F493408

General Info

Members Datasets Scaffolds Average Seq Length
1370 443 2674 102

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100688361|Ga0307408_1006883611
Length 126
Sequence MAAFARPYHPIDGISDEFLPKGREMIHVLAVITAKPGKRDEVLKHFRANVPAVRAEKGCIEYGAAIDADPALSVQTKYGPETFVVIEKWESLDALKAHAVAPHMQAYGAKTKELLASRVIHVLSPT

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
247 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
248 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
260 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
261 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
262 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
263 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
264 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
265 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
266 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
267 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
269 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
271 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
276 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
277 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
278 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
279 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
280 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
281 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
282 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
283 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
303 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
304 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
307 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
308 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
309 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
310 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
311 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
312 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
313 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
314 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
315 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
316 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
317 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
318 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
323 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
345 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
346 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
349 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
350 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
351 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
352 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
390 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
391 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
392 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
393 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
394 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
400 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
414 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
415 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
416 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
417 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
418 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
419 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
420 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
421 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
422 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
423 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
424 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
425 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
426 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
427 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
430 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
431 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
432 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
433 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
434 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
437 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
438 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
442 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
443 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 0.73
Rhizosphere 89.49
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100688361 3300031548 Bacteria 918
2 JGI25406J46586_10032237 3300003203 Bacteria 1949
3 JGI25160J50197_1050733 3300003354 Bacteria 882
4 Ga0065704_10715392 3300005289 Bacteria 555
5 Ga0065712_10284502 3300005290 Unclassified 873
6 Ga0065715_10250015 3300005293 Bacteria 1170
7 Ga0065707_10022154 3300005295 Bacteria 1395
8 Ga0070658_10042730 3300005327 Bacteria 3661
9 Ga0070658_10351203 3300005327 Bacteria 1262
10 Ga0070658_11264093 3300005327 Unclassified 641
11 Ga0070676_10287154 3300005328 Bacteria 1111
12 Ga0070676_10374076 3300005328 Unclassified 985
13 Ga0070676_10521337 3300005328 Bacteria 847
14 Ga0070683_100629096 3300005329 Bacteria 1027
15 Ga0070683_102186509 3300005329 Bacteria 531
16 Ga0070690_100012557 3300005330 Bacteria 4984
17 Ga0070690_100110103 3300005330 Bacteria 1837
18 Ga0070690_100386838 3300005330 Bacteria 1024
19 Ga0070690_100441882 3300005330 Bacteria 963
20 Ga0070690_100497388 3300005330 Bacteria 912
21 Ga0070690_100691791 3300005330 Bacteria 782
22 Ga0070690_101613754 3300005330 Bacteria 526
23 Ga0070670_100164783 3300005331 Unclassified 1921
24 Ga0070670_100640884 3300005331 Bacteria 953
25 Ga0070677_10557160 3300005333 Unclassified 629
26 Ga0070677_10673111 3300005333 Bacteria 580
27 Ga0068869_100010572 3300005334 Bacteria 6024
28 Ga0068869_100028360 3300005334 Bacteria 3910
29 Ga0068869_100038849 3300005334 Bacteria 3396
30 Ga0068869_100267464 3300005334 Unclassified 1371
31 Ga0070666_10191450 3300005335 Bacteria 1437
32 Ga0070666_10237339 3300005335 Bacteria 1289
33 Ga0070666_10329506 3300005335 Bacteria 1090
34 Ga0070666_11118801 3300005335 Bacteria 586
35 Ga0070680_100009066 3300005336 Bacteria 7629
36 Ga0070680_100013524 3300005336 Bacteria 6357
37 Ga0070680_100696726 3300005336 Bacteria 874
38 Ga0070680_101220092 3300005336 Bacteria 651
39 Ga0070682_100012003 3300005337 Bacteria 4956
40 Ga0068868_100173312 3300005338 Bacteria 1787
41 Ga0068868_100583368 3300005338 Bacteria 989
42 Ga0068868_100880466 3300005338 Bacteria 813
43 Ga0068868_101022241 3300005338 Bacteria 757
44 Ga0068868_102409504 3300005338 Unclassified 503
45 Ga0070660_100223734 3300005339 Bacteria 1530
46 Ga0070660_100734197 3300005339 Bacteria 829
47 Ga0070689_100026554 3300005340 Bacteria 4360
48 Ga0070689_100031801 3300005340 Bacteria 4011
49 Ga0070689_100062845 3300005340 Bacteria 2890
50 Ga0070689_100789226 3300005340 Bacteria 834
51 Ga0070689_101356375 3300005340 Bacteria 642
52 Ga0070689_101566295 3300005340 Bacteria 598
53 Ga0070689_101573139 3300005340 Bacteria 596
54 Ga0070689_102195073 3300005340 Unclassified 506
55 Ga0070691_10000773 3300005341 Bacteria 12685
56 Ga0070691_10005381 3300005341 Bacteria 5821
57 Ga0070691_10253366 3300005341 Bacteria 945
58 Ga0070691_10271808 3300005341 Bacteria 916
59 Ga0070687_100006053 3300005343 Bacteria 4934
60 Ga0070687_100067449 3300005343 Bacteria 1910
61 Ga0070687_100108343 3300005343 Bacteria 1568
62 Ga0070687_100956777 3300005343 Unclassified 618
63 Ga0070661_100582741 3300005344 Bacteria 903
64 Ga0070692_10215176 3300005345 Bacteria 1133
65 Ga0070692_10813934 3300005345 Unclassified 639
66 Ga0070692_11057123 3300005345 Unclassified 571
67 Ga0070692_11427803 3300005345 Bacteria 501
68 Ga0070668_100023388 3300005347 Bacteria 4673
69 Ga0070668_100738268 3300005347 Unclassified 871
70 Ga0070668_100808980 3300005347 Bacteria 833
71 Ga0070668_101021427 3300005347 Bacteria 744
72 Ga0070668_101777521 3300005347 Unclassified 567
73 Ga0070669_100038429 3300005353 Bacteria 3475
74 Ga0070669_100125831 3300005353 Bacteria 1961
75 Ga0070669_100456066 3300005353 Bacteria 1054
76 Ga0070669_100581002 3300005353 Bacteria 937
77 Ga0070669_100852056 3300005353 Bacteria 777
78 Ga0070669_101090018 3300005353 Unclassified 687
79 Ga0070669_101869497 3300005353 Bacteria 524
80 Ga0070675_100178241 3300005354 Bacteria 1836
81 Ga0070675_100264002 3300005354 Bacteria 1509
82 Ga0070675_100283663 3300005354 Unclassified 1456
83 Ga0070675_100433881 3300005354 Bacteria 1176
84 Ga0070675_100671118 3300005354 Unclassified 943
85 Ga0070675_101987292 3300005354 Bacteria 536
86 Ga0070671_100263676 3300005355 Bacteria 1464
87 Ga0070671_100468675 3300005355 Archaea 1081
88 Ga0070671_100868968 3300005355 Bacteria 787
89 Ga0070674_100025964 3300005356 Bacteria 3820
90 Ga0070674_100323640 3300005356 Bacteria 1237
91 Ga0070674_100375616 3300005356 Bacteria 1155
92 Ga0070674_101968566 3300005356 Bacteria 532
93 Ga0070673_100130018 3300005364 Bacteria 2111
94 Ga0070673_100131824 3300005364 Bacteria 2098
95 Ga0070673_100151584 3300005364 Bacteria 1964
96 Ga0070673_100473560 3300005364 Bacteria 1129
97 Ga0070673_100599534 3300005364 Bacteria 1005
98 Ga0070673_101111052 3300005364 Bacteria 739
99 Ga0070673_101176741 3300005364 Bacteria 718
100 Ga0070688_100537187 3300005365 Bacteria 887
101 Ga0070688_100593461 3300005365 Unclassified 847
102 Ga0070688_101020813 3300005365 Bacteria 658
103 Ga0070688_101112700 3300005365 Bacteria 632
104 Ga0070688_101362008 3300005365 Bacteria 574
105 Ga0070659_101006400 3300005366 Bacteria 732
106 Ga0070659_102013601 3300005366 Bacteria 519
107 Ga0070667_100101660 3300005367 Bacteria 2483
108 Ga0070667_101041929 3300005367 Unclassified 764
109 Ga0070667_101391980 3300005367 Unclassified 658
110 Ga0070703_10037497 3300005406 Bacteria 1494
111 Ga0070703_10509960 3300005406 Bacteria 542
112 Ga0070709_10208671 3300005434 Bacteria 1387
113 Ga0070709_10530586 3300005434 Bacteria 898
114 Ga0070709_10814039 3300005434 Bacteria 734
115 Ga0070714_100019233 3300005435 Bacteria 5559
116 Ga0070713_100766717 3300005436 Bacteria 923
117 Ga0070713_102451087 3300005436 Bacteria 504
118 Ga0070710_10123715 3300005437 Bacteria 1569
119 Ga0070710_10220161 3300005437 Bacteria 1207
120 Ga0070701_10227347 3300005438 Bacteria 1116
121 Ga0070701_11292439 3300005438 Bacteria 521
122 Ga0070711_100241021 3300005439 Bacteria 1414
123 Ga0070711_101118937 3300005439 Bacteria 679
124 Ga0070705_100002369 3300005440 Bacteria 9503
125 Ga0070705_100017346 3300005440 Bacteria 3758
126 Ga0070705_100321000 3300005440 Bacteria 1118
127 Ga0070705_100349481 3300005440 Unclassified 1077
128 Ga0070705_101480034 3300005440 Unclassified 568
129 Ga0070700_100004068 3300005441 Bacteria 7613
130 Ga0070700_100011522 3300005441 Bacteria 4900
131 Ga0070700_100166213 3300005441 Bacteria 1524
132 Ga0070700_100683604 3300005441 Bacteria 814
133 Ga0070700_100818386 3300005441 Bacteria 751
134 Ga0070694_100040653 3300005444 Bacteria 3099
135 Ga0070694_100053631 3300005444 Unclassified 2729
136 Ga0070694_100076189 3300005444 Bacteria 2322
137 Ga0070694_100095784 3300005444 Bacteria 2091
138 Ga0070694_100366964 3300005444 Bacteria 1119
139 Ga0070694_100427383 3300005444 Unclassified 1042
140 Ga0070694_100924985 3300005444 Bacteria 721
141 Ga0070694_101402251 3300005444 Bacteria 590
142 Ga0070708_100022243 3300005445 Bacteria 5374
143 Ga0070708_100264154 3300005445 Bacteria 1618
144 Ga0070708_100823401 3300005445 Bacteria 872
145 Ga0070708_101607190 3300005445 Bacteria 605
146 Ga0070678_100039026 3300005456 Bacteria 3347
147 Ga0070678_100039729 3300005456 Bacteria 3323
148 Ga0070678_100047326 3300005456 Bacteria 3089
149 Ga0070678_100293433 3300005456 Bacteria 1379
150 Ga0070678_100414760 3300005456 Bacteria 1172
151 Ga0070662_100247543 3300005457 Bacteria 1432
152 Ga0070662_100350653 3300005457 Bacteria 1209
153 Ga0070662_100523969 3300005457 Bacteria 991
154 Ga0070662_101119446 3300005457 Unclassified 676
155 Ga0070681_10016738 3300005458 Bacteria 7319
156 Ga0070681_10029560 3300005458 Bacteria 5503
157 Ga0070681_10381179 3300005458 Bacteria 1321
158 Ga0070681_10648281 3300005458 Unclassified 971
159 Ga0070681_10754318 3300005458 Bacteria 890
160 Ga0070681_10935485 3300005458 Bacteria 786
161 Ga0068867_100029259 3300005459 Bacteria 3968
162 Ga0068867_100056009 3300005459 Bacteria 2916
163 Ga0068867_100120986 3300005459 Bacteria 2023
164 Ga0068867_100257796 3300005459 Bacteria 1420
165 Ga0068867_101349057 3300005459 Unclassified 660
166 Ga0068867_101716576 3300005459 Bacteria 589
167 Ga0068867_102095758 3300005459 Bacteria 536
168 Ga0070685_10277001 3300005466 Bacteria 1122
169 Ga0070685_10280745 3300005466 Bacteria 1115
170 Ga0070685_11129585 3300005466 Bacteria 593
171 Ga0070706_100006842 3300005467 Bacteria 10765
172 Ga0070706_100486733 3300005467 Unclassified 1148
173 Ga0070706_100507083 3300005467 Bacteria 1122
174 Ga0070707_100009165 3300005468 Bacteria 9182
175 Ga0070707_100914283 3300005468 Unclassified 842
176 Ga0070707_101010780 3300005468 Bacteria 797
177 Ga0070707_101094860 3300005468 Bacteria 763
178 Ga0070707_102000311 3300005468 Bacteria 547
179 Ga0070698_100003981 3300005471 Bacteria 16258
180 Ga0070698_100100907 3300005471 Bacteria 2858
181 Ga0070699_100010564 3300005518 Bacteria 7992
182 Ga0070699_100040469 3300005518 Bacteria 4036
183 Ga0070699_100047380 3300005518 Bacteria 3719
184 Ga0070699_100086507 3300005518 Bacteria 2735
185 Ga0070699_100503280 3300005518 Bacteria 1101
186 Ga0070699_100519422 3300005518 Bacteria 1082
187 Ga0070699_100591089 3300005518 Unclassified 1012
188 Ga0070699_101064828 3300005518 Bacteria 742
189 Ga0070679_100009220 3300005530 Bacteria 9325
190 Ga0070679_100009349 3300005530 Bacteria 9268
191 Ga0070679_100645806 3300005530 Bacteria 1001
192 Ga0070684_100106283 3300005535 Bacteria 2512
193 Ga0070684_100172806 3300005535 Bacteria 1963
194 Ga0070684_100220332 3300005535 Bacteria 1731
195 Ga0070697_100020028 3300005536 Bacteria 5287
196 Ga0070697_100070651 3300005536 Bacteria 2863
197 Ga0070697_100775780 3300005536 Bacteria 848
198 Ga0070697_101614406 3300005536 Unclassified 580
199 Ga0068853_101271954 3300005539 Bacteria 711
200 Ga0068853_101782617 3300005539 Bacteria 597
201 Ga0068853_102417078 3300005539 Bacteria 509
202 Ga0070672_100174530 3300005543 Bacteria 1789
203 Ga0070672_100360955 3300005543 Bacteria 1240
204 Ga0070672_100375890 3300005543 Bacteria 1215
205 Ga0070686_100290781 3300005544 Bacteria 1209
206 Ga0070686_100363700 3300005544 Bacteria 1091
207 Ga0070686_100598942 3300005544 Bacteria 868
208 Ga0070686_100999421 3300005544 Bacteria 686
209 Ga0070686_101519296 3300005544 Bacteria 565
210 Ga0070695_100038923 3300005545 Bacteria 3004
211 Ga0070695_100158414 3300005545 Bacteria 1587
212 Ga0070695_101385514 3300005545 Bacteria 583
213 Ga0070695_101416825 3300005545 Bacteria 576
214 Ga0070696_100001813 3300005546 Bacteria 14024
215 Ga0070696_100069768 3300005546 Bacteria 2470
216 Ga0070696_100242374 3300005546 Unclassified 1360
217 Ga0070696_100589681 3300005546 Bacteria 895
218 Ga0070696_100690156 3300005546 Bacteria 831
219 Ga0070693_100003044 3300005547 Bacteria 7776
220 Ga0070693_100129608 3300005547 Bacteria 1575
221 Ga0070693_100202462 3300005547 Bacteria 1290
222 Ga0070693_100394138 3300005547 Bacteria 958
223 Ga0070693_100805040 3300005547 Bacteria 697
224 Ga0070665_100040919 3300005548 Bacteria 4657
225 Ga0070665_100175855 3300005548 Bacteria 2141
226 Ga0070665_100484484 3300005548 Bacteria 1248
227 Ga0070665_101312329 3300005548 Bacteria 733
228 Ga0070665_102629280 3300005548 Bacteria 504
229 Ga0070704_100006289 3300005549 Bacteria 6992
230 Ga0070704_100011989 3300005549 Bacteria 5340
231 Ga0070704_100034081 3300005549 Bacteria 3449
232 Ga0070704_100244221 3300005549 Bacteria 1471
233 Ga0070704_101831610 3300005549 Bacteria 562
234 Ga0068855_100046510 3300005563 Bacteria 5130
235 Ga0068855_100079603 3300005563 Bacteria 3800
236 Ga0068855_100117914 3300005563 Bacteria 3040
237 Ga0068855_100144502 3300005563 Unclassified 2709
238 Ga0068855_100658660 3300005563 Bacteria 1124
239 Ga0068855_102181229 3300005563 Bacteria 556
240 Ga0068855_102426924 3300005563 Bacteria 523
241 Ga0070664_101054498 3300005564 Unclassified 765
242 Ga0070664_101122629 3300005564 Unclassified 741
243 Ga0070664_101178132 3300005564 Bacteria 722
244 Ga0068857_100045735 3300005577 Bacteria 3884
245 Ga0068857_100620698 3300005577 Bacteria 1023
246 Ga0068857_100849380 3300005577 Bacteria 873
247 Ga0068857_101456240 3300005577 Bacteria 667
248 Ga0068857_101582135 3300005577 Unclassified 640
249 Ga0068854_100104117 3300005578 Bacteria 2132
250 Ga0068854_100215656 3300005578 Bacteria 1516
251 Ga0068854_100398175 3300005578 Bacteria 1139
252 Ga0068854_100436958 3300005578 Bacteria 1090
253 Ga0068854_100821129 3300005578 Bacteria 812
254 Ga0068856_100018692 3300005614 Bacteria 6717
255 Ga0068856_100069775 3300005614 Bacteria 3475
256 Ga0070702_100000291 3300005615 Bacteria 17133
257 Ga0070702_100216312 3300005615 Bacteria 1278
258 Ga0070702_100285010 3300005615 Bacteria 1136
259 Ga0070702_101054504 3300005615 Bacteria 647
260 Ga0070702_101405189 3300005615 Unclassified 571
261 Ga0070702_101550180 3300005615 Bacteria 547
262 Ga0070702_101821798 3300005615 Unclassified 509
263 Ga0068852_100164847 3300005616 Bacteria 2072
264 Ga0068852_100415072 3300005616 Bacteria 1327
265 Ga0068852_101713674 3300005616 Bacteria 651
266 Ga0068852_101855766 3300005616 Bacteria 625
267 Ga0068852_101936550 3300005616 Unclassified 612
268 Ga0068859_100018731 3300005617 Bacteria 6956
269 Ga0068859_100027864 3300005617 Bacteria 5666
270 Ga0068859_100122248 3300005617 Bacteria 2670
271 Ga0068859_100156633 3300005617 Bacteria 2355
272 Ga0068859_100193567 3300005617 Bacteria 2118
273 Ga0068859_100479915 3300005617 Unclassified 1339
274 Ga0068859_100674402 3300005617 Bacteria 1125
275 Ga0068859_100986813 3300005617 Bacteria 925
276 Ga0068864_100267315 3300005618 Bacteria 1592
277 Ga0068864_100289654 3300005618 Bacteria 1531
278 Ga0068864_100334587 3300005618 Bacteria 1425
279 Ga0068866_10001011 3300005718 Bacteria 12363
280 Ga0068866_10135889 3300005718 Bacteria 1405
281 Ga0068866_10440344 3300005718 Unclassified 850
282 Ga0068866_10939213 3300005718 Bacteria 611
283 Ga0068861_100009219 3300005719 Bacteria 6807
284 Ga0068861_100121147 3300005719 Bacteria 2111
285 Ga0068861_100131041 3300005719 Bacteria 2035
286 Ga0068861_100240859 3300005719 Unclassified 1538
287 Ga0068861_100317117 3300005719 Unclassified 1356
288 Ga0068861_100602315 3300005719 Bacteria 1009
289 Ga0068861_100805169 3300005719 Bacteria 882
290 Ga0068861_101792200 3300005719 Bacteria 609
291 Ga0068861_102216804 3300005719 Bacteria 551
292 Ga0068851_10278844 3300005834 Bacteria 955
293 Ga0068870_10079546 3300005840 Bacteria 1809
294 Ga0068870_10115219 3300005840 Bacteria 1540
295 Ga0068870_10570059 3300005840 Bacteria 765
296 Ga0068870_10588945 3300005840 Bacteria 754
297 Ga0068863_100194677 3300005841 Bacteria 1949
298 Ga0068863_100273175 3300005841 Unclassified 1636
299 Ga0068863_100654473 3300005841 Bacteria 1042
300 Ga0068858_100002998 3300005842 Bacteria 16925
301 Ga0068858_100417902 3300005842 Bacteria 1289
302 Ga0068858_100478462 3300005842 Bacteria 1202
303 Ga0068858_100577078 3300005842 Bacteria 1090
304 Ga0068858_100940286 3300005842 Unclassified 846
305 Ga0068858_102062527 3300005842 Bacteria 564
306 Ga0068858_102465877 3300005842 Bacteria 514
307 Ga0068860_100148408 3300005843 Bacteria 2257
308 Ga0068860_100265997 3300005843 Bacteria 1672
309 Ga0068862_100007394 3300005844 Bacteria 9109
310 Ga0068862_100029772 3300005844 Bacteria 4600
311 Ga0068862_100049498 3300005844 Bacteria 3589
312 Ga0068862_100142802 3300005844 Bacteria 2126
313 Ga0068862_100297929 3300005844 Bacteria 1483
314 Ga0068862_100633645 3300005844 Unclassified 1030
315 Ga0068862_101252914 3300005844 Unclassified 742
316 Ga0068862_101588684 3300005844 Bacteria 661
317 Ga0068862_102116745 3300005844 Unclassified 574
318 Ga0081455_10003323 3300005937 Bacteria 18577
319 Ga0081455_10015257 3300005937 Bacteria 7472
320 Ga0081455_10030837 3300005937 Bacteria 4864
321 Ga0081455_10143368 3300005937 Bacteria 1852
322 Ga0081455_10693255 3300005937 Bacteria 650
323 Ga0081538_10220093 3300005981 Bacteria 754
324 Ga0081540_1037373 3300005983 Bacteria 2575
325 Ga0081539_10002126 3300005985 Bacteria 29286
326 Ga0081539_10022656 3300005985 Bacteria 4145
327 Ga0081539_10105444 3300005985 Bacteria 1429
328 Ga0070717_10102436 3300006028 Bacteria 2432
329 Ga0070717_10355091 3300006028 Bacteria 1311
330 Ga0070717_10996776 3300006028 Bacteria 763
331 Ga0075365_10144548 3300006038 Bacteria 1652
332 Ga0075365_10265797 3300006038 Bacteria 1206
333 Ga0075365_10451223 3300006038 Bacteria 908
334 Ga0075365_10478765 3300006038 Bacteria 879
335 Ga0075365_10506211 3300006038 Bacteria 853
336 Ga0075365_10552103 3300006038 Bacteria 815
337 Ga0075365_10872992 3300006038 Bacteria 634
338 Ga0075368_10011988 3300006042 Bacteria 3163
339 Ga0075368_10049614 3300006042 Bacteria 1666
340 Ga0075368_10306077 3300006042 Bacteria 686
341 Ga0075363_100107609 3300006048 Bacteria 1547
342 Ga0075364_10178948 3300006051 Bacteria 1434
343 Ga0075364_10261697 3300006051 Bacteria 1176
344 Ga0075364_10343229 3300006051 Bacteria 1018
345 Ga0075364_10444444 3300006051 Bacteria 886
346 Ga0070715_10079941 3300006163 Bacteria 1482
347 Ga0070715_10436605 3300006163 Bacteria 736
348 Ga0070716_100057824 3300006173 Bacteria 2230
349 Ga0070716_100556385 3300006173 Bacteria 856
350 Ga0070716_101375408 3300006173 Bacteria 573
351 Ga0070716_101519973 3300006173 Bacteria 548
352 Ga0070716_101549930 3300006173 Bacteria 543
353 Ga0070712_100157907 3300006175 Bacteria 1749
354 Ga0075362_10010504 3300006177 Bacteria 3617
355 Ga0075362_10014616 3300006177 Bacteria 3172
356 Ga0075362_10043548 3300006177 Bacteria 1987
357 Ga0075362_10146318 3300006177 Bacteria 1132
358 Ga0075362_10350267 3300006177 Bacteria 739
359 Ga0075362_10717796 3300006177 Bacteria 522
360 Ga0075367_10032595 3300006178 Bacteria 2999
361 Ga0075367_10057986 3300006178 Bacteria 2303
362 Ga0075367_10069109 3300006178 Bacteria 2120
363 Ga0075367_10109767 3300006178 Bacteria 1692
364 Ga0075367_10163451 3300006178 Bacteria 1385
365 Ga0075367_10218021 3300006178 Bacteria 1194
366 Ga0075367_10277837 3300006178 Bacteria 1052
367 Ga0075369_10001043 3300006186 Bacteria 9268
368 Ga0075369_10038085 3300006186 Bacteria 2051
369 Ga0075369_10048423 3300006186 Bacteria 1834
370 Ga0075369_10179673 3300006186 Bacteria 973
371 Ga0075366_10013074 3300006195 Bacteria 4720
372 Ga0075366_10110626 3300006195 Bacteria 1652
373 Ga0075366_10172815 3300006195 Bacteria 1311
374 Ga0075366_10516821 3300006195 Bacteria 739
375 Ga0075366_10571032 3300006195 Bacteria 701
376 Ga0075366_10588089 3300006195 Bacteria 690
377 Ga0097621_100019598 3300006237 Bacteria 5196
378 Ga0097621_100078974 3300006237 Bacteria 2735
379 Ga0097621_100711215 3300006237 Archaea 925
380 Ga0097621_101379170 3300006237 Bacteria 667
381 Ga0075370_10320649 3300006353 Bacteria 923
382 Ga0075370_10331535 3300006353 Bacteria 907
383 Ga0068871_100010824 3300006358 Bacteria 6676
384 Ga0068871_100016719 3300006358 Bacteria 5535
385 Ga0068871_100130263 3300006358 Bacteria 2132
386 Ga0068871_100545415 3300006358 Bacteria 1050
387 Ga0068871_101511675 3300006358 Unclassified 634
388 Ga0075428_100015504 3300006844 Bacteria 8449
389 Ga0075428_100023946 3300006844 Bacteria 6755
390 Ga0075428_100485963 3300006844 Bacteria 1321
391 Ga0075428_100654279 3300006844 Unclassified 1120
392 Ga0075428_100839641 3300006844 Bacteria 976
393 Ga0075428_100896801 3300006844 Bacteria 940
394 Ga0075430_100018613 3300006846 Bacteria 5911
395 Ga0075430_100207158 3300006846 Bacteria 1627
396 Ga0075430_100419734 3300006846 Bacteria 1104
397 Ga0075430_100472264 3300006846 Bacteria 1035
398 Ga0075431_100000397 3300006847 Bacteria 35033
399 Ga0075431_100072948 3300006847 Bacteria 3542
400 Ga0075431_100187222 3300006847 Unclassified 2122
401 Ga0075431_100247066 3300006847 Bacteria 1814
402 Ga0075431_100274534 3300006847 Bacteria 1707
403 Ga0075431_100316150 3300006847 Bacteria 1575
404 Ga0075431_101318254 3300006847 Bacteria 683
405 Ga0075431_101376952 3300006847 Bacteria 665
406 Ga0075433_10039385 3300006852 Bacteria 4086
407 Ga0075433_10312452 3300006852 Bacteria 1391
408 Ga0075433_10630631 3300006852 Bacteria 940
409 Ga0075433_11358360 3300006852 Unclassified 615
410 Ga0075434_100015680 3300006871 Bacteria 7272
411 Ga0075434_100027657 3300006871 Bacteria 5568
412 Ga0075434_100102843 3300006871 Bacteria 2864
413 Ga0075434_100145840 3300006871 Bacteria 2387
414 Ga0075434_100547486 3300006871 Bacteria 1177
415 Ga0075434_101247953 3300006871 Bacteria 755
416 Ga0075434_102181190 3300006871 Bacteria 558
417 Ga0075429_100001368 3300006880 Bacteria 19959
418 Ga0075429_100011437 3300006880 Bacteria 7691
419 Ga0075429_100234105 3300006880 Bacteria 1609
420 Ga0075429_100257973 3300006880 Bacteria 1526
421 Ga0075429_100476211 3300006880 Bacteria 1094
422 Ga0075429_100842449 3300006880 Bacteria 803
423 Ga0075429_100850816 3300006880 Bacteria 798
424 Ga0068865_100012771 3300006881 Bacteria 5294
425 Ga0068865_100285491 3300006881 Bacteria 1315
426 Ga0068865_100328498 3300006881 Unclassified 1232
427 Ga0068865_100436784 3300006881 Unclassified 1079
428 Ga0075436_100000096 3300006914 Bacteria 51868
429 Ga0075436_100027365 3300006914 Bacteria 3925
430 Ga0075436_100175386 3300006914 Bacteria 1514
431 Ga0075436_100616989 3300006914 Bacteria 800
432 Ga0075436_100696047 3300006914 Bacteria 753
433 Ga0075436_100837438 3300006914 Bacteria 686
434 Ga0075436_101120398 3300006914 Bacteria 593
435 Ga0097620_100018728 3300006931 Bacteria 6956
436 Ga0097620_100027865 3300006931 Bacteria 5666
437 Ga0097620_100122248 3300006931 Bacteria 2670
438 Ga0097620_100156634 3300006931 Bacteria 2355
439 Ga0097620_100193567 3300006931 Bacteria 2118
440 Ga0097620_100479909 3300006931 Unclassified 1339
441 Ga0097620_100674269 3300006931 Bacteria 1125
442 Ga0097620_100986778 3300006931 Bacteria 925
443 Ga0075435_100002559 3300007076 Bacteria 12120
444 Ga0075435_100008145 3300007076 Bacteria 7505
445 Ga0075435_100017661 3300007076 Bacteria 5406
446 Ga0075435_100048108 3300007076 Bacteria 3425
447 Ga0075435_100144665 3300007076 Bacteria 1996
448 Ga0075435_100550620 3300007076 Bacteria 999
449 Ga0099794_10310602 3300007265 Bacteria 817
450 Ga0099795_10000951 3300007788 Bacteria 5882
451 Ga0099795_10008008 3300007788 Bacteria 2986
452 Ga0099795_10321420 3300007788 Bacteria 685
453 Ga0105251_10180411 3300009011 Unclassified 951
454 Ga0105250_10201382 3300009092 Bacteria 840
455 Ga0105240_10098573 3300009093 Bacteria 3558
456 Ga0105240_10230524 3300009093 Bacteria 2152
457 Ga0105240_11596772 3300009093 Bacteria 682
458 Ga0105240_12050572 3300009093 Bacteria 594
459 Ga0111539_10000970 3300009094 Bacteria 37698
460 Ga0111539_10006876 3300009094 Bacteria 14612
461 Ga0111539_10034290 3300009094 Bacteria 6157
462 Ga0111539_10185858 3300009094 Bacteria 2427
463 Ga0111539_10305459 3300009094 Bacteria 1851
464 Ga0111539_10451479 3300009094 Unclassified 1497
465 Ga0111539_10591828 3300009094 Unclassified 1292
466 Ga0111539_10674593 3300009094 Bacteria 1203
467 Ga0111539_10895058 3300009094 Bacteria 1032
468 Ga0111539_11001831 3300009094 Bacteria 971
469 Ga0111539_11201698 3300009094 Unclassified 881
470 Ga0111539_11956109 3300009094 Bacteria 680
471 Ga0111539_12221925 3300009094 Bacteria 637
472 Ga0111539_12358507 3300009094 Unclassified 617
473 Ga0105245_10009363 3300009098 Bacteria 8542
474 Ga0105245_10044636 3300009098 Bacteria 3957
475 Ga0105245_11148342 3300009098 Bacteria 824
476 Ga0105245_11800440 3300009098 Unclassified 665
477 Ga0105245_11929146 3300009098 Unclassified 644
478 Ga0105245_12033390 3300009098 Bacteria 628
479 Ga0105247_11571102 3300009101 Bacteria 539
480 Ga0114129_10001144 3300009147 Bacteria 35107
481 Ga0114129_10007262 3300009147 Bacteria 15773
482 Ga0114129_10366974 3300009147 Bacteria 1904
483 Ga0114129_11141515 3300009147 Bacteria 973
484 Ga0114129_11530089 3300009147 Unclassified 819
485 Ga0114129_11543520 3300009147 Bacteria 815
486 Ga0114129_12036755 3300009147 Bacteria 694
487 Ga0105243_10025235 3300009148 Bacteria 4539
488 Ga0105243_10046885 3300009148 Bacteria 3401
489 Ga0105243_10048485 3300009148 Bacteria 3348
490 Ga0105243_10193815 3300009148 Bacteria 1777
491 Ga0105243_11346250 3300009148 Bacteria 733
492 Ga0105243_12119817 3300009148 Bacteria 598
493 Ga0105243_12229357 3300009148 Bacteria 585
494 Ga0105241_10024003 3300009174 Bacteria 4527
495 Ga0105241_10209345 3300009174 Bacteria 1633
496 Ga0105241_11191514 3300009174 Bacteria 721
497 Ga0105242_10001023 3300009176 Bacteria 21987
498 Ga0105242_10001815 3300009176 Bacteria 16772
499 Ga0105242_10113987 3300009176 Bacteria 2309
500 Ga0105242_10931802 3300009176 Bacteria 871
501 Ga0105242_11849453 3300009176 Bacteria 643
502 Ga0105248_10246502 3300009177 Bacteria 2011
503 Ga0105248_10301088 3300009177 Bacteria 1805
504 Ga0105248_10661724 3300009177 Bacteria 1178
505 Ga0105248_11420857 3300009177 Unclassified 785
506 Ga0105248_13078036 3300009177 Bacteria 531
507 Ga0105237_10107310 3300009545 Bacteria 2784
508 Ga0105238_10226506 3300009551 Bacteria 1846
509 Ga0105238_10336549 3300009551 Bacteria 1497
510 Ga0105238_12401233 3300009551 Bacteria 563
511 Ga0105249_10013069 3300009553 Bacteria 7330
512 Ga0105249_10048358 3300009553 Bacteria 3877
513 Ga0105249_10269905 3300009553 Bacteria 1694
514 Ga0105249_10333558 3300009553 Bacteria 1531
515 Ga0105249_13333547 3300009553 Bacteria 517
516 Ga0105035_110452 3300009988 Bacteria 814
517 Ga0105035_114167 3300009988 Bacteria 725
518 Ga0099796_10062913 3300010159 Bacteria 1320
519 Ga0099796_10072817 3300010159 Bacteria 1244
520 Ga0099796_10225359 3300010159 Bacteria 770
521 Ga0105239_10064628 3300010375 Bacteria 4017
522 Ga0105239_10189695 3300010375 Bacteria 2301
523 Ga0105239_10986562 3300010375 Bacteria 968
524 Ga0105246_10241168 3300011119 Bacteria 1429
525 Ga0105246_10473774 3300011119 Bacteria 1058
526 Ga0105246_11501121 3300011119 Unclassified 633
527 Ga0157373_10093130 3300013100 Bacteria 2122
528 Ga0157373_10775217 3300013100 Bacteria 706
529 Ga0157371_10574538 3300013102 Bacteria 837
530 Ga0157370_10074623 3300013104 Bacteria 3199
531 Ga0157369_10127390 3300013105 Bacteria 2698
532 Ga0157369_10468186 3300013105 Bacteria 1305
533 Ga0157369_11677512 3300013105 Bacteria 646
534 Ga0157374_10265759 3300013296 Bacteria 1691
535 Ga0157374_10357365 3300013296 Unclassified 1452
536 Ga0157374_11057492 3300013296 Bacteria 832
537 Ga0157374_11718035 3300013296 Unclassified 652
538 Ga0157378_10009386 3300013297 Bacteria 8523
539 Ga0157378_10062408 3300013297 Bacteria 3327
540 Ga0157378_10174514 3300013297 Bacteria 2018
541 Ga0157378_10562957 3300013297 Bacteria 1147
542 Ga0157378_10664189 3300013297 Bacteria 1059
543 Ga0157378_11111950 3300013297 Bacteria 827
544 Ga0157378_12081823 3300013297 Bacteria 618
545 Ga0157378_12550021 3300013297 Bacteria 563
546 Ga0163162_10345706 3300013306 Bacteria 1620
547 Ga0163162_10412149 3300013306 Bacteria 1484
548 Ga0163162_11265007 3300013306 Unclassified 838
549 Ga0163162_11446613 3300013306 Bacteria 782
550 Ga0163162_11948925 3300013306 Bacteria 673
551 Ga0157372_10758716 3300013307 Bacteria 1128
552 Ga0157372_11562343 3300013307 Bacteria 760
553 Ga0157375_10020684 3300013308 Bacteria 6018
554 Ga0157375_10499485 3300013308 Bacteria 1381
555 Ga0157375_11333952 3300013308 Bacteria 844
556 Ga0157375_11603776 3300013308 Unclassified 769
557 Ga0157375_12396004 3300013308 Unclassified 630
558 Ga0157375_13323729 3300013308 Bacteria 536
559 Ga0157515_131170 3300013875 Bacteria 635
560 Ga0163163_10877848 3300014325 Bacteria 960
561 Ga0163163_11479150 3300014325 Bacteria 741
562 Ga0163163_11904832 3300014325 Bacteria 654
563 Ga0157380_10134351 3300014326 Bacteria 2115
564 Ga0157380_10786436 3300014326 Bacteria 967
565 Ga0157380_11935236 3300014326 Bacteria 651
566 Ga0182008_10307689 3300014497 Bacteria 831
567 Ga0182008_10815616 3300014497 Bacteria 543
568 Ga0157377_10184036 3300014745 Bacteria 1316
569 Ga0157377_11111203 3300014745 Unclassified 606
570 Ga0157379_10096268 3300014968 Bacteria 2656
571 Ga0157379_10163248 3300014968 Bacteria 2011
572 Ga0157379_10252070 3300014968 Bacteria 1603
573 Ga0157379_10489085 3300014968 Bacteria 1139
574 Ga0157379_11146880 3300014968 Bacteria 746
575 Ga0157376_10001037 3300014969 Bacteria 18215
576 Ga0157376_10014946 3300014969 Bacteria 5850
577 Ga0157376_10049364 3300014969 Bacteria 3485
578 Ga0157376_10221150 3300014969 Bacteria 1754
579 Ga0157376_10504519 3300014969 Bacteria 1190
580 Ga0157376_13020562 3300014969 Bacteria 509
581 Ga0182006_1259350 3300015261 Unclassified 570
582 Ga0182007_10299770 3300015262 Bacteria 590
583 Ga0163161_10218287 3300017792 Bacteria 1476
584 Ga0163161_11724687 3300017792 Bacteria 555
585 Ga0206352_10725851 3300020078 Bacteria 510
586 Ga0206353_11448514 3300020082 Bacteria 641
587 Ga0213872_10071552 3300021361 Bacteria 1563
588 Ga0213874_10081744 3300021377 Bacteria 1048
589 Ga0213874_10434378 3300021377 Bacteria 516
590 Ga0213876_10028299 3300021384 Bacteria 2954
591 Ga0213876_10194461 3300021384 Bacteria 1078
592 Ga0213876_10446571 3300021384 Bacteria 688
593 Ga0213875_10000030 3300021388 Bacteria 178500
594 Ga0213871_10027298 3300021441 Bacteria 1465
595 Ga0224712_10166571 3300022467 Bacteria 986
596 Ga0207426_1024241 3300025302 Bacteria 2061
597 Ga0207426_1044810 3300025302 Bacteria 1350
598 Ga0207697_10034324 3300025315 Bacteria 2077
599 Ga0207697_10064228 3300025315 Bacteria 1531
600 Ga0207653_10309383 3300025885 Bacteria 613
601 Ga0207682_10001510 3300025893 Bacteria 10727
602 Ga0207642_10010412 3300025899 Bacteria 3276
603 Ga0207642_10050989 3300025899 Bacteria 1870
604 Ga0207642_10454262 3300025899 Bacteria 777
605 Ga0207642_10532391 3300025899 Bacteria 723
606 Ga0207688_10001551 3300025901 Bacteria 12084
607 Ga0207688_10489891 3300025901 Bacteria 769
608 Ga0207688_10836184 3300025901 Bacteria 583
609 Ga0207680_10107330 3300025903 Bacteria 1804
610 Ga0207680_10348526 3300025903 Unclassified 1040
611 Ga0207680_10748650 3300025903 Bacteria 700
612 Ga0207680_10872288 3300025903 Bacteria 645
613 Ga0207647_10157076 3300025904 Bacteria 1327
614 Ga0207647_10164834 3300025904 Bacteria 1292
615 Ga0207685_10123186 3300025905 Bacteria 1141
616 Ga0207699_10123479 3300025906 Bacteria 1678
617 Ga0207699_10463034 3300025906 Bacteria 911
618 Ga0207645_10008734 3300025907 Bacteria 7055
619 Ga0207645_10087371 3300025907 Bacteria 2004
620 Ga0207645_10221618 3300025907 Unclassified 1247
621 Ga0207645_10391058 3300025907 Bacteria 934
622 Ga0207643_10005783 3300025908 Bacteria 6609
623 Ga0207643_10055386 3300025908 Bacteria 2255
624 Ga0207643_10107867 3300025908 Bacteria 1638
625 Ga0207643_10184124 3300025908 Bacteria 1265
626 Ga0207643_10555088 3300025908 Bacteria 737
627 Ga0207705_10069481 3300025909 Bacteria 2551
628 Ga0207684_10051419 3300025910 Bacteria 3496
629 Ga0207684_10872934 3300025910 Bacteria 757
630 Ga0207654_10033492 3300025911 Unclassified 2848
631 Ga0207707_10067776 3300025912 Bacteria 3108
632 Ga0207707_10361052 3300025912 Bacteria 1251
633 Ga0207707_10699277 3300025912 Bacteria 851
634 Ga0207695_10090373 3300025913 Bacteria 3078
635 Ga0207695_10094181 3300025913 Bacteria 3003
636 Ga0207671_10775096 3300025914 Bacteria 761
637 Ga0207693_10172419 3300025915 Bacteria 1703
638 Ga0207663_10190325 3300025916 Bacteria 1473
639 Ga0207660_10040869 3300025917 Bacteria 3248
640 Ga0207660_10094378 3300025917 Bacteria 2224
641 Ga0207660_10380753 3300025917 Bacteria 1134
642 Ga0207660_10538892 3300025917 Bacteria 949
643 Ga0207662_10000171 3300025918 Bacteria 30909
644 Ga0207662_10003496 3300025918 Bacteria 8092
645 Ga0207662_10096262 3300025918 Bacteria 1828
646 Ga0207662_10189706 3300025918 Bacteria 1326
647 Ga0207662_10618755 3300025918 Unclassified 755
648 Ga0207662_11155376 3300025918 Bacteria 550
649 Ga0207657_10126634 3300025919 Bacteria 2097
650 Ga0207657_10204846 3300025919 Bacteria 1585
651 Ga0207649_10152908 3300025920 Bacteria 1591
652 Ga0207652_10083531 3300025921 Bacteria 2796
653 Ga0207652_10217957 3300025921 Bacteria 1719
654 Ga0207652_10858752 3300025921 Bacteria 803
655 Ga0207646_10037148 3300025922 Bacteria 4392
656 Ga0207646_10673521 3300025922 Bacteria 926
657 Ga0207646_11077476 3300025922 Unclassified 708
658 Ga0207646_11538686 3300025922 Bacteria 575
659 Ga0207646_11618638 3300025922 Bacteria 558
660 Ga0207681_10068346 3300025923 Bacteria 2467
661 Ga0207681_10314288 3300025923 Bacteria 1243
662 Ga0207681_10348411 3300025923 Bacteria 1185
663 Ga0207681_10560441 3300025923 Bacteria 941
664 Ga0207681_10750437 3300025923 Archaea 813
665 Ga0207694_10116037 3300025924 Bacteria 2134
666 Ga0207694_10411877 3300025924 Bacteria 1125
667 Ga0207650_10525596 3300025925 Bacteria 990
668 Ga0207650_10643749 3300025925 Bacteria 893
669 Ga0207650_11028389 3300025925 Unclassified 701
670 Ga0207659_10296130 3300025926 Unclassified 1327
671 Ga0207659_10323953 3300025926 Bacteria 1272
672 Ga0207659_10456190 3300025926 Unclassified 1077
673 Ga0207659_10566652 3300025926 Bacteria 966
674 Ga0207659_10751715 3300025926 Bacteria 836
675 Ga0207659_11403920 3300025926 Bacteria 598
676 Ga0207687_10077444 3300025927 Unclassified 2391
677 Ga0207687_10383910 3300025927 Bacteria 1151
678 Ga0207700_11138844 3300025928 Bacteria 697
679 Ga0207700_11233144 3300025928 Bacteria 667
680 Ga0207664_10036601 3300025929 Bacteria 3794
681 Ga0207664_10462353 3300025929 Bacteria 1133
682 Ga0207644_10707665 3300025931 Bacteria 840
683 Ga0207644_11003699 3300025931 Bacteria 701
684 Ga0207644_11458868 3300025931 Bacteria 574
685 Ga0207690_10562232 3300025932 Bacteria 928
686 Ga0207690_10943887 3300025932 Bacteria 716
687 Ga0207706_10005426 3300025933 Bacteria 11883
688 Ga0207706_10230995 3300025933 Bacteria 1618
689 Ga0207706_10363777 3300025933 Bacteria 1257
690 Ga0207686_10011242 3300025934 Bacteria 4896
691 Ga0207686_10109837 3300025934 Bacteria 1858
692 Ga0207686_10652420 3300025934 Unclassified 833
693 Ga0207686_11301438 3300025934 Bacteria 597
694 Ga0207709_10050347 3300025935 Bacteria 2547
695 Ga0207709_10159396 3300025935 Bacteria 1572
696 Ga0207709_10196377 3300025935 Bacteria 1438
697 Ga0207709_10305528 3300025935 Bacteria 1185
698 Ga0207709_10428577 3300025935 Bacteria 1018
699 Ga0207709_11207927 3300025935 Bacteria 623
700 Ga0207670_10079644 3300025936 Bacteria 2288
701 Ga0207670_10124509 3300025936 Bacteria 1879
702 Ga0207670_10173142 3300025936 Bacteria 1620
703 Ga0207670_10515931 3300025936 Bacteria 972
704 Ga0207670_10528930 3300025936 Bacteria 961
705 Ga0207669_10217180 3300025937 Bacteria 1400
706 Ga0207669_10328917 3300025937 Bacteria 1172
707 Ga0207669_10491123 3300025937 Bacteria 980
708 Ga0207704_10005281 3300025938 Bacteria 5952
709 Ga0207704_10867799 3300025938 Bacteria 757
710 Ga0207665_10036698 3300025939 Bacteria 3261
711 Ga0207665_10069694 3300025939 Bacteria 2398
712 Ga0207691_10039183 3300025940 Bacteria 4384
713 Ga0207691_10046742 3300025940 Bacteria 3975
714 Ga0207691_10111470 3300025940 Bacteria 2433
715 Ga0207691_10112961 3300025940 Bacteria 2414
716 Ga0207691_10513949 3300025940 Unclassified 1017
717 Ga0207691_11242776 3300025940 Bacteria 617
718 Ga0207711_10130223 3300025941 Bacteria 2255
719 Ga0207711_10241533 3300025941 Bacteria 1656
720 Ga0207711_10395535 3300025941 Bacteria 1283
721 Ga0207711_10495521 3300025941 Bacteria 1138
722 Ga0207711_10839110 3300025941 Unclassified 855
723 Ga0207711_10972447 3300025941 Bacteria 788
724 Ga0207711_11235021 3300025941 Unclassified 689
725 Ga0207689_10001391 3300025942 Bacteria 23137
726 Ga0207689_10019838 3300025942 Bacteria 5663
727 Ga0207689_10050917 3300025942 Bacteria 3413
728 Ga0207689_10051349 3300025942 Bacteria 3399
729 Ga0207689_11050323 3300025942 Bacteria 687
730 Ga0207661_10255104 3300025944 Bacteria 1560
731 Ga0207679_10304831 3300025945 Bacteria 1374
732 Ga0207667_10019848 3300025949 Bacteria 7490
733 Ga0207667_10032989 3300025949 Bacteria 5573
734 Ga0207667_10037558 3300025949 Bacteria 5176
735 Ga0207667_10381938 3300025949 Bacteria 1435
736 Ga0207667_10864193 3300025949 Bacteria 898
737 Ga0207651_10092366 3300025960 Bacteria 2219
738 Ga0207651_11118112 3300025960 Bacteria 706
739 Ga0207651_11212830 3300025960 Unclassified 677
740 Ga0207712_10128240 3300025961 Bacteria 1929
741 Ga0207712_10134220 3300025961 Bacteria 1891
742 Ga0207668_10133008 3300025972 Unclassified 1902
743 Ga0207668_10923023 3300025972 Bacteria 778
744 Ga0207668_11189565 3300025972 Unclassified 685
745 Ga0207668_11839082 3300025972 Unclassified 546
746 Ga0207668_11895112 3300025972 Unclassified 538
747 Ga0207640_10286906 3300025981 Bacteria 1296
748 Ga0207640_10354990 3300025981 Bacteria 1179
749 Ga0207640_10376228 3300025981 Bacteria 1149
750 Ga0207640_11364831 3300025981 Bacteria 634
751 Ga0207640_11429613 3300025981 Bacteria 620
752 Ga0207640_12116777 3300025981 Bacteria 510
753 Ga0207658_10225029 3300025986 Bacteria 1580
754 Ga0207677_10008836 3300026023 Bacteria 5646
755 Ga0207677_10120274 3300026023 Bacteria 1974
756 Ga0207677_12241743 3300026023 Unclassified 508
757 Ga0207703_10411803 3300026035 Bacteria 1256
758 Ga0207703_10751145 3300026035 Bacteria 929
759 Ga0207703_10751430 3300026035 Bacteria 929
760 Ga0207703_11197028 3300026035 Bacteria 730
761 Ga0207703_11198427 3300026035 Bacteria 730
762 Ga0207639_11394732 3300026041 Bacteria 658
763 Ga0207678_10198541 3300026067 Bacteria 1715
764 Ga0207678_10791616 3300026067 Bacteria 837
765 Ga0207708_10003464 3300026075 Bacteria 11631
766 Ga0207708_10005357 3300026075 Bacteria 9451
767 Ga0207708_10034529 3300026075 Bacteria 3846
768 Ga0207708_10179233 3300026075 Bacteria 1682
769 Ga0207708_10210453 3300026075 Bacteria 1554
770 Ga0207708_10442356 3300026075 Bacteria 1081
771 Ga0207708_10606475 3300026075 Bacteria 928
772 Ga0207708_12047791 3300026075 Bacteria 501
773 Ga0207702_10046243 3300026078 Bacteria 3663
774 Ga0207702_10051094 3300026078 Bacteria 3492
775 Ga0207641_10286027 3300026088 Bacteria 1552
776 Ga0207641_10758413 3300026088 Bacteria 958
777 Ga0207641_10950952 3300026088 Bacteria 855
778 Ga0207641_11487323 3300026088 Bacteria 679
779 Ga0207641_11902228 3300026088 Bacteria 596
780 Ga0207641_12250028 3300026088 Bacteria 545
781 Ga0207648_10002207 3300026089 Bacteria 21115
782 Ga0207648_10027461 3300026089 Bacteria 5052
783 Ga0207648_10043932 3300026089 Bacteria 3922
784 Ga0207648_10125948 3300026089 Bacteria 2254
785 Ga0207648_10762720 3300026089 Unclassified 899
786 Ga0207648_11054372 3300026089 Bacteria 762
787 Ga0207648_11714763 3300026089 Bacteria 590
788 Ga0207648_12030836 3300026089 Bacteria 536
789 Ga0207676_10055274 3300026095 Bacteria 3115
790 Ga0207676_10237563 3300026095 Bacteria 1632
791 Ga0207676_10377454 3300026095 Bacteria 1319
792 Ga0207676_10733970 3300026095 Bacteria 959
793 Ga0207674_10050370 3300026116 Bacteria 4255
794 Ga0207674_10365446 3300026116 Bacteria 1395
795 Ga0207674_10434020 3300026116 Bacteria 1269
796 Ga0207674_10650920 3300026116 Bacteria 1018
797 Ga0207674_10963303 3300026116 Bacteria 822
798 Ga0207675_100001449 3300026118 Bacteria 23775
799 Ga0207675_100018474 3300026118 Bacteria 6503
800 Ga0207675_100018646 3300026118 Bacteria 6477
801 Ga0207675_100061761 3300026118 Bacteria 3498
802 Ga0207675_100871680 3300026118 Bacteria 916
803 Ga0207675_101607467 3300026118 Unclassified 670
804 Ga0207683_10033038 3300026121 Bacteria 4494
805 Ga0207683_10055065 3300026121 Bacteria 3488
806 Ga0207683_10173753 3300026121 Bacteria 1952
807 Ga0207683_10383569 3300026121 Bacteria 1292
808 Ga0207683_10415225 3300026121 Bacteria 1239
809 Ga0207683_10503283 3300026121 Bacteria 1119
810 Ga0207698_10359427 3300026142 Bacteria 1378
811 Ga0207698_10470770 3300026142 Bacteria 1217
812 Ga0207698_10700137 3300026142 Bacteria 1008
813 Ga0207698_12086918 3300026142 Bacteria 580
814 Ga0209967_1015224 3300027364 Unclassified 1100
815 Ga0209967_1041431 3300027364 Bacteria 700
816 Ga0209981_1058358 3300027378 Bacteria 589
817 Ga0209996_1044043 3300027395 Bacteria 668
818 Ga0210000_1051685 3300027462 Bacteria 660
819 Ga0209968_1026172 3300027526 Bacteria 963
820 Ga0209999_1022397 3300027543 Bacteria 1162
821 Ga0209999_1077716 3300027543 Bacteria 639
822 Ga0209983_1105346 3300027665 Bacteria 640
823 Ga0209971_1055441 3300027682 Bacteria 959
824 Ga0209966_1023577 3300027695 Unclassified 1210
825 Ga0209966_1147962 3300027695 Bacteria 546
826 Ga0209813_10062709 3300027866 Bacteria 1190
827 Ga0209974_10218055 3300027876 Bacteria 709
828 Ga0207428_10002424 3300027907 Bacteria 18609
829 Ga0207428_10103559 3300027907 Bacteria 2197
830 Ga0268266_10039349 3300028379 Bacteria 4027
831 Ga0268266_10211700 3300028379 Bacteria 1778
832 Ga0268266_10423643 3300028379 Bacteria 1262
833 Ga0268266_11153974 3300028379 Bacteria 749
834 Ga0268266_11556658 3300028379 Bacteria 637
835 Ga0268265_10100812 3300028380 Bacteria 2331
836 Ga0268265_10402234 3300028380 Bacteria 1266
837 Ga0268265_10634794 3300028380 Bacteria 1025
838 Ga0268265_11571514 3300028380 Unclassified 662
839 Ga0268265_11786542 3300028380 Bacteria 621
840 Ga0268264_10089661 3300028381 Bacteria 2648
841 Ga0268264_10477348 3300028381 Bacteria 1212
842 Ga0268264_10620247 3300028381 Bacteria 1068
843 Ga0268264_10691745 3300028381 Unclassified 1012
844 Ga0265334_10062508 3300028573 Bacteria 1401
845 Ga0307515_10062723 3300028794 Bacteria 5241
846 Ga0265325_10179145 3300031241 Bacteria 988
847 Ga0265340_10413041 3300031247 Unclassified 595
848 Ga0265331_10254491 3300031250 Bacteria 788
849 Ga0265327_10129861 3300031251 Bacteria 1186
850 Ga0307513_10357163 3300031456 Bacteria 1207
851 Ga0307509_10304390 3300031507 Unclassified 1340
852 Ga0307408_100205398 3300031548 Bacteria 1597
853 Ga0307408_100218470 3300031548 Bacteria 1554
854 Ga0307408_101394292 3300031548 Unclassified 660
855 Ga0316575_10056377 3300031665 Bacteria 1565
856 Ga0316575_10077435 3300031665 Bacteria 1339
857 Ga0316579_10000491 3300031691 Bacteria 12898
858 Ga0265342_10706359 3300031712 Bacteria 504
859 Ga0316578_10051154 3300031728 Bacteria 2419
860 Ga0307405_10349421 3300031731 Bacteria 1140
861 Ga0307406_10335377 3300031901 Unclassified 1176
862 Ga0307412_10437740 3300031911 Bacteria 1074
863 Ga0307412_11140575 3300031911 Bacteria 695
864 Ga0307412_11762171 3300031911 Bacteria 569
865 Ga0307409_101160262 3300031995 Bacteria 795
866 Ga0307416_100049786 3300032002 Bacteria 3334
867 Ga0307416_100257471 3300032002 Bacteria 1703
868 Ga0307416_101236868 3300032002 Bacteria 852
869 Ga0307416_101391821 3300032002 Bacteria 807
870 Ga0307414_10551335 3300032004 Bacteria 1027
871 Ga0307411_10111503 3300032005 Bacteria 1959
872 Ga0307411_10293420 3300032005 Bacteria 1300
873 Ga0307415_101069150 3300032126 Unclassified 754
874 Ga0316583_10007997 3300032133 Bacteria 3810
875 Ga0373930_0148855 3300034816 Bacteria 586
876 Ga0373926_0289152 3300035083 Bacteria 639
877 Ga0373926_0351783 3300035083 Unclassified 578
878 Ga0373928_0022691 3300035084 Bacteria 1333
879 Ga0373928_0130550 3300035084 Bacteria 681
880 Ga0373934_0335528 3300035086 Bacteria 629
881 Ga0373944_0399647 3300035089 Unclassified 529
882 Ga0373949_0076552 3300035090 Bacteria 885
883 Ga0373951_0238913 3300035091 Bacteria 542
884 Ga0373923_0091568 3300035111 Bacteria 1331
885 Ga0373923_0111331 3300035111 Bacteria 1216
886 Ga0373923_0262601 3300035111 Unclassified 810
887 Ga0373932_0020911 3300035112 Bacteria 1721
888 Ga0373936_0013361 3300035113 Bacteria 3134
889 Ga0373939_0051001 3300035114 Bacteria 1285
890 Ga0373941_0036842 3300035115 Bacteria 1490
891 Ga0373953_0121221 3300035117 Bacteria 1111
892 Ga0373954_0000885 3300035118 Bacteria 11653
893 Ga0373954_0305180 3300035118 Bacteria 785
894 Ga0373956_0096457 3300035119 Unclassified 1368
895 Ga0373956_0525458 3300035119 Bacteria 565
896 Ga0373960_0170043 3300035121 Bacteria 755
897 Ga0373960_0267056 3300035121 Bacteria 626
898 Ga0373960_0336215 3300035121 Unclassified 569
899 Ga0373943_0048531 3300035170 Bacteria 2080
900 Ga0373946_0743374 3300035171 Bacteria 514
901 Ga0373955_0516472 3300035172 Bacteria 730
902 Ga0373942_0006112 3300035207 Bacteria 2778
903 Ga0373942_0054662 3300035207 Bacteria 1129
904 Ga0373961_0334773 3300035241 Bacteria 568
905 Ga0373962_0124643 3300035242 Bacteria 825
906 Ga0373962_0370855 3300035242 Unclassified 521
907 Ga0316574_0027701 3300035398 Bacteria 3414
908 Ga0373924_0104162 3300035410 Unclassified 1222
909 Ga0373924_0113971 3300035410 Bacteria 1170
910 Ga0373931_0013099 3300035691 Bacteria 4032
911 Ga0373931_0426275 3300035691 Bacteria 844
912 Ga0373931_0793830 3300035691 Bacteria 631
913 Ga0373931_1005686 3300035691 Bacteria 564
914 Ga0373931_1012439 3300035691 Bacteria 563
915 Ga0373931_1281203 3300035691 Bacteria 504
916 Ga0373935_0006432 3300035692 Bacteria 7013
917 Ga0373935_0630176 3300035692 Bacteria 786
918 Ga0373927_0013335 3300035695 Bacteria 5464
919 Ga0373927_0127715 3300035695 Bacteria 1660
920 Ga0373927_0299199 3300035695 Bacteria 1059
921 Ga0373927_0366631 3300035695 Bacteria 950
922 Ga0373927_0539787 3300035695 Bacteria 771
923 Ga0373927_0632879 3300035695 Bacteria 707
924 Ga0373933_0003127 3300035724 Bacteria 9228
925 Ga0373933_0068833 3300035724 Bacteria 2151
926 Ga0373933_0496787 3300035724 Bacteria 799
927 Ga0373947_0039928 3300035725 Bacteria 2794
928 Ga0373947_0094519 3300035725 Bacteria 1870
929 Ga0373937_0001480 3300036401 Bacteria 19690
930 Ga0373937_0068840 3300036401 Bacteria 3263
931 Ga0373937_0149585 3300036401 Bacteria 2187
932 Ga0373937_0208153 3300036401 Bacteria 1840
933 Ga0373937_0554709 3300036401 Bacteria 1091
934 Ga0373937_1110441 3300036401 Bacteria 739
935 Ga0373925_0019215 3300037068 Bacteria 4969
936 Ga0373925_0070523 3300037068 Bacteria 2642
937 Ga0373925_0448284 3300037068 Bacteria 1056
938 Ga0373925_0492139 3300037068 Bacteria 1006
939 Ga0373925_1431573 3300037068 Unclassified 566
940 Ga0395899_0007777 3300037312 Bacteria 8266
941 Ga0395899_0115026 3300037312 Bacteria 1931
942 Ga0395900_0001993 3300037418 Bacteria 23054
943 Ga0395900_0019699 3300037418 Bacteria 6877
944 Ga0395898_0051377 3300037466 Bacteria 4031
945 Ga0395905_0506405 3300037471 Bacteria 1108
946 Ga0316581_0006285 3300037588 Bacteria 3135
947 Ga0436364_0053514 3300037853 Bacteria 2776
948 Ga0436364_0097757 3300037853 Bacteria 1683
949 Ga0436364_0121438 3300037853 Bacteria 14053
950 Ga0436364_0562957 3300037853 Bacteria 1712
951 Ga0436364_1034490 3300037853 Bacteria 2325
952 Ga0395901_0007491 3300038443 Bacteria 11024
953 Ga0395901_0032336 3300038443 Bacteria 5398
954 Ga0395901_1241895 3300038443 Bacteria 709
955 Ga0436365_0071775 3300039437 Bacteria 669
956 Ga0436365_0249799 3300039437 Bacteria 906
957 Ga0436365_0370328 3300039437 Bacteria 9603
958 Ga0436365_0443926 3300039437 Bacteria 5018
959 Ga0436365_0619658 3300039437 Bacteria 533
960 Ga0436365_1173676 3300039437 Bacteria 2170
961 Ga0436365_1369015 3300039437 Bacteria 891
962 Ga0436365_1552572 3300039437 Bacteria 1520
963 Ga0436365_1769432 3300039437 Bacteria 765
964 Ga0436360_0286329 3300039438 Bacteria 1211
965 Ga0436360_0552102 3300039438 Bacteria 824
966 Ga0436360_0696399 3300039438 Bacteria 19859
967 Ga0436360_0991768 3300039438 Bacteria 511
968 Ga0436360_1209191 3300039438 Bacteria 661
969 Ga0436361_0444416 3300039447 Bacteria 2349
970 Ga0436361_0604610 3300039447 Bacteria 3448
971 Ga0436361_1211710 3300039447 Bacteria 769
972 Ga0436363_0187588 3300039450 Bacteria 3467
973 Ga0436363_0593320 3300039450 Bacteria 515
974 Ga0436363_1293516 3300039450 Bacteria 518
975 Ga0436363_1621296 3300039450 Bacteria 583
976 Ga0436362_0368704 3300039453 Bacteria 751
977 Ga0436362_0692278 3300039453 Bacteria 721
978 Ga0439461_0075700 3300041410 Bacteria 787
979 Ga0451802_1813287 3300041460 Bacteria 728
980 Ga0451843_0652108 3300041509 Bacteria 555
981 Ga0451855_1100159 3300041511 Bacteria 742
982 Ga0439431_0025693 3300041997 Bacteria 1440
983 Ga0439441_000035 3300042001 Bacteria 9994
984 Ga0439441_049776 3300042001 Unclassified 860
985 Ga0439445_0007570 3300042004 Bacteria 2523
986 Ga0439448_0183443 3300042005 Bacteria 732
987 Ga0450911_000141 3300042115 Bacteria 29229
988 Ga0450891_011493 3300042129 Bacteria 820
989 Ga0439446_0040551 3300042156 Bacteria 1371
990 Ga0439435_0010860 3300042436 Unclassified 2172
991 Ga0439435_0037170 3300042436 Unclassified 1348
992 Ga0439444_0010484 3300042437 Bacteria 1481
993 Ga0439444_0035289 3300042437 Bacteria 958
994 Ga0439460_0004076 3300042461 Viruses 3548
995 Ga0439460_0006247 3300042461 Unclassified 2949
996 Ga0439460_0065946 3300042461 Bacteria 1113
997 Ga0439440_0224809 3300042993 Bacteria 564
998 Ga0453683_1032557 3300044673 Unclassified 546
999 Ga0466963_0078595 3300044694 Bacteria 2231
1000 Ga0466964_0355921 3300044706 Bacteria 753
1001 Ga0453684_1031539 3300044712 Bacteria 873
1002 Ga0466971_0466086 3300044719 Unclassified 621
1003 Ga0466968_0320143 3300044735 Unclassified 749
1004 Ga0466957_0059969 3300044842 Bacteria 2333
1005 Ga0466957_0586460 3300044842 Bacteria 779
1006 Ga0451576_0818677 3300045051 Bacteria 978
1007 Ga0451576_1186433 3300045051 Bacteria 797
1008 Ga0466967_0015127 3300045976 Bacteria 6040
1009 Ga0495592_0049803 3300046454 Bacteria 3113
1010 Ga0495592_0467378 3300046454 Unclassified 788
1011 Ga0495650_0001683 3300046471 Bacteria 20409
1012 Ga0495639_0399374 3300046475 Bacteria 694
1013 Ga0495662_0055200 3300046476 Bacteria 1919
1014 Ga0495662_0064278 3300046476 Bacteria 1773
1015 Ga0495594_0310719 3300046499 Bacteria 898
1016 Ga0495608_0003260 3300046511 Bacteria 11595
1017 Ga0495608_0412506 3300046511 Bacteria 825
1018 Ga0495630_0040655 3300046517 Bacteria 3475
1019 Ga0495630_0161638 3300046517 Bacteria 1705
1020 Ga0495642_0376008 3300046528 Unclassified 625
1021 Ga0495652_0164133 3300046529 Bacteria 1721
1022 Ga0495654_0228501 3300046530 Unclassified 784
1023 Ga0495640_0021315 3300046533 Bacteria 4758
1024 Ga0495640_0061843 3300046533 Bacteria 2542
1025 Ga0495586_0011601 3300046535 Bacteria 4690
1026 Ga0495586_0013285 3300046535 Bacteria 4365
1027 Ga0495587_0074531 3300046536 Bacteria 1971
1028 Ga0495587_0562849 3300046536 Unclassified 629
1029 Ga0495598_0030498 3300046537 Bacteria 1511
1030 Ga0495621_0118700 3300046539 Bacteria 1020
1031 Ga0495621_0229687 3300046539 Bacteria 753
1032 Ga0495621_0297736 3300046539 Unclassified 668
1033 Ga0495645_0442788 3300046543 Bacteria 821
1034 Ga0495667_0870194 3300046559 Bacteria 553
1035 Ga0495634_0030962 3300046642 Bacteria 3688
1036 Ga0495635_0057002 3300046663 Bacteria 2689
1037 Ga0495635_0234425 3300046663 Bacteria 1239
1038 Ga0495599_0013969 3300046678 Bacteria 4971
1039 Ga0495646_0319634 3300046680 Bacteria 818
1040 Ga0495647_0042840 3300046681 Bacteria 1730
1041 Ga0495647_0177954 3300046681 Bacteria 924
1042 Ga0495647_0424901 3300046681 Bacteria 613
1043 Ga0495658_0155206 3300046683 Bacteria 1408
1044 Ga0495658_0166781 3300046683 Bacteria 1361
1045 Ga0495658_0587186 3300046683 Bacteria 714
1046 Ga0495658_1013298 3300046683 Bacteria 530
1047 Ga0495669_0021968 3300046684 Unclassified 2772
1048 Ga0495669_0049577 3300046684 Bacteria 1880
1049 Ga0495613_0003842 3300046689 Bacteria 11243
1050 Ga0495624_0797214 3300046690 Bacteria 558
1051 Ga0495600_0078490 3300046809 Bacteria 2156
1052 Ga0495581_0895539 3300047315 Bacteria 507
1053 Ga0495604_0119737 3300047317 Bacteria 1907
1054 Ga0495604_0417401 3300047317 Bacteria 881
1055 Ga0495636_0217734 3300047318 Bacteria 876
1056 Ga0495674_0137856 3300047319 Bacteria 2052
1057 Ga0495674_0489518 3300047319 Bacteria 985
1058 Ga0495676_0967912 3300047321 Bacteria 544
1059 Ga0495680_0001251 3300047322 Bacteria 27849
1060 Ga0495602_0110276 3300048088 Bacteria 2237
1061 Ga0495615_0128154 3300048090 Bacteria 740
1062 Ga0496104_0674592 3300048907 Unclassified 942
1063 Ga0496104_1292434 3300048907 Bacteria 633
1064 Ga0496105_0701477 3300048908 Bacteria 777
1065 Ga0496109_1020809 3300048912 Unclassified 765
1066 Ga0496110_0779836 3300048913 Bacteria 860
1067 Ga0496110_1004046 3300048913 Bacteria 742
1068 Ga0496114_1684048 3300048917 Unclassified 522
1069 Ga0496114_1707914 3300048917 Bacteria 518
1070 Ga0496114_1781710 3300048917 Unclassified 504
1071 Ga0496125_0007726 3300048928 Bacteria 11390
1072 Ga0496126_0574497 3300048929 Bacteria 891
1073 Ga0501291_046735 3300049514 Bacteria 777
1074 Ga0501031_1095967 3300049568 Bacteria 508
1075 Ga0501033_0193482 3300049570 Unclassified 1455
1076 Ga0501033_0293577 3300049570 Bacteria 1146
1077 Ga0501033_0525106 3300049570 Bacteria 817
1078 Ga0501033_0638077 3300049570 Bacteria 728
1079 Ga0501034_0002928 3300049571 Bacteria 19795
1080 Ga0501034_0007770 3300049571 Bacteria 11409
1081 Ga0501034_0126227 3300049571 Bacteria 2544
1082 Ga0501034_0495934 3300049571 Bacteria 1135
1083 Ga0501034_0526198 3300049571 Bacteria 1094
1084 Ga0501034_1095979 3300049571 Bacteria 677
1085 Ga0501036_0002821 3300049572 Bacteria 13771
1086 Ga0501036_0108501 3300049572 Bacteria 2346
1087 Ga0501036_0113480 3300049572 Bacteria 2290
1088 Ga0501036_0334119 3300049572 Bacteria 1266
1089 Ga0501036_0637987 3300049572 Bacteria 882
1090 Ga0501036_1448748 3300049572 Bacteria 556
1091 Ga0501036_1584265 3300049572 Unclassified 529
1092 Ga0501037_0168356 3300049573 Bacteria 1559
1093 Ga0501037_0519970 3300049573 Bacteria 806
1094 Ga0501037_0561146 3300049573 Bacteria 770
1095 Ga0501038_0262733 3300049574 Bacteria 1364
1096 Ga0501038_0285166 3300049574 Bacteria 1299
1097 Ga0501038_0561373 3300049574 Bacteria 867
1098 Ga0501038_0963341 3300049574 Bacteria 628
1099 Ga0501038_1070785 3300049574 Bacteria 590
1100 Ga0501038_1089939 3300049574 Bacteria 583
1101 Ga0501039_0028545 3300049575 Bacteria 4295
1102 Ga0501039_0047973 3300049575 Bacteria 3301
1103 Ga0501039_0117128 3300049575 Bacteria 2086
1104 Ga0501039_0136020 3300049575 Bacteria 1929
1105 Ga0501039_0533530 3300049575 Unclassified 921
1106 Ga0501039_0860511 3300049575 Bacteria 706
1107 Ga0501039_1260896 3300049575 Bacteria 571
1108 Ga0501040_0008541 3300049576 Bacteria 6647
1109 Ga0501040_0162737 3300049576 Bacteria 1578
1110 Ga0501040_0208826 3300049576 Bacteria 1388
1111 Ga0501040_0690543 3300049576 Bacteria 738
1112 Ga0501040_0716938 3300049576 Unclassified 723
1113 Ga0501040_1429609 3300049576 Bacteria 502
1114 Ga0501041_0001559 3300049577 Bacteria 12754
1115 Ga0501041_0032456 3300049577 Bacteria 3156
1116 Ga0501041_0356332 3300049577 Bacteria 925
1117 Ga0501041_0389140 3300049577 Bacteria 883
1118 Ga0501041_0412181 3300049577 Bacteria 856
1119 Ga0501041_0428131 3300049577 Bacteria 839
1120 Ga0501042_0008892 3300049578 Bacteria 6661
1121 Ga0501042_0022068 3300049578 Bacteria 4444
1122 Ga0501042_0102607 3300049578 Bacteria 2058
1123 Ga0501042_0115091 3300049578 Bacteria 1937
1124 Ga0501042_0301387 3300049578 Bacteria 1158
1125 Ga0501042_0955989 3300049578 Bacteria 624
1126 Ga0501043_0044004 3300049579 Bacteria 3510
1127 Ga0501043_0186241 3300049579 Bacteria 1616
1128 Ga0501043_0198979 3300049579 Bacteria 1556
1129 Ga0501043_0602133 3300049579 Unclassified 812
1130 Ga0501043_0929832 3300049579 Bacteria 622
1131 Ga0501046_0024491 3300049580 Bacteria 4950
1132 Ga0501046_0071649 3300049580 Bacteria 2692
1133 Ga0501046_0149741 3300049580 Bacteria 1761
1134 Ga0501046_0207799 3300049580 Bacteria 1454
1135 Ga0501046_0476521 3300049580 Bacteria 896
1136 Ga0501046_1179485 3300049580 Bacteria 527
1137 Ga0501047_0082786 3300049581 Bacteria 3084
1138 Ga0501048_0015299 3300049582 Bacteria 5665
1139 Ga0501048_0044802 3300049582 Unclassified 3161
1140 Ga0501048_0049332 3300049582 Bacteria 3000
1141 Ga0501048_0475736 3300049582 Bacteria 895
1142 Ga0501048_1240812 3300049582 Bacteria 536
1143 Ga0501068_0034602 3300049584 Bacteria 3013
1144 Ga0501068_0623440 3300049584 Bacteria 703
1145 Ga0501068_1105386 3300049584 Bacteria 524
1146 Ga0501070_0284304 3300049586 Bacteria 1349
1147 Ga0501070_1371755 3300049586 Bacteria 538
1148 Ga0501071_0024468 3300049587 Bacteria 4225
1149 Ga0501071_0117763 3300049587 Bacteria 1967
1150 Ga0501071_0605114 3300049587 Bacteria 843
1151 Ga0501072_0010085 3300049588 Bacteria 7191
1152 Ga0501072_0012917 3300049588 Bacteria 6387
1153 Ga0501072_0079661 3300049588 Bacteria 2594
1154 Ga0501072_0204371 3300049588 Bacteria 1575
1155 Ga0501072_0573090 3300049588 Bacteria 891
1156 Ga0501072_0622135 3300049588 Bacteria 851
1157 Ga0501072_0645919 3300049588 Unclassified 833
1158 Ga0501072_0819826 3300049588 Bacteria 728
1159 Ga0501072_1158081 3300049588 Bacteria 601
1160 Ga0501073_0188677 3300049589 Bacteria 1426
1161 Ga0501073_0194340 3300049589 Bacteria 1404
1162 Ga0501073_0223720 3300049589 Bacteria 1300
1163 Ga0501073_0316275 3300049589 Bacteria 1077
1164 Ga0501074_0211465 3300049590 Bacteria 1382
1165 Ga0501074_0451939 3300049590 Bacteria 911
1166 Ga0501074_0545212 3300049590 Bacteria 821
1167 Ga0501075_0004520 3300049591 Bacteria 9421
1168 Ga0501075_0012594 3300049591 Bacteria 6016
1169 Ga0501075_0021384 3300049591 Bacteria 4715
1170 Ga0501075_0578733 3300049591 Bacteria 857
1171 Ga0501075_0891531 3300049591 Bacteria 676
1172 Ga0501075_0942389 3300049591 Bacteria 656
1173 Ga0501076_0001120 3300049592 Bacteria 17675
1174 Ga0501076_0002563 3300049592 Bacteria 12500
1175 Ga0501076_0067162 3300049592 Bacteria 2863
1176 Ga0501076_1086955 3300049592 Bacteria 659
1177 Ga0501076_1690564 3300049592 Bacteria 519
1178 Ga0501077_0016367 3300049593 Bacteria 4672
1179 Ga0501077_0056923 3300049593 Bacteria 2482
1180 Ga0501077_0617537 3300049593 Bacteria 696
1181 Ga0501217_261874 3300049661 Bacteria 560
1182 Ga0501251_071166 3300049681 Bacteria 593
1183 Ga0501079_0002428 3300049741 Bacteria 13528
1184 Ga0501079_0031031 3300049741 Bacteria 4107
1185 Ga0501079_0137227 3300049741 Bacteria 1905
1186 Ga0501079_1364355 3300049741 Bacteria 558
1187 Ga0501080_0015874 3300049742 Bacteria 6948
1188 Ga0501080_0139663 3300049742 Bacteria 2240
1189 Ga0501080_0261691 3300049742 Bacteria 1576
1190 Ga0501080_0262637 3300049742 Bacteria 1573
1191 Ga0501081_0024309 3300049743 Bacteria 4067
1192 Ga0501081_0036103 3300049743 Bacteria 3368
1193 Ga0501081_0101941 3300049743 Bacteria 2030
1194 Ga0501081_1488328 3300049743 Bacteria 514
1195 Ga0501083_0228787 3300049744 Bacteria 1211
1196 Ga0501241_090478 3300049758 Bacteria 648
1197 Ga0501283_108209 3300049779 Bacteria 547
1198 Ga0501035_0082188 3300049822 Bacteria 2843
1199 Ga0501035_0338166 3300049822 Bacteria 1262
1200 Ga0501035_1515656 3300049822 Bacteria 511
1201 Ga0501044_0116437 3300049823 Bacteria 2678
1202 Ga0501044_0322936 3300049823 Bacteria 1468
1203 Ga0501044_0647899 3300049823 Bacteria 946
1204 Ga0501044_0982008 3300049823 Bacteria 717
1205 Ga0501044_1480083 3300049823 Bacteria 544
1206 Ga0501045_0001112 3300049824 Bacteria 17776
1207 Ga0501045_0039237 3300049824 Bacteria 3446
1208 Ga0501045_0161414 3300049824 Bacteria 1668
1209 Ga0501045_0500586 3300049824 Bacteria 902
1210 nmdc:mga03683_13752_c1 3300050489 Bacteria 2984
1211 nmdc:mga03683_140073_c1 3300050489 Bacteria 1087
1212 nmdc:mga03683_155448_c1 3300050489 Bacteria 1034
1213 nmdc:mga03683_25784_c1 3300050489 Bacteria 1398
1214 nmdc:mga03683_32277_c1 3300050489 Bacteria 2106
1215 nmdc:mga03683_57282_c1 3300050489 Bacteria 1640
1216 nmdc:mga03n38_179037_c1 3300050490 Bacteria 1085
1217 nmdc:mga03n38_674663_c1 3300050490 Bacteria 594
1218 nmdc:mga00v17_264743_c1 3300050491 Bacteria 1115
1219 nmdc:mga0yw44_146808_c1 3300050492 Bacteria 1536
1220 nmdc:mga0yw44_282418_c1 3300050492 Bacteria 1110
1221 nmdc:mga0yw44_316921_c1 3300050492 Bacteria 1047
1222 nmdc:mga0yw44_340444_c1 3300050492 Bacteria 1009
1223 nmdc:mga0yw44_77646_c1 3300050492 Bacteria 2075
1224 nmdc:mga0yw44_82257_c1 3300050492 Bacteria 2020
1225 nmdc:mga0yw44_89078_c1 3300050492 Bacteria 1947
1226 nmdc:mga0k408_21342_c1 3300050493 Bacteria 3637
1227 nmdc:mga0k408_28073_c1 3300050493 Bacteria 3198
1228 nmdc:mga0k408_346249_c1 3300050493 Bacteria 886
1229 nmdc:mga0k408_628190_c1 3300050493 Bacteria 632
1230 nmdc:mga0k408_664056_c1 3300050493 Bacteria 612
1231 nmdc:mga0k408_879409_c1 3300050493 Bacteria 520
1232 nmdc:mga06z11_197443_c1 3300050494 Bacteria 1167
1233 nmdc:mga06z11_245902_c1 3300050494 Bacteria 1052
1234 nmdc:mga06z11_26685_c1 3300050494 Bacteria 1629
1235 nmdc:mga06z11_684628_c1 3300050494 Bacteria 625
1236 nmdc:mga06z11_75306_c1 3300050494 Bacteria 1797
1237 nmdc:mga04h51_21653_c1 3300050495 Bacteria 1936
1238 nmdc:mga04h51_298515_c1 3300050495 Bacteria 656
1239 nmdc:mga04h51_61815_c1 3300050495 Bacteria 1286
1240 nmdc:mga07m45_176769_c1 3300050496 Bacteria 1241
1241 nmdc:mga07m45_246710_c1 3300050496 Bacteria 1039
1242 nmdc:mga07m45_61574_c1 3300050496 Bacteria 2126
1243 nmdc:mga07m45_67300_c1 3300050496 Bacteria 2035
1244 nmdc:mga05p37_1173314_c1 3300050507 Bacteria 796
1245 nmdc:mga05p37_4303_c1 3300050507 Bacteria 16621
1246 nmdc:mga05p37_5490_c1 3300050507 Bacteria 14894
1247 nmdc:mga05p37_564508_c1 3300050507 Bacteria 1292
1248 nmdc:mga09592_1702945_c1 3300050508 Bacteria 508
1249 nmdc:mga09592_20470_c1 3300050508 Bacteria 5440
1250 nmdc:mga09592_341334_c1 3300050508 Unclassified 1297
1251 nmdc:mga09592_368938_c1 3300050508 Bacteria 1242
1252 nmdc:mga09592_524750_c1 3300050508 Bacteria 1018
1253 nmdc:mga09592_676637_c1 3300050508 Bacteria 880
1254 nmdc:mga09592_7494_c1 3300050508 Bacteria 8875
1255 nmdc:mga0qj67_118018_c1 3300050509 Bacteria 2145
1256 nmdc:mga0qj67_11976_c1 3300050509 Bacteria 6517
1257 nmdc:mga0qj67_151902_c1 3300050509 Bacteria 1879
1258 nmdc:mga0qj67_210077_c1 3300050509 Bacteria 1581
1259 nmdc:mga0qj67_327119_c1 3300050509 Unclassified 1241
1260 nmdc:mga0qj67_397774_c1 3300050509 Bacteria 1112
1261 nmdc:mga06r32_10902_c1 3300050510 Bacteria 8184
1262 nmdc:mga06r32_1114779_c1 3300050510 Bacteria 738
1263 nmdc:mga06r32_1288902_c1 3300050510 Bacteria 675
1264 nmdc:mga06r32_156_c1 3300050510 Bacteria 52284
1265 nmdc:mga06r32_370886_c1 3300050510 Unclassified 1415
1266 nmdc:mga06r32_479503_c1 3300050510 Bacteria 1222
1267 nmdc:mga08y16_1063293_c1 3300050511 Bacteria 786
1268 nmdc:mga08y16_1612199_c1 3300050511 Bacteria 606
1269 nmdc:mga08y16_21537_c1 3300050511 Bacteria 6806
1270 nmdc:mga08y16_227105_c1 3300050511 Bacteria 1931
1271 nmdc:mga08y16_327601_c1 3300050511 Bacteria 1576
1272 nmdc:mga08y16_419129_c1 3300050511 Bacteria 1368
1273 nmdc:mga08y16_564_c1 3300050511 Bacteria 34392
1274 nmdc:mga0n895_100725_c1 3300050512 Bacteria 2898
1275 nmdc:mga0n895_35020_c1 3300050512 Bacteria 4837
1276 nmdc:mga0n895_515818_c1 3300050512 Unclassified 1203
1277 nmdc:mga0n895_691525_c1 3300050512 Bacteria 1016
1278 nmdc:mga0n895_695687_c1 3300050512 Bacteria 1013
1279 nmdc:mga0n895_72539_c1 3300050512 Bacteria 3416
1280 nmdc:mga0rr50_111898_c1 3300050513 Bacteria 2162
1281 nmdc:mga0rr50_12286_c1 3300050513 Bacteria 5526
1282 nmdc:mga0rr50_23338_c1 3300050513 Bacteria 4264
1283 nmdc:mga0rr50_326562_c1 3300050513 Bacteria 1287
1284 nmdc:mga0rr50_852814_c1 3300050513 Bacteria 777
1285 nmdc:mga0rr50_9253_c1 3300050513 Bacteria 6184
1286 nmdc:mga08x19_1197723_c1 3300050514 Bacteria 538
1287 nmdc:mga08x19_26861_c1 3300050514 Bacteria 3596
1288 nmdc:mga08x19_28648_c1 3300050514 Bacteria 3490
1289 nmdc:mga08x19_44336_c1 3300050514 Bacteria 2839
1290 nmdc:mga08x19_695288_c1 3300050514 Bacteria 722
1291 nmdc:mga08x19_825330_c1 3300050514 Bacteria 658
1292 nmdc:mga08x19_94269_c1 3300050514 Bacteria 1979
1293 nmdc:mga0a205_1056025_c1 3300050515 Bacteria 659
1294 nmdc:mga0a205_1096_c1 3300050515 Bacteria 22507
1295 nmdc:mga0a205_49925_c1 3300050515 Bacteria 4039
1296 nmdc:mga0a205_8560_c2 3300050515 Bacteria 1305
1297 nmdc:mga0a205_963033_c1 3300050515 Unclassified 700
1298 nmdc:mga0sz30_101333_c1 3300050516 Bacteria 1258
1299 nmdc:mga0sz30_101354_c1 3300050516 Bacteria 1258
1300 nmdc:mga0sz30_114864_c1 3300050516 Bacteria 1181
1301 nmdc:mga0sz30_154677_c1 3300050516 Bacteria 1015
1302 nmdc:mga0sz30_251619_c1 3300050516 Bacteria 787
1303 nmdc:mga0sz30_258291_c1 3300050516 Bacteria 776
1304 Ga0495601_0132046 3300053077 Bacteria 1627
1305 Ga0500635_0221191 3300053080 Bacteria 739
1306 Ga0495619_0146558 3300053085 Bacteria 1628
1307 Ga0500647_0394309 3300053091 Bacteria 563
1308 Ga0500651_0414479 3300053093 Bacteria 755
1309 Ga0500641_0000852 3300053096 Bacteria 10941
1310 Ga0500641_0010187 3300053096 Bacteria 3392
1311 Ga0500641_0287845 3300053096 Bacteria 679
1312 Ga0500594_0076379 3300053118 Bacteria 994
1313 Ga0500655_097059 3300053133 Bacteria 616
1314 Ga0500658_0017103 3300053134 Bacteria 2706
1315 Ga0500568_0029173 3300053139 Bacteria 2292
1316 Ga0500586_219944 3300053145 Unclassified 612
1317 Ga0500588_0292831 3300053146 Bacteria 615
1318 Ga0500589_161146 3300053147 Bacteria 902
1319 Ga0500616_0030043 3300053153 Bacteria 2986
1320 Ga0500616_0401837 3300053153 Bacteria 547
1321 Ga0500620_304313 3300053155 Bacteria 516
1322 Ga0500609_009619 3300053731 Bacteria 1302
1323 Ga0500552_000340 3300053733 Bacteria 4287
1324 Ga0501084_0003188 3300054114 Bacteria 13274
1325 Ga0501084_0098810 3300054114 Bacteria 2451
1326 Ga0501084_0272302 3300054114 Bacteria 1430
1327 Ga0501084_0392526 3300054114 Bacteria 1173
1328 Ga0501084_1360645 3300054114 Bacteria 595
1329 Ga0587062_140709 3300059639 Bacteria 503
1330 Ga0501082_0000870 3300060353 Bacteria 26655
1331 Ga0501082_0019539 3300060353 Bacteria 5842
1332 Ga0501082_0311860 3300060353 Bacteria 1370
1333 Ga0501082_1859869 3300060353 Bacteria 525
1334 Ga0466962_0659555 3300061719 Bacteria 535
1335 Ga0530510_0000199 3300061734 Bacteria 37022
1336 Ga0530510_0246233 3300061734 Bacteria 1331
1337 Ga0530510_1391032 3300061734 Unclassified 538
1338 Ga0307408_100688361
1339 JGI25406J46586_10032237
1340 JGI25160J50197_1050733
1341 Ga0065704_10715392
1342 Ga0065712_10284502
1343 Ga0065715_10250015
1344 Ga0065707_10022154
1345 Ga0070658_10042730
1346 Ga0070658_10351203
1347 Ga0070658_11264093
1348 Ga0070676_10287154
1349 Ga0070676_10374076
1350 Ga0070676_10521337
1351 Ga0070683_100629096
1352 Ga0070683_102186509
1353 Ga0070690_100012557
1354 Ga0070690_100110103
1355 Ga0070690_100386838
1356 Ga0070690_100441882
1357 Ga0070690_100497388
1358 Ga0070690_100691791
1359 Ga0070690_101613754
1360 Ga0070670_100164783
1361 Ga0070670_100640884
1362 Ga0070677_10557160
1363 Ga0070677_10673111
1364 Ga0068869_100010572
1365 Ga0068869_100028360
1366 Ga0068869_100038849
1367 Ga0068869_100267464
1368 Ga0070666_10191450
1369 Ga0070666_10237339
1370 Ga0070666_10329506
1371 Ga0070666_11118801
1372 Ga0070680_100009066
1373 Ga0070680_100013524
1374 Ga0070680_100696726
1375 Ga0070680_101220092
1376 Ga0070682_100012003
1377 Ga0068868_100173312
1378 Ga0068868_100583368
1379 Ga0068868_100880466
1380 Ga0068868_101022241
1381 Ga0068868_102409504
1382 Ga0070660_100223734
1383 Ga0070660_100734197
1384 Ga0070689_100026554
1385 Ga0070689_100031801
1386 Ga0070689_100062845
1387 Ga0070689_100789226
1388 Ga0070689_101356375
1389 Ga0070689_101566295
1390 Ga0070689_101573139
1391 Ga0070689_102195073
1392 Ga0070691_10000773
1393 Ga0070691_10005381
1394 Ga0070691_10253366
1395 Ga0070691_10271808
1396 Ga0070687_100006053
1397 Ga0070687_100067449
1398 Ga0070687_100108343
1399 Ga0070687_100956777
1400 Ga0070661_100582741
1401 Ga0070692_10215176
1402 Ga0070692_10813934
1403 Ga0070692_11057123
1404 Ga0070692_11427803
1405 Ga0070668_100023388
1406 Ga0070668_100738268
1407 Ga0070668_100808980
1408 Ga0070668_101021427
1409 Ga0070668_101777521
1410 Ga0070669_100038429
1411 Ga0070669_100125831
1412 Ga0070669_100456066
1413 Ga0070669_100581002
1414 Ga0070669_100852056
1415 Ga0070669_101090018
1416 Ga0070669_101869497
1417 Ga0070675_100178241
1418 Ga0070675_100264002
1419 Ga0070675_100283663
1420 Ga0070675_100433881
1421 Ga0070675_100671118
1422 Ga0070675_101987292
1423 Ga0070671_100263676
1424 Ga0070671_100468675
1425 Ga0070671_100868968
1426 Ga0070674_100025964
1427 Ga0070674_100323640
1428 Ga0070674_100375616
1429 Ga0070674_101968566
1430 Ga0070673_100130018
1431 Ga0070673_100131824
1432 Ga0070673_100151584
1433 Ga0070673_100473560
1434 Ga0070673_100599534
1435 Ga0070673_101111052
1436 Ga0070673_101176741
1437 Ga0070688_100537187
1438 Ga0070688_100593461
1439 Ga0070688_101020813
1440 Ga0070688_101112700
1441 Ga0070688_101362008
1442 Ga0070659_101006400
1443 Ga0070659_102013601
1444 Ga0070667_100101660
1445 Ga0070667_101041929
1446 Ga0070667_101391980
1447 Ga0070703_10037497
1448 Ga0070703_10509960
1449 Ga0070709_10208671
1450 Ga0070709_10530586
1451 Ga0070709_10814039
1452 Ga0070714_100019233
1453 Ga0070713_100766717
1454 Ga0070713_102451087
1455 Ga0070710_10123715
1456 Ga0070710_10220161
1457 Ga0070701_10227347
1458 Ga0070701_11292439
1459 Ga0070711_100241021
1460 Ga0070711_101118937
1461 Ga0070705_100002369
1462 Ga0070705_100017346
1463 Ga0070705_100321000
1464 Ga0070705_100349481
1465 Ga0070705_101480034
1466 Ga0070700_100004068
1467 Ga0070700_100011522
1468 Ga0070700_100166213
1469 Ga0070700_100683604
1470 Ga0070700_100818386
1471 Ga0070694_100040653
1472 Ga0070694_100053631
1473 Ga0070694_100076189
1474 Ga0070694_100095784
1475 Ga0070694_100366964
1476 Ga0070694_100427383
1477 Ga0070694_100924985
1478 Ga0070694_101402251
1479 Ga0070708_100022243
1480 Ga0070708_100264154
1481 Ga0070708_100823401
1482 Ga0070708_101607190
1483 Ga0070678_100039026
1484 Ga0070678_100039729
1485 Ga0070678_100047326
1486 Ga0070678_100293433
1487 Ga0070678_100414760
1488 Ga0070662_100247543
1489 Ga0070662_100350653
1490 Ga0070662_100523969
1491 Ga0070662_101119446
1492 Ga0070681_10016738
1493 Ga0070681_10029560
1494 Ga0070681_10381179
1495 Ga0070681_10648281
1496 Ga0070681_10754318
1497 Ga0070681_10935485
1498 Ga0068867_100029259
1499 Ga0068867_100056009
1500 Ga0068867_100120986
1501 Ga0068867_100257796
1502 Ga0068867_101349057
1503 Ga0068867_101716576
1504 Ga0068867_102095758
1505 Ga0070685_10277001
1506 Ga0070685_10280745
1507 Ga0070685_11129585
1508 Ga0070706_100006842
1509 Ga0070706_100486733
1510 Ga0070706_100507083
1511 Ga0070707_100009165
1512 Ga0070707_100914283
1513 Ga0070707_101010780
1514 Ga0070707_101094860
1515 Ga0070707_102000311
1516 Ga0070698_100003981
1517 Ga0070698_100100907
1518 Ga0070699_100010564
1519 Ga0070699_100040469
1520 Ga0070699_100047380
1521 Ga0070699_100086507
1522 Ga0070699_100503280
1523 Ga0070699_100519422
1524 Ga0070699_100591089
1525 Ga0070699_101064828
1526 Ga0070679_100009220
1527 Ga0070679_100009349
1528 Ga0070679_100645806
1529 Ga0070684_100106283
1530 Ga0070684_100172806
1531 Ga0070684_100220332
1532 Ga0070697_100020028
1533 Ga0070697_100070651
1534 Ga0070697_100775780
1535 Ga0070697_101614406
1536 Ga0068853_101271954
1537 Ga0068853_101782617
1538 Ga0068853_102417078
1539 Ga0070672_100174530
1540 Ga0070672_100360955
1541 Ga0070672_100375890
1542 Ga0070686_100290781
1543 Ga0070686_100363700
1544 Ga0070686_100598942
1545 Ga0070686_100999421
1546 Ga0070686_101519296
1547 Ga0070695_100038923
1548 Ga0070695_100158414
1549 Ga0070695_101385514
1550 Ga0070695_101416825
1551 Ga0070696_100001813
1552 Ga0070696_100069768
1553 Ga0070696_100242374
1554 Ga0070696_100589681
1555 Ga0070696_100690156
1556 Ga0070693_100003044
1557 Ga0070693_100129608
1558 Ga0070693_100202462
1559 Ga0070693_100394138
1560 Ga0070693_100805040
1561 Ga0070665_100040919
1562 Ga0070665_100175855
1563 Ga0070665_100484484
1564 Ga0070665_101312329
1565 Ga0070665_102629280
1566 Ga0070704_100006289
1567 Ga0070704_100011989
1568 Ga0070704_100034081
1569 Ga0070704_100244221
1570 Ga0070704_101831610
1571 Ga0068855_100046510
1572 Ga0068855_100079603
1573 Ga0068855_100117914
1574 Ga0068855_100144502
1575 Ga0068855_100658660
1576 Ga0068855_102181229
1577 Ga0068855_102426924
1578 Ga0070664_101054498
1579 Ga0070664_101122629
1580 Ga0070664_101178132
1581 Ga0068857_100045735
1582 Ga0068857_100620698
1583 Ga0068857_100849380
1584 Ga0068857_101456240
1585 Ga0068857_101582135
1586 Ga0068854_100104117
1587 Ga0068854_100215656
1588 Ga0068854_100398175
1589 Ga0068854_100436958
1590 Ga0068854_100821129
1591 Ga0068856_100018692
1592 Ga0068856_100069775
1593 Ga0070702_100000291
1594 Ga0070702_100216312
1595 Ga0070702_100285010
1596 Ga0070702_101054504
1597 Ga0070702_101405189
1598 Ga0070702_101550180
1599 Ga0070702_101821798
1600 Ga0068852_100164847
1601 Ga0068852_100415072
1602 Ga0068852_101713674
1603 Ga0068852_101855766
1604 Ga0068852_101936550
1605 Ga0068859_100018731
1606 Ga0068859_100027864
1607 Ga0068859_100122248
1608 Ga0068859_100156633
1609 Ga0068859_100193567
1610 Ga0068859_100479915
1611 Ga0068859_100674402
1612 Ga0068859_100986813
1613 Ga0068864_100267315
1614 Ga0068864_100289654
1615 Ga0068864_100334587
1616 Ga0068866_10001011
1617 Ga0068866_10135889
1618 Ga0068866_10440344
1619 Ga0068866_10939213
1620 Ga0068861_100009219
1621 Ga0068861_100121147
1622 Ga0068861_100131041
1623 Ga0068861_100240859
1624 Ga0068861_100317117
1625 Ga0068861_100602315
1626 Ga0068861_100805169
1627 Ga0068861_101792200
1628 Ga0068861_102216804
1629 Ga0068851_10278844
1630 Ga0068870_10079546
1631 Ga0068870_10115219
1632 Ga0068870_10570059
1633 Ga0068870_10588945
1634 Ga0068863_100194677
1635 Ga0068863_100273175
1636 Ga0068863_100654473
1637 Ga0068858_100002998
1638 Ga0068858_100417902
1639 Ga0068858_100478462
1640 Ga0068858_100577078
1641 Ga0068858_100940286
1642 Ga0068858_102062527
1643 Ga0068858_102465877
1644 Ga0068860_100148408
1645 Ga0068860_100265997
1646 Ga0068862_100007394
1647 Ga0068862_100029772
1648 Ga0068862_100049498
1649 Ga0068862_100142802
1650 Ga0068862_100297929
1651 Ga0068862_100633645
1652 Ga0068862_101252914
1653 Ga0068862_101588684
1654 Ga0068862_102116745
1655 Ga0081455_10003323
1656 Ga0081455_10015257
1657 Ga0081455_10030837
1658 Ga0081455_10143368
1659 Ga0081455_10693255
1660 Ga0081538_10220093
1661 Ga0081540_1037373
1662 Ga0081539_10002126
1663 Ga0081539_10022656
1664 Ga0081539_10105444
1665 Ga0070717_10102436
1666 Ga0070717_10355091
1667 Ga0070717_10996776
1668 Ga0075365_10144548
1669 Ga0075365_10265797
1670 Ga0075365_10451223
1671 Ga0075365_10478765
1672 Ga0075365_10506211
1673 Ga0075365_10552103
1674 Ga0075365_10872992
1675 Ga0075368_10011988
1676 Ga0075368_10049614
1677 Ga0075368_10306077
1678 Ga0075363_100107609
1679 Ga0075364_10178948
1680 Ga0075364_10261697
1681 Ga0075364_10343229
1682 Ga0075364_10444444
1683 Ga0070715_10079941
1684 Ga0070715_10436605
1685 Ga0070716_100057824
1686 Ga0070716_100556385
1687 Ga0070716_101375408
1688 Ga0070716_101519973
1689 Ga0070716_101549930
1690 Ga0070712_100157907
1691 Ga0075362_10010504
1692 Ga0075362_10014616
1693 Ga0075362_10043548
1694 Ga0075362_10146318
1695 Ga0075362_10350267
1696 Ga0075362_10717796
1697 Ga0075367_10032595
1698 Ga0075367_10057986
1699 Ga0075367_10069109
1700 Ga0075367_10109767
1701 Ga0075367_10163451
1702 Ga0075367_10218021
1703 Ga0075367_10277837
1704 Ga0075369_10001043
1705 Ga0075369_10038085
1706 Ga0075369_10048423
1707 Ga0075369_10179673
1708 Ga0075366_10013074
1709 Ga0075366_10110626
1710 Ga0075366_10172815
1711 Ga0075366_10516821
1712 Ga0075366_10571032
1713 Ga0075366_10588089
1714 Ga0097621_100019598
1715 Ga0097621_100078974
1716 Ga0097621_100711215
1717 Ga0097621_101379170
1718 Ga0075370_10320649
1719 Ga0075370_10331535
1720 Ga0068871_100010824
1721 Ga0068871_100016719
1722 Ga0068871_100130263
1723 Ga0068871_100545415
1724 Ga0068871_101511675
1725 Ga0075428_100015504
1726 Ga0075428_100023946
1727 Ga0075428_100485963
1728 Ga0075428_100654279
1729 Ga0075428_100839641
1730 Ga0075428_100896801
1731 Ga0075430_100018613
1732 Ga0075430_100207158
1733 Ga0075430_100419734
1734 Ga0075430_100472264
1735 Ga0075431_100000397
1736 Ga0075431_100072948
1737 Ga0075431_100187222
1738 Ga0075431_100247066
1739 Ga0075431_100274534
1740 Ga0075431_100316150
1741 Ga0075431_101318254
1742 Ga0075431_101376952
1743 Ga0075433_10039385
1744 Ga0075433_10312452
1745 Ga0075433_10630631
1746 Ga0075433_11358360
1747 Ga0075434_100015680
1748 Ga0075434_100027657
1749 Ga0075434_100102843
1750 Ga0075434_100145840
1751 Ga0075434_100547486
1752 Ga0075434_101247953
1753 Ga0075434_102181190
1754 Ga0075429_100001368
1755 Ga0075429_100011437
1756 Ga0075429_100234105
1757 Ga0075429_100257973
1758 Ga0075429_100476211
1759 Ga0075429_100842449
1760 Ga0075429_100850816
1761 Ga0068865_100012771
1762 Ga0068865_100285491
1763 Ga0068865_100328498
1764 Ga0068865_100436784
1765 Ga0075436_100000096
1766 Ga0075436_100027365
1767 Ga0075436_100175386
1768 Ga0075436_100616989
1769 Ga0075436_100696047
1770 Ga0075436_100837438
1771 Ga0075436_101120398
1772 Ga0097620_100018728
1773 Ga0097620_100027865
1774 Ga0097620_100122248
1775 Ga0097620_100156634
1776 Ga0097620_100193567
1777 Ga0097620_100479909
1778 Ga0097620_100674269
1779 Ga0097620_100986778
1780 Ga0075435_100002559
1781 Ga0075435_100008145
1782 Ga0075435_100017661
1783 Ga0075435_100048108
1784 Ga0075435_100144665
1785 Ga0075435_100550620
1786 Ga0099794_10310602
1787 Ga0099795_10000951
1788 Ga0099795_10008008
1789 Ga0099795_10321420
1790 Ga0105251_10180411
1791 Ga0105250_10201382
1792 Ga0105240_10098573
1793 Ga0105240_10230524
1794 Ga0105240_11596772
1795 Ga0105240_12050572
1796 Ga0111539_10000970
1797 Ga0111539_10006876
1798 Ga0111539_10034290
1799 Ga0111539_10185858
1800 Ga0111539_10305459
1801 Ga0111539_10451479
1802 Ga0111539_10591828
1803 Ga0111539_10674593
1804 Ga0111539_10895058
1805 Ga0111539_11001831
1806 Ga0111539_11201698
1807 Ga0111539_11956109
1808 Ga0111539_12221925
1809 Ga0111539_12358507
1810 Ga0105245_10009363
1811 Ga0105245_10044636
1812 Ga0105245_11148342
1813 Ga0105245_11800440
1814 Ga0105245_11929146
1815 Ga0105245_12033390
1816 Ga0105247_11571102
1817 Ga0114129_10001144
1818 Ga0114129_10007262
1819 Ga0114129_10366974
1820 Ga0114129_11141515
1821 Ga0114129_11530089
1822 Ga0114129_11543520
1823 Ga0114129_12036755
1824 Ga0105243_10025235
1825 Ga0105243_10046885
1826 Ga0105243_10048485
1827 Ga0105243_10193815
1828 Ga0105243_11346250
1829 Ga0105243_12119817
1830 Ga0105243_12229357
1831 Ga0105241_10024003
1832 Ga0105241_10209345
1833 Ga0105241_11191514
1834 Ga0105242_10001023
1835 Ga0105242_10001815
1836 Ga0105242_10113987
1837 Ga0105242_10931802
1838 Ga0105242_11849453
1839 Ga0105248_10246502
1840 Ga0105248_10301088
1841 Ga0105248_10661724
1842 Ga0105248_11420857
1843 Ga0105248_13078036
1844 Ga0105237_10107310
1845 Ga0105238_10226506
1846 Ga0105238_10336549
1847 Ga0105238_12401233
1848 Ga0105249_10013069
1849 Ga0105249_10048358
1850 Ga0105249_10269905
1851 Ga0105249_10333558
1852 Ga0105249_13333547
1853 Ga0105035_110452
1854 Ga0105035_114167
1855 Ga0099796_10062913
1856 Ga0099796_10072817
1857 Ga0099796_10225359
1858 Ga0105239_10064628
1859 Ga0105239_10189695
1860 Ga0105239_10986562
1861 Ga0105246_10241168
1862 Ga0105246_10473774
1863 Ga0105246_11501121
1864 Ga0157373_10093130
1865 Ga0157373_10775217
1866 Ga0157371_10574538
1867 Ga0157370_10074623
1868 Ga0157369_10127390
1869 Ga0157369_10468186
1870 Ga0157369_11677512
1871 Ga0157374_10265759
1872 Ga0157374_10357365
1873 Ga0157374_11057492
1874 Ga0157374_11718035
1875 Ga0157378_10009386
1876 Ga0157378_10062408
1877 Ga0157378_10174514
1878 Ga0157378_10562957
1879 Ga0157378_10664189
1880 Ga0157378_11111950
1881 Ga0157378_12081823
1882 Ga0157378_12550021
1883 Ga0163162_10345706
1884 Ga0163162_10412149
1885 Ga0163162_11265007
1886 Ga0163162_11446613
1887 Ga0163162_11948925
1888 Ga0157372_10758716
1889 Ga0157372_11562343
1890 Ga0157375_10020684
1891 Ga0157375_10499485
1892 Ga0157375_11333952
1893 Ga0157375_11603776
1894 Ga0157375_12396004
1895 Ga0157375_13323729
1896 Ga0157515_131170
1897 Ga0163163_10877848
1898 Ga0163163_11479150
1899 Ga0163163_11904832
1900 Ga0157380_10134351
1901 Ga0157380_10786436
1902 Ga0157380_11935236
1903 Ga0182008_10307689
1904 Ga0182008_10815616
1905 Ga0157377_10184036
1906 Ga0157377_11111203
1907 Ga0157379_10096268
1908 Ga0157379_10163248
1909 Ga0157379_10252070
1910 Ga0157379_10489085
1911 Ga0157379_11146880
1912 Ga0157376_10001037
1913 Ga0157376_10014946
1914 Ga0157376_10049364
1915 Ga0157376_10221150
1916 Ga0157376_10504519
1917 Ga0157376_13020562
1918 Ga0182006_1259350
1919 Ga0182007_10299770
1920 Ga0163161_10218287
1921 Ga0163161_11724687
1922 Ga0206352_10725851
1923 Ga0206353_11448514
1924 Ga0213872_10071552
1925 Ga0213874_10081744
1926 Ga0213874_10434378
1927 Ga0213876_10028299
1928 Ga0213876_10194461
1929 Ga0213876_10446571
1930 Ga0213875_10000030
1931 Ga0213871_10027298
1932 Ga0224712_10166571
1933 Ga0207426_1024241
1934 Ga0207426_1044810
1935 Ga0207697_10034324
1936 Ga0207697_10064228
1937 Ga0207653_10309383
1938 Ga0207682_10001510
1939 Ga0207642_10010412
1940 Ga0207642_10050989
1941 Ga0207642_10454262
1942 Ga0207642_10532391
1943 Ga0207688_10001551
1944 Ga0207688_10489891
1945 Ga0207688_10836184
1946 Ga0207680_10107330
1947 Ga0207680_10348526
1948 Ga0207680_10748650
1949 Ga0207680_10872288
1950 Ga0207647_10157076
1951 Ga0207647_10164834
1952 Ga0207685_10123186
1953 Ga0207699_10123479
1954 Ga0207699_10463034
1955 Ga0207645_10008734
1956 Ga0207645_10087371
1957 Ga0207645_10221618
1958 Ga0207645_10391058
1959 Ga0207643_10005783
1960 Ga0207643_10055386
1961 Ga0207643_10107867
1962 Ga0207643_10184124
1963 Ga0207643_10555088
1964 Ga0207705_10069481
1965 Ga0207684_10051419
1966 Ga0207684_10872934
1967 Ga0207654_10033492
1968 Ga0207707_10067776
1969 Ga0207707_10361052
1970 Ga0207707_10699277
1971 Ga0207695_10090373
1972 Ga0207695_10094181
1973 Ga0207671_10775096
1974 Ga0207693_10172419
1975 Ga0207663_10190325
1976 Ga0207660_10040869
1977 Ga0207660_10094378
1978 Ga0207660_10380753
1979 Ga0207660_10538892
1980 Ga0207662_10000171
1981 Ga0207662_10003496
1982 Ga0207662_10096262
1983 Ga0207662_10189706
1984 Ga0207662_10618755
1985 Ga0207662_11155376
1986 Ga0207657_10126634
1987 Ga0207657_10204846
1988 Ga0207649_10152908
1989 Ga0207652_10083531
1990 Ga0207652_10217957
1991 Ga0207652_10858752
1992 Ga0207646_10037148
1993 Ga0207646_10673521
1994 Ga0207646_11077476
1995 Ga0207646_11538686
1996 Ga0207646_11618638
1997 Ga0207681_10068346
1998 Ga0207681_10314288
1999 Ga0207681_10348411
2000 Ga0207681_10560441
2001 Ga0207681_10750437
2002 Ga0207694_10116037
2003 Ga0207694_10411877
2004 Ga0207650_10525596
2005 Ga0207650_10643749
2006 Ga0207650_11028389
2007 Ga0207659_10296130
2008 Ga0207659_10323953
2009 Ga0207659_10456190
2010 Ga0207659_10566652
2011 Ga0207659_10751715
2012 Ga0207659_11403920
2013 Ga0207687_10077444
2014 Ga0207687_10383910
2015 Ga0207700_11138844
2016 Ga0207700_11233144
2017 Ga0207664_10036601
2018 Ga0207664_10462353
2019 Ga0207644_10707665
2020 Ga0207644_11003699
2021 Ga0207644_11458868
2022 Ga0207690_10562232
2023 Ga0207690_10943887
2024 Ga0207706_10005426
2025 Ga0207706_10230995
2026 Ga0207706_10363777
2027 Ga0207686_10011242
2028 Ga0207686_10109837
2029 Ga0207686_10652420
2030 Ga0207686_11301438
2031 Ga0207709_10050347
2032 Ga0207709_10159396
2033 Ga0207709_10196377
2034 Ga0207709_10305528
2035 Ga0207709_10428577
2036 Ga0207709_11207927
2037 Ga0207670_10079644
2038 Ga0207670_10124509
2039 Ga0207670_10173142
2040 Ga0207670_10515931
2041 Ga0207670_10528930
2042 Ga0207669_10217180
2043 Ga0207669_10328917
2044 Ga0207669_10491123
2045 Ga0207704_10005281
2046 Ga0207704_10867799
2047 Ga0207665_10036698
2048 Ga0207665_10069694
2049 Ga0207691_10039183
2050 Ga0207691_10046742
2051 Ga0207691_10111470
2052 Ga0207691_10112961
2053 Ga0207691_10513949
2054 Ga0207691_11242776
2055 Ga0207711_10130223
2056 Ga0207711_10241533
2057 Ga0207711_10395535
2058 Ga0207711_10495521
2059 Ga0207711_10839110
2060 Ga0207711_10972447
2061 Ga0207711_11235021
2062 Ga0207689_10001391
2063 Ga0207689_10019838
2064 Ga0207689_10050917
2065 Ga0207689_10051349
2066 Ga0207689_11050323
2067 Ga0207661_10255104
2068 Ga0207679_10304831
2069 Ga0207667_10019848
2070 Ga0207667_10032989
2071 Ga0207667_10037558
2072 Ga0207667_10381938
2073 Ga0207667_10864193
2074 Ga0207651_10092366
2075 Ga0207651_11118112
2076 Ga0207651_11212830
2077 Ga0207712_10128240
2078 Ga0207712_10134220
2079 Ga0207668_10133008
2080 Ga0207668_10923023
2081 Ga0207668_11189565
2082 Ga0207668_11839082
2083 Ga0207668_11895112
2084 Ga0207640_10286906
2085 Ga0207640_10354990
2086 Ga0207640_10376228
2087 Ga0207640_11364831
2088 Ga0207640_11429613
2089 Ga0207640_12116777
2090 Ga0207658_10225029
2091 Ga0207677_10008836
2092 Ga0207677_10120274
2093 Ga0207677_12241743
2094 Ga0207703_10411803
2095 Ga0207703_10751145
2096 Ga0207703_10751430
2097 Ga0207703_11197028
2098 Ga0207703_11198427
2099 Ga0207639_11394732
2100 Ga0207678_10198541
2101 Ga0207678_10791616
2102 Ga0207708_10003464
2103 Ga0207708_10005357
2104 Ga0207708_10034529
2105 Ga0207708_10179233
2106 Ga0207708_10210453
2107 Ga0207708_10442356
2108 Ga0207708_10606475
2109 Ga0207708_12047791
2110 Ga0207702_10046243
2111 Ga0207702_10051094
2112 Ga0207641_10286027
2113 Ga0207641_10758413
2114 Ga0207641_10950952
2115 Ga0207641_11487323
2116 Ga0207641_11902228
2117 Ga0207641_12250028
2118 Ga0207648_10002207
2119 Ga0207648_10027461
2120 Ga0207648_10043932
2121 Ga0207648_10125948
2122 Ga0207648_10762720
2123 Ga0207648_11054372
2124 Ga0207648_11714763
2125 Ga0207648_12030836
2126 Ga0207676_10055274
2127 Ga0207676_10237563
2128 Ga0207676_10377454
2129 Ga0207676_10733970
2130 Ga0207674_10050370
2131 Ga0207674_10365446
2132 Ga0207674_10434020
2133 Ga0207674_10650920
2134 Ga0207674_10963303
2135 Ga0207675_100001449
2136 Ga0207675_100018474
2137 Ga0207675_100018646
2138 Ga0207675_100061761
2139 Ga0207675_100871680
2140 Ga0207675_101607467
2141 Ga0207683_10033038
2142 Ga0207683_10055065
2143 Ga0207683_10173753
2144 Ga0207683_10383569
2145 Ga0207683_10415225
2146 Ga0207683_10503283
2147 Ga0207698_10359427
2148 Ga0207698_10470770
2149 Ga0207698_10700137
2150 Ga0207698_12086918
2151 Ga0209967_1015224
2152 Ga0209967_1041431
2153 Ga0209981_1058358
2154 Ga0209996_1044043
2155 Ga0210000_1051685
2156 Ga0209968_1026172
2157 Ga0209999_1022397
2158 Ga0209999_1077716
2159 Ga0209983_1105346
2160 Ga0209971_1055441
2161 Ga0209966_1023577
2162 Ga0209966_1147962
2163 Ga0209813_10062709
2164 Ga0209974_10218055
2165 Ga0207428_10002424
2166 Ga0207428_10103559
2167 Ga0268266_10039349
2168 Ga0268266_10211700
2169 Ga0268266_10423643
2170 Ga0268266_11153974
2171 Ga0268266_11556658
2172 Ga0268265_10100812
2173 Ga0268265_10402234
2174 Ga0268265_10634794
2175 Ga0268265_11571514
2176 Ga0268265_11786542
2177 Ga0268264_10089661
2178 Ga0268264_10477348
2179 Ga0268264_10620247
2180 Ga0268264_10691745
2181 Ga0265334_10062508
2182 Ga0307515_10062723
2183 Ga0265325_10179145
2184 Ga0265340_10413041
2185 Ga0265331_10254491
2186 Ga0265327_10129861
2187 Ga0307513_10357163
2188 Ga0307509_10304390
2189 Ga0307408_100205398
2190 Ga0307408_100218470
2191 Ga0307408_101394292
2192 Ga0316575_10056377
2193 Ga0316575_10077435
2194 Ga0316579_10000491
2195 Ga0265342_10706359
2196 Ga0316578_10051154
2197 Ga0307405_10349421
2198 Ga0307406_10335377
2199 Ga0307412_10437740
2200 Ga0307412_11140575
2201 Ga0307412_11762171
2202 Ga0307409_101160262
2203 Ga0307416_100049786
2204 Ga0307416_100257471
2205 Ga0307416_101236868
2206 Ga0307416_101391821
2207 Ga0307414_10551335
2208 Ga0307411_10111503
2209 Ga0307411_10293420
2210 Ga0307415_101069150
2211 Ga0316583_10007997
2212 Ga0373930_0148855
2213 Ga0373926_0289152
2214 Ga0373926_0351783
2215 Ga0373928_0022691
2216 Ga0373928_0130550
2217 Ga0373934_0335528
2218 Ga0373944_0399647
2219 Ga0373949_0076552
2220 Ga0373951_0238913
2221 Ga0373923_0091568
2222 Ga0373923_0111331
2223 Ga0373923_0262601
2224 Ga0373932_0020911
2225 Ga0373936_0013361
2226 Ga0373939_0051001
2227 Ga0373941_0036842
2228 Ga0373953_0121221
2229 Ga0373954_0000885
2230 Ga0373954_0305180
2231 Ga0373956_0096457
2232 Ga0373956_0525458
2233 Ga0373960_0170043
2234 Ga0373960_0267056
2235 Ga0373960_0336215
2236 Ga0373943_0048531
2237 Ga0373946_0743374
2238 Ga0373955_0516472
2239 Ga0373942_0006112
2240 Ga0373942_0054662
2241 Ga0373961_0334773
2242 Ga0373962_0124643
2243 Ga0373962_0370855
2244 Ga0316574_0027701
2245 Ga0373924_0104162
2246 Ga0373924_0113971
2247 Ga0373931_0013099
2248 Ga0373931_0426275
2249 Ga0373931_0793830
2250 Ga0373931_1005686
2251 Ga0373931_1012439
2252 Ga0373931_1281203
2253 Ga0373935_0006432
2254 Ga0373935_0630176
2255 Ga0373927_0013335
2256 Ga0373927_0127715
2257 Ga0373927_0299199
2258 Ga0373927_0366631
2259 Ga0373927_0539787
2260 Ga0373927_0632879
2261 Ga0373933_0003127
2262 Ga0373933_0068833
2263 Ga0373933_0496787
2264 Ga0373947_0039928
2265 Ga0373947_0094519
2266 Ga0373937_0001480
2267 Ga0373937_0068840
2268 Ga0373937_0149585
2269 Ga0373937_0208153
2270 Ga0373937_0554709
2271 Ga0373937_1110441
2272 Ga0373925_0019215
2273 Ga0373925_0070523
2274 Ga0373925_0448284
2275 Ga0373925_0492139
2276 Ga0373925_1431573
2277 Ga0395899_0007777
2278 Ga0395899_0115026
2279 Ga0395900_0001993
2280 Ga0395900_0019699
2281 Ga0395898_0051377
2282 Ga0395905_0506405
2283 Ga0316581_0006285
2284 Ga0436364_0053514
2285 Ga0436364_0097757
2286 Ga0436364_0121438
2287 Ga0436364_0562957
2288 Ga0436364_1034490
2289 Ga0395901_0007491
2290 Ga0395901_0032336
2291 Ga0395901_1241895
2292 Ga0436365_0071775
2293 Ga0436365_0249799
2294 Ga0436365_0370328
2295 Ga0436365_0443926
2296 Ga0436365_0619658
2297 Ga0436365_1173676
2298 Ga0436365_1369015
2299 Ga0436365_1552572
2300 Ga0436365_1769432
2301 Ga0436360_0286329
2302 Ga0436360_0552102
2303 Ga0436360_0696399
2304 Ga0436360_0991768
2305 Ga0436360_1209191
2306 Ga0436361_0444416
2307 Ga0436361_0604610
2308 Ga0436361_1211710
2309 Ga0436363_0187588
2310 Ga0436363_0593320
2311 Ga0436363_1293516
2312 Ga0436363_1621296
2313 Ga0436362_0368704
2314 Ga0436362_0692278
2315 Ga0439461_0075700
2316 Ga0451802_1813287
2317 Ga0451843_0652108
2318 Ga0451855_1100159
2319 Ga0439431_0025693
2320 Ga0439441_000035
2321 Ga0439441_049776
2322 Ga0439445_0007570
2323 Ga0439448_0183443
2324 Ga0450911_000141
2325 Ga0450891_011493
2326 Ga0439446_0040551
2327 Ga0439435_0010860
2328 Ga0439435_0037170
2329 Ga0439444_0010484
2330 Ga0439444_0035289
2331 Ga0439460_0004076
2332 Ga0439460_0006247
2333 Ga0439460_0065946
2334 Ga0439440_0224809
2335 Ga0453683_1032557
2336 Ga0466963_0078595
2337 Ga0466964_0355921
2338 Ga0453684_1031539
2339 Ga0466971_0466086
2340 Ga0466968_0320143
2341 Ga0466957_0059969
2342 Ga0466957_0586460
2343 Ga0451576_0818677
2344 Ga0451576_1186433
2345 Ga0466967_0015127
2346 Ga0495592_0049803
2347 Ga0495592_0467378
2348 Ga0495650_0001683
2349 Ga0495639_0399374
2350 Ga0495662_0055200
2351 Ga0495662_0064278
2352 Ga0495594_0310719
2353 Ga0495608_0003260
2354 Ga0495608_0412506
2355 Ga0495630_0040655
2356 Ga0495630_0161638
2357 Ga0495642_0376008
2358 Ga0495652_0164133
2359 Ga0495654_0228501
2360 Ga0495640_0021315
2361 Ga0495640_0061843
2362 Ga0495586_0011601
2363 Ga0495586_0013285
2364 Ga0495587_0074531
2365 Ga0495587_0562849
2366 Ga0495598_0030498
2367 Ga0495621_0118700
2368 Ga0495621_0229687
2369 Ga0495621_0297736
2370 Ga0495645_0442788
2371 Ga0495667_0870194
2372 Ga0495634_0030962
2373 Ga0495635_0057002
2374 Ga0495635_0234425
2375 Ga0495599_0013969
2376 Ga0495646_0319634
2377 Ga0495647_0042840
2378 Ga0495647_0177954
2379 Ga0495647_0424901
2380 Ga0495658_0155206
2381 Ga0495658_0166781
2382 Ga0495658_0587186
2383 Ga0495658_1013298
2384 Ga0495669_0021968
2385 Ga0495669_0049577
2386 Ga0495613_0003842
2387 Ga0495624_0797214
2388 Ga0495600_0078490
2389 Ga0495581_0895539
2390 Ga0495604_0119737
2391 Ga0495604_0417401
2392 Ga0495636_0217734
2393 Ga0495674_0137856
2394 Ga0495674_0489518
2395 Ga0495676_0967912
2396 Ga0495680_0001251
2397 Ga0495602_0110276
2398 Ga0495615_0128154
2399 Ga0496104_0674592
2400 Ga0496104_1292434
2401 Ga0496105_0701477
2402 Ga0496109_1020809
2403 Ga0496110_0779836
2404 Ga0496110_1004046
2405 Ga0496114_1684048
2406 Ga0496114_1707914
2407 Ga0496114_1781710
2408 Ga0496125_0007726
2409 Ga0496126_0574497
2410 Ga0501291_046735
2411 Ga0501031_1095967
2412 Ga0501033_0193482
2413 Ga0501033_0293577
2414 Ga0501033_0525106
2415 Ga0501033_0638077
2416 Ga0501034_0002928
2417 Ga0501034_0007770
2418 Ga0501034_0126227
2419 Ga0501034_0495934
2420 Ga0501034_0526198
2421 Ga0501034_1095979
2422 Ga0501036_0002821
2423 Ga0501036_0108501
2424 Ga0501036_0113480
2425 Ga0501036_0334119
2426 Ga0501036_0637987
2427 Ga0501036_1448748
2428 Ga0501036_1584265
2429 Ga0501037_0168356
2430 Ga0501037_0519970
2431 Ga0501037_0561146
2432 Ga0501038_0262733
2433 Ga0501038_0285166
2434 Ga0501038_0561373
2435 Ga0501038_0963341
2436 Ga0501038_1070785
2437 Ga0501038_1089939
2438 Ga0501039_0028545
2439 Ga0501039_0047973
2440 Ga0501039_0117128
2441 Ga0501039_0136020
2442 Ga0501039_0533530
2443 Ga0501039_0860511
2444 Ga0501039_1260896
2445 Ga0501040_0008541
2446 Ga0501040_0162737
2447 Ga0501040_0208826
2448 Ga0501040_0690543
2449 Ga0501040_0716938
2450 Ga0501040_1429609
2451 Ga0501041_0001559
2452 Ga0501041_0032456
2453 Ga0501041_0356332
2454 Ga0501041_0389140
2455 Ga0501041_0412181
2456 Ga0501041_0428131
2457 Ga0501042_0008892
2458 Ga0501042_0022068
2459 Ga0501042_0102607
2460 Ga0501042_0115091
2461 Ga0501042_0301387
2462 Ga0501042_0955989
2463 Ga0501043_0044004
2464 Ga0501043_0186241
2465 Ga0501043_0198979
2466 Ga0501043_0602133
2467 Ga0501043_0929832
2468 Ga0501046_0024491
2469 Ga0501046_0071649
2470 Ga0501046_0149741
2471 Ga0501046_0207799
2472 Ga0501046_0476521
2473 Ga0501046_1179485
2474 Ga0501047_0082786
2475 Ga0501048_0015299
2476 Ga0501048_0044802
2477 Ga0501048_0049332
2478 Ga0501048_0475736
2479 Ga0501048_1240812
2480 Ga0501068_0034602
2481 Ga0501068_0623440
2482 Ga0501068_1105386
2483 Ga0501070_0284304
2484 Ga0501070_1371755
2485 Ga0501071_0024468
2486 Ga0501071_0117763
2487 Ga0501071_0605114
2488 Ga0501072_0010085
2489 Ga0501072_0012917
2490 Ga0501072_0079661
2491 Ga0501072_0204371
2492 Ga0501072_0573090
2493 Ga0501072_0622135
2494 Ga0501072_0645919
2495 Ga0501072_0819826
2496 Ga0501072_1158081
2497 Ga0501073_0188677
2498 Ga0501073_0194340
2499 Ga0501073_0223720
2500 Ga0501073_0316275
2501 Ga0501074_0211465
2502 Ga0501074_0451939
2503 Ga0501074_0545212
2504 Ga0501075_0004520
2505 Ga0501075_0012594
2506 Ga0501075_0021384
2507 Ga0501075_0578733
2508 Ga0501075_0891531
2509 Ga0501075_0942389
2510 Ga0501076_0001120
2511 Ga0501076_0002563
2512 Ga0501076_0067162
2513 Ga0501076_1086955
2514 Ga0501076_1690564
2515 Ga0501077_0016367
2516 Ga0501077_0056923
2517 Ga0501077_0617537
2518 Ga0501217_261874
2519 Ga0501251_071166
2520 Ga0501079_0002428
2521 Ga0501079_0031031
2522 Ga0501079_0137227
2523 Ga0501079_1364355
2524 Ga0501080_0015874
2525 Ga0501080_0139663
2526 Ga0501080_0261691
2527 Ga0501080_0262637
2528 Ga0501081_0024309
2529 Ga0501081_0036103
2530 Ga0501081_0101941
2531 Ga0501081_1488328
2532 Ga0501083_0228787
2533 Ga0501241_090478
2534 Ga0501283_108209
2535 Ga0501035_0082188
2536 Ga0501035_0338166
2537 Ga0501035_1515656
2538 Ga0501044_0116437
2539 Ga0501044_0322936
2540 Ga0501044_0647899
2541 Ga0501044_0982008
2542 Ga0501044_1480083
2543 Ga0501045_0001112
2544 Ga0501045_0039237
2545 Ga0501045_0161414
2546 Ga0501045_0500586
2547 nmdc:mga03683_13752_c1
2548 nmdc:mga03683_140073_c1
2549 nmdc:mga03683_155448_c1
2550 nmdc:mga03683_25784_c1
2551 nmdc:mga03683_32277_c1
2552 nmdc:mga03683_57282_c1
2553 nmdc:mga03n38_179037_c1
2554 nmdc:mga03n38_674663_c1
2555 nmdc:mga00v17_264743_c1
2556 nmdc:mga0yw44_146808_c1
2557 nmdc:mga0yw44_282418_c1
2558 nmdc:mga0yw44_316921_c1
2559 nmdc:mga0yw44_340444_c1
2560 nmdc:mga0yw44_77646_c1
2561 nmdc:mga0yw44_82257_c1
2562 nmdc:mga0yw44_89078_c1
2563 nmdc:mga0k408_21342_c1
2564 nmdc:mga0k408_28073_c1
2565 nmdc:mga0k408_346249_c1
2566 nmdc:mga0k408_628190_c1
2567 nmdc:mga0k408_664056_c1
2568 nmdc:mga0k408_879409_c1
2569 nmdc:mga06z11_197443_c1
2570 nmdc:mga06z11_245902_c1
2571 nmdc:mga06z11_26685_c1
2572 nmdc:mga06z11_684628_c1
2573 nmdc:mga06z11_75306_c1
2574 nmdc:mga04h51_21653_c1
2575 nmdc:mga04h51_298515_c1
2576 nmdc:mga04h51_61815_c1
2577 nmdc:mga07m45_176769_c1
2578 nmdc:mga07m45_246710_c1
2579 nmdc:mga07m45_61574_c1
2580 nmdc:mga07m45_67300_c1
2581 nmdc:mga05p37_1173314_c1
2582 nmdc:mga05p37_4303_c1
2583 nmdc:mga05p37_5490_c1
2584 nmdc:mga05p37_564508_c1
2585 nmdc:mga09592_1702945_c1
2586 nmdc:mga09592_20470_c1
2587 nmdc:mga09592_341334_c1
2588 nmdc:mga09592_368938_c1
2589 nmdc:mga09592_524750_c1
2590 nmdc:mga09592_676637_c1
2591 nmdc:mga09592_7494_c1
2592 nmdc:mga0qj67_118018_c1
2593 nmdc:mga0qj67_11976_c1
2594 nmdc:mga0qj67_151902_c1
2595 nmdc:mga0qj67_210077_c1
2596 nmdc:mga0qj67_327119_c1
2597 nmdc:mga0qj67_397774_c1
2598 nmdc:mga06r32_10902_c1
2599 nmdc:mga06r32_1114779_c1
2600 nmdc:mga06r32_1288902_c1
2601 nmdc:mga06r32_156_c1
2602 nmdc:mga06r32_370886_c1
2603 nmdc:mga06r32_479503_c1
2604 nmdc:mga08y16_1063293_c1
2605 nmdc:mga08y16_1612199_c1
2606 nmdc:mga08y16_21537_c1
2607 nmdc:mga08y16_227105_c1
2608 nmdc:mga08y16_327601_c1
2609 nmdc:mga08y16_419129_c1
2610 nmdc:mga08y16_564_c1
2611 nmdc:mga0n895_100725_c1
2612 nmdc:mga0n895_35020_c1
2613 nmdc:mga0n895_515818_c1
2614 nmdc:mga0n895_691525_c1
2615 nmdc:mga0n895_695687_c1
2616 nmdc:mga0n895_72539_c1
2617 nmdc:mga0rr50_111898_c1
2618 nmdc:mga0rr50_12286_c1
2619 nmdc:mga0rr50_23338_c1
2620 nmdc:mga0rr50_326562_c1
2621 nmdc:mga0rr50_852814_c1
2622 nmdc:mga0rr50_9253_c1
2623 nmdc:mga08x19_1197723_c1
2624 nmdc:mga08x19_26861_c1
2625 nmdc:mga08x19_28648_c1
2626 nmdc:mga08x19_44336_c1
2627 nmdc:mga08x19_695288_c1
2628 nmdc:mga08x19_825330_c1
2629 nmdc:mga08x19_94269_c1
2630 nmdc:mga0a205_1056025_c1
2631 nmdc:mga0a205_1096_c1
2632 nmdc:mga0a205_49925_c1
2633 nmdc:mga0a205_8560_c2
2634 nmdc:mga0a205_963033_c1
2635 nmdc:mga0sz30_101333_c1
2636 nmdc:mga0sz30_101354_c1
2637 nmdc:mga0sz30_114864_c1
2638 nmdc:mga0sz30_154677_c1
2639 nmdc:mga0sz30_251619_c1
2640 nmdc:mga0sz30_258291_c1
2641 Ga0495601_0132046
2642 Ga0500635_0221191
2643 Ga0495619_0146558
2644 Ga0500647_0394309
2645 Ga0500651_0414479
2646 Ga0500641_0000852
2647 Ga0500641_0010187
2648 Ga0500641_0287845
2649 Ga0500594_0076379
2650 Ga0500655_097059
2651 Ga0500658_0017103
2652 Ga0500568_0029173
2653 Ga0500586_219944
2654 Ga0500588_0292831
2655 Ga0500589_161146
2656 Ga0500616_0030043
2657 Ga0500616_0401837
2658 Ga0500620_304313
2659 Ga0500609_009619
2660 Ga0500552_000340
2661 Ga0501084_0003188
2662 Ga0501084_0098810
2663 Ga0501084_0272302
2664 Ga0501084_0392526
2665 Ga0501084_1360645
2666 Ga0587062_140709
2667 Ga0501082_0000870
2668 Ga0501082_0019539
2669 Ga0501082_0311860
2670 Ga0501082_1859869
2671 Ga0466962_0659555
2672 Ga0530510_0000199
2673 Ga0530510_0246233
2674 Ga0530510_1391032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

25

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r6y-assembly1.cif.gz_A crystal structure of ygin from escherichia coli 0.9334 1 100
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9286 2 100
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9263 1 100
1r6y-assembly1.cif.gz_A crystal structure of ygin from escherichia coli 0.9246 1 100
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.9213 2 100
ID Description Score Start End Superfamily
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.929 2 100 3.30.70.100
1tuvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9262 1 100 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9213 2 100 3.30.70.100
1tuvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9175 1 100 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.908 2 100 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W5QUF6-F1-model_v4 deleted 0.9929 2 100
AF-A0A437SYR7-F1-model_v4 deleted 0.9774 1 100
AF-A0A387FRC0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9762 1 100 GO:0004497
GO:0005829
AF-A0A7W8W0S4-F1-model_v4 Quinol monooxygenase YgiN 0.9759 2 100 GO:0004497
GO:0005829
AF-A0A2D9JRY0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9751 1 100 GO:0004497
GO:0005829

Map