333 3300006038 Ga0075365_10050909 Ga0075365_100509094 129
334 3300006042 Ga0075368_10002415 Ga0075368_1000241511 129
335 3300006048 Ga0075363_100093378 Ga0075363_1000933781 129
336 3300006163 Ga0070715_10072145 Ga0070715_100721452 129
337 3300006175 Ga0070712_100461985 Ga0070712_1004619851 129
338 3300006178 Ga0075367_10207325 Ga0075367_102073253 129
339 3300006195 Ga0075366_10043441 Ga0075366_100434412 129
340 3300006195 Ga0075366_10347162 Ga0075366_103471622 129
341 3300006237 Ga0097621_100291285 Ga0097621_1002912852 129
342 3300006237 Ga0097621_100339957 Ga0097621_1003399572 129
343 3300006237 Ga0097621_101148182 Ga0097621_1011481822 129
344 3300006353 Ga0075370_10121056 Ga0075370_101210562 129
345 3300006358 Ga0068871_100760895 Ga0068871_1007608952 129
346 3300006844 Ga0075428_100121619 Ga0075428_1001216194 129
347 3300006844 Ga0075428_100337512 Ga0075428_1003375122 129
348 3300006844 Ga0075428_100677028 Ga0075428_1006770282 129
349 3300006844 Ga0075428_100809363 Ga0075428_1008093631 129
350 3300006846 Ga0075430_100025465 Ga0075430_1000254653 129
351 3300006847 Ga0075431_100014343 Ga0075431_10001434312 129
352 3300006847 Ga0075431_100137414 Ga0075431_1001374142 129
353 3300006847 Ga0075431_100204143 Ga0075431_1002041431 129
354 3300006847 Ga0075431_100372131 Ga0075431_1003721312 129
355 3300006852 Ga0075433_10001194 Ga0075433_100011946 129
356 3300006852 Ga0075433_10455435 Ga0075433_104554352 129
357 3300006871 Ga0075434_100002309 Ga0075434_10000230918 129
358 3300006871 Ga0075434_100005901 Ga0075434_10000590111 129
359 3300006871 Ga0075434_100489510 Ga0075434_1004895101 129
360 3300006871 Ga0075434_102039620 Ga0075434_1020396202 129
361 3300006880 Ga0075429_100230456 Ga0075429_1002304562 129
362 3300006880 Ga0075429_100994062 Ga0075429_1009940622 129
363 3300006914 Ga0075436_100627444 Ga0075436_1006274442 129
364 3300006931 Ga0097620_100005627 Ga0097620_1000056273 129
365 3300006931 Ga0097620_100243755 Ga0097620_1002437554 129
366 3300006931 Ga0097620_100440942 Ga0097620_1004409421 129
367 3300007076 Ga0075435_100084480 Ga0075435_1000844804 129
368 3300007076 Ga0075435_100178503 Ga0075435_1001785032 129
369 3300009011 Ga0105251_10178396 Ga0105251_101783962 129
370 3300009093 Ga0105240_10872993 Ga0105240_108729932 129
371 3300009094 Ga0111539_10009902 Ga0111539_1000990220 129
372 3300009094 Ga0111539_10102489 Ga0111539_101024894 129
373 3300009094 Ga0111539_10159827 Ga0111539_101598273 129
374 3300009094 Ga0111539_10186305 Ga0111539_101863053 129
375 3300009098 Ga0105245_10271673 Ga0105245_102716732 129
376 3300009101 Ga0105247_10265933 Ga0105247_102659332 129
377 3300009147 Ga0114129_10052649 Ga0114129_100526494 129
378 3300009147 Ga0114129_10115748 Ga0114129_101157483 129
379 3300009147 Ga0114129_10307258 Ga0114129_103072584 129
380 3300009147 Ga0114129_10532331 Ga0114129_105323313 129
381 3300009148 Ga0105243_10005642 Ga0105243_1000564212 129
382 3300009148 Ga0105243_10185163 Ga0105243_101851633 129
383 3300009148 Ga0105243_10424620 Ga0105243_104246202 129
384 3300009174 Ga0105241_10853785 Ga0105241_108537852 129
385 3300009177 Ga0105248_10048814 Ga0105248_100488144 129
386 3300009545 Ga0105237_10343233 Ga0105237_103432332 129
387 3300009551 Ga0105238_10014386 Ga0105238_1001438610 129
388 3300009551 Ga0105238_10037395 Ga0105238_100373956 129
389 3300009551 Ga0105238_12979379 Ga0105238_129793791 129
390 3300009553 Ga0105249_10010481 Ga0105249_100104818 129
391 3300009553 Ga0105249_10232087 Ga0105249_102320872 129
392 3300009553 Ga0105249_10504662 Ga0105249_105046621 129
393 3300009553 Ga0105249_10629910 Ga0105249_106299102 129
394 3300010375 Ga0105239_10077772 Ga0105239_100777724 129
395 3300010375 Ga0105239_10152056 Ga0105239_101520563 129
396 3300010375 Ga0105239_10154786 Ga0105239_101547863 129
397 3300010375 Ga0105239_10442559 Ga0105239_104425591 129
398 3300010375 Ga0105239_11042557 Ga0105239_110425572 129
399 3300011119 Ga0105246_10008563 Ga0105246_100085638 129
400 3300011119 Ga0105246_10608919 Ga0105246_106089191 129
401 3300011119 Ga0105246_10610720 Ga0105246_106107202 129
402 3300013100 Ga0157373_11389966 Ga0157373_113899661 129
403 3300013102 Ga0157371_10018600 Ga0157371_100186003 129
404 3300013104 Ga0157370_10096703 Ga0157370_100967033 129
405 3300013104 Ga0157370_10141347 Ga0157370_101413472 129
406 3300013104 Ga0157370_10231765 Ga0157370_102317652 129
407 3300013105 Ga0157369_10032567 Ga0157369_100325678 129
408 3300013105 Ga0157369_10356738 Ga0157369_103567382 129
409 3300013296 Ga0157374_10534851 Ga0157374_105348512 129
410 3300013297 Ga0157378_10357095 Ga0157378_103570953 129
411 3300013297 Ga0157378_10540698 Ga0157378_105406982 129
412 3300013297 Ga0157378_10845320 Ga0157378_108453202 129
413 3300013306 Ga0163162_10338990 Ga0163162_103389903 129
414 3300013306 Ga0163162_11195020 Ga0163162_111950202 129
415 3300013307 Ga0157372_12584690 Ga0157372_125846901 129
416 3300013308 Ga0157375_10116435 Ga0157375_101164353 129
417 3300013308 Ga0157375_10859984 Ga0157375_108599842 129
418 3300013308 Ga0157375_11491023 Ga0157375_114910232 129
419 3300013308 Ga0157375_11857261 Ga0157375_118572612 129
420 3300013308 Ga0157375_12550657 Ga0157375_125506571 129
421 3300014325 Ga0163163_10169829 Ga0163163_101698291 129
422 3300014325 Ga0163163_10329470 Ga0163163_103294702 129
423 3300014325 Ga0163163_11289895 Ga0163163_112898952 129
424 3300014325 Ga0163163_12852432 Ga0163163_128524321 129
425 3300014326 Ga0157380_10009306 Ga0157380_100093064 129
426 3300014326 Ga0157380_10198955 Ga0157380_101989552 129
427 3300014326 Ga0157380_10293021 Ga0157380_102930213 129
428 3300014326 Ga0157380_11627094 Ga0157380_116270942 129
429 3300014326 Ga0157380_12925422 Ga0157380_129254222 129
430 3300014326 Ga0157380_13293333 Ga0157380_132933331 129
431 3300014497 Ga0182008_10027386 Ga0182008_100273862 129
432 3300014968 Ga0157379_10027510 Ga0157379_100275104 129
433 3300014968 Ga0157379_10117175 Ga0157379_101171754 129
434 3300014968 Ga0157379_11296326 Ga0157379_112963262 129
435 3300014968 Ga0157379_11624045 Ga0157379_116240452 129
436 3300014969 Ga0157376_10136727 Ga0157376_101367272 129
437 3300014969 Ga0157376_10268214 Ga0157376_102682142 129
438 3300014969 Ga0157376_10366273 Ga0157376_103662732 129
439 3300014969 Ga0157376_10774006 Ga0157376_107740061 129
440 3300017792 Ga0163161_10088631 Ga0163161_100886312 129
441 3300017792 Ga0163161_10647377 Ga0163161_106473771 129
442 3300020082 Ga0206353_10361816 Ga0206353_103618161 129
443 3300020610 Ga0154015_1156125 Ga0154015_11561252 129
444 3300021361 Ga0213872_10036033 Ga0213872_100360332 129
445 3300021441 Ga0213871_10311541 Ga0213871_103115411 129
446 3300025272 Ga0209455_1008380 Ga0209455_10083804 129
447 3300025297 Ga0209758_1000013 Ga0209758_1000013887 129
448 3300025321 Ga0207656_10068548 Ga0207656_100685482 129
449 3300025885 Ga0207653_10073529 Ga0207653_100735292 129
450 3300025885 Ga0207653_10075550 Ga0207653_100755502 129
451 3300025903 Ga0207680_10035901 Ga0207680_100359012 129
452 3300025903 Ga0207680_11312866 Ga0207680_113128661 129
453 3300025904 Ga0207647_10069690 Ga0207647_100696902 129
454 3300025905 Ga0207685_10002550 Ga0207685_100025502 129
455 3300025907 Ga0207645_11026796 Ga0207645_110267961 129
456 3300025909 Ga0207705_10004936 Ga0207705_1000493612 129
457 3300025909 Ga0207705_10035805 Ga0207705_100358052 129
458 3300025909 Ga0207705_10591827 Ga0207705_105918272 129
459 3300025912 Ga0207707_10010230 Ga0207707_1001023012 129
460 3300025912 Ga0207707_10038191 Ga0207707_100381912 129
461 3300025912 Ga0207707_10056826 Ga0207707_100568264 129
462 3300025912 Ga0207707_10115614 Ga0207707_101156143 129
463 3300025912 Ga0207707_10156822 Ga0207707_101568223 129
464 3300025913 Ga0207695_10000575 Ga0207695_1000057540 129
465 3300025913 Ga0207695_10259669 Ga0207695_102596693 129
466 3300025913 Ga0207695_10579178 Ga0207695_105791782 129
467 3300025913 Ga0207695_10752667 Ga0207695_107526672 129
468 3300025913 Ga0207695_10863779 Ga0207695_108637791 129
469 3300025914 Ga0207671_10401373 Ga0207671_104013732 129
470 3300025915 Ga0207693_10275682 Ga0207693_102756822 129
471 3300025917 Ga0207660_10000537 Ga0207660_1000053733 129
472 3300025917 Ga0207660_10003004 Ga0207660_1000300419 129
473 3300025917 Ga0207660_10052376 Ga0207660_100523762 129
474 3300025917 Ga0207660_10146738 Ga0207660_101467383 129
475 3300025917 Ga0207660_10155049 Ga0207660_101550493 129
476 3300025918 Ga0207662_10356421 Ga0207662_103564212 129
477 3300025919 Ga0207657_10006388 Ga0207657_1000638813 129
478 3300025919 Ga0207657_10021181 Ga0207657_100211812 129
479 3300025919 Ga0207657_10100998 Ga0207657_101009982 129
480 3300025919 Ga0207657_10290398 Ga0207657_102903982 129
481 3300025920 Ga0207649_11136592 Ga0207649_111365922 129
482 3300025921 Ga0207652_10045523 Ga0207652_100455232 129
483 3300025921 Ga0207652_10048851 Ga0207652_100488514 129
484 3300025921 Ga0207652_10116633 Ga0207652_101166334 129
485 3300025921 Ga0207652_10154260 Ga0207652_101542603 129
486 3300025921 Ga0207652_10546380 Ga0207652_105463801 129
487 3300025922 Ga0207646_10178105 Ga0207646_101781052 129
488 3300025923 Ga0207681_10078471 Ga0207681_100784713 129
489 3300025923 Ga0207681_10191943 Ga0207681_101919432 129
490 3300025924 Ga0207694_10021191 Ga0207694_100211916 129
491 3300025924 Ga0207694_10279826 Ga0207694_102798262 129
492 3300025924 Ga0207694_10581570 Ga0207694_105815702 129
493 3300025927 Ga0207687_10155570 Ga0207687_101555702 129
494 3300025927 Ga0207687_11507210 Ga0207687_115072101 129
495 3300025928 Ga0207700_11264045 Ga0207700_112640452 129
496 3300025928 Ga0207700_12009809 Ga0207700_120098091 129
497 3300025929 Ga0207664_10000478 Ga0207664_1000047827 129
498 3300025929 Ga0207664_11336705 Ga0207664_113367051 129
499 3300025929 Ga0207664_11404239 Ga0207664_114042391 129
500 3300025931 Ga0207644_10420732 Ga0207644_104207322 129
501 3300025932 Ga0207690_10000322 Ga0207690_100003226 129
502 3300025932 Ga0207690_10008862 Ga0207690_100088625 129
503 3300025932 Ga0207690_10008933 Ga0207690_100089338 129
504 3300025933 Ga0207706_10025334 Ga0207706_100253343 129
505 3300025933 Ga0207706_10531531 Ga0207706_105315312 129
506 3300025933 Ga0207706_10548571 Ga0207706_105485711 129
507 3300025933 Ga0207706_11004057 Ga0207706_110040572 129
508 3300025933 Ga0207706_11532526 Ga0207706_115325261 129
509 3300025935 Ga0207709_10384088 Ga0207709_103840882 129
510 3300025936 Ga0207670_10396942 Ga0207670_103969422 129
511 3300025940 Ga0207691_10750320 Ga0207691_107503202 129
512 3300025941 Ga0207711_10009066 Ga0207711_100090669 129
513 3300025942 Ga0207689_10030241 Ga0207689_100302415 129
514 3300025942 Ga0207689_10221147 Ga0207689_102211473 129
515 3300025944 Ga0207661_10058611 Ga0207661_100586114 129
516 3300025945 Ga0207679_11662135 Ga0207679_116621351 129
517 3300025945 Ga0207679_11747271 Ga0207679_117472711 129
518 3300025949 Ga0207667_10026409 Ga0207667_100264093 129
519 3300025949 Ga0207667_10057429 Ga0207667_100574295 129
520 3300025949 Ga0207667_10063505 Ga0207667_100635054 129
521 3300025949 Ga0207667_10351288 Ga0207667_103512883 129
522 3300025949 Ga0207667_10411725 Ga0207667_104117252 129
523 3300025960 Ga0207651_10174855 Ga0207651_101748552 129
524 3300025961 Ga0207712_10003369 Ga0207712_100033695 129
525 3300025961 Ga0207712_10246693 Ga0207712_102466932 129
526 3300025972 Ga0207668_10098919 Ga0207668_100989192 129
527 3300025972 Ga0207668_10456132 Ga0207668_104561322 129
528 3300025981 Ga0207640_10503971 Ga0207640_105039712 129
529 3300025986 Ga0207658_10031844 Ga0207658_100318443 129
530 3300025986 Ga0207658_10231702 Ga0207658_102317022 129
531 3300026023 Ga0207677_10646154 Ga0207677_106461542 129
532 3300026023 Ga0207677_11091649 Ga0207677_110916491 129
533 3300026035 Ga0207703_10246380 Ga0207703_102463802 129
534 3300026035 Ga0207703_10644001 Ga0207703_106440012 129
535 3300026035 Ga0207703_10784666 Ga0207703_107846661 129
536 3300026041 Ga0207639_10019252 Ga0207639_100192526 129
537 3300026041 Ga0207639_10371523 Ga0207639_103715232 129
538 3300026041 Ga0207639_10734826 Ga0207639_107348262 129
539 3300026041 Ga0207639_11620230 Ga0207639_116202302 129
540 3300026067 Ga0207678_10000118 Ga0207678_1000011834 129
541 3300026067 Ga0207678_10001998 Ga0207678_100019988 129
542 3300026067 Ga0207678_10092917 Ga0207678_100929172 129
543 3300026067 Ga0207678_10568602 Ga0207678_105686022 129
544 3300026075 Ga0207708_10001023 Ga0207708_1000102326 129
545 3300026075 Ga0207708_10079350 Ga0207708_100793501 129
546 3300026075 Ga0207708_10660023 Ga0207708_106600231 129
547 3300026075 Ga0207708_10707224 Ga0207708_107072242 129
548 3300026075 Ga0207708_11505701 Ga0207708_115057011 129
549 3300026078 Ga0207702_10981532 Ga0207702_109815322 129
550 3300026088 Ga0207641_10031526 Ga0207641_100315262 129
551 3300026088 Ga0207641_10064762 Ga0207641_100647622 129
552 3300026088 Ga0207641_10576200 Ga0207641_105762002 129
553 3300026089 Ga0207648_10099185 Ga0207648_100991852 129
554 3300026089 Ga0207648_10217728 Ga0207648_102177282 129
555 3300026089 Ga0207648_10982180 Ga0207648_109821801 129
556 3300026089 Ga0207648_11278503 Ga0207648_112785032 129
557 3300026095 Ga0207676_10147003 Ga0207676_101470032 129
558 3300026095 Ga0207676_11589531 Ga0207676_115895312 129
559 3300026116 Ga0207674_10040450 Ga0207674_100404506 129
560 3300026116 Ga0207674_10066996 Ga0207674_100669962 129
561 3300026116 Ga0207674_10145952 Ga0207674_101459523 129
562 3300026116 Ga0207674_10430144 Ga0207674_104301442 129
563 3300026116 Ga0207674_11534436 Ga0207674_115344361 129
564 3300026118 Ga0207675_100022568 Ga0207675_1000225683 129
565 3300026118 Ga0207675_100066743 Ga0207675_1000667433 129
566 3300026118 Ga0207675_100559964 Ga0207675_1005599642 129
567 3300026118 Ga0207675_101024505 Ga0207675_1010245051 129
568 3300026121 Ga0207683_10190947 Ga0207683_101909472 129
569 3300026121 Ga0207683_10337170 Ga0207683_103371702 129
570 3300026121 Ga0207683_10432369 Ga0207683_104323692 129
571 3300026142 Ga0207698_10522792 Ga0207698_105227922 129
572 3300026142 Ga0207698_10904180 Ga0207698_109041801 129
573 3300027378 Ga0209981_1000043 Ga0209981_100004313 129
574 3300027543 Ga0209999_1007077 Ga0209999_10070772 129
575 3300027665 Ga0209983_1050968 Ga0209983_10509682 129
576 3300027866 Ga0209813_10054754 Ga0209813_100547543 129
577 3300027907 Ga0207428_10007316 Ga0207428_100073164 129
578 3300027907 Ga0207428_10023296 Ga0207428_100232965 129
579 3300027907 Ga0207428_10156661 Ga0207428_101566613 129
580 3300027907 Ga0207428_10829115 Ga0207428_108291151 129
581 3300028379 Ga0268266_10000106 Ga0268266_1000010622 129
582 3300028379 Ga0268266_10000557 Ga0268266_1000055726 129
583 3300028379 Ga0268266_10233432 Ga0268266_102334322 129
584 3300028379 Ga0268266_11790024 Ga0268266_117900241 129
585 3300028380 Ga0268265_10004169 Ga0268265_1000416917 129
586 3300028380 Ga0268265_10052380 Ga0268265_100523802 129
587 3300028380 Ga0268265_10775640 Ga0268265_107756402 129
588 3300028380 Ga0268265_12266033 Ga0268265_122660332 129
589 3300028381 Ga0268264_10002325 Ga0268264_1000232528 129
590 3300028381 Ga0268264_10005719 Ga0268264_1000571919 129
591 3300028381 Ga0268264_10201865 Ga0268264_102018652 129
592 3300028381 Ga0268264_10349240 Ga0268264_103492401 129
593 3300028563 Ga0265319_1102853 Ga0265319_11028532 129
594 3300028573 Ga0265334_10127982 Ga0265334_101279822 129
595 3300028577 Ga0265318_10004788 Ga0265318_1000478812 129
596 3300028666 Ga0265336_10029236 Ga0265336_100292362 129
597 3300028786 Ga0307517_10012557 Ga0307517_100125577 129
598 3300028794 Ga0307515_10153824 Ga0307515_101538244 129
599 3300028794 Ga0307515_10173473 Ga0307515_101734734 129
600 3300028800 Ga0265338_10002896 Ga0265338_1000289621 129
601 3300028800 Ga0265338_10046965 Ga0265338_100469652 129
602 3300028800 Ga0265338_10096847 Ga0265338_100968475 129
603 3300028800 Ga0265338_10156776 Ga0265338_101567762 129
604 3300028800 Ga0265338_10170295 Ga0265338_101702952 129
605 3300028800 Ga0265338_10664129 Ga0265338_106641292 129
606 3300028800 Ga0265338_11063122 Ga0265338_110631221 129
607 3300030878 Ga0265770_1041356 Ga0265770_10413562 129
608 3300031235 Ga0265330_10077828 Ga0265330_100778282 129
609 3300031238 Ga0265332_10033404 Ga0265332_100334042 129
610 3300031239 Ga0265328_10157031 Ga0265328_101570312 129
611 3300031239 Ga0265328_10296701 Ga0265328_102967011 129
612 3300031240 Ga0265320_10057316 Ga0265320_100573161 129
613 3300031240 Ga0265320_10355914 Ga0265320_103559142 129
614 3300031241 Ga0265325_10008115 Ga0265325_100081155 129
615 3300031241 Ga0265325_10146029 Ga0265325_101460292 129
616 3300031242 Ga0265329_10051749 Ga0265329_100517492 129
617 3300031249 Ga0265339_10063241 Ga0265339_100632413 129
618 3300031249 Ga0265339_10205030 Ga0265339_102050302 129
619 3300031250 Ga0265331_10033733 Ga0265331_100337334 129
620 3300031250 Ga0265331_10035730 Ga0265331_100357303 129
621 3300031250 Ga0265331_10058532 Ga0265331_100585321 129
622 3300031250 Ga0265331_10063163 Ga0265331_100631632 129
623 3300031344 Ga0265316_10075091 Ga0265316_100750913 129
624 3300031344 Ga0265316_10100937 Ga0265316_101009372 129
625 3300031344 Ga0265316_10748816 Ga0265316_107488162 129
626 3300031344 Ga0265316_10886912 Ga0265316_108869122 129
627 3300031456 Ga0307513_10002446 Ga0307513_1000244619 129
628 3300031456 Ga0307513_10009092 Ga0307513_100090926 129
629 3300031456 Ga0307513_10285642 Ga0307513_102856422 129
630 3300031456 Ga0307513_10387495 Ga0307513_103874952 129
631 3300031548 Ga0307408_101933520 Ga0307408_1019335201 129
632 3300031595 Ga0265313_10006418 Ga0265313_100064188 129
633 3300031595 Ga0265313_10011787 Ga0265313_100117872 129
634 3300031595 Ga0265313_10081099 Ga0265313_100810992 129
635 3300031595 Ga0265313_10093517 Ga0265313_100935172 129
636 3300031595 Ga0265313_10197474 Ga0265313_101974742 129
637 3300031595 Ga0265313_10328556 Ga0265313_103285562 129
638 3300031691 Ga0316579_10545452 Ga0316579_105454521 129
639 3300031711 Ga0265314_10037136 Ga0265314_100371364 129
640 3300031711 Ga0265314_10049812 Ga0265314_100498124 129
641 3300031711 Ga0265314_10063782 Ga0265314_100637822 129
642 3300031711 Ga0265314_10081934 Ga0265314_100819342 129
643 3300031711 Ga0265314_10373438 Ga0265314_103734381 129
644 3300031712 Ga0265342_10063846 Ga0265342_100638463 129
645 3300031712 Ga0265342_10086286 Ga0265342_100862863 129
646 3300031727 Ga0316576_10011989 Ga0316576_100119894 129
647 3300031728 Ga0316578_10084150 Ga0316578_100841503 129
648 3300031730 Ga0307516_10001565 Ga0307516_1000156520 129
649 3300031730 Ga0307516_10104724 Ga0307516_101047242 129
650 3300031731 Ga0307405_10438305 Ga0307405_104383052 129
651 3300031731 Ga0307405_10942466 Ga0307405_109424662 129
652 3300031733 Ga0316577_10030400 Ga0316577_100304003 129
653 3300031733 Ga0316577_10663423 Ga0316577_106634231 129
654 3300031824 Ga0307413_10122230 Ga0307413_101222302 129
655 3300031824 Ga0307413_10485172 Ga0307413_104851722 129
656 3300031852 Ga0307410_11498005 Ga0307410_114980051 129
657 3300031901 Ga0307406_10327963 Ga0307406_103279632 129
658 3300031911 Ga0307412_11212886 Ga0307412_112128862 129
659 3300031911 Ga0307412_11396599 Ga0307412_113965991 129
660 3300031911 Ga0307412_11859440 Ga0307412_118594401 129
661 3300031995 Ga0307409_100035784 Ga0307409_1000357843 129
662 3300031995 Ga0307409_100050696 Ga0307409_1000506963 129
663 3300031995 Ga0307409_100573334 Ga0307409_1005733342 129
664 3300032002 Ga0307416_101912685 Ga0307416_1019126852 129
665 3300032004 Ga0307414_10097082 Ga0307414_100970822 129
666 3300032004 Ga0307414_10673833 Ga0307414_106738332 129
667 3300032004 Ga0307414_10877295 Ga0307414_108772951 129
668 3300032005 Ga0307411_10075136 Ga0307411_100751364 129
669 3300032126 Ga0307415_100169025 Ga0307415_1001690252 129
670 3300033180 Ga0307510_10028447 Ga0307510_100284474 129
671 3300033180 Ga0307510_10168985 Ga0307510_101689852 129
672 3300033180 Ga0307510_10348817 Ga0307510_103488172 129
673 3300033180 Ga0307510_10417455 Ga0307510_104174551 129
674 3300033541 Ga0316596_1001896 Ga0316596_10018964 129
675 3300034818 Ga0373950_0003924 Ga0373950_0003924_149_553 129
676 3300034818 Ga0373950_0098931 Ga0373950_0098931_171_575 129
677 3300034819 Ga0373958_0038915 Ga0373958_0038915_213_617 129
678 3300034820 Ga0373959_0073071 Ga0373959_0073071_44_448 129
679 3300035084 Ga0373928_0039569 Ga0373928_0039569_191_580 129
680 3300035085 Ga0373929_0131098 Ga0373929_0131098_227_631 129
681 3300035088 Ga0373940_0038650 Ga0373940_0038650_584_988 129
682 3300035088 Ga0373940_0075564 Ga0373940_0075564_511_930 129
683 3300035090 Ga0373949_0042118 Ga0373949_0042118_510_914 129
684 3300035091 Ga0373951_0041827 Ga0373951_0041827_37_441 129
685 3300035092 Ga0373952_0003002 Ga0373952_0003002_1544_1948 129
686 3300035092 Ga0373952_0011057 Ga0373952_0011057_1117_1521 129
687 3300035113 Ga0373936_0102330 Ga0373936_0102330_583_972 129
688 3300035114 Ga0373939_0010321 Ga0373939_0010321_971_1375 129
689 3300035114 Ga0373939_0052644 Ga0373939_0052644_575_979 129
690 3300035115 Ga0373941_0149178 Ga0373941_0149178_85_489 129
691 3300035116 Ga0373945_0233133 Ga0373945_0233133_45_455 129
692 3300035116 Ga0373945_0346528 Ga0373945_0346528_20_427 129
693 3300035117 Ga0373953_0007154 Ga0373953_0007154_945_1349 129
694 3300035118 Ga0373954_0129176 Ga0373954_0129176_585_989 129
695 3300035119 Ga0373956_0193735 Ga0373956_0193735_261_668 129
696 3300035121 Ga0373960_0014902 Ga0373960_0014902_817_1221 129
697 3300035170 Ga0373943_0260156 Ga0373943_0260156_391_798 129
698 3300035172 Ga0373955_0085689 Ga0373955_0085689_472_876 129
699 3300035207 Ga0373942_0014138 Ga0373942_0014138_360_764 129
700 3300035207 Ga0373942_0073387 Ga0373942_0073387_490_894 129
701 3300035241 Ga0373961_0008082 Ga0373961_0008082_1693_2097 129
702 3300035241 Ga0373961_0074440 Ga0373961_0074440_448_852 129
703 3300035241 Ga0373961_0183781 Ga0373961_0183781_161_565 129
704 3300035242 Ga0373962_0004031 Ga0373962_0004031_1093_1497 129
705 3300035242 Ga0373962_0012560 Ga0373962_0012560_903_1307 129
706 3300035242 Ga0373962_0261189 Ga0373962_0261189_164_568 129
707 3300035398 Ga0316574_0302208 Ga0316574_0302208_368_763 129
708 3300035398 Ga0316574_0581708 Ga0316574_0581708_36_431 129
709 3300035691 Ga0373931_0002939 Ga0373931_0002939_2060_2464 129
710 3300035691 Ga0373931_0005200 Ga0373931_0005200_3569_3973 129
711 3300035691 Ga0373931_0711394 Ga0373931_0711394_170_559 129
712 3300035692 Ga0373935_0136168 Ga0373935_0136168_628_1017 129
713 3300035692 Ga0373935_0690433 Ga0373935_0690433_293_703 129
714 3300035695 Ga0373927_0000479 Ga0373927_0000479_16831_17220 129
715 3300035695 Ga0373927_0162569 Ga0373927_0162569_137_544 129
716 3300035695 Ga0373927_0188819 Ga0373927_0188819_753_1163 129
717 3300035724 Ga0373933_0600353 Ga0373933_0600353_236_625 129
718 3300035725 Ga0373947_0052110 Ga0373947_0052110_1441_1848 129
719 3300035725 Ga0373947_0480313 Ga0373947_0480313_185_592 129
720 3300035725 Ga0373947_0515441 Ga0373947_0515441_285_695 129
721 3300036401 Ga0373937_0143345 Ga0373937_0143345_1043_1447 129
722 3300036647 Ga0316582_0065073 Ga0316582_0065073_104_499 129
723 3300036712 Ga0316584_0060375 Ga0316584_0060375_342_737 129
724 3300037068 Ga0373925_0000023 Ga0373925_0000023_2926_3315 129
725 3300037068 Ga0373925_0310107 Ga0373925_0310107_205_594 129
726 3300037068 Ga0373925_0557184 Ga0373925_0557184_286_675 129
727 3300037068 Ga0373925_1295228 Ga0373925_1295228_19_408 129
728 3300037312 Ga0395899_0004948 Ga0395899_0004948_2773_3171 129
729 3300037312 Ga0395899_0135860 Ga0395899_0135860_424_825 129
730 3300037418 Ga0395900_0054207 Ga0395900_0054207_3591_3989 129
731 3300037418 Ga0395900_0118387 Ga0395900_0118387_659_1060 129
732 3300037418 Ga0395900_0294566 Ga0395900_0294566_973_1377 129
733 3300037466 Ga0395898_0003055 Ga0395898_0003055_9997_10395 129
734 3300037466 Ga0395898_0086433 Ga0395898_0086433_1758_2159 129
735 3300037466 Ga0395898_0130907 Ga0395898_0130907_851_1255 129
736 3300037466 Ga0395898_0141060 Ga0395898_0141060_972_1373 129
737 3300038443 Ga0395901_0012391 Ga0395901_0012391_6931_7329 129
738 3300038443 Ga0395901_0250996 Ga0395901_0250996_361_750 129
739 3300038443 Ga0395901_0270554 Ga0395901_0270554_1291_1695 129
740 3300038443 Ga0395901_0493640 Ga0395901_0493640_791_1192 129
741 3300038726 Ga0400490_05556 Ga0400490_05556_190_579 129
742 3300038735 Ga0400485_18010 Ga0400485_18010_181_570 129
743 3300038735 Ga0400485_18067 Ga0400485_18067_2691_3080 129
744 3300038741 Ga0400488_60863 Ga0400488_60863_827_1216 129
745 3300038742 Ga0400486_19626 Ga0400486_19626_1085_1474 129
746 3300038742 Ga0400486_26804 Ga0400486_26804_984_1373 129
747 3300039062 Ga0400483_275193 Ga0400483_275193_141_530 129
748 3300039437 Ga0436365_0367003 Ga0436365_0367003_955_1362 129
749 3300039437 Ga0436365_1281228 Ga0436365_1281228_1602_1991 129
750 3300039447 Ga0436361_0953537 Ga0436361_0953537_30481_30870 129
751 3300039450 Ga0436363_0491191 Ga0436363_0491191_273_662 129
752 3300039453 Ga0436362_0512929 Ga0436362_0512929_39_446 129
753 3300039453 Ga0436362_0526223 Ga0436362_0526223_82_489 129
754 3300041413 Ga0439465_0041536 Ga0439465_0041536_281_670 129
755 3300041413 Ga0439465_0056207 Ga0439465_0056207_15_422 129
756 3300041444 Ga0451790_24623 Ga0451790_24623_85_474 129
757 3300041453 Ga0451797_1305445 Ga0451797_1305445_517_906 129
758 3300041456 Ga0451795_0820506 Ga0451795_0820506_94_483 129
759 3300041459 Ga0451800_0177595 Ga0451800_0177595_80_481 129
760 3300041496 Ga0451839_1312103 Ga0451839_1312103_310_699 129
761 3300041502 Ga0451846_63244 Ga0451846_63244_152_541 129
762 3300041507 Ga0451851_0517789 Ga0451851_0517789_48_449 129
763 3300042005 Ga0439448_0302565 Ga0439448_0302565_140_544 129
764 3300042137 Ga0450902_006870 Ga0450902_006870_409_816 129
765 3300044656 Ga0466969_0224559 Ga0466969_0224559_144_533 129
766 3300044684 Ga0466966_0067594 Ga0466966_0067594_146_535 129
767 3300044694 Ga0466963_0052778 Ga0466963_0052778_1431_1820 129
768 3300044694 Ga0466963_0274798 Ga0466963_0274798_23_427 129
769 3300044712 Ga0453684_0022894 Ga0453684_0022894_6137_6532 129
770 3300044842 Ga0466957_0042883 Ga0466957_0042883_783_1172 129
771 3300044842 Ga0466957_0176495 Ga0466957_0176495_653_1057 129
772 3300044842 Ga0466957_0337115 Ga0466957_0337115_394_783 129
773 3300044901 Ga0466960_0094316 Ga0466960_0094316_413_802 129
774 3300045051 Ga0451576_0003979 Ga0451576_0003979_6611_7000 129
775 3300045836 Ga0466958_0277112 Ga0466958_0277112_167_571 129
776 3300045836 Ga0466958_0418373 Ga0466958_0418373_257_646 129
777 3300045976 Ga0466967_0148237 Ga0466967_0148237_1331_1735 129
778 3300045976 Ga0466967_0928017 Ga0466967_0928017_36_440 129
779 3300045976 Ga0466967_1031331 Ga0466967_1031331_137_526 129
780 3300046453 Ga0495627_000399 Ga0495627_000399_14540_14929 129
781 3300046459 Ga0495629_0392276 Ga0495629_0392276_343_753 129
782 3300046460 Ga0495638_0247288 Ga0495638_0247288_484_873 129
783 3300046460 Ga0495638_0278505 Ga0495638_0278505_29_418 129
784 3300046460 Ga0495638_0451268 Ga0495638_0451268_177_566 129
785 3300046460 Ga0495638_0649888 Ga0495638_0649888_55_444 129
786 3300046463 Ga0495653_0606452 Ga0495653_0606452_28_432 129
787 3300046474 Ga0495605_0136067 Ga0495605_0136067_353_742 129
788 3300046475 Ga0495639_0574932 Ga0495639_0574932_20_430 129
789 3300046491 Ga0495584_0027432 Ga0495584_0027432_1842_2246 129
790 3300046491 Ga0495584_0233145 Ga0495584_0233145_281_685 129
791 3300046506 Ga0495583_0048649 Ga0495583_0048649_562_951 129
792 3300046512 Ga0495610_0307179 Ga0495610_0307179_91_480 129
793 3300046516 Ga0495628_0966317 Ga0495628_0966317_158_562 129
794 3300046519 Ga0495632_0083729 Ga0495632_0083729_962_1351 129
795 3300046520 Ga0495637_0367090 Ga0495637_0367090_88_492 129
796 3300046524 Ga0495648_0206971 Ga0495648_0206971_194_583 129
797 3300046528 Ga0495642_0075799 Ga0495642_0075799_611_1000 129
798 3300046529 Ga0495652_0050149 Ga0495652_0050149_1529_1933 129
799 3300046533 Ga0495640_0447182 Ga0495640_0447182_78_482 129
800 3300046536 Ga0495587_0740903 Ga0495587_0740903_30_419 129
801 3300046538 Ga0495609_0061486 Ga0495609_0061486_427_816 129
802 3300046558 Ga0495633_0000510 Ga0495633_0000510_35340_35729 129
803 3300046558 Ga0495633_0161794 Ga0495633_0161794_309_698 129
804 3300046559 Ga0495667_0103734 Ga0495667_0103734_732_1136 129
805 3300046615 Ga0495656_0523824 Ga0495656_0523824_30_434 129
806 3300046648 Ga0495611_0076340 Ga0495611_0076340_852_1241 129
807 3300046660 Ga0495625_0087377 Ga0495625_0087377_708_1097 129
808 3300046664 Ga0495659_0038300 Ga0495659_0038300_1267_1671 129
809 3300046674 Ga0495588_0504029 Ga0495588_0504029_160_549 129
810 3300046680 Ga0495646_0590075 Ga0495646_0590075_141_548 129
811 3300046683 Ga0495658_0291721 Ga0495658_0291721_434_823 129
812 3300046684 Ga0495669_0175551 Ga0495669_0175551_529_918 129
813 3300046684 Ga0495669_0185650 Ga0495669_0185650_17_406 129
814 3300046692 Ga0495671_0129761 Ga0495671_0129761_295_684 129
815 3300046694 Ga0495649_0050668 Ga0495649_0050668_1004_1393 129
816 3300046794 Ga0495589_0086629 Ga0495589_0086629_137_526 129
817 3300047317 Ga0495604_0027202 Ga0495604_0027202_1014_1418 129
818 3300047317 Ga0495604_0536468 Ga0495604_0536468_317_724 129
819 3300047318 Ga0495636_0052191 Ga0495636_0052191_844_1233 129
820 3300047319 Ga0495674_0802390 Ga0495674_0802390_211_600 129
821 3300047323 Ga0495683_0031924 Ga0495683_0031924_1204_1593 129
822 3300047445 Ga0495677_0143449 Ga0495677_0143449_58_447 129
823 3300047446 Ga0495679_017960 Ga0495679_017960_641_1030 129
824 3300047446 Ga0495679_195562 Ga0495679_195562_57_446 129
825 3300047447 Ga0495685_082832 Ga0495685_082832_99_488 129
826 3300047469 Ga0495673_0000189 Ga0495673_0000189_87295_87684 129
827 3300047469 Ga0495673_0158617 Ga0495673_0158617_87_476 129
828 3300047471 Ga0495684_0922227 Ga0495684_0922227_49_456 129
829 3300047472 Ga0495686_0000007 Ga0495686_0000007_322864_323265 129
830 3300048903 Ga0496100_0093096 Ga0496100_0093096_1284_1688 129
831 3300048903 Ga0496100_0215715 Ga0496100_0215715_255_659 129
832 3300048903 Ga0496100_0436428 Ga0496100_0436428_286_690 129
833 3300048904 Ga0496101_0044118 Ga0496101_0044118_1684_2094 129
834 3300048904 Ga0496101_0122223 Ga0496101_0122223_1131_1520 129
835 3300048904 Ga0496101_0139715 Ga0496101_0139715_373_777 129
836 3300048904 Ga0496101_0150505 Ga0496101_0150505_176_580 129
837 3300048905 Ga0496102_0002642 Ga0496102_0002642_14369_14773 129
838 3300048905 Ga0496102_0015318 Ga0496102_0015318_2446_2850 129
839 3300048905 Ga0496102_0029392 Ga0496102_0029392_1532_1921 129
840 3300048905 Ga0496102_0318035 Ga0496102_0318035_276_680 129
841 3300048905 Ga0496102_0370286 Ga0496102_0370286_35_439 129
842 3300048905 Ga0496102_0455678 Ga0496102_0455678_376_780 129
843 3300048906 Ga0496103_0017034 Ga0496103_0017034_458_862 129
844 3300048906 Ga0496103_0035388 Ga0496103_0035388_2015_2419 129
845 3300048906 Ga0496103_0169394 Ga0496103_0169394_570_959 129
846 3300048907 Ga0496104_0051414 Ga0496104_0051414_1857_2261 129
847 3300048907 Ga0496104_0061755 Ga0496104_0061755_2814_3218 129
848 3300048907 Ga0496104_0087155 Ga0496104_0087155_1024_1434 129
849 3300048907 Ga0496104_0609717 Ga0496104_0609717_99_503 129
850 3300048907 Ga0496104_0932809 Ga0496104_0932809_257_646 129
851 3300048908 Ga0496105_0038459 Ga0496105_0038459_1180_1584 129
852 3300048908 Ga0496105_0098467 Ga0496105_0098467_1666_2070 129
853 3300048909 Ga0496106_0002278 Ga0496106_0002278_861_1265 129
854 3300048909 Ga0496106_0004608 Ga0496106_0004608_1419_1823 129
855 3300048909 Ga0496106_0384857 Ga0496106_0384857_709_1113 129
856 3300048910 Ga0496107_0018263 Ga0496107_0018263_2523_2927 129
857 3300048910 Ga0496107_0098093 Ga0496107_0098093_615_1019 129
858 3300048910 Ga0496107_0366440 Ga0496107_0366440_528_935 129
859 3300048910 Ga0496107_0678626 Ga0496107_0678626_228_617 129
860 3300048910 Ga0496107_0743478 Ga0496107_0743478_238_645 129
861 3300048911 Ga0496108_0010640 Ga0496108_0010640_2309_2719 129
862 3300048911 Ga0496108_0100742 Ga0496108_0100742_1531_1935 129
863 3300048911 Ga0496108_0160553 Ga0496108_0160553_462_869 129
864 3300048912 Ga0496109_0095451 Ga0496109_0095451_1418_1807 129
865 3300048912 Ga0496109_0139689 Ga0496109_0139689_1739_2143 129
866 3300048912 Ga0496109_0223543 Ga0496109_0223543_568_972 129
867 3300048913 Ga0496110_0018375 Ga0496110_0018375_3546_3953 129
868 3300048913 Ga0496110_1106175 Ga0496110_1106175_212_601 129
869 3300048914 Ga0496111_0267272 Ga0496111_0267272_186_590 129
870 3300048914 Ga0496111_0480506 Ga0496111_0480506_127_516 129
871 3300048915 Ga0496112_0043241 Ga0496112_0043241_1449_1838 129
872 3300048915 Ga0496112_0077705 Ga0496112_0077705_1881_2288 129
873 3300048915 Ga0496112_0400670 Ga0496112_0400670_226_630 129
874 3300048915 Ga0496112_1692895 Ga0496112_1692895_83_493 129
875 3300048916 Ga0496113_0464420 Ga0496113_0464420_451_858 129
876 3300048916 Ga0496113_0990499 Ga0496113_0990499_237_647 129
877 3300048916 Ga0496113_1518333 Ga0496113_1518333_11_415 129
878 3300048917 Ga0496114_0148509 Ga0496114_0148509_253_657 129
879 3300048917 Ga0496114_0389759 Ga0496114_0389759_495_899 129
880 3300048917 Ga0496114_0765310 Ga0496114_0765310_61_450 129
881 3300048918 Ga0496115_0001049 Ga0496115_0001049_7973_8362 129
882 3300048918 Ga0496115_0001671 Ga0496115_0001671_180_584 129
883 3300048918 Ga0496115_0003309 Ga0496115_0003309_904_1293 129
884 3300048918 Ga0496115_0017590 Ga0496115_0017590_921_1325 129
885 3300048918 Ga0496115_0032794 Ga0496115_0032794_2200_2610 129
886 3300048918 Ga0496115_0098395 Ga0496115_0098395_1818_2207 129
887 3300048919 Ga0496116_0078632 Ga0496116_0078632_1600_1989 129
888 3300048924 Ga0496121_0006108 Ga0496121_0006108_1262_1669 129
889 3300048925 Ga0496122_0035977 Ga0496122_0035977_1802_2191 129
890 3300048926 Ga0496123_0000699 Ga0496123_0000699_4663_5052 129
891 3300048927 Ga0496124_0119515 Ga0496124_0119515_614_1021 129
892 3300048927 Ga0496124_0387394 Ga0496124_0387394_446_835 129
893 3300048927 Ga0496124_0933360 Ga0496124_0933360_73_462 129
894 3300048928 Ga0496125_0011137 Ga0496125_0011137_4837_5226 129
895 3300048929 Ga0496126_0031566 Ga0496126_0031566_880_1281 129
896 3300048929 Ga0496126_0680280 Ga0496126_0680280_132_536 129
897 3300048929 Ga0496126_0685237 Ga0496126_0685237_310_699 129
898 3300048929 Ga0496126_0913724 Ga0496126_0913724_78_482 129
899 3300049128 Ga0501308_027199 Ga0501308_027199_298_687 129
900 3300049130 Ga0501310_068948 Ga0501310_068948_78_467 129
901 3300049131 Ga0501341_00973 Ga0501341_00973_891_1280 129
902 3300049162 Ga0501307_005363 Ga0501307_005363_794_1183 129
903 3300049459 Ga0495678_005745 Ga0495678_005745_5206_5595 129
904 3300049527 Ga0501311_001594 Ga0501311_001594_1243_1647 129
905 3300049527 Ga0501311_004336 Ga0501311_004336_434_823 129
906 3300049531 Ga0501315_018380 Ga0501315_018380_467_856 129
907 3300049534 Ga0501318_005621 Ga0501318_005621_422_811 129
908 3300049535 Ga0501319_000156 Ga0501319_000156_575_964 129
909 3300049539 Ga0501323_008595 Ga0501323_008595_33_422 129
910 3300049539 Ga0501323_011490 Ga0501323_011490_215_604 129
911 3300049539 Ga0501323_070165 Ga0501323_070165_66_455 129
912 3300049568 Ga0501031_0122081 Ga0501031_0122081_1112_1513 129
913 3300049569 Ga0501032_0289863 Ga0501032_0289863_253_654 129
914 3300049569 Ga0501032_0328982 Ga0501032_0328982_458_859 129
915 3300049569 Ga0501032_0511585 Ga0501032_0511585_349_750 129
916 3300049569 Ga0501032_0669897 Ga0501032_0669897_125_523 129
917 3300049570 Ga0501033_0012917 Ga0501033_0012917_5823_6221 129
918 3300049570 Ga0501033_0082082 Ga0501033_0082082_211_609 129
919 3300049570 Ga0501033_0094343 Ga0501033_0094343_186_590 129
920 3300049570 Ga0501033_0129530 Ga0501033_0129530_136_534 129
921 3300049570 Ga0501033_0226014 Ga0501033_0226014_82_483 129
922 3300049570 Ga0501033_0270110 Ga0501033_0270110_444_845 129
923 3300049570 Ga0501033_0515904 Ga0501033_0515904_301_705 129
924 3300049570 Ga0501033_0571565 Ga0501033_0571565_259_660 129
925 3300049570 Ga0501033_0922255 Ga0501033_0922255_162_566 129
926 3300049571 Ga0501034_0000208 Ga0501034_0000208_29434_29832 129
927 3300049571 Ga0501034_0009460 Ga0501034_0009460_8344_8745 129
928 3300049571 Ga0501034_0123530 Ga0501034_0123530_1522_1923 129
929 3300049571 Ga0501034_0181982 Ga0501034_0181982_1178_1567 129
930 3300049571 Ga0501034_0202292 Ga0501034_0202292_1007_1405 129
931 3300049571 Ga0501034_0213528 Ga0501034_0213528_1269_1670 129
932 3300049571 Ga0501034_0357812 Ga0501034_0357812_853_1260 129
933 3300049571 Ga0501034_0442181 Ga0501034_0442181_562_963 129
934 3300049571 Ga0501034_0598496 Ga0501034_0598496_487_876 129
935 3300049571 Ga0501034_0606783 Ga0501034_0606783_183_590 129
936 3300049571 Ga0501034_0643494 Ga0501034_0643494_27_428 129
937 3300049571 Ga0501034_1619741 Ga0501034_1619741_29_418 129
938 3300049572 Ga0501036_0072449 Ga0501036_0072449_710_1108 129
939 3300049572 Ga0501036_0076785 Ga0501036_0076785_591_992 129
940 3300049572 Ga0501036_0401367 Ga0501036_0401367_618_1013 129
941 3300049572 Ga0501036_0437121 Ga0501036_0437121_513_911 129
942 3300049572 Ga0501036_0450143 Ga0501036_0450143_230_631 129
943 3300049572 Ga0501036_0599766 Ga0501036_0599766_166_567 129
944 3300049572 Ga0501036_0708953 Ga0501036_0708953_401_799 129
945 3300049572 Ga0501036_0806694 Ga0501036_0806694_215_604 129
946 3300049572 Ga0501036_1141308 Ga0501036_1141308_129_518 129
947 3300049572 Ga0501036_1433706 Ga0501036_1433706_118_519 129
948 3300049573 Ga0501037_0005168 Ga0501037_0005168_4189_4587 129
949 3300049573 Ga0501037_0418622 Ga0501037_0418622_383_784 129
950 3300049573 Ga0501037_0684765 Ga0501037_0684765_125_523 129
951 3300049574 Ga0501038_0009962 Ga0501038_0009962_7557_7955 129
952 3300049574 Ga0501038_0269357 Ga0501038_0269357_581_979 129
953 3300049574 Ga0501038_0485697 Ga0501038_0485697_526_927 129
954 3300049574 Ga0501038_0525631 Ga0501038_0525631_274_663 129
955 3300049574 Ga0501038_0636953 Ga0501038_0636953_110_511 129
956 3300049574 Ga0501038_0661597 Ga0501038_0661597_143_544 129
957 3300049574 Ga0501038_0732930 Ga0501038_0732930_145_534 129
958 3300049575 Ga0501039_0000072 Ga0501039_0000072_60601_60999 129
959 3300049575 Ga0501039_0166307 Ga0501039_0166307_361_762 129
960 3300049575 Ga0501039_0450135 Ga0501039_0450135_182_583 129
961 3300049575 Ga0501039_0547576 Ga0501039_0547576_31_432 129
962 3300049575 Ga0501039_0613820 Ga0501039_0613820_129_533 129
963 3300049575 Ga0501039_0681252 Ga0501039_0681252_132_521 129
964 3300049575 Ga0501039_0769915 Ga0501039_0769915_190_591 129
965 3300049575 Ga0501039_1145568 Ga0501039_1145568_152_553 129
966 3300049576 Ga0501040_0378603 Ga0501040_0378603_392_793 129
967 3300049576 Ga0501040_0550938 Ga0501040_0550938_395_796 129
968 3300049576 Ga0501040_0655701 Ga0501040_0655701_185_574 129
969 3300049577 Ga0501041_0118391 Ga0501041_0118391_257_661 129
970 3300049577 Ga0501041_0509396 Ga0501041_0509396_288_677 129
971 3300049578 Ga0501042_0447496 Ga0501042_0447496_406_807 129
972 3300049578 Ga0501042_0768679 Ga0501042_0768679_127_528 129
973 3300049578 Ga0501042_1000071 Ga0501042_1000071_100_489 129
974 3300049578 Ga0501042_1088683 Ga0501042_1088683_147_545 129
975 3300049579 Ga0501043_0172568 Ga0501043_0172568_362_766 129
976 3300049579 Ga0501043_0411029 Ga0501043_0411029_346_747 129
977 3300049579 Ga0501043_0538625 Ga0501043_0538625_186_584 129
978 3300049579 Ga0501043_0651224 Ga0501043_0651224_328_729 129
979 3300049579 Ga0501043_0987574 Ga0501043_0987574_35_439 129
980 3300049579 Ga0501043_0990134 Ga0501043_0990134_38_436 129
981 3300049580 Ga0501046_0000045 Ga0501046_0000045_13888_14289 129
982 3300049580 Ga0501046_0004977 Ga0501046_0004977_10309_10710 129
983 3300049580 Ga0501046_0016665 Ga0501046_0016665_5016_5414 129
984 3300049580 Ga0501046_0021690 Ga0501046_0021690_4046_4447 129
985 3300049580 Ga0501046_0171333 Ga0501046_0171333_283_684 129
986 3300049580 Ga0501046_0180748 Ga0501046_0180748_927_1331 129
987 3300049580 Ga0501046_0313286 Ga0501046_0313286_303_701 129
988 3300049580 Ga0501046_0333543 Ga0501046_0333543_551_955 129
989 3300049581 Ga0501047_0001212 Ga0501047_0001212_9426_9824 129
990 3300049581 Ga0501047_0014860 Ga0501047_0014860_1829_2230 129
991 3300049581 Ga0501047_0046064 Ga0501047_0046064_228_629 129
992 3300049581 Ga0501047_0334586 Ga0501047_0334586_916_1305 129
993 3300049581 Ga0501047_0538509 Ga0501047_0538509_539_937 129
994 3300049581 Ga0501047_1019154 Ga0501047_1019154_168_572 129
995 3300049581 Ga0501047_1069360 Ga0501047_1069360_186_575 129
996 3300049582 Ga0501048_0000501 Ga0501048_0000501_6162_6560 129
997 3300049582 Ga0501048_0082989 Ga0501048_0082989_1591_1992 129
998 3300049582 Ga0501048_0312882 Ga0501048_0312882_370_759 129
999 3300049583 Ga0501067_0001102 Ga0501067_0001102_9244_9642 129
1000 3300049583 Ga0501067_0008019 Ga0501067_0008019_4525_4914 129
1001 3300049583 Ga0501067_0073295 Ga0501067_0073295_274_675 129
1002 3300049583 Ga0501067_0124203 Ga0501067_0124203_897_1298 129
1003 3300049583 Ga0501067_0283029 Ga0501067_0283029_455_859 129
1004 3300049583 Ga0501067_0311891 Ga0501067_0311891_384_785 129
1005 3300049584 Ga0501068_0251126 Ga0501068_0251126_716_1105 129
1006 3300049584 Ga0501068_0532634 Ga0501068_0532634_221_622 129
1007 3300049585 Ga0501069_0071224 Ga0501069_0071224_1139_1540 129
1008 3300049585 Ga0501069_0132004 Ga0501069_0132004_803_1192 129
1009 3300049585 Ga0501069_0175997 Ga0501069_0175997_704_1108 129
1010 3300049585 Ga0501069_0468363 Ga0501069_0468363_44_451 129
1011 3300049586 Ga0501070_0016943 Ga0501070_0016943_4896_5294 129
1012 3300049586 Ga0501070_0160366 Ga0501070_0160366_1123_1512 129
1013 3300049586 Ga0501070_0390283 Ga0501070_0390283_313_714 129
1014 3300049586 Ga0501070_0432667 Ga0501070_0432667_358_759 129
1015 3300049586 Ga0501070_0462200 Ga0501070_0462200_334_729 129
1016 3300049586 Ga0501070_0547289 Ga0501070_0547289_70_471 129
1017 3300049586 Ga0501070_0603528 Ga0501070_0603528_64_465 129
1018 3300049586 Ga0501070_0798815 Ga0501070_0798815_215_619 129
1019 3300049586 Ga0501070_0919529 Ga0501070_0919529_184_585 129
1020 3300049587 Ga0501071_0034272 Ga0501071_0034272_947_1348 129
1021 3300049587 Ga0501071_0436307 Ga0501071_0436307_300_689 129
1022 3300049587 Ga0501071_0638969 Ga0501071_0638969_286_690 129
1023 3300049587 Ga0501071_1171802 Ga0501071_1171802_187_582 129
1024 3300049587 Ga0501071_1248804 Ga0501071_1248804_80_469 129
1025 3300049588 Ga0501072_0147528 Ga0501072_0147528_1265_1666 129
1026 3300049588 Ga0501072_0163516 Ga0501072_0163516_719_1120 129
1027 3300049588 Ga0501072_0208507 Ga0501072_0208507_194_595 129
1028 3300049588 Ga0501072_0482486 Ga0501072_0482486_534_923 129
1029 3300049588 Ga0501072_0526950 Ga0501072_0526950_58_465 129
1030 3300049588 Ga0501072_1150109 Ga0501072_1150109_55_465 129
1031 3300049588 Ga0501072_1525348 Ga0501072_1525348_41_448 129
1032 3300049589 Ga0501073_0024093 Ga0501073_0024093_3153_3542 129
1033 3300049589 Ga0501073_0029749 Ga0501073_0029749_3236_3637 129
1034 3300049589 Ga0501073_0076482 Ga0501073_0076482_1625_2023 129
1035 3300049589 Ga0501073_0350204 Ga0501073_0350204_16_417 129
1036 3300049589 Ga0501073_0429999 Ga0501073_0429999_11_412 129
1037 3300049589 Ga0501073_0586976 Ga0501073_0586976_17_418 129
1038 3300049589 Ga0501073_0875787 Ga0501073_0875787_174_578 129
1039 3300049590 Ga0501074_0012386 Ga0501074_0012386_4861_5262 129
1040 3300049590 Ga0501074_0261439 Ga0501074_0261439_359_748 129
1041 3300049590 Ga0501074_0467707 Ga0501074_0467707_76_480 129
1042 3300049590 Ga0501074_0583602 Ga0501074_0583602_252_656 129
1043 3300049590 Ga0501074_0742033 Ga0501074_0742033_268_672 129
1044 3300049591 Ga0501075_0062889 Ga0501075_0062889_1197_1598 129
1045 3300049591 Ga0501075_0178154 Ga0501075_0178154_124_525 129
1046 3300049591 Ga0501075_0244635 Ga0501075_0244635_683_1084 129
1047 3300049591 Ga0501075_1269028 Ga0501075_1269028_49_438 129
1048 3300049592 Ga0501076_0217802 Ga0501076_0217802_522_923 129
1049 3300049592 Ga0501076_0368912 Ga0501076_0368912_46_438 129
1050 3300049592 Ga0501076_0571613 Ga0501076_0571613_18_422 129
1051 3300049592 Ga0501076_0606309 Ga0501076_0606309_348_737 129
1052 3300049592 Ga0501076_1397253 Ga0501076_1397253_50_460 129
1053 3300049593 Ga0501077_0007051 Ga0501077_0007051_479_880 129
1054 3300049593 Ga0501077_0067662 Ga0501077_0067662_233_634 129
1055 3300049593 Ga0501077_0072576 Ga0501077_0072576_1528_1917 129
1056 3300049593 Ga0501077_0334534 Ga0501077_0334534_498_902 129
1057 3300049593 Ga0501077_0609326 Ga0501077_0609326_196_597 129
1058 3300049593 Ga0501077_0695917 Ga0501077_0695917_99_506 129
1059 3300049671 Ga0501238_001704 Ga0501238_001704_509_898 129
1060 3300049741 Ga0501079_0022217 Ga0501079_0022217_3220_3621 129
1061 3300049741 Ga0501079_0085229 Ga0501079_0085229_710_1114 129
1062 3300049741 Ga0501079_0757933 Ga0501079_0757933_61_465 129
1063 3300049741 Ga0501079_0782294 Ga0501079_0782294_264_665 129
1064 3300049742 Ga0501080_0000005 Ga0501080_0000005_153758_154156 129
1065 3300049742 Ga0501080_0010846 Ga0501080_0010846_7152_7553 129
1066 3300049742 Ga0501080_0188525 Ga0501080_0188525_558_959 129
1067 3300049742 Ga0501080_0615338 Ga0501080_0615338_80_481 129
1068 3300049743 Ga0501081_0042743 Ga0501081_0042743_984_1388 129
1069 3300049743 Ga0501081_0113773 Ga0501081_0113773_715_1116 129
1070 3300049743 Ga0501081_0433895 Ga0501081_0433895_35_439 129
1071 3300049743 Ga0501081_0935444 Ga0501081_0935444_49_438 129
1072 3300049743 Ga0501081_1054618 Ga0501081_1054618_80_484 129
1073 3300049744 Ga0501083_0114508 Ga0501083_0114508_546_947 129
1074 3300049744 Ga0501083_0225221 Ga0501083_0225221_781_1182 129
1075 3300049744 Ga0501083_1087282 Ga0501083_1087282_33_422 129
1076 3300049822 Ga0501035_0000049 Ga0501035_0000049_32902_33300 129
1077 3300049822 Ga0501035_0030043 Ga0501035_0030043_4405_4803 129
1078 3300049822 Ga0501035_0113525 Ga0501035_0113525_575_979 129
1079 3300049822 Ga0501035_0351623 Ga0501035_0351623_827_1216 129
1080 3300049822 Ga0501035_0415470 Ga0501035_0415470_682_1083 129
1081 3300049822 Ga0501035_0696089 Ga0501035_0696089_94_495 129
1082 3300049822 Ga0501035_0804700 Ga0501035_0804700_140_538 129
1083 3300049823 Ga0501044_0000030 Ga0501044_0000030_60662_61060 129
1084 3300049823 Ga0501044_0027898 Ga0501044_0027898_4909_5310 129
1085 3300049823 Ga0501044_0237864 Ga0501044_0237864_312_713 129
1086 3300049823 Ga0501044_0272626 Ga0501044_0272626_841_1230 129
1087 3300049823 Ga0501044_0321454 Ga0501044_0321454_210_611 129
1088 3300049823 Ga0501044_0419727 Ga0501044_0419727_150_539 129
1089 3300049823 Ga0501044_0462733 Ga0501044_0462733_147_545 129
1090 3300049823 Ga0501044_0469605 Ga0501044_0469605_680_1069 129
1091 3300049823 Ga0501044_0666789 Ga0501044_0666789_402_791 129
1092 3300049823 Ga0501044_0793535 Ga0501044_0793535_88_489 129
1093 3300049824 Ga0501045_0026586 Ga0501045_0026586_161_562 129
1094 3300049824 Ga0501045_0110710 Ga0501045_0110710_525_923 129
1095 3300049824 Ga0501045_0388511 Ga0501045_0388511_409_810 129
1096 3300049824 Ga0501045_0462869 Ga0501045_0462869_251_655 129
1097 3300049824 Ga0501045_0610950 Ga0501045_0610950_291_698 129
1098 3300050492 nmdc:mga0yw44_205378_c1 nmdc:mga0yw44_205378_c1_735_1124 129
1099 3300050492 nmdc:mga0yw44_319256_c1 nmdc:mga0yw44_319256_c1_32_433 129
1100 3300050493 nmdc:mga0k408_36414_c1 nmdc:mga0k408_36414_c1_1801_2190 129
1101 3300050494 nmdc:mga06z11_14438_c1 nmdc:mga06z11_14438_c1_177_566 129
1102 3300050495 nmdc:mga04h51_2833_c1 nmdc:mga04h51_2833_c1_152_541 129
1103 3300050496 nmdc:mga07m45_231865_c1 nmdc:mga07m45_231865_c1_540_929 129
1104 3300050507 nmdc:mga05p37_1596261_c1 nmdc:mga05p37_1596261_c1_123_527 129
1105 3300050507 nmdc:mga05p37_172193_c1 nmdc:mga05p37_172193_c1_468_872 129
1106 3300050507 nmdc:mga05p37_236239_c1 nmdc:mga05p37_236239_c1_1424_1828 129
1107 3300050507 nmdc:mga05p37_317241_c1 nmdc:mga05p37_317241_c1_1363_1767 129
1108 3300050507 nmdc:mga05p37_56603_c1 nmdc:mga05p37_56603_c1_3670_4074 129
1109 3300050507 nmdc:mga05p37_780216_c1 nmdc:mga05p37_780216_c1_555_959 129
1110 3300050508 nmdc:mga09592_165761_c1 nmdc:mga09592_165761_c1_1472_1876 129
1111 3300050509 nmdc:mga0qj67_186404_c1 nmdc:mga0qj67_186404_c1_404_808 129
1112 3300050509 nmdc:mga0qj67_4050_c1 nmdc:mga0qj67_4050_c1_7796_8200 129
1113 3300050510 nmdc:mga06r32_385104_c1 nmdc:mga06r32_385104_c1_398_802 129
1114 3300050510 nmdc:mga06r32_650083_c1 nmdc:mga06r32_650083_c1_201_605 129
1115 3300050510 nmdc:mga06r32_671829_c1 nmdc:mga06r32_671829_c1_308_712 129
1116 3300050511 nmdc:mga08y16_1220500_c1 nmdc:mga08y16_1220500_c1_293_697 129
1117 3300050511 nmdc:mga08y16_174191_c1 nmdc:mga08y16_174191_c1_1009_1413 129
1118 3300050511 nmdc:mga08y16_29815_c1 nmdc:mga08y16_29815_c1_673_1077 129
1119 3300050511 nmdc:mga08y16_31334_c1 nmdc:mga08y16_31334_c1_4929_5330 129
1120 3300050511 nmdc:mga08y16_45619_c1 nmdc:mga08y16_45619_c1_3838_4242 129
1121 3300050511 nmdc:mga08y16_867444_c1 nmdc:mga08y16_867444_c1_43_447 129
1122 3300050512 nmdc:mga0n895_173736_c1 nmdc:mga0n895_173736_c1_1693_2100 129
1123 3300050512 nmdc:mga0n895_2833_c1 nmdc:mga0n895_2833_c1_12360_12764 129
1124 3300050512 nmdc:mga0n895_400566_c1 nmdc:mga0n895_400566_c1_757_1161 129
1125 3300050513 nmdc:mga0rr50_38822_c1 nmdc:mga0rr50_38822_c1_829_1236 129
1126 3300050513 nmdc:mga0rr50_970250_c1 nmdc:mga0rr50_970250_c1_13_420 129
1127 3300050514 nmdc:mga08x19_522658_c1 nmdc:mga08x19_522658_c1_240_647 129
1128 3300050515 nmdc:mga0a205_2479_c1 nmdc:mga0a205_2479_c1_15137_15541 129
1129 3300050515 nmdc:mga0a205_396682_c1 nmdc:mga0a205_396682_c1_127_531 129
1130 3300050515 nmdc:mga0a205_685731_c1 nmdc:mga0a205_685731_c1_199_606 129
1131 3300053077 Ga0495601_0194481 Ga0495601_0194481_152_541 129
1132 3300053078 Ga0495612_0018232 Ga0495612_0018232_652_1056 129
1133 3300053084 Ga0495595_0051526 Ga0495595_0051526_1263_1667 129
1134 3300053085 Ga0495619_0057702 Ga0495619_0057702_127_534 129
1135 3300053085 Ga0495619_0125055 Ga0495619_0125055_416_820 129
1136 3300053085 Ga0495619_0578918 Ga0495619_0578918_241_630 129
1137 3300053086 Ga0500578_0000459 Ga0500578_0000459_24491_24880 129
1138 3300053087 Ga0500643_001398 Ga0500643_001398_9731_10120 129
1139 3300053087 Ga0500643_002694 Ga0500643_002694_3326_3715 129
1140 3300053088 Ga0500644_0163011 Ga0500644_0163011_208_597 129
1141 3300053092 Ga0500583_0162063 Ga0500583_0162063_658_1047 129
1142 3300053096 Ga0500641_0097697 Ga0500641_0097697_715_1104 129
1143 3300053102 Ga0500554_070188 Ga0500554_070188_577_966 129
1144 3300053104 Ga0500556_0000636 Ga0500556_0000636_14497_14904 129
1145 3300053108 Ga0500562_003308 Ga0500562_003308_440_829 129
1146 3300053111 Ga0500572_000706 Ga0500572_000706_1020_1409 129
1147 3300053118 Ga0500594_0123906 Ga0500594_0123906_231_620 129
1148 3300053118 Ga0500594_0160110 Ga0500594_0160110_265_672 129
1149 3300053119 Ga0500595_071208 Ga0500595_071208_550_957 129
1150 3300053122 Ga0500608_000084 Ga0500608_000084_21914_22303 129
1151 3300053123 Ga0500614_032376 Ga0500614_032376_146_535 129
1152 3300053125 Ga0500618_000395 Ga0500618_000395_4592_4981 129
1153 3300053130 Ga0500642_0080981 Ga0500642_0080981_439_828 129
1154 3300053136 Ga0500559_0000113 Ga0500559_0000113_47375_47764 129
1155 3300053136 Ga0500559_0001398 Ga0500559_0001398_12505_12894 129
1156 3300053136 Ga0500559_0179035 Ga0500559_0179035_62_451 129
1157 3300053140 Ga0500573_0040077 Ga0500573_0040077_792_1181 129
1158 3300053142 Ga0500577_0017824 Ga0500577_0017824_862_1251 129
1159 3300053142 Ga0500577_0279280 Ga0500577_0279280_245_634 129
1160 3300053146 Ga0500588_0375719 Ga0500588_0375719_38_427 129
1161 3300053148 Ga0500590_305366 Ga0500590_305366_62_451 129
1162 3300053151 Ga0500604_0065300 Ga0500604_0065300_570_959 129
1163 3300053153 Ga0500616_0003259 Ga0500616_0003259_1879_2286 129
1164 3300053156 Ga0500622_0019916 Ga0500622_0019916_2713_3102 129
1165 3300053160 Ga0500633_0184725 Ga0500633_0184725_89_478 129
1166 3300053161 Ga0500634_0157358 Ga0500634_0157358_519_908 129
1167 3300053163 Ga0500639_075340 Ga0500639_075340_194_583 129
1168 3300053727 Ga0500611_095561 Ga0500611_095561_346_735 129
1169 3300053727 Ga0500611_100892 Ga0500611_100892_244_633 129
1170 3300053730 Ga0500645_010383 Ga0500645_010383_576_983 129
1171 3300053731 Ga0500609_054154 Ga0500609_054154_63_452 129
1172 3300054114 Ga0501084_0006267 Ga0501084_0006267_8763_9164 129
1173 3300054114 Ga0501084_0141553 Ga0501084_0141553_417_806 129
1174 3300054114 Ga0501084_0184188 Ga0501084_0184188_761_1165 129
1175 3300054114 Ga0501084_0289759 Ga0501084_0289759_812_1213 129
1176 3300054114 Ga0501084_0299474 Ga0501084_0299474_755_1156 129
1177 3300054114 Ga0501084_0663744 Ga0501084_0663744_392_790 129
1178 3300054114 Ga0501084_0770388 Ga0501084_0770388_321_725 129
1179 3300054114 Ga0501084_0977468 Ga0501084_0977468_35_436 129
1180 3300059477 Ga0587084_083583 Ga0587084_083583_181_570 129
1181 3300059478 Ga0587093_042853 Ga0587093_042853_21_410 129
1182 3300059492 Ga0587073_0232585 Ga0587073_0232585_40_450 129
1183 3300059505 Ga0587083_0074098 Ga0587083_0074098_250_639 129
1184 3300059508 Ga0587088_128227 Ga0587088_128227_136_525 129
1185 3300059510 Ga0587090_058580 Ga0587090_058580_42_437 129
1186 3300059512 Ga0587092_027629 Ga0587092_027629_79_468 129
1187 3300059512 Ga0587092_098355 Ga0587092_098355_106_495 129
1188 3300059513 Ga0587094_025516 Ga0587094_025516_471_860 129
1189 3300059604 Ga0587098_005909 Ga0587098_005909_93_482 129
1190 3300059605 Ga0587106_000505 Ga0587106_000505_1476_1865 129
1191 3300059605 Ga0587106_102105 Ga0587106_102105_120_509 129
1192 3300059607 Ga0587125_013034 Ga0587125_013034_59_448 129
1193 3300059608 Ga0587129_004972 Ga0587129_004972_16_405 129
1194 3300059623 Ga0587101_067023 Ga0587101_067023_11_400 129
1195 3300059623 Ga0587101_149138 Ga0587101_149138_35_424 129
1196 3300059645 Ga0587076_050589 Ga0587076_050589_83_472 129
1197 3300059646 Ga0587078_026257 Ga0587078_026257_48_437 129
1198 3300059652 Ga0587107_011200 Ga0587107_011200_59_448 129
1199 3300060346 Ga0587111_0253784 Ga0587111_0253784_13_402 129
1200 3300060353 Ga0501082_0030302 Ga0501082_0030302_3313_3714 129
1201 3300060353 Ga0501082_0069663 Ga0501082_0069663_980_1381 129
1202 3300060353 Ga0501082_0088119 Ga0501082_0088119_844_1242 129
1203 3300060353 Ga0501082_0114130 Ga0501082_0114130_570_974 129
1204 3300060353 Ga0501082_0136753 Ga0501082_0136753_842_1243 129
1205 3300060353 Ga0501082_0665513 Ga0501082_0665513_411_800 129
1206 3300060353 Ga0501082_0997369 Ga0501082_0997369_283_684 129
1207 3300060353 Ga0501082_1046130 Ga0501082_1046130_155_559 129
1208 3300060353 Ga0501082_1561408 Ga0501082_1561408_44_448 129
1209 3300060353 Ga0501082_1692524 Ga0501082_1692524_130_531 129
1210 3300061734 Ga0530510_0066947 Ga0530510_0066947_1991_2392 129
1211 3300061734 Ga0530510_0118926 Ga0530510_0118926_686_1087 129
1212 3300061734 Ga0530510_0182254 Ga0530510_0182254_258_659 129
1213 3300061734 Ga0530510_0877165 Ga0530510_0877165_94_495 129
1214 3300061734 Ga0530510_0997585 Ga0530510_0997585_34_423 129
1215 3300001979 JGI24740J21852_10057967 JGI24740J21852_100579672 130
1216 3300003214 JGI25165J46597_1001315 JGI25165J46597_10013152 130
1217 3300005330 Ga0070690_100186523 Ga0070690_1001865232 130
1218 3300005334 Ga0068869_100008437 Ga0068869_1000084375 130
1219 3300005334 Ga0068869_100544084 Ga0068869_1005440841 130
1220 3300005335 Ga0070666_10264260 Ga0070666_102642603 130
1221 3300005338 Ga0068868_100602383 Ga0068868_1006023832 130
1222 3300005338 Ga0068868_101136364 Ga0068868_1011363641 130
1223 3300005338 Ga0068868_101894648 Ga0068868_1018946481 130
1224 3300005339 Ga0070660_100061987 Ga0070660_1000619872 130
1225 3300005341 Ga0070691_10140140 Ga0070691_101401401 130
1226 3300005344 Ga0070661_100246457 Ga0070661_1002464572 130
1227 3300005344 Ga0070661_101866016 Ga0070661_1018660161 130
1228 3300005347 Ga0070668_100443671 Ga0070668_1004436711 130
1229 3300005353 Ga0070669_101011062 Ga0070669_1010110622 130
1230 3300005354 Ga0070675_101001736 Ga0070675_1010017362 130
1231 3300005355 Ga0070671_100110233 Ga0070671_1001102331 130
1232 3300005355 Ga0070671_101004691 Ga0070671_1010046912 130
1233 3300005365 Ga0070688_100187724 Ga0070688_1001877242 130
1234 3300005365 Ga0070688_101421598 Ga0070688_1014215981 130
1235 3300005367 Ga0070667_100209903 Ga0070667_1002099033 130
1236 3300005367 Ga0070667_101130230 Ga0070667_1011302301 130
1237 3300005436 Ga0070713_100708019 Ga0070713_1007080191 130
1238 3300005438 Ga0070701_10216281 Ga0070701_102162811 130
1239 3300005441 Ga0070700_100800876 Ga0070700_1008008762 130
1240 3300005456 Ga0070678_100483807 Ga0070678_1004838071 130
1241 3300005457 Ga0070662_100141547 Ga0070662_1001415472 130
1242 3300005459 Ga0068867_100209008 Ga0068867_1002090082 130
1243 3300005459 Ga0068867_100572102 Ga0068867_1005721022 130
1244 3300005544 Ga0070686_100334643 Ga0070686_1003346432 130
1245 3300005544 Ga0070686_100502805 Ga0070686_1005028052 130
1246 3300005548 Ga0070665_100026249 Ga0070665_1000262494 130
1247 3300005549 Ga0070704_101620467 Ga0070704_1016204671 130
1248 3300005563 Ga0068855_100137813 Ga0068855_1001378133 130
1249 3300005564 Ga0070664_101506345 Ga0070664_1015063452 130
1250 3300005615 Ga0070702_101822182 Ga0070702_1018221821 130
1251 3300005616 Ga0068852_100576541 Ga0068852_1005765412 130
1252 3300005618 Ga0068864_102048436 Ga0068864_1020484361 130
1253 3300005718 Ga0068866_10209421 Ga0068866_102094212 130
1254 3300005841 Ga0068863_100983699 Ga0068863_1009836992 130
1255 3300005842 Ga0068858_100012099 Ga0068858_1000120994 130
1256 3300006028 Ga0070717_11373621 Ga0070717_113736211 130
1257 3300006195 Ga0075366_10044076 Ga0075366_100440763 130
1258 3300006237 Ga0097621_100003892 Ga0097621_10000389212 130
1259 3300006237 Ga0097621_100679452 Ga0097621_1006794522 130
1260 3300006358 Ga0068871_100532121 Ga0068871_1005321212 130
1261 3300006358 Ga0068871_100605847 Ga0068871_1006058472 130
1262 3300007788 Ga0099795_10246029 Ga0099795_102460292 130
1263 3300009093 Ga0105240_10811134 Ga0105240_108111342 130
1264 3300009098 Ga0105245_11199584 Ga0105245_111995841 130
1265 3300009098 Ga0105245_12327652 Ga0105245_123276522 130
1266 3300009101 Ga0105247_10741764 Ga0105247_107417642 130
1267 3300009148 Ga0105243_10624585 Ga0105243_106245852 130
1268 3300009176 Ga0105242_11429425 Ga0105242_114294251 130
1269 3300009177 Ga0105248_10239747 Ga0105248_102397472 130
1270 3300009551 Ga0105238_11994332 Ga0105238_119943321 130
1271 3300010375 Ga0105239_12960839 Ga0105239_129608392 130
1272 3300013296 Ga0157374_10609235 Ga0157374_106092352 130
1273 3300013297 Ga0157378_10618473 Ga0157378_106184732 130
1274 3300013308 Ga0157375_12522197 Ga0157375_125221971 130
1275 3300014968 Ga0157379_10206026 Ga0157379_102060262 130
1276 3300014969 Ga0157376_11520995 Ga0157376_115209951 130
1277 3300021361 Ga0213872_10363622 Ga0213872_103636222 130
1278 3300025231 Ga0207427_104861 Ga0207427_1048612 130
1279 3300025261 Ga0209233_1000013 Ga0209233_1000013750 130
1280 3300025899 Ga0207642_10465669 Ga0207642_104656692 130
1281 3300025900 Ga0207710_10206345 Ga0207710_102063452 130
1282 3300025903 Ga0207680_10193851 Ga0207680_101938513 130
1283 3300025903 Ga0207680_10294370 Ga0207680_102943701 130
1284 3300025907 Ga0207645_10027676 Ga0207645_100276765 130
1285 3300025908 Ga0207643_10321808 Ga0207643_103218082 130
1286 3300025909 Ga0207705_10076496 Ga0207705_100764963 130
1287 3300025912 Ga0207707_10484945 Ga0207707_104849451 130
1288 3300025913 Ga0207695_10403007 Ga0207695_104030072 130
1289 3300025914 Ga0207671_10705708 Ga0207671_107057082 130
1290 3300025919 Ga0207657_10083597 Ga0207657_100835972 130
1291 3300025926 Ga0207659_11379701 Ga0207659_113797011 130
1292 3300025927 Ga0207687_10527637 Ga0207687_105276372 130
1293 3300025927 Ga0207687_10625466 Ga0207687_106254662 130
1294 3300025927 Ga0207687_10945196 Ga0207687_109451961 130
1295 3300025928 Ga0207700_10719333 Ga0207700_107193332 130
1296 3300025931 Ga0207644_10078687 Ga0207644_100786872 130
1297 3300025933 Ga0207706_10205402 Ga0207706_102054022 130
1298 3300025935 Ga0207709_10007982 Ga0207709_100079822 130
1299 3300025936 Ga0207670_10366911 Ga0207670_103669112 130
1300 3300025940 Ga0207691_10350676 Ga0207691_103506762 130
1301 3300025942 Ga0207689_10013634 Ga0207689_100136346 130
1302 3300025942 Ga0207689_10442129 Ga0207689_104421292 130
1303 3300025944 Ga0207661_10519997 Ga0207661_105199972 130
1304 3300025944 Ga0207661_11055193 Ga0207661_110551932 130
1305 3300025945 Ga0207679_10981191 Ga0207679_109811912 130
1306 3300025949 Ga0207667_10589684 Ga0207667_105896842 130
1307 3300025960 Ga0207651_10027205 Ga0207651_100272052 130
1308 3300025972 Ga0207668_10222061 Ga0207668_102220612 130
1309 3300025981 Ga0207640_11840477 Ga0207640_118404772 130
1310 3300025986 Ga0207658_10420427 Ga0207658_104204271 130
1311 3300025986 Ga0207658_10593453 Ga0207658_105934532 130
1312 3300025986 Ga0207658_11283616 Ga0207658_112836162 130
1313 3300026035 Ga0207703_10124896 Ga0207703_101248964 130
1314 3300026067 Ga0207678_10750054 Ga0207678_107500541 130
1315 3300026089 Ga0207648_10025631 Ga0207648_100256315 130
1316 3300026089 Ga0207648_10625804 Ga0207648_106258041 130
1317 3300026121 Ga0207683_10566477 Ga0207683_105664772 130
1318 3300026142 Ga0207698_10443331 Ga0207698_104433313 130
1319 3300026142 Ga0207698_10834411 Ga0207698_108344112 130
1320 3300028379 Ga0268266_10178394 Ga0268266_101783942 130
1321 3300028380 Ga0268265_10593862 Ga0268265_105938622 130
1322 3300028381 Ga0268264_12263184 Ga0268264_122631842 130
1323 3300031456 Ga0307513_10600403 Ga0307513_106004031 130
1324 3300031507 Ga0307509_10386543 Ga0307509_103865432 130
1325 3300031616 Ga0307508_10171057 Ga0307508_101710573 130
1326 3300031824 Ga0307413_11365589 Ga0307413_113655891 130
1327 3300031901 Ga0307406_10505848 Ga0307406_105058482 130
1328 3300033180 Ga0307510_10540988 Ga0307510_105409881 130
1329 3300034957 Ga0373938_0026082 Ga0373938_0026082_486_896 130
1330 3300035695 Ga0373927_0964677 Ga0373927_0964677_18_428 130
1331 3300035724 Ga0373933_0554236 Ga0373933_0554236_213_623 130
1332 3300036401 Ga0373937_0228037 Ga0373937_0228037_982_1392 130
1333 3300037471 Ga0395905_1052736 Ga0395905_1052736_202_615 130
1334 3300037471 Ga0395905_1413361 Ga0395905_1413361_167_559 130
1335 3300039438 Ga0436360_0387015 Ga0436360_0387015_325_735 130
1336 3300039450 Ga0436363_1304811 Ga0436363_1304811_40_450 130
1337 3300041459 Ga0451800_1326835 Ga0451800_1326835_76_486 130
1338 3300041507 Ga0451851_1169255 Ga0451851_1169255_39_449 130
1339 3300046455 Ga0495603_0502067 Ga0495603_0502067_185_595 130
1340 3300046457 Ga0495590_0136108 Ga0495590_0136108_318_728 130
1341 3300046492 Ga0495585_0066533 Ga0495585_0066533_941_1351 130
1342 3300046507 Ga0495606_0032036 Ga0495606_0032036_2675_3088 130
1343 3300046514 Ga0495618_0184469 Ga0495618_0184469_73_483 130
1344 3300046517 Ga0495630_0702144 Ga0495630_0702144_261_671 130
1345 3300046519 Ga0495632_0079274 Ga0495632_0079274_625_1035 130
1346 3300046523 Ga0495644_0251560 Ga0495644_0251560_41_451 130
1347 3300046530 Ga0495654_0060993 Ga0495654_0060993_129_539 130
1348 3300046533 Ga0495640_0240079 Ga0495640_0240079_514_924 130
1349 3300046535 Ga0495586_0376981 Ga0495586_0376981_279_689 130
1350 3300046557 Ga0495622_0005663 Ga0495622_0005663_4637_5047 130
1351 3300046615 Ga0495656_0073584 Ga0495656_0073584_404_814 130
1352 3300046648 Ga0495611_0428415 Ga0495611_0428415_65_478 130
1353 3300046660 Ga0495625_0020239 Ga0495625_0020239_1702_2112 130
1354 3300046665 Ga0495661_0128758 Ga0495661_0128758_462_872 130
1355 3300046689 Ga0495613_0229804 Ga0495613_0229804_301_711 130
1356 3300047318 Ga0495636_0103531 Ga0495636_0103531_803_1213 130
1357 3300047321 Ga0495676_0264279 Ga0495676_0264279_157_567 130
1358 3300048090 Ga0495615_0221308 Ga0495615_0221308_111_521 130
1359 3300048905 Ga0496102_0294433 Ga0496102_0294433_870_1262 130
1360 3300048906 Ga0496103_0209716 Ga0496103_0209716_650_1042 130
1361 3300048910 Ga0496107_0973644 Ga0496107_0973644_16_408 130
1362 3300048917 Ga0496114_0855636 Ga0496114_0855636_60_461 130
1363 3300048920 Ga0496117_0146665 Ga0496117_0146665_584_976 130
1364 3300048924 Ga0496121_0253153 Ga0496121_0253153_97_489 130
1365 3300048929 Ga0496126_0094915 Ga0496126_0094915_815_1207 130
1366 3300049460 Ga0495682_0189414 Ga0495682_0189414_131_541 130
1367 3300049527 Ga0501311_014284 Ga0501311_014284_33_434 130
1368 3300049572 Ga0501036_0815168 Ga0501036_0815168_149_571 130
1369 3300049574 Ga0501038_0000069 Ga0501038_0000069_60749_61174 130
1370 3300049574 Ga0501038_0402943 Ga0501038_0402943_537_929 130
1371 3300049583 Ga0501067_0592349 Ga0501067_0592349_143_553 130
1372 3300049589 Ga0501073_0213301 Ga0501073_0213301_845_1258 130
1373 3300049589 Ga0501073_0460050 Ga0501073_0460050_40_456 130
1374 3300049742 Ga0501080_0517088 Ga0501080_0517088_142_555 130
1375 3300050493 nmdc:mga0k408_139435_c1 nmdc:mga0k408_139435_c1_218_610 130
1376 3300050509 nmdc:mga0qj67_344652_c1 nmdc:mga0qj67_344652_c1_504_917 130
1377 3300050516 nmdc:mga0sz30_24066_c1 nmdc:mga0sz30_24066_c1_807_1199 130
1378 3300053080 Ga0500635_0031075 Ga0500635_0031075_586_996 130
1379 3300053087 Ga0500643_000003 Ga0500643_000003_34002_34412 130
1380 3300053094 Ga0500566_0487259 Ga0500566_0487259_52_462 130
1381 3300053097 Ga0500648_374559 Ga0500648_374559_37_447 130
1382 3300053103 Ga0500555_050120 Ga0500555_050120_217_627 130
1383 3300053105 Ga0500557_217408 Ga0500557_217408_107_499 130
1384 3300053119 Ga0500595_030639 Ga0500595_030639_136_546 130
1385 3300053119 Ga0500595_109071 Ga0500595_109071_126_599 130
1386 3300053120 Ga0500597_331540 Ga0500597_331540_125_535 130
1387 3300053136 Ga0500559_0084588 Ga0500559_0084588_1018_1428 130
1388 3300053153 Ga0500616_0054505 Ga0500616_0054505_44_436 130
1389 3300053163 Ga0500639_120431 Ga0500639_120431_38_448 130
1390 3300053735 Ga0500596_028037 Ga0500596_028037_322_732 130
1391 3300059493 Ga0587077_194132 Ga0587077_194132_105_503 130
1392 3300059503 Ga0587080_066164 Ga0587080_066164_198_590 130
1393 3300059623 Ga0587101_027562 Ga0587101_027562_50_442 130
1394 3300059623 Ga0587101_118593 Ga0587101_118593_75_470 130
1395 3300059623 Ga0587101_135185 Ga0587101_135185_36_428 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00411

Ribosomal_S11

Ribosomal protein S11

47

156

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9507 17 116
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9498 17 108
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9399 17 108
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9326 17 116
4v48-assembly1.cif.gz_BK real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.924 14 114
ID Description Score Start End Superfamily
af_P55138_1_114_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8777 19 47 3.30.420.40
af_A0A1D6DWZ1_6_279_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8454 24 47 3.30.420.40
4qs2K00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8357 18 126 3.30.420.80
af_C0P5F8_195_302_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8108 20 106 3.30.420.100
af_P9WH65_1_139_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8077 1 130 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9448 22 109 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0G1UXB4-F1-model_v4 Small ribosomal subunit protein uS11 0.9326 18 101 GO:0003735
GO:0005840
GO:0006412
GO:0008168
GO:0019843
GO:0032259
GO:1990904
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9245 22 109 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E1U474-F1-model_v4 30S ribosomal protein S11 0.9239 12 89 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7J9GWT2-F1-model_v4 Ribosomal protein S11 0.9233 17 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.96 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map