F493027
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1325 | 486 | 1325 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10027267|Ga0105245_100272674 |
| Length | 222 |
| Sequence | MADEKQEKAPRGDKGGDKDKRRGKSEASNEPKAKVITTVEVQAARFAGKYTKDVIPALVKQFGYKNPNEVPKLQKIVINMGLGAAVTNPKIVDAAVDELRAITGQKPVVTRAKKAIASFKLRQGIAIGAMVTLRKARMWEFLDRLVTLGLPRTRDFRGVSRKAFDGKGNYTLGLKEQIIFPEINYDRIDVIKGLNISFVTTARTDDEGRALLTHLGMPFRAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 145 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 148 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 149 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 234 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 247 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 251 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 252 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 265 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 266 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 267 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 291 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 295 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 296 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 299 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 300 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 301 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 302 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 308 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 309 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 312 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 313 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 314 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 315 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 316 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 317 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 320 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 321 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 322 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 323 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 324 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 325 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 326 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 327 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 381 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 382 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 383 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 389 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 390 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 391 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 394 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 417 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 418 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 419 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 430 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 442 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 446 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 450 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 451 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 452 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 453 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 456 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 458 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 486 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.17 |
| Metatranscriptomes | 4.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.51 |
| Nodule | 0 |
| Rhizoplane | 1.28 |
| Rhizosphere | 92.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006759J45824_1039453 | 3300003163 | Bacteria | 2123 |
| 2 | Ga0006758J48902_1012886 | 3300003300 | Bacteria | 2834 |
| 3 | Ga0006758J48902_1013389 | 3300003300 | Bacteria | 1314 |
| 4 | rootL2_10157317 | 3300003322 | Bacteria | 1205 |
| 5 | rootL2_10194461 | 3300003322 | Bacteria | 1615 |
| 6 | rootH1_10015553 | 3300003323 | Bacteria | 3043 |
| 7 | rootH1_10085120 | 3300003323 | Bacteria | 1192 |
| 8 | JGI25404J52841_10009653 | 3300003659 | Bacteria | 2066 |
| 9 | Ga0032354_1058877 | 3300003693 | Bacteria | 1077 |
| 10 | Ga0058859_11829127 | 3300004798 | Bacteria | 1752 |
| 11 | Ga0065704_10091784 | 3300005289 | Bacteria | 2682 |
| 12 | Ga0065704_10195761 | 3300005289 | Bacteria | 1127 |
| 13 | Ga0065712_10091604 | 3300005290 | Bacteria | 2366 |
| 14 | Ga0065715_10102075 | 3300005293 | Bacteria | 3147 |
| 15 | Ga0065715_10143668 | 3300005293 | Bacteria | 1814 |
| 16 | Ga0065715_10165959 | 3300005293 | Bacteria | 1586 |
| 17 | Ga0065707_10027729 | 3300005295 | Bacteria | 1354 |
| 18 | Ga0065707_10094039 | 3300005295 | Bacteria | 3532 |
| 19 | Ga0065707_10132362 | 3300005295 | Bacteria | 1898 |
| 20 | Ga0065707_10132436 | 3300005295 | Bacteria | 1897 |
| 21 | Ga0070676_10255063 | 3300005328 | Bacteria | 1172 |
| 22 | Ga0070683_100000033 | 3300005329 | Bacteria | 135305 |
| 23 | Ga0070690_100115551 | 3300005330 | Bacteria | 1795 |
| 24 | Ga0070690_100159739 | 3300005330 | Bacteria | 1543 |
| 25 | Ga0070670_100002900 | 3300005331 | Bacteria | 14190 |
| 26 | Ga0070670_100530543 | 3300005331 | Bacteria | 1049 |
| 27 | Ga0068869_100009311 | 3300005334 | Bacteria | 6370 |
| 28 | Ga0068869_100024219 | 3300005334 | Unclassified | 4203 |
| 29 | Ga0068869_100027588 | 3300005334 | Bacteria | 3960 |
| 30 | Ga0068869_100413594 | 3300005334 | Bacteria | 1111 |
| 31 | Ga0070666_10102938 | 3300005335 | Bacteria | 1969 |
| 32 | Ga0070666_10507546 | 3300005335 | Bacteria | 875 |
| 33 | Ga0070680_100246401 | 3300005336 | Bacteria | 1511 |
| 34 | Ga0070680_100766455 | 3300005336 | Bacteria | 831 |
| 35 | Ga0070682_100155089 | 3300005337 | Bacteria | 1575 |
| 36 | Ga0068868_100000632 | 3300005338 | Bacteria | 23664 |
| 37 | Ga0068868_100045599 | 3300005338 | Bacteria | 3430 |
| 38 | Ga0068868_100058678 | 3300005338 | Bacteria | 3042 |
| 39 | Ga0068868_100235512 | 3300005338 | Bacteria | 1537 |
| 40 | Ga0068868_100244098 | 3300005338 | Bacteria | 1510 |
| 41 | Ga0068868_100695734 | 3300005338 | Bacteria | 909 |
| 42 | Ga0068868_100968036 | 3300005338 | Bacteria | 777 |
| 43 | Ga0070660_100019074 | 3300005339 | Bacteria | 5020 |
| 44 | Ga0070660_100355169 | 3300005339 | Bacteria | 1207 |
| 45 | Ga0070660_100436774 | 3300005339 | Bacteria | 1085 |
| 46 | Ga0070689_100021710 | 3300005340 | Bacteria | 4785 |
| 47 | Ga0070689_100124190 | 3300005340 | Bacteria | 2064 |
| 48 | Ga0070689_100190030 | 3300005340 | Bacteria | 1672 |
| 49 | Ga0070661_100010686 | 3300005344 | Bacteria | 6387 |
| 50 | Ga0070661_100053245 | 3300005344 | Unclassified | 2961 |
| 51 | Ga0070661_100418491 | 3300005344 | Bacteria | 1062 |
| 52 | Ga0070692_10001104 | 3300005345 | Bacteria | 9415 |
| 53 | Ga0070692_10004482 | 3300005345 | Bacteria | 5844 |
| 54 | Ga0070668_100003120 | 3300005347 | Bacteria | 12241 |
| 55 | Ga0070668_100120598 | 3300005347 | Bacteria | 2095 |
| 56 | Ga0070668_100228205 | 3300005347 | Bacteria | 1538 |
| 57 | Ga0070669_100017307 | 3300005353 | Bacteria | 5142 |
| 58 | Ga0070669_100030647 | 3300005353 | Bacteria | 3882 |
| 59 | Ga0070669_100097584 | 3300005353 | Bacteria | 2212 |
| 60 | Ga0070675_100000007 | 3300005354 | Bacteria | 263394 |
| 61 | Ga0070675_100036517 | 3300005354 | Bacteria | 3999 |
| 62 | Ga0070671_100778352 | 3300005355 | Bacteria | 832 |
| 63 | Ga0070674_100415638 | 3300005356 | Unclassified | 1102 |
| 64 | Ga0070673_100034873 | 3300005364 | Bacteria | 3812 |
| 65 | Ga0070673_100079521 | 3300005364 | Unclassified | 2655 |
| 66 | Ga0070673_100207463 | 3300005364 | Unclassified | 1690 |
| 67 | Ga0070673_100697288 | 3300005364 | Bacteria | 932 |
| 68 | Ga0070673_100705998 | 3300005364 | Bacteria | 926 |
| 69 | Ga0070688_100229472 | 3300005365 | Bacteria | 1312 |
| 70 | Ga0070659_100010189 | 3300005366 | Bacteria | 6915 |
| 71 | Ga0070659_100117793 | 3300005366 | Bacteria | 2148 |
| 72 | Ga0070667_100045119 | 3300005367 | Unclassified | 3705 |
| 73 | Ga0070667_100096799 | 3300005367 | Bacteria | 2545 |
| 74 | Ga0070667_100191169 | 3300005367 | Bacteria | 1813 |
| 75 | Ga0070667_100436951 | 3300005367 | Bacteria | 1195 |
| 76 | Ga0070703_10000427 | 3300005406 | Bacteria | 17206 |
| 77 | Ga0070703_10077638 | 3300005406 | Bacteria | 1123 |
| 78 | Ga0070703_10248062 | 3300005406 | Bacteria | 721 |
| 79 | Ga0070703_10349908 | 3300005406 | Bacteria | 630 |
| 80 | Ga0070709_10009375 | 3300005434 | Bacteria | 5398 |
| 81 | Ga0070709_10136421 | 3300005434 | Bacteria | 1681 |
| 82 | Ga0070709_10471596 | 3300005434 | Bacteria | 949 |
| 83 | Ga0070714_100004105 | 3300005435 | Bacteria | 10951 |
| 84 | Ga0070714_100019115 | 3300005435 | Bacteria | 5577 |
| 85 | Ga0070713_100009715 | 3300005436 | Bacteria | 6909 |
| 86 | Ga0070713_100403549 | 3300005436 | Bacteria | 1277 |
| 87 | Ga0070713_100447613 | 3300005436 | Bacteria | 1212 |
| 88 | Ga0070713_101247721 | 3300005436 | Bacteria | 720 |
| 89 | Ga0070713_101432516 | 3300005436 | Bacteria | 670 |
| 90 | Ga0070710_10010725 | 3300005437 | Bacteria | 4505 |
| 91 | Ga0070710_10029534 | 3300005437 | Bacteria | 2942 |
| 92 | Ga0070710_10090324 | 3300005437 | Bacteria | 1805 |
| 93 | Ga0070710_10666943 | 3300005437 | Bacteria | 731 |
| 94 | Ga0070701_10003059 | 3300005438 | Bacteria | 6557 |
| 95 | Ga0070701_10188587 | 3300005438 | Bacteria | 1212 |
| 96 | Ga0070701_10500755 | 3300005438 | Bacteria | 789 |
| 97 | Ga0070711_100033377 | 3300005439 | Bacteria | 3427 |
| 98 | Ga0070711_100046997 | 3300005439 | Bacteria | 2944 |
| 99 | Ga0070711_100294410 | 3300005439 | Bacteria | 1288 |
| 100 | Ga0070711_100677303 | 3300005439 | Bacteria | 867 |
| 101 | Ga0070711_100812563 | 3300005439 | Bacteria | 794 |
| 102 | Ga0070705_100029752 | 3300005440 | Bacteria | 3008 |
| 103 | Ga0070700_100079746 | 3300005441 | Bacteria | 2111 |
| 104 | Ga0070700_100195828 | 3300005441 | Bacteria | 1416 |
| 105 | Ga0070700_100278482 | 3300005441 | Bacteria | 1212 |
| 106 | Ga0070700_100580821 | 3300005441 | Bacteria | 875 |
| 107 | Ga0070700_100583576 | 3300005441 | Bacteria | 873 |
| 108 | Ga0070694_100001132 | 3300005444 | Bacteria | 15284 |
| 109 | Ga0070694_100004904 | 3300005444 | Bacteria | 8062 |
| 110 | Ga0070694_100038571 | 3300005444 | Unclassified | 3175 |
| 111 | Ga0070694_100093403 | 3300005444 | Bacteria | 2115 |
| 112 | Ga0070708_100146203 | 3300005445 | Bacteria | 2196 |
| 113 | Ga0070708_100337407 | 3300005445 | Bacteria | 1420 |
| 114 | Ga0070708_100388002 | 3300005445 | Bacteria | 1317 |
| 115 | Ga0070708_100516085 | 3300005445 | Bacteria | 1127 |
| 116 | Ga0070708_101469904 | 3300005445 | Bacteria | 635 |
| 117 | Ga0070663_100100368 | 3300005455 | Bacteria | 2159 |
| 118 | Ga0070663_101290746 | 3300005455 | Bacteria | 644 |
| 119 | Ga0070662_100138944 | 3300005457 | Bacteria | 1881 |
| 120 | Ga0070662_100256012 | 3300005457 | Unclassified | 1409 |
| 121 | Ga0070662_100575853 | 3300005457 | Bacteria | 945 |
| 122 | Ga0070662_100679972 | 3300005457 | Bacteria | 870 |
| 123 | Ga0070681_10047524 | 3300005458 | Bacteria | 4290 |
| 124 | Ga0070681_10287200 | 3300005458 | Bacteria | 1555 |
| 125 | Ga0070681_10303539 | 3300005458 | Bacteria | 1506 |
| 126 | Ga0070681_10312633 | 3300005458 | Bacteria | 1480 |
| 127 | Ga0068867_100022477 | 3300005459 | Bacteria | 4510 |
| 128 | Ga0068867_100058565 | 3300005459 | Bacteria | 2855 |
| 129 | Ga0068867_100068643 | 3300005459 | Bacteria | 2646 |
| 130 | Ga0068867_100403028 | 3300005459 | Bacteria | 1154 |
| 131 | Ga0068867_101249685 | 3300005459 | Bacteria | 684 |
| 132 | Ga0070685_10027522 | 3300005466 | Bacteria | 3143 |
| 133 | Ga0070685_10179176 | 3300005466 | Bacteria | 1363 |
| 134 | Ga0070706_100005771 | 3300005467 | Bacteria | 11760 |
| 135 | Ga0070706_100021749 | 3300005467 | Bacteria | 5905 |
| 136 | Ga0070706_100160143 | 3300005467 | Bacteria | 2101 |
| 137 | Ga0070706_100290494 | 3300005467 | Bacteria | 1526 |
| 138 | Ga0070706_100308008 | 3300005467 | Bacteria | 1477 |
| 139 | Ga0070706_100381803 | 3300005467 | Bacteria | 1312 |
| 140 | Ga0070706_100394110 | 3300005467 | Unclassified | 1289 |
| 141 | Ga0070707_100000343 | 3300005468 | Bacteria | 45816 |
| 142 | Ga0070707_100006596 | 3300005468 | Bacteria | 10769 |
| 143 | Ga0070707_100008651 | 3300005468 | Bacteria | 9448 |
| 144 | Ga0070707_100012600 | 3300005468 | Bacteria | 7898 |
| 145 | Ga0070707_100081504 | 3300005468 | Bacteria | 3124 |
| 146 | Ga0070707_100296630 | 3300005468 | Unclassified | 1571 |
| 147 | Ga0070707_101091800 | 3300005468 | Bacteria | 764 |
| 148 | Ga0070707_101106659 | 3300005468 | Bacteria | 758 |
| 149 | Ga0070707_101344140 | 3300005468 | Bacteria | 681 |
| 150 | Ga0070698_100000084 | 3300005471 | Bacteria | 73239 |
| 151 | Ga0070698_100013686 | 3300005471 | Bacteria | 8589 |
| 152 | Ga0070698_100029263 | 3300005471 | Bacteria | 5716 |
| 153 | Ga0070698_100039432 | 3300005471 | Bacteria | 4862 |
| 154 | Ga0070698_100039505 | 3300005471 | Bacteria | 4857 |
| 155 | Ga0070698_100064533 | 3300005471 | Bacteria | 3689 |
| 156 | Ga0070698_100172142 | 3300005471 | Bacteria | 2106 |
| 157 | Ga0070698_100495468 | 3300005471 | Bacteria | 1159 |
| 158 | Ga0070698_100780400 | 3300005471 | Bacteria | 899 |
| 159 | Ga0070699_100038276 | 3300005518 | Bacteria | 4152 |
| 160 | Ga0070699_100077781 | 3300005518 | Unclassified | 2888 |
| 161 | Ga0070699_100098833 | 3300005518 | Bacteria | 2557 |
| 162 | Ga0070699_100124595 | 3300005518 | Bacteria | 2268 |
| 163 | Ga0070699_100171924 | 3300005518 | Unclassified | 1920 |
| 164 | Ga0070699_100242768 | 3300005518 | Bacteria | 1608 |
| 165 | Ga0070679_100030062 | 3300005530 | Bacteria | 5361 |
| 166 | Ga0070679_100153303 | 3300005530 | Bacteria | 2280 |
| 167 | Ga0070684_100006540 | 3300005535 | Bacteria | 9022 |
| 168 | Ga0070684_101085047 | 3300005535 | Bacteria | 752 |
| 169 | Ga0070697_100002003 | 3300005536 | Bacteria | 15614 |
| 170 | Ga0070697_100030441 | 3300005536 | Bacteria | 4336 |
| 171 | Ga0070697_100183374 | 3300005536 | Bacteria | 1775 |
| 172 | Ga0070697_100250256 | 3300005536 | Bacteria | 1515 |
| 173 | Ga0070697_100365617 | 3300005536 | Unclassified | 1248 |
| 174 | Ga0070697_100936537 | 3300005536 | Bacteria | 769 |
| 175 | Ga0068853_100010446 | 3300005539 | Bacteria | 7515 |
| 176 | Ga0068853_100016886 | 3300005539 | Bacteria | 6015 |
| 177 | Ga0068853_100325030 | 3300005539 | Bacteria | 1427 |
| 178 | Ga0068853_100330010 | 3300005539 | Bacteria | 1415 |
| 179 | Ga0068853_100562825 | 3300005539 | Bacteria | 1081 |
| 180 | Ga0070672_100057049 | 3300005543 | Bacteria | 3065 |
| 181 | Ga0070686_100002184 | 3300005544 | Bacteria | 10801 |
| 182 | Ga0070686_100038213 | 3300005544 | Bacteria | 2983 |
| 183 | Ga0070686_100188740 | 3300005544 | Bacteria | 1470 |
| 184 | Ga0070686_100276720 | 3300005544 | Bacteria | 1236 |
| 185 | Ga0070695_100073003 | 3300005545 | Bacteria | 2251 |
| 186 | Ga0070695_100104477 | 3300005545 | Bacteria | 1913 |
| 187 | Ga0070695_100117228 | 3300005545 | Bacteria | 1817 |
| 188 | Ga0070695_100136229 | 3300005545 | Bacteria | 1698 |
| 189 | Ga0070695_100239366 | 3300005545 | Bacteria | 1316 |
| 190 | Ga0070695_100408605 | 3300005545 | Bacteria | 1031 |
| 191 | Ga0070695_100584665 | 3300005545 | Bacteria | 875 |
| 192 | Ga0070696_100012751 | 3300005546 | Bacteria | 5644 |
| 193 | Ga0070696_100033599 | 3300005546 | Bacteria | 3525 |
| 194 | Ga0070696_100062295 | 3300005546 | Bacteria | 2610 |
| 195 | Ga0070696_100498617 | 3300005546 | Unclassified | 968 |
| 196 | Ga0070693_100042808 | 3300005547 | Bacteria | 2554 |
| 197 | Ga0070693_100261023 | 3300005547 | Bacteria | 1152 |
| 198 | Ga0070693_100312066 | 3300005547 | Bacteria | 1064 |
| 199 | Ga0070665_100015455 | 3300005548 | Bacteria | 7667 |
| 200 | Ga0070665_100039969 | 3300005548 | Bacteria | 4716 |
| 201 | Ga0070665_100212960 | 3300005548 | Bacteria | 1933 |
| 202 | Ga0070704_100058068 | 3300005549 | Unclassified | 2755 |
| 203 | Ga0070704_100078530 | 3300005549 | Bacteria | 2422 |
| 204 | Ga0070704_100139413 | 3300005549 | Bacteria | 1891 |
| 205 | Ga0070704_100142767 | 3300005549 | Unclassified | 1872 |
| 206 | Ga0070704_100158890 | 3300005549 | Bacteria | 1786 |
| 207 | Ga0070704_100683494 | 3300005549 | Unclassified | 909 |
| 208 | Ga0068855_100002256 | 3300005563 | Bacteria | 23806 |
| 209 | Ga0068855_100021979 | 3300005563 | Bacteria | 7648 |
| 210 | Ga0068855_100135013 | 3300005563 | Bacteria | 2815 |
| 211 | Ga0068855_101171064 | 3300005563 | Bacteria | 800 |
| 212 | Ga0070664_100005841 | 3300005564 | Bacteria | 9927 |
| 213 | Ga0070664_100108268 | 3300005564 | Unclassified | 2423 |
| 214 | Ga0070664_100361144 | 3300005564 | Bacteria | 1323 |
| 215 | Ga0070664_100383001 | 3300005564 | Bacteria | 1284 |
| 216 | Ga0068857_100084727 | 3300005577 | Bacteria | 2832 |
| 217 | Ga0068857_100233814 | 3300005577 | Bacteria | 1681 |
| 218 | Ga0068857_101166759 | 3300005577 | Bacteria | 745 |
| 219 | Ga0068854_100831891 | 3300005578 | Bacteria | 807 |
| 220 | Ga0068856_100040989 | 3300005614 | Bacteria | 4549 |
| 221 | Ga0068856_100073064 | 3300005614 | Bacteria | 3396 |
| 222 | Ga0070702_100076187 | 3300005615 | Bacteria | 1996 |
| 223 | Ga0070702_100160357 | 3300005615 | Bacteria | 1453 |
| 224 | Ga0068852_100384633 | 3300005616 | Bacteria | 1377 |
| 225 | Ga0068852_100491550 | 3300005616 | Bacteria | 1221 |
| 226 | Ga0068852_100719697 | 3300005616 | Bacteria | 1009 |
| 227 | Ga0068859_100006061 | 3300005617 | Bacteria | 12276 |
| 228 | Ga0068859_100020360 | 3300005617 | Bacteria | 6660 |
| 229 | Ga0068859_100052938 | 3300005617 | Bacteria | 4082 |
| 230 | Ga0068859_100117976 | 3300005617 | Bacteria | 2719 |
| 231 | Ga0068859_100609037 | 3300005617 | Bacteria | 1185 |
| 232 | Ga0068864_100000349 | 3300005618 | Bacteria | 40495 |
| 233 | Ga0068864_100017558 | 3300005618 | Bacteria | 5965 |
| 234 | Ga0068864_100018412 | 3300005618 | Bacteria | 5835 |
| 235 | Ga0068864_100053223 | 3300005618 | Bacteria | 3491 |
| 236 | Ga0068864_100155076 | 3300005618 | Bacteria | 2078 |
| 237 | Ga0068864_100195967 | 3300005618 | Bacteria | 1853 |
| 238 | Ga0068864_100494591 | 3300005618 | Bacteria | 1176 |
| 239 | Ga0068866_10000684 | 3300005718 | Bacteria | 15437 |
| 240 | Ga0068866_10781779 | 3300005718 | Bacteria | 662 |
| 241 | Ga0068861_100069342 | 3300005719 | Bacteria | 2727 |
| 242 | Ga0068861_100084086 | 3300005719 | Bacteria | 2498 |
| 243 | Ga0068861_100283062 | 3300005719 | Bacteria | 1429 |
| 244 | Ga0068861_100411943 | 3300005719 | Bacteria | 1202 |
| 245 | Ga0068861_100862671 | 3300005719 | Bacteria | 854 |
| 246 | Ga0068851_10045673 | 3300005834 | Unclassified | 2214 |
| 247 | Ga0068851_10291239 | 3300005834 | Bacteria | 936 |
| 248 | Ga0068870_10030357 | 3300005840 | Bacteria | 2731 |
| 249 | Ga0068870_10277622 | 3300005840 | Bacteria | 1049 |
| 250 | Ga0068863_100050660 | 3300005841 | Bacteria | 3935 |
| 251 | Ga0068863_100104622 | 3300005841 | Bacteria | 2693 |
| 252 | Ga0068863_100218686 | 3300005841 | Bacteria | 1835 |
| 253 | Ga0068863_100282278 | 3300005841 | Bacteria | 1609 |
| 254 | Ga0068863_100335315 | 3300005841 | Bacteria | 1471 |
| 255 | Ga0068863_100525482 | 3300005841 | Bacteria | 1167 |
| 256 | Ga0068863_100871902 | 3300005841 | Bacteria | 900 |
| 257 | Ga0068863_101271023 | 3300005841 | Bacteria | 743 |
| 258 | Ga0068863_101362902 | 3300005841 | Bacteria | 717 |
| 259 | Ga0068863_101866298 | 3300005841 | Bacteria | 611 |
| 260 | Ga0068858_100030046 | 3300005842 | Bacteria | 5045 |
| 261 | Ga0068858_100043268 | 3300005842 | Bacteria | 4176 |
| 262 | Ga0068858_100060954 | 3300005842 | Bacteria | 3487 |
| 263 | Ga0068858_100129609 | 3300005842 | Bacteria | 2364 |
| 264 | Ga0068858_100241418 | 3300005842 | Unclassified | 1714 |
| 265 | Ga0068858_100466781 | 3300005842 | Bacteria | 1217 |
| 266 | Ga0068858_100545114 | 3300005842 | Bacteria | 1123 |
| 267 | Ga0068858_100660916 | 3300005842 | Bacteria | 1016 |
| 268 | Ga0068858_100958323 | 3300005842 | Bacteria | 838 |
| 269 | Ga0068860_100036229 | 3300005843 | Bacteria | 4728 |
| 270 | Ga0068860_100108998 | 3300005843 | Bacteria | 2646 |
| 271 | Ga0068860_100129513 | 3300005843 | Bacteria | 2421 |
| 272 | Ga0068860_100138962 | 3300005843 | Bacteria | 2334 |
| 273 | Ga0068860_100173905 | 3300005843 | Bacteria | 2081 |
| 274 | Ga0068860_100227613 | 3300005843 | Bacteria | 1812 |
| 275 | Ga0068860_100630527 | 3300005843 | Bacteria | 1079 |
| 276 | Ga0068860_101059429 | 3300005843 | Bacteria | 830 |
| 277 | Ga0068862_100003143 | 3300005844 | Bacteria | 14358 |
| 278 | Ga0068862_100019818 | 3300005844 | Bacteria | 5616 |
| 279 | Ga0068862_100063574 | 3300005844 | Bacteria | 3175 |
| 280 | Ga0081455_10015866 | 3300005937 | Bacteria | 7294 |
| 281 | Ga0081538_10000746 | 3300005981 | Bacteria | 35470 |
| 282 | Ga0081540_1071335 | 3300005983 | Unclassified | 1605 |
| 283 | Ga0081539_10004359 | 3300005985 | Bacteria | 15776 |
| 284 | Ga0081539_10033236 | 3300005985 | Bacteria | 3145 |
| 285 | Ga0081539_10048025 | 3300005985 | Bacteria | 2431 |
| 286 | Ga0070717_10007950 | 3300006028 | Bacteria | 7898 |
| 287 | Ga0070717_10451231 | 3300006028 | Bacteria | 1159 |
| 288 | Ga0075364_10046502 | 3300006051 | Bacteria | 2826 |
| 289 | Ga0070715_10000038 | 3300006163 | Bacteria | 67091 |
| 290 | Ga0070716_100000006 | 3300006173 | Bacteria | 268067 |
| 291 | Ga0070716_100105842 | 3300006173 | Bacteria | 1734 |
| 292 | Ga0070716_100112969 | 3300006173 | Bacteria | 1687 |
| 293 | Ga0070716_100137550 | 3300006173 | Bacteria | 1553 |
| 294 | Ga0070716_100333897 | 3300006173 | Bacteria | 1067 |
| 295 | Ga0070716_100466167 | 3300006173 | Bacteria | 924 |
| 296 | Ga0070716_100803972 | 3300006173 | Bacteria | 728 |
| 297 | Ga0070712_100018095 | 3300006175 | Bacteria | 4570 |
| 298 | Ga0070712_100075018 | 3300006175 | Bacteria | 2431 |
| 299 | Ga0070712_100841590 | 3300006175 | Bacteria | 789 |
| 300 | Ga0075366_10018157 | 3300006195 | Bacteria | 4061 |
| 301 | Ga0097621_100033934 | 3300006237 | Bacteria | 4068 |
| 302 | Ga0097621_100148746 | 3300006237 | Bacteria | 2007 |
| 303 | Ga0097621_100267095 | 3300006237 | Bacteria | 1502 |
| 304 | Ga0097621_100314685 | 3300006237 | Bacteria | 1385 |
| 305 | Ga0097621_100390168 | 3300006237 | Bacteria | 1245 |
| 306 | Ga0097621_100537624 | 3300006237 | Bacteria | 1062 |
| 307 | Ga0097621_100602095 | 3300006237 | Bacteria | 1004 |
| 308 | Ga0075370_10103706 | 3300006353 | Bacteria | 1648 |
| 309 | Ga0068871_100019563 | 3300006358 | Bacteria | 5171 |
| 310 | Ga0068871_100193630 | 3300006358 | Bacteria | 1752 |
| 311 | Ga0068871_100253749 | 3300006358 | Bacteria | 1532 |
| 312 | Ga0068871_100425472 | 3300006358 | Bacteria | 1186 |
| 313 | Ga0068871_100544580 | 3300006358 | Bacteria | 1050 |
| 314 | Ga0068871_100600343 | 3300006358 | Bacteria | 1001 |
| 315 | Ga0075428_100090316 | 3300006844 | Bacteria | 3341 |
| 316 | Ga0075428_100594780 | 3300006844 | Bacteria | 1182 |
| 317 | Ga0075428_101135833 | 3300006844 | Bacteria | 825 |
| 318 | Ga0075430_100048234 | 3300006846 | Bacteria | 3595 |
| 319 | Ga0075430_100289235 | 3300006846 | Bacteria | 1356 |
| 320 | Ga0075431_100006546 | 3300006847 | Bacteria | 11573 |
| 321 | Ga0075431_100012451 | 3300006847 | Bacteria | 8585 |
| 322 | Ga0075431_100062412 | 3300006847 | Bacteria | 3845 |
| 323 | Ga0075433_10117851 | 3300006852 | Unclassified | 2356 |
| 324 | Ga0075433_10196766 | 3300006852 | Bacteria | 1793 |
| 325 | Ga0075433_10218906 | 3300006852 | Bacteria | 1691 |
| 326 | Ga0075433_10910508 | 3300006852 | Bacteria | 767 |
| 327 | Ga0075434_100014841 | 3300006871 | Bacteria | 7452 |
| 328 | Ga0075434_100108899 | 3300006871 | Bacteria | 2780 |
| 329 | Ga0075434_100135556 | 3300006871 | Bacteria | 2481 |
| 330 | Ga0075434_100147155 | 3300006871 | Bacteria | 2376 |
| 331 | Ga0075434_100149590 | 3300006871 | Bacteria | 2355 |
| 332 | Ga0075434_100311101 | 3300006871 | Bacteria | 1595 |
| 333 | Ga0075434_100980111 | 3300006871 | Bacteria | 859 |
| 334 | Ga0075434_101034042 | 3300006871 | Bacteria | 835 |
| 335 | Ga0075429_100043278 | 3300006880 | Bacteria | 3918 |
| 336 | Ga0075429_100053365 | 3300006880 | Bacteria | 3518 |
| 337 | Ga0075429_100116740 | 3300006880 | Bacteria | 2333 |
| 338 | Ga0075429_100192614 | 3300006880 | Bacteria | 1786 |
| 339 | Ga0075429_100603236 | 3300006880 | Bacteria | 962 |
| 340 | Ga0075429_100667185 | 3300006880 | Bacteria | 911 |
| 341 | Ga0068865_100042984 | 3300006881 | Bacteria | 3085 |
| 342 | Ga0068865_100113414 | 3300006881 | Bacteria | 2003 |
| 343 | Ga0068865_100114113 | 3300006881 | Bacteria | 1998 |
| 344 | Ga0068865_100349059 | 3300006881 | Bacteria | 1198 |
| 345 | Ga0075436_100000017 | 3300006914 | Bacteria | 151066 |
| 346 | Ga0075436_100098077 | 3300006914 | Bacteria | 2039 |
| 347 | Ga0097620_100006061 | 3300006931 | Bacteria | 12276 |
| 348 | Ga0097620_100020360 | 3300006931 | Bacteria | 6660 |
| 349 | Ga0097620_100052942 | 3300006931 | Bacteria | 4082 |
| 350 | Ga0097620_100117967 | 3300006931 | Bacteria | 2719 |
| 351 | Ga0097620_100609021 | 3300006931 | Bacteria | 1185 |
| 352 | Ga0075435_100006806 | 3300007076 | Bacteria | 8112 |
| 353 | Ga0075435_100458777 | 3300007076 | Bacteria | 1099 |
| 354 | Ga0075435_100773302 | 3300007076 | Unclassified | 836 |
| 355 | Ga0075435_100943304 | 3300007076 | Bacteria | 753 |
| 356 | Ga0099794_10157532 | 3300007265 | Bacteria | 1154 |
| 357 | Ga0105251_10107438 | 3300009011 | Bacteria | 1273 |
| 358 | Ga0105244_10011650 | 3300009036 | Bacteria | 5253 |
| 359 | Ga0105244_10351770 | 3300009036 | Bacteria | 679 |
| 360 | Ga0105240_10127569 | 3300009093 | Bacteria | 3055 |
| 361 | Ga0105240_11218503 | 3300009093 | Bacteria | 796 |
| 362 | Ga0111539_10000022 | 3300009094 | Bacteria | 240838 |
| 363 | Ga0111539_10005702 | 3300009094 | Bacteria | 16116 |
| 364 | Ga0111539_10047047 | 3300009094 | Bacteria | 5158 |
| 365 | Ga0111539_12530333 | 3300009094 | Bacteria | 595 |
| 366 | Ga0105245_10001507 | 3300009098 | Bacteria | 21079 |
| 367 | Ga0105245_10027267 | 3300009098 | Bacteria | 5034 |
| 368 | Ga0105245_10067426 | 3300009098 | Bacteria | 3241 |
| 369 | Ga0105245_10133819 | 3300009098 | Bacteria | 2328 |
| 370 | Ga0105245_10234129 | 3300009098 | Bacteria | 1778 |
| 371 | Ga0105245_10344030 | 3300009098 | Bacteria | 1476 |
| 372 | Ga0105245_10498453 | 3300009098 | Bacteria | 1234 |
| 373 | Ga0105247_10142791 | 3300009101 | Bacteria | 1570 |
| 374 | Ga0114129_10001417 | 3300009147 | Bacteria | 32326 |
| 375 | Ga0114129_10023849 | 3300009147 | Bacteria | 8670 |
| 376 | Ga0114129_10063914 | 3300009147 | Bacteria | 5136 |
| 377 | Ga0114129_10237453 | 3300009147 | Bacteria | 2452 |
| 378 | Ga0114129_10254600 | 3300009147 | Bacteria | 2356 |
| 379 | Ga0114129_10425680 | 3300009147 | Bacteria | 1745 |
| 380 | Ga0114129_11058774 | 3300009147 | Bacteria | 1018 |
| 381 | Ga0114129_11194260 | 3300009147 | Bacteria | 948 |
| 382 | Ga0114129_11504603 | 3300009147 | Unclassified | 827 |
| 383 | Ga0105243_10000777 | 3300009148 | Bacteria | 30566 |
| 384 | Ga0105243_10005446 | 3300009148 | Bacteria | 9931 |
| 385 | Ga0105243_10063603 | 3300009148 | Bacteria | 2957 |
| 386 | Ga0105243_10085454 | 3300009148 | Bacteria | 2586 |
| 387 | Ga0105243_10207725 | 3300009148 | Bacteria | 1722 |
| 388 | Ga0105243_10267171 | 3300009148 | Bacteria | 1534 |
| 389 | Ga0105243_10293320 | 3300009148 | Bacteria | 1470 |
| 390 | Ga0105243_10384782 | 3300009148 | Unclassified | 1299 |
| 391 | Ga0105243_10436767 | 3300009148 | Bacteria | 1225 |
| 392 | Ga0105243_10499500 | 3300009148 | Bacteria | 1152 |
| 393 | Ga0105241_10017868 | 3300009174 | Bacteria | 5216 |
| 394 | Ga0105241_10311812 | 3300009174 | Bacteria | 1354 |
| 395 | Ga0105241_10409529 | 3300009174 | Bacteria | 1191 |
| 396 | Ga0105241_10898177 | 3300009174 | Bacteria | 822 |
| 397 | Ga0105242_10001940 | 3300009176 | Bacteria | 16279 |
| 398 | Ga0105242_10003416 | 3300009176 | Bacteria | 12345 |
| 399 | Ga0105242_10065108 | 3300009176 | Bacteria | 3006 |
| 400 | Ga0105242_10092929 | 3300009176 | Bacteria | 2542 |
| 401 | Ga0105242_10178219 | 3300009176 | Bacteria | 1873 |
| 402 | Ga0105242_10376498 | 3300009176 | Bacteria | 1318 |
| 403 | Ga0105242_10377915 | 3300009176 | Bacteria | 1316 |
| 404 | Ga0105242_10377916 | 3300009176 | Bacteria | 1316 |
| 405 | Ga0105242_10520208 | 3300009176 | Bacteria | 1135 |
| 406 | Ga0105248_10004070 | 3300009177 | Bacteria | 16159 |
| 407 | Ga0105248_10129876 | 3300009177 | Bacteria | 2842 |
| 408 | Ga0105248_10138301 | 3300009177 | Bacteria | 2747 |
| 409 | Ga0105248_10438568 | 3300009177 | Bacteria | 1471 |
| 410 | Ga0105248_10611825 | 3300009177 | Bacteria | 1229 |
| 411 | Ga0105248_10886601 | 3300009177 | Bacteria | 1007 |
| 412 | Ga0105237_10047955 | 3300009545 | Bacteria | 4295 |
| 413 | Ga0105237_10239542 | 3300009545 | Bacteria | 1815 |
| 414 | Ga0105237_10284777 | 3300009545 | Bacteria | 1655 |
| 415 | Ga0105237_10721327 | 3300009545 | Bacteria | 1003 |
| 416 | Ga0105237_11443511 | 3300009545 | Bacteria | 694 |
| 417 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 418 | Ga0105238_10013909 | 3300009551 | Bacteria | 8139 |
| 419 | Ga0105238_10094337 | 3300009551 | Bacteria | 2980 |
| 420 | Ga0105238_10880654 | 3300009551 | Bacteria | 913 |
| 421 | Ga0105249_10000118 | 3300009553 | Bacteria | 107887 |
| 422 | Ga0105249_10007788 | 3300009553 | Bacteria | 9333 |
| 423 | Ga0105249_10089304 | 3300009553 | Bacteria | 2880 |
| 424 | Ga0105249_10121147 | 3300009553 | Bacteria | 2486 |
| 425 | Ga0105249_10945772 | 3300009553 | Bacteria | 929 |
| 426 | Ga0099796_10045790 | 3300010159 | Bacteria | 1499 |
| 427 | Ga0105239_10034574 | 3300010375 | Bacteria | 5550 |
| 428 | Ga0105239_10442356 | 3300010375 | Bacteria | 1474 |
| 429 | Ga0105239_10592207 | 3300010375 | Bacteria | 1264 |
| 430 | Ga0105246_10195568 | 3300011119 | Bacteria | 1568 |
| 431 | Ga0105246_10552534 | 3300011119 | Bacteria | 987 |
| 432 | Ga0105246_10653548 | 3300011119 | Bacteria | 916 |
| 433 | Ga0105246_10894739 | 3300011119 | Bacteria | 796 |
| 434 | Ga0105246_11139647 | 3300011119 | Bacteria | 714 |
| 435 | Ga0157342_1004951 | 3300012507 | Bacteria | 1206 |
| 436 | Ga0157373_10042642 | 3300013100 | Bacteria | 3243 |
| 437 | Ga0157373_10173913 | 3300013100 | Bacteria | 1515 |
| 438 | Ga0157373_10346517 | 3300013100 | Bacteria | 1059 |
| 439 | Ga0157373_10350626 | 3300013100 | Bacteria | 1053 |
| 440 | Ga0157371_10260026 | 3300013102 | Bacteria | 1251 |
| 441 | Ga0157370_10223850 | 3300013104 | Bacteria | 1742 |
| 442 | Ga0157370_10525608 | 3300013104 | Bacteria | 1086 |
| 443 | Ga0157369_10001943 | 3300013105 | Bacteria | 24887 |
| 444 | Ga0157369_10100872 | 3300013105 | Bacteria | 3077 |
| 445 | Ga0157369_10179579 | 3300013105 | Bacteria | 2227 |
| 446 | Ga0157369_10705100 | 3300013105 | Bacteria | 1039 |
| 447 | Ga0157369_10972711 | 3300013105 | Bacteria | 869 |
| 448 | Ga0157374_10000005 | 3300013296 | Bacteria | 646767 |
| 449 | Ga0157374_10051849 | 3300013296 | Bacteria | 3819 |
| 450 | Ga0157374_10318977 | 3300013296 | Bacteria | 1540 |
| 451 | Ga0157378_10006521 | 3300013297 | Bacteria | 10202 |
| 452 | Ga0157378_10009557 | 3300013297 | Bacteria | 8445 |
| 453 | Ga0157378_10037124 | 3300013297 | Bacteria | 4314 |
| 454 | Ga0157378_10037188 | 3300013297 | Bacteria | 4311 |
| 455 | Ga0157378_10046862 | 3300013297 | Bacteria | 3842 |
| 456 | Ga0157378_10061822 | 3300013297 | Bacteria | 3343 |
| 457 | Ga0157378_10174597 | 3300013297 | Bacteria | 2018 |
| 458 | Ga0157378_10229478 | 3300013297 | Bacteria | 1768 |
| 459 | Ga0157378_10286085 | 3300013297 | Bacteria | 1591 |
| 460 | Ga0157378_10291716 | 3300013297 | Bacteria | 1576 |
| 461 | Ga0157378_10386132 | 3300013297 | Bacteria | 1376 |
| 462 | Ga0157378_10951745 | 3300013297 | Bacteria | 891 |
| 463 | Ga0157378_11200549 | 3300013297 | Bacteria | 798 |
| 464 | Ga0157378_11749776 | 3300013297 | Bacteria | 669 |
| 465 | Ga0163162_10000059 | 3300013306 | Bacteria | 107864 |
| 466 | Ga0163162_10002962 | 3300013306 | Bacteria | 16203 |
| 467 | Ga0163162_10042501 | 3300013306 | Bacteria | 4549 |
| 468 | Ga0163162_10097255 | 3300013306 | Bacteria | 3032 |
| 469 | Ga0163162_10171154 | 3300013306 | Bacteria | 2296 |
| 470 | Ga0163162_10177522 | 3300013306 | Bacteria | 2255 |
| 471 | Ga0163162_10432255 | 3300013306 | Bacteria | 1449 |
| 472 | Ga0163162_10526900 | 3300013306 | Bacteria | 1311 |
| 473 | Ga0163162_10749810 | 3300013306 | Bacteria | 1096 |
| 474 | Ga0163162_10769470 | 3300013306 | Bacteria | 1081 |
| 475 | Ga0163162_10853200 | 3300013306 | Bacteria | 1026 |
| 476 | Ga0163162_11101503 | 3300013306 | Bacteria | 900 |
| 477 | Ga0163162_11533232 | 3300013306 | Bacteria | 759 |
| 478 | Ga0157372_10106460 | 3300013307 | Bacteria | 3207 |
| 479 | Ga0157372_10229816 | 3300013307 | Bacteria | 2150 |
| 480 | Ga0157372_11016823 | 3300013307 | Bacteria | 960 |
| 481 | Ga0157375_10000055 | 3300013308 | Bacteria | 126704 |
| 482 | Ga0157375_10001006 | 3300013308 | Bacteria | 24369 |
| 483 | Ga0157375_10023497 | 3300013308 | Bacteria | 5690 |
| 484 | Ga0157375_10071083 | 3300013308 | Bacteria | 3492 |
| 485 | Ga0157375_10103709 | 3300013308 | Bacteria | 2931 |
| 486 | Ga0157375_10150736 | 3300013308 | Bacteria | 2460 |
| 487 | Ga0157375_10312790 | 3300013308 | Bacteria | 1735 |
| 488 | Ga0157375_11166179 | 3300013308 | Unclassified | 903 |
| 489 | Ga0163163_10007538 | 3300014325 | Bacteria | 9607 |
| 490 | Ga0163163_10139116 | 3300014325 | Bacteria | 2470 |
| 491 | Ga0163163_10139935 | 3300014325 | Bacteria | 2462 |
| 492 | Ga0163163_10644357 | 3300014325 | Bacteria | 1123 |
| 493 | Ga0163163_10753571 | 3300014325 | Bacteria | 1037 |
| 494 | Ga0163163_10873696 | 3300014325 | Bacteria | 962 |
| 495 | Ga0163163_11393216 | 3300014325 | Bacteria | 763 |
| 496 | Ga0163163_11977087 | 3300014325 | Bacteria | 643 |
| 497 | Ga0157380_10015819 | 3300014326 | Bacteria | 5550 |
| 498 | Ga0157380_10034625 | 3300014326 | Bacteria | 3896 |
| 499 | Ga0157380_10095902 | 3300014326 | Bacteria | 2458 |
| 500 | Ga0157380_10425170 | 3300014326 | Bacteria | 1268 |
| 501 | Ga0157380_11068164 | 3300014326 | Bacteria | 845 |
| 502 | Ga0157377_10000001 | 3300014745 | Bacteria | 623098 |
| 503 | Ga0157377_10031186 | 3300014745 | Bacteria | 2895 |
| 504 | Ga0157379_10043447 | 3300014968 | Bacteria | 4012 |
| 505 | Ga0157379_10083913 | 3300014968 | Bacteria | 2856 |
| 506 | Ga0157379_10194166 | 3300014968 | Bacteria | 1835 |
| 507 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 508 | Ga0157376_10242205 | 3300014969 | Bacteria | 1681 |
| 509 | Ga0157376_10264543 | 3300014969 | Bacteria | 1613 |
| 510 | Ga0157376_10485347 | 3300014969 | Bacteria | 1211 |
| 511 | Ga0157376_11034652 | 3300014969 | Bacteria | 845 |
| 512 | Ga0157376_11069613 | 3300014969 | Bacteria | 832 |
| 513 | Ga0163161_10019647 | 3300017792 | Unclassified | 4739 |
| 514 | Ga0163161_10060636 | 3300017792 | Bacteria | 2753 |
| 515 | Ga0163161_10239116 | 3300017792 | Bacteria | 1412 |
| 516 | Ga0163161_10308965 | 3300017792 | Unclassified | 1247 |
| 517 | Ga0163161_10358773 | 3300017792 | Bacteria | 1160 |
| 518 | Ga0197907_10527097 | 3300020069 | Bacteria | 2979 |
| 519 | Ga0197907_11331507 | 3300020069 | Bacteria | 2060 |
| 520 | Ga0206349_1115449 | 3300020075 | Bacteria | 9518 |
| 521 | Ga0206349_1228824 | 3300020075 | Bacteria | 2459 |
| 522 | Ga0206351_10098839 | 3300020077 | Bacteria | 1971 |
| 523 | Ga0206351_10905449 | 3300020077 | Bacteria | 1356 |
| 524 | Ga0206352_10193538 | 3300020078 | Bacteria | 21551 |
| 525 | Ga0206350_10234328 | 3300020080 | Bacteria | 18042 |
| 526 | Ga0206350_10325577 | 3300020080 | Bacteria | 21530 |
| 527 | Ga0206350_10574257 | 3300020080 | Bacteria | 3570 |
| 528 | Ga0213873_10000553 | 3300021358 | Bacteria | 6058 |
| 529 | Ga0213873_10005028 | 3300021358 | Bacteria | 2508 |
| 530 | Ga0213873_10199168 | 3300021358 | Bacteria | 621 |
| 531 | Ga0213874_10000313 | 3300021377 | Bacteria | 9595 |
| 532 | Ga0213874_10048447 | 3300021377 | Bacteria | 1296 |
| 533 | Ga0213876_10000009 | 3300021384 | Bacteria | 496136 |
| 534 | Ga0213876_10000058 | 3300021384 | Bacteria | 134080 |
| 535 | Ga0213876_10017136 | 3300021384 | Bacteria | 3825 |
| 536 | Ga0213876_10019697 | 3300021384 | Bacteria | 3564 |
| 537 | Ga0213876_10170647 | 3300021384 | Bacteria | 1157 |
| 538 | Ga0213875_10010857 | 3300021388 | Bacteria | 4553 |
| 539 | Ga0213875_10025282 | 3300021388 | Bacteria | 2829 |
| 540 | Ga0213875_10165202 | 3300021388 | Bacteria | 1039 |
| 541 | Ga0213871_10091176 | 3300021441 | Bacteria | 883 |
| 542 | Ga0224712_10000482 | 3300022467 | Bacteria | 7993 |
| 543 | Ga0224712_10010313 | 3300022467 | Bacteria | 2853 |
| 544 | Ga0228598_1001060 | 3300024227 | Bacteria | 6056 |
| 545 | Ga0209257_1056203 | 3300025304 | Bacteria | 1088 |
| 546 | Ga0207656_10055538 | 3300025321 | Unclassified | 1724 |
| 547 | Ga0207655_1074984 | 3300025728 | Bacteria | 1242 |
| 548 | Ga0207653_10000033 | 3300025885 | Bacteria | 103535 |
| 549 | Ga0207653_10076248 | 3300025885 | Bacteria | 1153 |
| 550 | Ga0207653_10149279 | 3300025885 | Bacteria | 859 |
| 551 | Ga0207682_10023804 | 3300025893 | Bacteria | 2422 |
| 552 | Ga0207682_10028648 | 3300025893 | Bacteria | 2224 |
| 553 | Ga0207692_10004608 | 3300025898 | Bacteria | 5467 |
| 554 | Ga0207642_10022056 | 3300025899 | Bacteria | 2518 |
| 555 | Ga0207642_10385765 | 3300025899 | Bacteria | 835 |
| 556 | Ga0207710_10519746 | 3300025900 | Bacteria | 619 |
| 557 | Ga0207688_10598914 | 3300025901 | Bacteria | 694 |
| 558 | Ga0207688_10636511 | 3300025901 | Bacteria | 673 |
| 559 | Ga0207685_10000051 | 3300025905 | Bacteria | 39503 |
| 560 | Ga0207699_10008158 | 3300025906 | Bacteria | 5154 |
| 561 | Ga0207699_10026834 | 3300025906 | Bacteria | 3180 |
| 562 | Ga0207699_10072571 | 3300025906 | Bacteria | 2109 |
| 563 | Ga0207699_10168267 | 3300025906 | Bacteria | 1464 |
| 564 | Ga0207699_10268933 | 3300025906 | Bacteria | 1181 |
| 565 | Ga0207699_10365446 | 3300025906 | Bacteria | 1021 |
| 566 | Ga0207645_10359464 | 3300025907 | Bacteria | 975 |
| 567 | Ga0207643_10017199 | 3300025908 | Bacteria | 3950 |
| 568 | Ga0207643_10078505 | 3300025908 | Bacteria | 1910 |
| 569 | Ga0207643_10485184 | 3300025908 | Bacteria | 789 |
| 570 | Ga0207705_10146366 | 3300025909 | Bacteria | 1768 |
| 571 | Ga0207684_10000431 | 3300025910 | Bacteria | 55647 |
| 572 | Ga0207684_10029417 | 3300025910 | Bacteria | 4678 |
| 573 | Ga0207684_10034076 | 3300025910 | Bacteria | 4328 |
| 574 | Ga0207684_10068492 | 3300025910 | Bacteria | 3016 |
| 575 | Ga0207684_10072862 | 3300025910 | Bacteria | 2917 |
| 576 | Ga0207684_10135396 | 3300025910 | Bacteria | 2115 |
| 577 | Ga0207684_10760785 | 3300025910 | Bacteria | 820 |
| 578 | Ga0207684_11169296 | 3300025910 | Unclassified | 638 |
| 579 | Ga0207654_10041690 | 3300025911 | Bacteria | 2594 |
| 580 | Ga0207654_10450739 | 3300025911 | Bacteria | 902 |
| 581 | Ga0207654_11008106 | 3300025911 | Bacteria | 606 |
| 582 | Ga0207707_10018832 | 3300025912 | Bacteria | 6021 |
| 583 | Ga0207707_10047405 | 3300025912 | Bacteria | 3742 |
| 584 | Ga0207707_10075513 | 3300025912 | Bacteria | 2941 |
| 585 | Ga0207707_10138344 | 3300025912 | Bacteria | 2129 |
| 586 | Ga0207707_10170172 | 3300025912 | Bacteria | 1904 |
| 587 | Ga0207707_10511053 | 3300025912 | Bacteria | 1024 |
| 588 | Ga0207695_10091115 | 3300025913 | Bacteria | 3063 |
| 589 | Ga0207695_10140217 | 3300025913 | Bacteria | 2367 |
| 590 | Ga0207671_10060155 | 3300025914 | Bacteria | 2818 |
| 591 | Ga0207671_10300698 | 3300025914 | Bacteria | 1268 |
| 592 | Ga0207693_10008823 | 3300025915 | Bacteria | 8239 |
| 593 | Ga0207693_10075253 | 3300025915 | Bacteria | 2644 |
| 594 | Ga0207693_10104971 | 3300025915 | Bacteria | 2216 |
| 595 | Ga0207693_10287522 | 3300025915 | Bacteria | 1288 |
| 596 | Ga0207693_10530848 | 3300025915 | Bacteria | 918 |
| 597 | Ga0207663_10056484 | 3300025916 | Bacteria | 2469 |
| 598 | Ga0207663_10075460 | 3300025916 | Bacteria | 2188 |
| 599 | Ga0207663_10096340 | 3300025916 | Bacteria | 1976 |
| 600 | Ga0207663_10274480 | 3300025916 | Bacteria | 1250 |
| 601 | Ga0207663_10314350 | 3300025916 | Bacteria | 1175 |
| 602 | Ga0207663_10584903 | 3300025916 | Bacteria | 876 |
| 603 | Ga0207660_10076991 | 3300025917 | Bacteria | 2440 |
| 604 | Ga0207660_10137592 | 3300025917 | Bacteria | 1865 |
| 605 | Ga0207660_10717401 | 3300025917 | Bacteria | 816 |
| 606 | Ga0207662_10052948 | 3300025918 | Bacteria | 2417 |
| 607 | Ga0207662_10164177 | 3300025918 | Bacteria | 1421 |
| 608 | Ga0207657_10003364 | 3300025919 | Bacteria | 17093 |
| 609 | Ga0207649_10129753 | 3300025920 | Unclassified | 1710 |
| 610 | Ga0207652_10047930 | 3300025921 | Bacteria | 3651 |
| 611 | Ga0207652_10096220 | 3300025921 | Bacteria | 2608 |
| 612 | Ga0207652_10637704 | 3300025921 | Bacteria | 953 |
| 613 | Ga0207646_10000630 | 3300025922 | Bacteria | 45810 |
| 614 | Ga0207646_10000708 | 3300025922 | Bacteria | 43282 |
| 615 | Ga0207646_10030710 | 3300025922 | Bacteria | 4869 |
| 616 | Ga0207646_10080346 | 3300025922 | Bacteria | 2915 |
| 617 | Ga0207646_10178348 | 3300025922 | Bacteria | 1918 |
| 618 | Ga0207646_10383686 | 3300025922 | Bacteria | 1269 |
| 619 | Ga0207646_10392368 | 3300025922 | Unclassified | 1254 |
| 620 | Ga0207646_10468882 | 3300025922 | Bacteria | 1136 |
| 621 | Ga0207646_10655207 | 3300025922 | Bacteria | 940 |
| 622 | Ga0207646_10867299 | 3300025922 | Bacteria | 802 |
| 623 | Ga0207681_10002895 | 3300025923 | Bacteria | 10852 |
| 624 | Ga0207681_10018422 | 3300025923 | Bacteria | 4399 |
| 625 | Ga0207681_10900674 | 3300025923 | Bacteria | 741 |
| 626 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 627 | Ga0207694_10010354 | 3300025924 | Bacteria | 7030 |
| 628 | Ga0207650_10001512 | 3300025925 | Bacteria | 16613 |
| 629 | Ga0207659_10000036 | 3300025926 | Bacteria | 103327 |
| 630 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 631 | Ga0207687_10002330 | 3300025927 | Bacteria | 12928 |
| 632 | Ga0207687_10149550 | 3300025927 | Bacteria | 1780 |
| 633 | Ga0207687_10159467 | 3300025927 | Bacteria | 1730 |
| 634 | Ga0207687_10241063 | 3300025927 | Bacteria | 1433 |
| 635 | Ga0207687_10378226 | 3300025927 | Bacteria | 1159 |
| 636 | Ga0207700_10017186 | 3300025928 | Bacteria | 4826 |
| 637 | Ga0207700_10037637 | 3300025928 | Bacteria | 3505 |
| 638 | Ga0207664_10011372 | 3300025929 | Bacteria | 6322 |
| 639 | Ga0207664_10068004 | 3300025929 | Bacteria | 2860 |
| 640 | Ga0207664_10867437 | 3300025929 | Bacteria | 811 |
| 641 | Ga0207644_10000414 | 3300025931 | Bacteria | 27902 |
| 642 | Ga0207644_10291825 | 3300025931 | Bacteria | 1312 |
| 643 | Ga0207644_10481732 | 3300025931 | Bacteria | 1022 |
| 644 | Ga0207690_10057507 | 3300025932 | Unclassified | 2627 |
| 645 | Ga0207690_10120468 | 3300025932 | Bacteria | 1905 |
| 646 | Ga0207706_10100663 | 3300025933 | Bacteria | 2542 |
| 647 | Ga0207706_10122129 | 3300025933 | Unclassified | 2291 |
| 648 | Ga0207706_10257235 | 3300025933 | Bacteria | 1524 |
| 649 | Ga0207686_10000005 | 3300025934 | Bacteria | 260873 |
| 650 | Ga0207686_10001337 | 3300025934 | Bacteria | 14036 |
| 651 | Ga0207686_10004022 | 3300025934 | Bacteria | 7888 |
| 652 | Ga0207686_10110303 | 3300025934 | Bacteria | 1854 |
| 653 | Ga0207686_10119923 | 3300025934 | Bacteria | 1789 |
| 654 | Ga0207686_10230913 | 3300025934 | Bacteria | 1341 |
| 655 | Ga0207686_10450479 | 3300025934 | Bacteria | 990 |
| 656 | Ga0207709_10000133 | 3300025935 | Bacteria | 108698 |
| 657 | Ga0207709_10009706 | 3300025935 | Bacteria | 5303 |
| 658 | Ga0207709_10326828 | 3300025935 | Bacteria | 1150 |
| 659 | Ga0207709_10532146 | 3300025935 | Bacteria | 922 |
| 660 | Ga0207670_10110917 | 3300025936 | Bacteria | 1977 |
| 661 | Ga0207670_10285167 | 3300025936 | Bacteria | 1288 |
| 662 | Ga0207669_10113601 | 3300025937 | Bacteria | 1821 |
| 663 | Ga0207704_10004874 | 3300025938 | Bacteria | 6167 |
| 664 | Ga0207704_10450541 | 3300025938 | Bacteria | 1027 |
| 665 | Ga0207665_10000005 | 3300025939 | Bacteria | 194919 |
| 666 | Ga0207665_10039267 | 3300025939 | Bacteria | 3155 |
| 667 | Ga0207665_10077046 | 3300025939 | Bacteria | 2288 |
| 668 | Ga0207665_10089277 | 3300025939 | Bacteria | 2134 |
| 669 | Ga0207665_10105427 | 3300025939 | Bacteria | 1974 |
| 670 | Ga0207691_10002644 | 3300025940 | Bacteria | 17504 |
| 671 | Ga0207711_10004233 | 3300025941 | Bacteria | 12280 |
| 672 | Ga0207711_10132896 | 3300025941 | Bacteria | 2233 |
| 673 | Ga0207711_10306669 | 3300025941 | Bacteria | 1465 |
| 674 | Ga0207711_10498167 | 3300025941 | Unclassified | 1135 |
| 675 | Ga0207711_10560170 | 3300025941 | Bacteria | 1066 |
| 676 | Ga0207689_10003268 | 3300025942 | Bacteria | 14863 |
| 677 | Ga0207689_10009254 | 3300025942 | Bacteria | 8519 |
| 678 | Ga0207689_10009503 | 3300025942 | Bacteria | 8397 |
| 679 | Ga0207689_10010598 | 3300025942 | Bacteria | 7937 |
| 680 | Ga0207689_10040739 | 3300025942 | Bacteria | 3844 |
| 681 | Ga0207689_10070209 | 3300025942 | Bacteria | 2878 |
| 682 | Ga0207689_10162913 | 3300025942 | Bacteria | 1837 |
| 683 | Ga0207689_11012370 | 3300025942 | Bacteria | 701 |
| 684 | Ga0207661_10000006 | 3300025944 | Bacteria | 537727 |
| 685 | Ga0207661_11134445 | 3300025944 | Bacteria | 720 |
| 686 | Ga0207679_10034524 | 3300025945 | Bacteria | 3569 |
| 687 | Ga0207679_10158818 | 3300025945 | Bacteria | 1849 |
| 688 | Ga0207679_10230992 | 3300025945 | Bacteria | 1562 |
| 689 | Ga0207679_10534070 | 3300025945 | Bacteria | 1050 |
| 690 | Ga0207667_10000612 | 3300025949 | Bacteria | 46149 |
| 691 | Ga0207667_10114447 | 3300025949 | Bacteria | 2780 |
| 692 | Ga0207667_10142564 | 3300025949 | Bacteria | 2467 |
| 693 | Ga0207651_10008745 | 3300025960 | Bacteria | 5492 |
| 694 | Ga0207651_10070128 | 3300025960 | Unclassified | 2478 |
| 695 | Ga0207712_10000709 | 3300025961 | Bacteria | 25746 |
| 696 | Ga0207712_10302180 | 3300025961 | Bacteria | 1314 |
| 697 | Ga0207712_10633640 | 3300025961 | Bacteria | 928 |
| 698 | Ga0207668_10004545 | 3300025972 | Bacteria | 8164 |
| 699 | Ga0207668_10058291 | 3300025972 | Bacteria | 2699 |
| 700 | Ga0207668_10475212 | 3300025972 | Bacteria | 1071 |
| 701 | Ga0207668_10936671 | 3300025972 | Bacteria | 772 |
| 702 | Ga0207640_10196065 | 3300025981 | Bacteria | 1526 |
| 703 | Ga0207640_10995760 | 3300025981 | Bacteria | 737 |
| 704 | Ga0207658_10124942 | 3300025986 | Bacteria | 2057 |
| 705 | Ga0207658_10227130 | 3300025986 | Bacteria | 1574 |
| 706 | Ga0207658_10254031 | 3300025986 | Bacteria | 1495 |
| 707 | Ga0207658_10822208 | 3300025986 | Bacteria | 844 |
| 708 | Ga0207677_10000101 | 3300026023 | Bacteria | 70739 |
| 709 | Ga0207677_10000141 | 3300026023 | Bacteria | 59003 |
| 710 | Ga0207677_10000772 | 3300026023 | Bacteria | 18388 |
| 711 | Ga0207677_10016453 | 3300026023 | Bacteria | 4383 |
| 712 | Ga0207677_10471864 | 3300026023 | Bacteria | 1079 |
| 713 | Ga0207677_10928524 | 3300026023 | Bacteria | 786 |
| 714 | Ga0207703_10019029 | 3300026035 | Bacteria | 5364 |
| 715 | Ga0207703_10020588 | 3300026035 | Bacteria | 5160 |
| 716 | Ga0207703_10032311 | 3300026035 | Bacteria | 4142 |
| 717 | Ga0207703_10063129 | 3300026035 | Bacteria | 3036 |
| 718 | Ga0207703_10064766 | 3300026035 | Bacteria | 3001 |
| 719 | Ga0207703_10285132 | 3300026035 | Bacteria | 1501 |
| 720 | Ga0207703_10446091 | 3300026035 | Bacteria | 1208 |
| 721 | Ga0207703_10449254 | 3300026035 | Bacteria | 1204 |
| 722 | Ga0207703_10685623 | 3300026035 | Bacteria | 974 |
| 723 | Ga0207703_10710044 | 3300026035 | Bacteria | 956 |
| 724 | Ga0207639_10000013 | 3300026041 | Bacteria | 293084 |
| 725 | Ga0207639_10028396 | 3300026041 | Bacteria | 4084 |
| 726 | Ga0207639_10220928 | 3300026041 | Bacteria | 1636 |
| 727 | Ga0207639_10498747 | 3300026041 | Bacteria | 1112 |
| 728 | Ga0207678_10212259 | 3300026067 | Bacteria | 1656 |
| 729 | Ga0207678_10542233 | 3300026067 | Bacteria | 1017 |
| 730 | Ga0207678_10620838 | 3300026067 | Bacteria | 948 |
| 731 | Ga0207708_10116208 | 3300026075 | Bacteria | 2081 |
| 732 | Ga0207708_10164164 | 3300026075 | Bacteria | 1755 |
| 733 | Ga0207708_10476606 | 3300026075 | Bacteria | 1043 |
| 734 | Ga0207708_10873482 | 3300026075 | Bacteria | 777 |
| 735 | Ga0207702_10030901 | 3300026078 | Bacteria | 4463 |
| 736 | Ga0207702_10040498 | 3300026078 | Bacteria | 3906 |
| 737 | Ga0207641_10023693 | 3300026088 | Bacteria | 5058 |
| 738 | Ga0207641_10085205 | 3300026088 | Bacteria | 2753 |
| 739 | Ga0207641_10089316 | 3300026088 | Bacteria | 2693 |
| 740 | Ga0207641_10335742 | 3300026088 | Bacteria | 1437 |
| 741 | Ga0207641_10430922 | 3300026088 | Bacteria | 1271 |
| 742 | Ga0207641_10563232 | 3300026088 | Bacteria | 1112 |
| 743 | Ga0207641_11329213 | 3300026088 | Bacteria | 719 |
| 744 | Ga0207648_10019210 | 3300026089 | Bacteria | 6167 |
| 745 | Ga0207648_10281488 | 3300026089 | Unclassified | 1487 |
| 746 | Ga0207648_10302052 | 3300026089 | Bacteria | 1436 |
| 747 | Ga0207676_10000023 | 3300026095 | Bacteria | 266848 |
| 748 | Ga0207676_10009610 | 3300026095 | Bacteria | 6885 |
| 749 | Ga0207676_10049891 | 3300026095 | Bacteria | 3259 |
| 750 | Ga0207676_10086376 | 3300026095 | Bacteria | 2563 |
| 751 | Ga0207676_10098561 | 3300026095 | Bacteria | 2417 |
| 752 | Ga0207676_10507545 | 3300026095 | Bacteria | 1146 |
| 753 | Ga0207676_10749478 | 3300026095 | Bacteria | 949 |
| 754 | Ga0207676_10760610 | 3300026095 | Bacteria | 943 |
| 755 | Ga0207674_10013233 | 3300026116 | Bacteria | 9170 |
| 756 | Ga0207674_10018433 | 3300026116 | Bacteria | 7586 |
| 757 | Ga0207674_10040581 | 3300026116 | Bacteria | 4820 |
| 758 | Ga0207674_10141748 | 3300026116 | Bacteria | 2363 |
| 759 | Ga0207674_10193921 | 3300026116 | Bacteria | 1981 |
| 760 | Ga0207674_10345588 | 3300026116 | Bacteria | 1438 |
| 761 | Ga0207674_10677704 | 3300026116 | Bacteria | 995 |
| 762 | Ga0207675_100001227 | 3300026118 | Bacteria | 25579 |
| 763 | Ga0207675_100068381 | 3300026118 | Bacteria | 3320 |
| 764 | Ga0207675_100109886 | 3300026118 | Bacteria | 2602 |
| 765 | Ga0207675_100629670 | 3300026118 | Bacteria | 1078 |
| 766 | Ga0207675_101408081 | 3300026118 | Bacteria | 718 |
| 767 | Ga0207698_10977438 | 3300026142 | Bacteria | 856 |
| 768 | Ga0207698_11300152 | 3300026142 | Bacteria | 742 |
| 769 | Ga0209984_1004426 | 3300027424 | Bacteria | 1656 |
| 770 | Ga0209995_1011397 | 3300027471 | Bacteria | 1446 |
| 771 | Ga0209999_1004693 | 3300027543 | Bacteria | 2453 |
| 772 | Ga0209970_1005891 | 3300027614 | Bacteria | 2014 |
| 773 | Ga0209983_1000280 | 3300027665 | Bacteria | 10618 |
| 774 | Ga0209971_1000384 | 3300027682 | Bacteria | 12081 |
| 775 | Ga0209966_1013867 | 3300027695 | Bacteria | 1498 |
| 776 | Ga0209966_1043285 | 3300027695 | Bacteria | 943 |
| 777 | Ga0209998_10002827 | 3300027717 | Bacteria | 3904 |
| 778 | Ga0209974_10004420 | 3300027876 | Bacteria | 5002 |
| 779 | Ga0209974_10035385 | 3300027876 | Bacteria | 1659 |
| 780 | Ga0207428_10000030 | 3300027907 | Bacteria | 240846 |
| 781 | Ga0207428_10007215 | 3300027907 | Bacteria | 10162 |
| 782 | Ga0207428_10073683 | 3300027907 | Bacteria | 2678 |
| 783 | Ga0268266_10011799 | 3300028379 | Bacteria | 7574 |
| 784 | Ga0268266_10043390 | 3300028379 | Bacteria | 3843 |
| 785 | Ga0268266_10370969 | 3300028379 | Bacteria | 1348 |
| 786 | Ga0268266_10758304 | 3300028379 | Bacteria | 937 |
| 787 | Ga0268265_10009861 | 3300028380 | Bacteria | 6450 |
| 788 | Ga0268265_10022343 | 3300028380 | Bacteria | 4443 |
| 789 | Ga0268265_10136452 | 3300028380 | Bacteria | 2048 |
| 790 | Ga0268265_10691586 | 3300028380 | Bacteria | 984 |
| 791 | Ga0268264_10060239 | 3300028381 | Bacteria | 3181 |
| 792 | Ga0268264_10079012 | 3300028381 | Bacteria | 2806 |
| 793 | Ga0268264_10137708 | 3300028381 | Bacteria | 2173 |
| 794 | Ga0268264_10144015 | 3300028381 | Bacteria | 2128 |
| 795 | Ga0268264_10200084 | 3300028381 | Bacteria | 1827 |
| 796 | Ga0268264_10201376 | 3300028381 | Bacteria | 1822 |
| 797 | Ga0268264_10380109 | 3300028381 | Bacteria | 1352 |
| 798 | Ga0268264_10722154 | 3300028381 | Bacteria | 991 |
| 799 | Ga0265323_10034570 | 3300028653 | Bacteria | 1866 |
| 800 | Ga0307515_10202150 | 3300028794 | Bacteria | 1859 |
| 801 | Ga0265338_10036788 | 3300028800 | Bacteria | 4676 |
| 802 | Ga0307511_10002513 | 3300030521 | Bacteria | 19146 |
| 803 | Ga0265761_107552 | 3300030889 | Bacteria | 595 |
| 804 | Ga0265330_10021074 | 3300031235 | Bacteria | 2978 |
| 805 | Ga0265328_10162384 | 3300031239 | Bacteria | 843 |
| 806 | Ga0265328_10188699 | 3300031239 | Bacteria | 781 |
| 807 | Ga0265340_10031321 | 3300031247 | Bacteria | 2660 |
| 808 | Ga0265339_10005033 | 3300031249 | Bacteria | 8891 |
| 809 | Ga0265339_10141364 | 3300031249 | Bacteria | 1224 |
| 810 | Ga0265327_10090986 | 3300031251 | Bacteria | 1488 |
| 811 | Ga0265316_10008237 | 3300031344 | Bacteria | 9701 |
| 812 | Ga0265316_10210287 | 3300031344 | Bacteria | 1439 |
| 813 | Ga0307513_10016578 | 3300031456 | Bacteria | 8880 |
| 814 | Ga0307513_10090959 | 3300031456 | Bacteria | 3111 |
| 815 | Ga0307509_10363140 | 3300031507 | Bacteria | 1167 |
| 816 | Ga0307408_100001928 | 3300031548 | Bacteria | 15077 |
| 817 | Ga0307408_100038105 | 3300031548 | Bacteria | 3390 |
| 818 | Ga0307408_100268050 | 3300031548 | Bacteria | 1416 |
| 819 | Ga0307408_100867718 | 3300031548 | Bacteria | 824 |
| 820 | Ga0307408_101036508 | 3300031548 | Bacteria | 758 |
| 821 | Ga0265313_10004521 | 3300031595 | Bacteria | 10621 |
| 822 | Ga0307508_10078439 | 3300031616 | Bacteria | 2883 |
| 823 | Ga0316575_10004333 | 3300031665 | Bacteria | 4989 |
| 824 | Ga0316575_10021116 | 3300031665 | Bacteria | 2503 |
| 825 | Ga0316575_10025775 | 3300031665 | Bacteria | 2282 |
| 826 | Ga0316579_10003044 | 3300031691 | Bacteria | 6456 |
| 827 | Ga0316579_10078475 | 3300031691 | Bacteria | 1570 |
| 828 | Ga0265314_10000003 | 3300031711 | Bacteria | 1653386 |
| 829 | Ga0265314_10000833 | 3300031711 | Bacteria | 36549 |
| 830 | Ga0265314_10009286 | 3300031711 | Bacteria | 8330 |
| 831 | Ga0265314_10126045 | 3300031711 | Bacteria | 1604 |
| 832 | Ga0265342_10064957 | 3300031712 | Bacteria | 2140 |
| 833 | Ga0316576_10002450 | 3300031727 | Bacteria | 10558 |
| 834 | Ga0316576_10003583 | 3300031727 | Bacteria | 9149 |
| 835 | Ga0316576_10010549 | 3300031727 | Bacteria | 6008 |
| 836 | Ga0316576_10046481 | 3300031727 | Bacteria | 3142 |
| 837 | Ga0316576_10106373 | 3300031727 | Bacteria | 2100 |
| 838 | Ga0316576_10238193 | 3300031727 | Bacteria | 1367 |
| 839 | Ga0316578_10000551 | 3300031728 | Bacteria | 12895 |
| 840 | Ga0316578_10058133 | 3300031728 | Bacteria | 2273 |
| 841 | Ga0307405_10003109 | 3300031731 | Bacteria | 7539 |
| 842 | Ga0307405_10040438 | 3300031731 | Bacteria | 2824 |
| 843 | Ga0316577_10002746 | 3300031733 | Bacteria | 8764 |
| 844 | Ga0316577_10074607 | 3300031733 | Bacteria | 1894 |
| 845 | Ga0316577_10517461 | 3300031733 | Bacteria | 678 |
| 846 | Ga0307413_10000449 | 3300031824 | Bacteria | 13415 |
| 847 | Ga0307413_10000549 | 3300031824 | Bacteria | 12525 |
| 848 | Ga0307413_10003502 | 3300031824 | Bacteria | 6617 |
| 849 | Ga0307413_10362313 | 3300031824 | Bacteria | 1123 |
| 850 | Ga0307410_10001120 | 3300031852 | Bacteria | 11726 |
| 851 | Ga0307410_10003798 | 3300031852 | Bacteria | 7666 |
| 852 | Ga0307410_10004470 | 3300031852 | Bacteria | 7237 |
| 853 | Ga0307410_10170710 | 3300031852 | Bacteria | 1638 |
| 854 | Ga0307406_10014432 | 3300031901 | Bacteria | 4546 |
| 855 | Ga0307406_10082192 | 3300031901 | Bacteria | 2144 |
| 856 | Ga0307406_10128816 | 3300031901 | Bacteria | 1773 |
| 857 | Ga0307406_10157487 | 3300031901 | Bacteria | 1628 |
| 858 | Ga0307406_10411940 | 3300031901 | Bacteria | 1074 |
| 859 | Ga0307407_10001031 | 3300031903 | Bacteria | 9619 |
| 860 | Ga0307407_10001139 | 3300031903 | Bacteria | 9316 |
| 861 | Ga0307407_10015861 | 3300031903 | Bacteria | 3737 |
| 862 | Ga0307407_10135498 | 3300031903 | Bacteria | 1581 |
| 863 | Ga0307407_10946675 | 3300031903 | Bacteria | 663 |
| 864 | Ga0307412_10009022 | 3300031911 | Bacteria | 5714 |
| 865 | Ga0307412_10039792 | 3300031911 | Bacteria | 3038 |
| 866 | Ga0307412_10072234 | 3300031911 | Bacteria | 2357 |
| 867 | Ga0307412_10177862 | 3300031911 | Bacteria | 1597 |
| 868 | Ga0307412_10280859 | 3300031911 | Bacteria | 1307 |
| 869 | Ga0307412_10660458 | 3300031911 | Bacteria | 893 |
| 870 | Ga0307409_100003195 | 3300031995 | Bacteria | 8813 |
| 871 | Ga0307416_100016487 | 3300032002 | Bacteria | 5138 |
| 872 | Ga0307416_100019290 | 3300032002 | Bacteria | 4830 |
| 873 | Ga0307416_100035072 | 3300032002 | Bacteria | 3826 |
| 874 | Ga0307416_100099664 | 3300032002 | Bacteria | 2524 |
| 875 | Ga0307416_100246657 | 3300032002 | Bacteria | 1735 |
| 876 | Ga0307416_100689644 | 3300032002 | Bacteria | 1110 |
| 877 | Ga0307416_101171787 | 3300032002 | Bacteria | 874 |
| 878 | Ga0307416_101768943 | 3300032002 | Bacteria | 722 |
| 879 | Ga0307414_10019950 | 3300032004 | Bacteria | 4166 |
| 880 | Ga0307414_10027746 | 3300032004 | Bacteria | 3663 |
| 881 | Ga0307414_10034819 | 3300032004 | Bacteria | 3344 |
| 882 | Ga0307414_10404202 | 3300032004 | Bacteria | 1187 |
| 883 | Ga0307411_10234887 | 3300032005 | Bacteria | 1431 |
| 884 | Ga0307415_100053963 | 3300032126 | Bacteria | 2741 |
| 885 | Ga0307415_100276861 | 3300032126 | Bacteria | 1378 |
| 886 | Ga0307415_100399278 | 3300032126 | Bacteria | 1173 |
| 887 | Ga0316583_10015823 | 3300032133 | Bacteria | 2716 |
| 888 | Ga0316583_10033936 | 3300032133 | Bacteria | 1810 |
| 889 | Ga0316583_10118532 | 3300032133 | Bacteria | 922 |
| 890 | Ga0316583_10188662 | 3300032133 | Bacteria | 716 |
| 891 | Ga0316585_10001353 | 3300032137 | Bacteria | 6432 |
| 892 | Ga0316585_10004948 | 3300032137 | Bacteria | 3744 |
| 893 | Ga0316585_10057900 | 3300032137 | Bacteria | 1248 |
| 894 | Ga0316580_10002359 | 3300032139 | Bacteria | 5179 |
| 895 | Ga0316580_10026342 | 3300032139 | Bacteria | 1798 |
| 896 | Ga0316593_10000033 | 3300032168 | Bacteria | 14603 |
| 897 | Ga0316593_10000122 | 3300032168 | Bacteria | 10489 |
| 898 | Ga0316593_10001783 | 3300032168 | Bacteria | 4897 |
| 899 | Ga0316593_10002306 | 3300032168 | Bacteria | 4483 |
| 900 | Ga0316593_10003721 | 3300032168 | Bacteria | 3827 |
| 901 | Ga0316593_10010834 | 3300032168 | Bacteria | 2630 |
| 902 | Ga0316588_1033653 | 3300033528 | Bacteria | 1209 |
| 903 | Ga0316596_1022948 | 3300033541 | Bacteria | 1596 |
| 904 | Ga0316596_1036298 | 3300033541 | Bacteria | 1288 |
| 905 | Ga0373926_0002499 | 3300035083 | Bacteria | 5835 |
| 906 | Ga0373934_0007545 | 3300035086 | Bacteria | 4038 |
| 907 | Ga0373934_0008632 | 3300035086 | Bacteria | 3800 |
| 908 | Ga0373934_0014666 | 3300035086 | Bacteria | 2970 |
| 909 | Ga0373944_0000533 | 3300035089 | Bacteria | 8946 |
| 910 | Ga0373944_0114041 | 3300035089 | Bacteria | 926 |
| 911 | Ga0373949_0017759 | 3300035090 | Bacteria | 1607 |
| 912 | Ga0373923_0000448 | 3300035111 | Bacteria | 9770 |
| 913 | Ga0373936_0025334 | 3300035113 | Bacteria | 2319 |
| 914 | Ga0373941_0062111 | 3300035115 | Bacteria | 1218 |
| 915 | Ga0373945_0000882 | 3300035116 | Bacteria | 8855 |
| 916 | Ga0373953_0008828 | 3300035117 | Bacteria | 3439 |
| 917 | Ga0373953_0011305 | 3300035117 | Bacteria | 3130 |
| 918 | Ga0373953_0069272 | 3300035117 | Bacteria | 1453 |
| 919 | Ga0373954_0008600 | 3300035118 | Bacteria | 4488 |
| 920 | Ga0373957_0017064 | 3300035120 | Bacteria | 2522 |
| 921 | Ga0373943_0036947 | 3300035170 | Bacteria | 2342 |
| 922 | Ga0373946_0014205 | 3300035171 | Bacteria | 3001 |
| 923 | Ga0373946_0322848 | 3300035171 | Bacteria | 767 |
| 924 | Ga0373955_0518973 | 3300035172 | Bacteria | 728 |
| 925 | Ga0316574_0001004 | 3300035398 | Bacteria | 12720 |
| 926 | Ga0316574_0003671 | 3300035398 | Bacteria | 7945 |
| 927 | Ga0316574_0006441 | 3300035398 | Bacteria | 6347 |
| 928 | Ga0316574_0050430 | 3300035398 | Unclassified | 2590 |
| 929 | Ga0316574_0109331 | 3300035398 | Bacteria | 1772 |
| 930 | Ga0316574_0173136 | 3300035398 | Bacteria | 1389 |
| 931 | Ga0316574_0439226 | 3300035398 | Bacteria | 819 |
| 932 | Ga0316574_0468942 | 3300035398 | Bacteria | 787 |
| 933 | Ga0316574_0518551 | 3300035398 | Bacteria | 742 |
| 934 | Ga0373924_0007336 | 3300035410 | Bacteria | 3978 |
| 935 | Ga0373924_0015978 | 3300035410 | Bacteria | 2860 |
| 936 | Ga0373924_0027067 | 3300035410 | Bacteria | 2279 |
| 937 | Ga0373924_0316261 | 3300035410 | Bacteria | 694 |
| 938 | Ga0373935_0280257 | 3300035692 | Bacteria | 1173 |
| 939 | Ga0373927_0105317 | 3300035695 | Bacteria | 1836 |
| 940 | Ga0373927_0199596 | 3300035695 | Bacteria | 1313 |
| 941 | Ga0373927_0819978 | 3300035695 | Bacteria | 614 |
| 942 | Ga0373933_0004782 | 3300035724 | Bacteria | 7402 |
| 943 | Ga0373933_0383520 | 3300035724 | Bacteria | 915 |
| 944 | Ga0373933_0665113 | 3300035724 | Bacteria | 685 |
| 945 | Ga0373937_0036358 | 3300036401 | Bacteria | 4487 |
| 946 | Ga0373937_0069217 | 3300036401 | Bacteria | 3253 |
| 947 | Ga0373937_0288414 | 3300036401 | Bacteria | 1550 |
| 948 | Ga0316582_0003224 | 3300036647 | Bacteria | 7940 |
| 949 | Ga0316582_0005211 | 3300036647 | Bacteria | 6660 |
| 950 | Ga0316582_0100542 | 3300036647 | Bacteria | 1915 |
| 951 | Ga0316582_0176094 | 3300036647 | Bacteria | 1454 |
| 952 | Ga0316582_0377240 | 3300036647 | Bacteria | 976 |
| 953 | Ga0316584_0002208 | 3300036712 | Bacteria | 12192 |
| 954 | Ga0316584_0045853 | 3300036712 | Bacteria | 3264 |
| 955 | Ga0316584_0056894 | 3300036712 | Bacteria | 2927 |
| 956 | Ga0316584_0566156 | 3300036712 | Bacteria | 792 |
| 957 | Ga0373925_0045202 | 3300037068 | Bacteria | 3271 |
| 958 | Ga0395900_0180156 | 3300037418 | Bacteria | 2148 |
| 959 | Ga0395900_0395376 | 3300037418 | Bacteria | 1348 |
| 960 | Ga0395905_0004072 | 3300037471 | Bacteria | 15323 |
| 961 | Ga0395905_0092421 | 3300037471 | Bacteria | 2837 |
| 962 | Ga0395905_0335843 | 3300037471 | Bacteria | 1402 |
| 963 | Ga0395905_0506042 | 3300037471 | Bacteria | 1108 |
| 964 | Ga0395905_0572848 | 3300037471 | Bacteria | 1030 |
| 965 | Ga0395905_0617827 | 3300037471 | Bacteria | 986 |
| 966 | Ga0395905_1168441 | 3300037471 | Bacteria | 673 |
| 967 | Ga0316581_0010080 | 3300037588 | Bacteria | 2613 |
| 968 | Ga0436364_0600523 | 3300037853 | Bacteria | 1439 |
| 969 | Ga0436364_0623666 | 3300037853 | Bacteria | 660 |
| 970 | Ga0436364_0754414 | 3300037853 | Bacteria | 624 |
| 971 | Ga0436364_0863400 | 3300037853 | Bacteria | 962 |
| 972 | Ga0436364_1316563 | 3300037853 | Bacteria | 5833 |
| 973 | Ga0436364_1354648 | 3300037853 | Bacteria | 115417 |
| 974 | Ga0395901_0000654 | 3300038443 | Bacteria | 39925 |
| 975 | Ga0395901_0920942 | 3300038443 | Bacteria | 855 |
| 976 | Ga0400484_14002 | 3300038725 | Bacteria | 7367 |
| 977 | Ga0400490_30744 | 3300038726 | Bacteria | 133210 |
| 978 | Ga0400488_22380 | 3300038741 | Bacteria | 1687 |
| 979 | Ga0400483_035845 | 3300039062 | Bacteria | 4840 |
| 980 | Ga0400483_155646 | 3300039062 | Bacteria | 1440 |
| 981 | Ga0400483_281776 | 3300039062 | Bacteria | 7321 |
| 982 | Ga0400489_27072 | 3300039093 | Bacteria | 2745 |
| 983 | Ga0400489_86209 | 3300039093 | Bacteria | 8537 |
| 984 | Ga0436365_0048919 | 3300039437 | Bacteria | 660 |
| 985 | Ga0436365_0154164 | 3300039437 | Bacteria | 11061 |
| 986 | Ga0436365_0332019 | 3300039437 | Bacteria | 1766 |
| 987 | Ga0436365_0340116 | 3300039437 | Bacteria | 15753 |
| 988 | Ga0436365_0382778 | 3300039437 | Bacteria | 2331 |
| 989 | Ga0436365_0464141 | 3300039437 | Bacteria | 46759 |
| 990 | Ga0436365_0647080 | 3300039437 | Bacteria | 807 |
| 991 | Ga0436365_1001167 | 3300039437 | Bacteria | 1405 |
| 992 | Ga0436365_1032223 | 3300039437 | Bacteria | 1137 |
| 993 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 994 | Ga0436360_0163442 | 3300039438 | Bacteria | 11133 |
| 995 | Ga0436360_0328120 | 3300039438 | Bacteria | 768 |
| 996 | Ga0436360_0591939 | 3300039438 | Bacteria | 730 |
| 997 | Ga0436360_0923015 | 3300039438 | Bacteria | 4679 |
| 998 | Ga0436363_0022136 | 3300039450 | Bacteria | 903 |
| 999 | Ga0436363_0323271 | 3300039450 | Bacteria | 5181 |
| 1000 | Ga0436363_0537550 | 3300039450 | Bacteria | 7384 |
| 1001 | Ga0436363_0872043 | 3300039450 | Bacteria | 1357 |
| 1002 | Ga0436362_0260637 | 3300039453 | Bacteria | 1148 |
| 1003 | Ga0436362_0656010 | 3300039453 | Bacteria | 14220 |
| 1004 | Ga0436362_0832964 | 3300039453 | Bacteria | 2955 |
| 1005 | Ga0436362_1063276 | 3300039453 | Bacteria | 20265 |
| 1006 | Ga0436362_1065558 | 3300039453 | Bacteria | 1124 |
| 1007 | Ga0436362_1069013 | 3300039453 | Bacteria | 90804 |
| 1008 | Ga0439439_0016465 | 3300041406 | Bacteria | 1811 |
| 1009 | Ga0439439_0036614 | 3300041406 | Bacteria | 1263 |
| 1010 | Ga0439466_0055003 | 3300041411 | Bacteria | 1295 |
| 1011 | Ga0451795_0157516 | 3300041456 | Bacteria | 795 |
| 1012 | Ga0451807_0333339 | 3300041486 | Bacteria | 1907 |
| 1013 | Ga0451839_0378043 | 3300041496 | Bacteria | 1552 |
| 1014 | Ga0451843_0181247 | 3300041509 | Bacteria | 1519 |
| 1015 | Ga0451855_1923054 | 3300041511 | Bacteria | 1945 |
| 1016 | Ga0439462_0023689 | 3300042015 | Bacteria | 1610 |
| 1017 | Ga0450892_003270 | 3300042130 | Unclassified | 1339 |
| 1018 | Ga0439446_0026364 | 3300042156 | Unclassified | 1665 |
| 1019 | Ga0450893_0041135 | 3300042532 | Bacteria | 847 |
| 1020 | Ga0451577_0000004 | 3300042876 | Bacteria | 816743 |
| 1021 | Ga0451577_0000828 | 3300042876 | Bacteria | 46284 |
| 1022 | Ga0451577_0006363 | 3300042876 | Bacteria | 11795 |
| 1023 | Ga0451577_0269782 | 3300042876 | Bacteria | 1541 |
| 1024 | Ga0451577_0649678 | 3300042876 | Bacteria | 956 |
| 1025 | Ga0466972_0002629 | 3300044658 | Bacteria | 8898 |
| 1026 | Ga0466972_0007079 | 3300044658 | Bacteria | 5631 |
| 1027 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 1028 | Ga0453683_0492208 | 3300044673 | Bacteria | 795 |
| 1029 | Ga0466965_0004970 | 3300044683 | Bacteria | 5954 |
| 1030 | Ga0466965_0012715 | 3300044683 | Bacteria | 3964 |
| 1031 | Ga0466963_0545387 | 3300044694 | Bacteria | 819 |
| 1032 | Ga0466964_0082772 | 3300044706 | Bacteria | 1381 |
| 1033 | Ga0453684_0000025 | 3300044712 | Bacteria | 818638 |
| 1034 | Ga0453684_0003637 | 3300044712 | Bacteria | 34273 |
| 1035 | Ga0453684_0005988 | 3300044712 | Bacteria | 23557 |
| 1036 | Ga0453684_0020910 | 3300044712 | Bacteria | 9821 |
| 1037 | Ga0453684_0032497 | 3300044712 | Bacteria | 7301 |
| 1038 | Ga0453684_0055586 | 3300044712 | Bacteria | 5145 |
| 1039 | Ga0453684_0140838 | 3300044712 | Bacteria | 2880 |
| 1040 | Ga0453684_0494279 | 3300044712 | Bacteria | 1355 |
| 1041 | Ga0466968_0002163 | 3300044735 | Bacteria | 7173 |
| 1042 | Ga0466957_0006920 | 3300044842 | Bacteria | 6411 |
| 1043 | Ga0466960_0002207 | 3300044901 | Bacteria | 7269 |
| 1044 | Ga0466960_0017262 | 3300044901 | Bacteria | 3143 |
| 1045 | Ga0451576_0005912 | 3300045051 | Bacteria | 15170 |
| 1046 | Ga0451576_0032997 | 3300045051 | Bacteria | 5505 |
| 1047 | Ga0451576_0073380 | 3300045051 | Bacteria | 3561 |
| 1048 | Ga0451576_0089061 | 3300045051 | Bacteria | 3210 |
| 1049 | Ga0451576_0453652 | 3300045051 | Bacteria | 1346 |
| 1050 | Ga0451576_0718808 | 3300045051 | Bacteria | 1049 |
| 1051 | Ga0466967_0044233 | 3300045976 | Bacteria | 3861 |
| 1052 | Ga0466967_0126564 | 3300045976 | Bacteria | 2367 |
| 1053 | Ga0495592_0136326 | 3300046454 | Bacteria | 1711 |
| 1054 | Ga0495629_0502263 | 3300046459 | Unclassified | 818 |
| 1055 | Ga0495629_0517482 | 3300046459 | Bacteria | 803 |
| 1056 | Ga0495641_0076199 | 3300046461 | Bacteria | 1503 |
| 1057 | Ga0495651_0043424 | 3300046462 | Bacteria | 3488 |
| 1058 | Ga0495653_0062800 | 3300046463 | Bacteria | 2805 |
| 1059 | Ga0495580_0057891 | 3300046472 | Bacteria | 2727 |
| 1060 | Ga0495580_0303839 | 3300046472 | Bacteria | 1086 |
| 1061 | Ga0495639_0003260 | 3300046475 | Bacteria | 7049 |
| 1062 | Ga0495664_0017680 | 3300046477 | Bacteria | 4077 |
| 1063 | Ga0495594_0008104 | 3300046499 | Bacteria | 5403 |
| 1064 | Ga0495608_0003772 | 3300046511 | Bacteria | 10886 |
| 1065 | Ga0495618_0194862 | 3300046514 | Unclassified | 1284 |
| 1066 | Ga0495628_0032936 | 3300046516 | Bacteria | 4179 |
| 1067 | Ga0495628_0058306 | 3300046516 | Bacteria | 3034 |
| 1068 | Ga0495630_0013363 | 3300046517 | Bacteria | 5975 |
| 1069 | Ga0495630_0218936 | 3300046517 | Bacteria | 1453 |
| 1070 | Ga0495630_0286748 | 3300046517 | Bacteria | 1258 |
| 1071 | Ga0495632_0019314 | 3300046519 | Bacteria | 3716 |
| 1072 | Ga0495663_0001514 | 3300046525 | Bacteria | 7303 |
| 1073 | Ga0495666_0007526 | 3300046526 | Bacteria | 5447 |
| 1074 | Ga0495652_0205882 | 3300046529 | Bacteria | 1490 |
| 1075 | Ga0495665_0004028 | 3300046531 | Bacteria | 7928 |
| 1076 | Ga0495586_0006192 | 3300046535 | Bacteria | 6400 |
| 1077 | Ga0495598_0000163 | 3300046537 | Bacteria | 11410 |
| 1078 | Ga0495621_0015538 | 3300046539 | Bacteria | 2429 |
| 1079 | Ga0495621_0020255 | 3300046539 | Bacteria | 2181 |
| 1080 | Ga0495667_0003938 | 3300046559 | Bacteria | 9952 |
| 1081 | Ga0495656_0295605 | 3300046615 | Bacteria | 829 |
| 1082 | Ga0495656_0347301 | 3300046615 | Bacteria | 768 |
| 1083 | Ga0495625_0016058 | 3300046660 | Bacteria | 5902 |
| 1084 | Ga0495635_0004293 | 3300046663 | Bacteria | 9868 |
| 1085 | Ga0495635_0052784 | 3300046663 | Bacteria | 2800 |
| 1086 | Ga0495635_0140096 | 3300046663 | Bacteria | 1648 |
| 1087 | Ga0495588_0032738 | 3300046674 | Bacteria | 2621 |
| 1088 | Ga0495657_0217306 | 3300046675 | Bacteria | 1160 |
| 1089 | Ga0495599_0058308 | 3300046678 | Bacteria | 2415 |
| 1090 | Ga0495623_0326026 | 3300046679 | Bacteria | 842 |
| 1091 | Ga0495646_0001927 | 3300046680 | Bacteria | 12478 |
| 1092 | Ga0495658_0018132 | 3300046683 | Bacteria | 3653 |
| 1093 | Ga0495613_0163119 | 3300046689 | Bacteria | 1584 |
| 1094 | Ga0495624_0011751 | 3300046690 | Bacteria | 6011 |
| 1095 | Ga0495624_0090865 | 3300046690 | Bacteria | 1884 |
| 1096 | Ga0495670_0163925 | 3300046691 | Bacteria | 1168 |
| 1097 | Ga0495600_0002535 | 3300046809 | Bacteria | 10511 |
| 1098 | Ga0495600_0320799 | 3300046809 | Bacteria | 974 |
| 1099 | Ga0495581_0022118 | 3300047315 | Bacteria | 3684 |
| 1100 | Ga0495581_0048090 | 3300047315 | Bacteria | 2464 |
| 1101 | Ga0495604_0121875 | 3300047317 | Bacteria | 1886 |
| 1102 | Ga0495636_0001105 | 3300047318 | Bacteria | 10134 |
| 1103 | Ga0495674_0100487 | 3300047319 | Bacteria | 2461 |
| 1104 | Ga0495672_0006094 | 3300047320 | Bacteria | 9420 |
| 1105 | Ga0495672_0077350 | 3300047320 | Bacteria | 1865 |
| 1106 | Ga0495680_0028661 | 3300047322 | Bacteria | 4564 |
| 1107 | Ga0495680_0367266 | 3300047322 | Bacteria | 999 |
| 1108 | Ga0495680_0705676 | 3300047322 | Unclassified | 666 |
| 1109 | Ga0495679_007316 | 3300047446 | Bacteria | 4617 |
| 1110 | Ga0495684_0001009 | 3300047471 | Bacteria | 22928 |
| 1111 | Ga0495684_0024903 | 3300047471 | Bacteria | 4603 |
| 1112 | Ga0495684_0106866 | 3300047471 | Bacteria | 2114 |
| 1113 | Ga0495684_0417907 | 3300047471 | Bacteria | 938 |
| 1114 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 1115 | Ga0495593_0016768 | 3300047673 | Bacteria | 4126 |
| 1116 | Ga0495602_0017278 | 3300048088 | Bacteria | 7234 |
| 1117 | Ga0495614_0003011 | 3300048089 | Bacteria | 7507 |
| 1118 | Ga0495615_0001516 | 3300048090 | Bacteria | 3484 |
| 1119 | Ga0495615_0207169 | 3300048090 | Bacteria | 607 |
| 1120 | Ga0496100_0079592 | 3300048903 | Bacteria | 2209 |
| 1121 | Ga0496101_0586164 | 3300048904 | Bacteria | 882 |
| 1122 | Ga0496102_0497858 | 3300048905 | Bacteria | 1140 |
| 1123 | Ga0496103_0019686 | 3300048906 | Bacteria | 4052 |
| 1124 | Ga0496103_0246527 | 3300048906 | Bacteria | 1149 |
| 1125 | Ga0496104_0275923 | 3300048907 | Bacteria | 1594 |
| 1126 | Ga0496104_0300228 | 3300048907 | Bacteria | 1518 |
| 1127 | Ga0496106_0004259 | 3300048909 | Bacteria | 10652 |
| 1128 | Ga0496108_0067143 | 3300048911 | Bacteria | 3025 |
| 1129 | Ga0496109_0001176 | 3300048912 | Bacteria | 21761 |
| 1130 | Ga0496110_0209515 | 3300048913 | Bacteria | 1772 |
| 1131 | Ga0496110_0933151 | 3300048913 | Bacteria | 774 |
| 1132 | Ga0496112_0768175 | 3300048915 | Bacteria | 889 |
| 1133 | Ga0496114_0313364 | 3300048917 | Unclassified | 1386 |
| 1134 | Ga0496115_0425937 | 3300048918 | Bacteria | 1075 |
| 1135 | Ga0496117_0277608 | 3300048920 | Bacteria | 899 |
| 1136 | Ga0496118_0086097 | 3300048921 | Bacteria | 2185 |
| 1137 | Ga0496121_0004571 | 3300048924 | Bacteria | 18454 |
| 1138 | Ga0496121_0244620 | 3300048924 | Bacteria | 1248 |
| 1139 | Ga0496124_0541390 | 3300048927 | Bacteria | 771 |
| 1140 | Ga0501311_058651 | 3300049527 | Bacteria | 618 |
| 1141 | Ga0501032_0317824 | 3300049569 | Bacteria | 1005 |
| 1142 | Ga0501033_0340260 | 3300049570 | Bacteria | 1052 |
| 1143 | Ga0501034_0050937 | 3300049571 | Bacteria | 4175 |
| 1144 | Ga0501034_0105612 | 3300049571 | Bacteria | 2809 |
| 1145 | Ga0501034_0608958 | 3300049571 | Bacteria | 997 |
| 1146 | Ga0501036_0062381 | 3300049572 | Bacteria | 3157 |
| 1147 | Ga0501036_0083767 | 3300049572 | Bacteria | 2696 |
| 1148 | Ga0501037_0001918 | 3300049573 | Bacteria | 15085 |
| 1149 | Ga0501038_0019238 | 3300049574 | Bacteria | 6159 |
| 1150 | Ga0501038_0198598 | 3300049574 | Bacteria | 1611 |
| 1151 | Ga0501039_0121032 | 3300049575 | Bacteria | 2051 |
| 1152 | Ga0501040_0088966 | 3300049576 | Bacteria | 2145 |
| 1153 | Ga0501040_0509060 | 3300049576 | Bacteria | 868 |
| 1154 | Ga0501042_0818738 | 3300049578 | Bacteria | 678 |
| 1155 | Ga0501046_0229489 | 3300049580 | Bacteria | 1372 |
| 1156 | Ga0501047_0033218 | 3300049581 | Bacteria | 4980 |
| 1157 | Ga0501047_0628769 | 3300049581 | Bacteria | 894 |
| 1158 | Ga0501048_0017587 | 3300049582 | Bacteria | 5264 |
| 1159 | Ga0501048_0075654 | 3300049582 | Bacteria | 2376 |
| 1160 | Ga0501048_0362725 | 3300049582 | Bacteria | 1034 |
| 1161 | Ga0501067_0064621 | 3300049583 | Bacteria | 2026 |
| 1162 | Ga0501067_0129961 | 3300049583 | Bacteria | 1402 |
| 1163 | Ga0501068_0078516 | 3300049584 | Bacteria | 2023 |
| 1164 | Ga0501068_0657026 | 3300049584 | Bacteria | 685 |
| 1165 | Ga0501071_0018420 | 3300049587 | Bacteria | 4834 |
| 1166 | Ga0501071_0164909 | 3300049587 | Bacteria | 1657 |
| 1167 | Ga0501071_0392541 | 3300049587 | Bacteria | 1059 |
| 1168 | Ga0501072_0079503 | 3300049588 | Bacteria | 2597 |
| 1169 | Ga0501072_0114164 | 3300049588 | Bacteria | 2150 |
| 1170 | Ga0501073_0009833 | 3300049589 | Bacteria | 7039 |
| 1171 | Ga0501073_0199830 | 3300049589 | Bacteria | 1382 |
| 1172 | Ga0501074_0002140 | 3300049590 | Bacteria | 13659 |
| 1173 | Ga0501075_0042052 | 3300049591 | Bacteria | 3426 |
| 1174 | Ga0501075_0083880 | 3300049591 | Bacteria | 2413 |
| 1175 | Ga0501075_0504443 | 3300049591 | Bacteria | 923 |
| 1176 | Ga0501075_0551589 | 3300049591 | Bacteria | 880 |
| 1177 | Ga0501076_0019380 | 3300049592 | Bacteria | 5201 |
| 1178 | Ga0501076_0297910 | 3300049592 | Bacteria | 1322 |
| 1179 | Ga0501077_0206050 | 3300049593 | Bacteria | 1250 |
| 1180 | Ga0501206_017533 | 3300049653 | Bacteria | 1003 |
| 1181 | Ga0501208_015304 | 3300049655 | Bacteria | 1176 |
| 1182 | Ga0501221_048680 | 3300049704 | Bacteria | 949 |
| 1183 | Ga0501225_0215129 | 3300049705 | Bacteria | 616 |
| 1184 | Ga0501079_0039652 | 3300049741 | Bacteria | 3632 |
| 1185 | Ga0501079_0971486 | 3300049741 | Bacteria | 669 |
| 1186 | Ga0501080_0004016 | 3300049742 | Bacteria | 13028 |
| 1187 | Ga0501080_0139067 | 3300049742 | Bacteria | 2246 |
| 1188 | Ga0501080_0150585 | 3300049742 | Bacteria | 2151 |
| 1189 | Ga0501080_0169697 | 3300049742 | Bacteria | 2013 |
| 1190 | Ga0501080_0361261 | 3300049742 | Bacteria | 1310 |
| 1191 | Ga0501080_0402220 | 3300049742 | Bacteria | 1232 |
| 1192 | Ga0501081_0042874 | 3300049743 | Bacteria | 3102 |
| 1193 | Ga0501081_0286507 | 3300049743 | Bacteria | 1207 |
| 1194 | Ga0501081_1115911 | 3300049743 | Bacteria | 597 |
| 1195 | Ga0501083_0071428 | 3300049744 | Bacteria | 2308 |
| 1196 | Ga0501083_0208275 | 3300049744 | Bacteria | 1275 |
| 1197 | Ga0501083_0232787 | 3300049744 | Bacteria | 1200 |
| 1198 | Ga0501083_0521086 | 3300049744 | Bacteria | 774 |
| 1199 | Ga0501035_1118227 | 3300049822 | Bacteria | 615 |
| 1200 | Ga0501044_0007741 | 3300049823 | Bacteria | 11812 |
| 1201 | Ga0501044_0144781 | 3300049823 | Bacteria | 2363 |
| 1202 | Ga0501045_0054880 | 3300049824 | Bacteria | 2914 |
| 1203 | Ga0501045_0091755 | 3300049824 | Bacteria | 2245 |
| 1204 | Ga0501045_0093809 | 3300049824 | Bacteria | 2220 |
| 1205 | Ga0501045_0417026 | 3300049824 | Bacteria | 999 |
| 1206 | Ga0501045_0879131 | 3300049824 | Bacteria | 659 |
| 1207 | nmdc:mga0k408_14443_c1 | 3300050493 | Bacteria | 4352 |
| 1208 | nmdc:mga06z11_177784_c1 | 3300050494 | Bacteria | 1225 |
| 1209 | nmdc:mga07m45_131724_c1 | 3300050496 | Bacteria | 1447 |
| 1210 | nmdc:mga05p37_1055797_c1 | 3300050507 | Bacteria | 856 |
| 1211 | nmdc:mga05p37_1157389_c1 | 3300050507 | Bacteria | 804 |
| 1212 | nmdc:mga05p37_17014_c1 | 3300050507 | Bacteria | 8769 |
| 1213 | nmdc:mga05p37_1701_c1 | 3300050507 | Bacteria | 25630 |
| 1214 | nmdc:mga05p37_262169_c1 | 3300050507 | Bacteria | 2068 |
| 1215 | nmdc:mga05p37_28557_c1 | 3300050507 | Bacteria | 6803 |
| 1216 | nmdc:mga05p37_430068_c1 | 3300050507 | Bacteria | 1534 |
| 1217 | nmdc:mga05p37_49078_c1 | 3300050507 | Bacteria | 5191 |
| 1218 | nmdc:mga05p37_497302_c1 | 3300050507 | Bacteria | 1400 |
| 1219 | nmdc:mga05p37_53231_c1 | 3300050507 | Bacteria | 4977 |
| 1220 | nmdc:mga09592_296147_c1 | 3300050508 | Bacteria | 1403 |
| 1221 | nmdc:mga09592_302628_c1 | 3300050508 | Bacteria | 1386 |
| 1222 | nmdc:mga09592_400481_c1 | 3300050508 | Bacteria | 1186 |
| 1223 | nmdc:mga09592_521261_c1 | 3300050508 | Bacteria | 1022 |
| 1224 | nmdc:mga09592_598506_c1 | 3300050508 | Bacteria | 945 |
| 1225 | nmdc:mga09592_634272_c1 | 3300050508 | Bacteria | 913 |
| 1226 | nmdc:mga09592_88599_c1 | 3300050508 | Bacteria | 2643 |
| 1227 | nmdc:mga0qj67_246174_c1 | 3300050509 | Bacteria | 1450 |
| 1228 | nmdc:mga0qj67_30909_c1 | 3300050509 | Bacteria | 4170 |
| 1229 | nmdc:mga06r32_14172_c1 | 3300050510 | Bacteria | 7230 |
| 1230 | nmdc:mga06r32_15501_c1 | 3300050510 | Bacteria | 6920 |
| 1231 | nmdc:mga06r32_367114_c1 | 3300050510 | Bacteria | 1423 |
| 1232 | nmdc:mga06r32_5062_c1 | 3300050510 | Bacteria | 11871 |
| 1233 | nmdc:mga08y16_175859_c1 | 3300050511 | Bacteria | 2223 |
| 1234 | nmdc:mga08y16_24_c1 | 3300050511 | Bacteria | 240846 |
| 1235 | nmdc:mga08y16_5130_c1 | 3300050511 | Bacteria | 13690 |
| 1236 | nmdc:mga0n895_15345_c1 | 3300050512 | Bacteria | 6981 |
| 1237 | nmdc:mga0n895_165230_c1 | 3300050512 | Bacteria | 2245 |
| 1238 | nmdc:mga0n895_227259_c1 | 3300050512 | Bacteria | 1894 |
| 1239 | nmdc:mga0n895_24370_c1 | 3300050512 | Bacteria | 5701 |
| 1240 | nmdc:mga0n895_292027_c1 | 3300050512 | Unclassified | 1653 |
| 1241 | nmdc:mga0n895_459873_c1 | 3300050512 | Bacteria | 1284 |
| 1242 | nmdc:mga0n895_629021_c1 | 3300050512 | Bacteria | 1074 |
| 1243 | nmdc:mga0n895_682568_c1 | 3300050512 | Bacteria | 1024 |
| 1244 | nmdc:mga0n895_71961_c1 | 3300050512 | Bacteria | 3429 |
| 1245 | nmdc:mga0n895_938046_c1 | 3300050512 | Bacteria | 849 |
| 1246 | nmdc:mga0rr50_116_c1 | 3300050513 | Bacteria | 44002 |
| 1247 | nmdc:mga0rr50_433462_c1 | 3300050513 | Bacteria | 1113 |
| 1248 | nmdc:mga08x19_40_c1 | 3300050514 | Bacteria | 154170 |
| 1249 | nmdc:mga08x19_87268_c1 | 3300050514 | Bacteria | 2055 |
| 1250 | nmdc:mga0a205_1228_c1 | 3300050515 | Bacteria | 21495 |
| 1251 | nmdc:mga0a205_234689_c1 | 3300050515 | Bacteria | 1716 |
| 1252 | nmdc:mga0a205_245638_c1 | 3300050515 | Bacteria | 1670 |
| 1253 | nmdc:mga0a205_27799_c1 | 3300050515 | Bacteria | 5403 |
| 1254 | nmdc:mga0a205_35735_c1 | 3300050515 | Bacteria | 4312 |
| 1255 | nmdc:mga0a205_410039_c1 | 3300050515 | Bacteria | 1218 |
| 1256 | nmdc:mga0a205_478841_c1 | 3300050515 | Unclassified | 1103 |
| 1257 | nmdc:mga0a205_8807_c1 | 3300050515 | Bacteria | 9192 |
| 1258 | Ga0495601_0077447 | 3300053077 | Bacteria | 2129 |
| 1259 | Ga0495601_0177031 | 3300053077 | Bacteria | 1394 |
| 1260 | Ga0495601_0206776 | 3300053077 | Bacteria | 1282 |
| 1261 | Ga0495612_0009262 | 3300053078 | Bacteria | 3995 |
| 1262 | Ga0495612_0113656 | 3300053078 | Bacteria | 1161 |
| 1263 | Ga0500635_0007996 | 3300053080 | Bacteria | 2885 |
| 1264 | Ga0495655_0009219 | 3300053083 | Bacteria | 1905 |
| 1265 | Ga0495595_0003797 | 3300053084 | Bacteria | 6011 |
| 1266 | Ga0495619_0002703 | 3300053085 | Bacteria | 11595 |
| 1267 | Ga0495619_0071086 | 3300053085 | Bacteria | 2328 |
| 1268 | Ga0500643_005686 | 3300053087 | Bacteria | 5324 |
| 1269 | Ga0500566_0106700 | 3300053094 | Bacteria | 1528 |
| 1270 | Ga0500650_0081666 | 3300053098 | Bacteria | 1512 |
| 1271 | Ga0500650_0156728 | 3300053098 | Bacteria | 1051 |
| 1272 | Ga0500556_0000107 | 3300053104 | Bacteria | 74228 |
| 1273 | Ga0500569_011302 | 3300053109 | Bacteria | 2128 |
| 1274 | Ga0500614_033703 | 3300053123 | Bacteria | 1267 |
| 1275 | Ga0500642_0000007 | 3300053130 | Bacteria | 294238 |
| 1276 | Ga0500559_0013950 | 3300053136 | Bacteria | 3396 |
| 1277 | Ga0500568_0002264 | 3300053139 | Bacteria | 11497 |
| 1278 | Ga0500616_0000499 | 3300053153 | Bacteria | 50346 |
| 1279 | Ga0500620_017136 | 3300053155 | Bacteria | 2085 |
| 1280 | Ga0501084_0021102 | 3300054114 | Bacteria | 5432 |
| 1281 | Ga0501084_0074131 | 3300054114 | Bacteria | 2850 |
| 1282 | Ga0501084_0273530 | 3300054114 | Bacteria | 1426 |
| 1283 | Ga0590071_111659 | 3300059421 | Bacteria | 694 |
| 1284 | Ga0587084_009768 | 3300059477 | Bacteria | 1247 |
| 1285 | Ga0587084_016481 | 3300059477 | Bacteria | 1055 |
| 1286 | Ga0587093_006640 | 3300059478 | Bacteria | 1268 |
| 1287 | Ga0587066_011018 | 3300059490 | Bacteria | 1318 |
| 1288 | Ga0587070_011201 | 3300059491 | Bacteria | 1337 |
| 1289 | Ga0587070_021744 | 3300059491 | Bacteria | 1086 |
| 1290 | Ga0587073_0024911 | 3300059492 | Bacteria | 1186 |
| 1291 | Ga0587080_004278 | 3300059503 | Bacteria | 1842 |
| 1292 | Ga0587082_003869 | 3300059504 | Bacteria | 1834 |
| 1293 | Ga0587082_051374 | 3300059504 | Bacteria | 787 |
| 1294 | Ga0587083_0120053 | 3300059505 | Bacteria | 678 |
| 1295 | Ga0587085_000796 | 3300059506 | Bacteria | 2596 |
| 1296 | Ga0587085_008385 | 3300059506 | Bacteria | 1317 |
| 1297 | Ga0587088_005875 | 3300059508 | Bacteria | 1633 |
| 1298 | Ga0587088_011865 | 3300059508 | Bacteria | 1307 |
| 1299 | Ga0587090_007706 | 3300059510 | Bacteria | 1422 |
| 1300 | Ga0587091_013781 | 3300059511 | Bacteria | 1305 |
| 1301 | Ga0587092_021364 | 3300059512 | Bacteria | 1004 |
| 1302 | Ga0587094_000627 | 3300059513 | Bacteria | 2903 |
| 1303 | Ga0587101_007952 | 3300059623 | Bacteria | 1267 |
| 1304 | Ga0587109_006059 | 3300059624 | Bacteria | 1767 |
| 1305 | Ga0587109_030000 | 3300059624 | Unclassified | 1026 |
| 1306 | Ga0587117_002125 | 3300059627 | Bacteria | 1804 |
| 1307 | Ga0587062_000749 | 3300059639 | Bacteria | 2480 |
| 1308 | Ga0587068_003778 | 3300059641 | Bacteria | 1962 |
| 1309 | Ga0587072_014285 | 3300059643 | Bacteria | 1336 |
| 1310 | Ga0587072_014729 | 3300059643 | Bacteria | 1320 |
| 1311 | Ga0587076_004008 | 3300059645 | Bacteria | 1807 |
| 1312 | Ga0587100_002195 | 3300059648 | Bacteria | 1233 |
| 1313 | Ga0587107_045475 | 3300059652 | Bacteria | 726 |
| 1314 | Ga0587124_004632 | 3300059660 | Bacteria | 1069 |
| 1315 | Ga0587124_004682 | 3300059660 | Bacteria | 1066 |
| 1316 | Ga0587071_012931 | 3300060344 | Bacteria | 1431 |
| 1317 | Ga0587111_0002564 | 3300060346 | Bacteria | 2447 |
| 1318 | Ga0587111_0006696 | 3300060346 | Bacteria | 1840 |
| 1319 | Ga0587111_0063471 | 3300060346 | Bacteria | 846 |
| 1320 | Ga0501082_0010286 | 3300060353 | Bacteria | 8053 |
| 1321 | Ga0501082_0075942 | 3300060353 | Bacteria | 2895 |
| 1322 | Ga0501082_1494493 | 3300060353 | Bacteria | 590 |
| 1323 | Ga0466962_0054472 | 3300061719 | Bacteria | 1911 |
| 1324 | Ga0530510_0071285 | 3300061734 | Bacteria | 2522 |
| 1325 | Ga0530510_0572320 | 3300061734 | Bacteria | 859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10009375 | Ga0070709_100093756 | 178 |
| 2 | 3300005435 | Ga0070714_100004105 | Ga0070714_10000410513 | 178 |
| 3 | 3300005436 | Ga0070713_100009715 | Ga0070713_1000097159 | 178 |
| 4 | 3300005436 | Ga0070713_100447613 | Ga0070713_1004476132 | 178 |
| 5 | 3300005437 | Ga0070710_10010725 | Ga0070710_100107253 | 178 |
| 6 | 3300005437 | Ga0070710_10029534 | Ga0070710_100295343 | 178 |
| 7 | 3300005437 | Ga0070710_10090324 | Ga0070710_100903244 | 178 |
| 8 | 3300005439 | Ga0070711_100033377 | Ga0070711_1000333776 | 178 |
| 9 | 3300005439 | Ga0070711_100812563 | Ga0070711_1008125631 | 178 |
| 10 | 3300005471 | Ga0070698_100039432 | Ga0070698_1000394326 | 178 |
| 11 | 3300005536 | Ga0070697_100250256 | Ga0070697_1002502562 | 178 |
| 12 | 3300005564 | Ga0070664_100361144 | Ga0070664_1003611442 | 178 |
| 13 | 3300005577 | Ga0068857_101166759 | Ga0068857_1011667591 | 178 |
| 14 | 3300005616 | Ga0068852_100719697 | Ga0068852_1007196972 | 178 |
| 15 | 3300005618 | Ga0068864_100494591 | Ga0068864_1004945912 | 178 |
| 16 | 3300005841 | Ga0068863_101362902 | Ga0068863_1013629021 | 178 |
| 17 | 3300006175 | Ga0070712_100018095 | Ga0070712_1000180954 | 178 |
| 18 | 3300006175 | Ga0070712_100075018 | Ga0070712_1000750183 | 178 |
| 19 | 3300013306 | Ga0163162_10769470 | Ga0163162_107694703 | 178 |
| 20 | 3300021358 | Ga0213873_10199168 | Ga0213873_101991681 | 178 |
| 21 | 3300021441 | Ga0213871_10091176 | Ga0213871_100911762 | 178 |
| 22 | 3300025898 | Ga0207692_10004608 | Ga0207692_100046086 | 178 |
| 23 | 3300025906 | Ga0207699_10026834 | Ga0207699_100268345 | 178 |
| 24 | 3300025906 | Ga0207699_10168267 | Ga0207699_101682672 | 178 |
| 25 | 3300025915 | Ga0207693_10008823 | Ga0207693_1000882310 | 178 |
| 26 | 3300025915 | Ga0207693_10075253 | Ga0207693_100752536 | 178 |
| 27 | 3300025915 | Ga0207693_10104971 | Ga0207693_101049712 | 178 |
| 28 | 3300025916 | Ga0207663_10056484 | Ga0207663_100564842 | 178 |
| 29 | 3300025916 | Ga0207663_10584903 | Ga0207663_105849031 | 178 |
| 30 | 3300025928 | Ga0207700_10017186 | Ga0207700_100171866 | 178 |
| 31 | 3300025928 | Ga0207700_10037637 | Ga0207700_100376378 | 178 |
| 32 | 3300025929 | Ga0207664_10068004 | Ga0207664_100680043 | 178 |
| 33 | 3300025929 | Ga0207664_10867437 | Ga0207664_108674372 | 178 |
| 34 | 3300025939 | Ga0207665_10089277 | Ga0207665_100892776 | 178 |
| 35 | 3300026035 | Ga0207703_10449254 | Ga0207703_104492542 | 178 |
| 36 | 3300026116 | Ga0207674_10345588 | Ga0207674_103455882 | 178 |
| 37 | 3300028379 | Ga0268266_10758304 | Ga0268266_107583042 | 178 |
| 38 | 3300031595 | Ga0265313_10004521 | Ga0265313_1000452114 | 178 |
| 39 | 3300031711 | Ga0265314_10126045 | Ga0265314_101260453 | 178 |
| 40 | 3300035117 | Ga0373953_0069272 | Ga0373953_0069272_137_682 | 178 |
| 41 | 3300035410 | Ga0373924_0027067 | Ga0373924_0027067_79_624 | 178 |
| 42 | 3300035724 | Ga0373933_0383520 | Ga0373933_0383520_224_769 | 178 |
| 43 | 3300037853 | Ga0436364_0623666 | Ga0436364_0623666_62_637 | 178 |
| 44 | 3300037853 | Ga0436364_0863400 | Ga0436364_0863400_229_774 | 178 |
| 45 | 3300039437 | Ga0436365_1001167 | Ga0436365_1001167_24_590 | 178 |
| 46 | 3300039438 | Ga0436360_0328120 | Ga0436360_0328120_159_698 | 178 |
| 47 | 3300039438 | Ga0436360_0923015 | Ga0436360_0923015_2072_2617 | 178 |
| 48 | 3300039453 | Ga0436362_0260637 | Ga0436362_0260637_268_813 | 178 |
| 49 | 3300039453 | Ga0436362_0832964 | Ga0436362_0832964_236_781 | 178 |
| 50 | 3300042876 | Ga0451577_0000828 | Ga0451577_0000828_32994_33536 | 178 |
| 51 | 3300045976 | Ga0466967_0126564 | Ga0466967_0126564_473_1018 | 178 |
| 52 | 3300049571 | Ga0501034_0050937 | Ga0501034_0050937_963_1526 | 178 |
| 53 | 3300049581 | Ga0501047_0628769 | Ga0501047_0628769_25_564 | 178 |
| 54 | 3300049742 | Ga0501080_0139067 | Ga0501080_0139067_835_1377 | 178 |
| 55 | 3300049742 | Ga0501080_0402220 | Ga0501080_0402220_414_959 | 178 |
| 56 | 3300053077 | Ga0495601_0206776 | Ga0495601_0206776_337_882 | 178 |
| 57 | 3300053085 | Ga0495619_0071086 | Ga0495619_0071086_156_701 | 178 |
| 58 | 3300005289 | Ga0065704_10091784 | Ga0065704_100917842 | 179 |
| 59 | 3300005295 | Ga0065707_10094039 | Ga0065707_100940394 | 179 |
| 60 | 3300005330 | Ga0070690_100115551 | Ga0070690_1001155513 | 179 |
| 61 | 3300005330 | Ga0070690_100159739 | Ga0070690_1001597393 | 179 |
| 62 | 3300005334 | Ga0068869_100024219 | Ga0068869_1000242195 | 179 |
| 63 | 3300005335 | Ga0070666_10102938 | Ga0070666_101029383 | 179 |
| 64 | 3300005335 | Ga0070666_10507546 | Ga0070666_105075462 | 179 |
| 65 | 3300005336 | Ga0070680_100246401 | Ga0070680_1002464012 | 179 |
| 66 | 3300005336 | Ga0070680_100766455 | Ga0070680_1007664552 | 179 |
| 67 | 3300005337 | Ga0070682_100155089 | Ga0070682_1001550891 | 179 |
| 68 | 3300005338 | Ga0068868_100045599 | Ga0068868_1000455991 | 179 |
| 69 | 3300005338 | Ga0068868_100058678 | Ga0068868_1000586785 | 179 |
| 70 | 3300005338 | Ga0068868_100244098 | Ga0068868_1002440983 | 179 |
| 71 | 3300005338 | Ga0068868_100968036 | Ga0068868_1009680361 | 179 |
| 72 | 3300005339 | Ga0070660_100019074 | Ga0070660_1000190747 | 179 |
| 73 | 3300005339 | Ga0070660_100355169 | Ga0070660_1003551692 | 179 |
| 74 | 3300005340 | Ga0070689_100021710 | Ga0070689_1000217108 | 179 |
| 75 | 3300005340 | Ga0070689_100190030 | Ga0070689_1001900302 | 179 |
| 76 | 3300005344 | Ga0070661_100053245 | Ga0070661_1000532454 | 179 |
| 77 | 3300005354 | Ga0070675_100036517 | Ga0070675_1000365173 | 179 |
| 78 | 3300005355 | Ga0070671_100778352 | Ga0070671_1007783522 | 179 |
| 79 | 3300005356 | Ga0070674_100415638 | Ga0070674_1004156381 | 179 |
| 80 | 3300005365 | Ga0070688_100229472 | Ga0070688_1002294721 | 179 |
| 81 | 3300005366 | Ga0070659_100010189 | Ga0070659_1000101893 | 179 |
| 82 | 3300005367 | Ga0070667_100045119 | Ga0070667_1000451194 | 179 |
| 83 | 3300005367 | Ga0070667_100096799 | Ga0070667_1000967995 | 179 |
| 84 | 3300005367 | Ga0070667_100191169 | Ga0070667_1001911694 | 179 |
| 85 | 3300005367 | Ga0070667_100436951 | Ga0070667_1004369511 | 179 |
| 86 | 3300005406 | Ga0070703_10000427 | Ga0070703_1000042719 | 179 |
| 87 | 3300005406 | Ga0070703_10077638 | Ga0070703_100776383 | 179 |
| 88 | 3300005434 | Ga0070709_10136421 | Ga0070709_101364213 | 179 |
| 89 | 3300005434 | Ga0070709_10471596 | Ga0070709_104715962 | 179 |
| 90 | 3300005435 | Ga0070714_100019115 | Ga0070714_1000191152 | 179 |
| 91 | 3300005438 | Ga0070701_10188587 | Ga0070701_101885872 | 179 |
| 92 | 3300005441 | Ga0070700_100278482 | Ga0070700_1002784821 | 179 |
| 93 | 3300005444 | Ga0070694_100001132 | Ga0070694_10000113215 | 179 |
| 94 | 3300005444 | Ga0070694_100038571 | Ga0070694_1000385715 | 179 |
| 95 | 3300005445 | Ga0070708_100388002 | Ga0070708_1003880023 | 179 |
| 96 | 3300005445 | Ga0070708_101469904 | Ga0070708_1014699041 | 179 |
| 97 | 3300005458 | Ga0070681_10047524 | Ga0070681_100475246 | 179 |
| 98 | 3300005458 | Ga0070681_10287200 | Ga0070681_102872004 | 179 |
| 99 | 3300005458 | Ga0070681_10312633 | Ga0070681_103126332 | 179 |
| 100 | 3300005459 | Ga0068867_100068643 | Ga0068867_1000686434 | 179 |
| 101 | 3300005466 | Ga0070685_10179176 | Ga0070685_101791762 | 179 |
| 102 | 3300005467 | Ga0070706_100308008 | Ga0070706_1003080082 | 179 |
| 103 | 3300005467 | Ga0070706_100394110 | Ga0070706_1003941101 | 179 |
| 104 | 3300005468 | Ga0070707_100008651 | Ga0070707_10000865115 | 179 |
| 105 | 3300005468 | Ga0070707_101106659 | Ga0070707_1011066591 | 179 |
| 106 | 3300005468 | Ga0070707_101344140 | Ga0070707_1013441401 | 179 |
| 107 | 3300005471 | Ga0070698_100000084 | Ga0070698_10000008469 | 179 |
| 108 | 3300005471 | Ga0070698_100029263 | Ga0070698_1000292637 | 179 |
| 109 | 3300005518 | Ga0070699_100171924 | Ga0070699_1001719243 | 179 |
| 110 | 3300005530 | Ga0070679_100030062 | Ga0070679_1000300627 | 179 |
| 111 | 3300005530 | Ga0070679_100153303 | Ga0070679_1001533032 | 179 |
| 112 | 3300005535 | Ga0070684_101085047 | Ga0070684_1010850472 | 179 |
| 113 | 3300005536 | Ga0070697_100030441 | Ga0070697_1000304414 | 179 |
| 114 | 3300005536 | Ga0070697_100936537 | Ga0070697_1009365371 | 179 |
| 115 | 3300005539 | Ga0068853_100016886 | Ga0068853_1000168869 | 179 |
| 116 | 3300005539 | Ga0068853_100325030 | Ga0068853_1003250302 | 179 |
| 117 | 3300005539 | Ga0068853_100330010 | Ga0068853_1003300103 | 179 |
| 118 | 3300005539 | Ga0068853_100562825 | Ga0068853_1005628252 | 179 |
| 119 | 3300005544 | Ga0070686_100188740 | Ga0070686_1001887403 | 179 |
| 120 | 3300005545 | Ga0070695_100104477 | Ga0070695_1001044773 | 179 |
| 121 | 3300005545 | Ga0070695_100239366 | Ga0070695_1002393661 | 179 |
| 122 | 3300005545 | Ga0070695_100408605 | Ga0070695_1004086052 | 179 |
| 123 | 3300005545 | Ga0070695_100584665 | Ga0070695_1005846652 | 179 |
| 124 | 3300005546 | Ga0070696_100062295 | Ga0070696_1000622952 | 179 |
| 125 | 3300005547 | Ga0070693_100042808 | Ga0070693_1000428084 | 179 |
| 126 | 3300005547 | Ga0070693_100312066 | Ga0070693_1003120661 | 179 |
| 127 | 3300005548 | Ga0070665_100015455 | Ga0070665_10001545515 | 179 |
| 128 | 3300005548 | Ga0070665_100039969 | Ga0070665_1000399698 | 179 |
| 129 | 3300005549 | Ga0070704_100058068 | Ga0070704_1000580681 | 179 |
| 130 | 3300005549 | Ga0070704_100142767 | Ga0070704_1001427672 | 179 |
| 131 | 3300005549 | Ga0070704_100158890 | Ga0070704_1001588902 | 179 |
| 132 | 3300005563 | Ga0068855_100002256 | Ga0068855_1000022563 | 179 |
| 133 | 3300005563 | Ga0068855_100135013 | Ga0068855_1001350136 | 179 |
| 134 | 3300005563 | Ga0068855_101171064 | Ga0068855_1011710642 | 179 |
| 135 | 3300005564 | Ga0070664_100108268 | Ga0070664_1001082682 | 179 |
| 136 | 3300005577 | Ga0068857_100084727 | Ga0068857_1000847276 | 179 |
| 137 | 3300005577 | Ga0068857_100233814 | Ga0068857_1002338144 | 179 |
| 138 | 3300005614 | Ga0068856_100073064 | Ga0068856_1000730641 | 179 |
| 139 | 3300005615 | Ga0070702_100076187 | Ga0070702_1000761872 | 179 |
| 140 | 3300005615 | Ga0070702_100160357 | Ga0070702_1001603571 | 179 |
| 141 | 3300005616 | Ga0068852_100491550 | Ga0068852_1004915501 | 179 |
| 142 | 3300005617 | Ga0068859_100006061 | Ga0068859_10000606112 | 179 |
| 143 | 3300005617 | Ga0068859_100117976 | Ga0068859_1001179762 | 179 |
| 144 | 3300005618 | Ga0068864_100017558 | Ga0068864_1000175582 | 179 |
| 145 | 3300005618 | Ga0068864_100018412 | Ga0068864_1000184127 | 179 |
| 146 | 3300005618 | Ga0068864_100053223 | Ga0068864_1000532233 | 179 |
| 147 | 3300005718 | Ga0068866_10000684 | Ga0068866_100006844 | 179 |
| 148 | 3300005718 | Ga0068866_10781779 | Ga0068866_107817791 | 179 |
| 149 | 3300005719 | Ga0068861_100069342 | Ga0068861_1000693424 | 179 |
| 150 | 3300005834 | Ga0068851_10045673 | Ga0068851_100456734 | 179 |
| 151 | 3300005840 | Ga0068870_10277622 | Ga0068870_102776222 | 179 |
| 152 | 3300005841 | Ga0068863_100050660 | Ga0068863_1000506608 | 179 |
| 153 | 3300005841 | Ga0068863_100104622 | Ga0068863_1001046223 | 179 |
| 154 | 3300005841 | Ga0068863_100335315 | Ga0068863_1003353153 | 179 |
| 155 | 3300005842 | Ga0068858_100030046 | Ga0068858_1000300467 | 179 |
| 156 | 3300005842 | Ga0068858_100060954 | Ga0068858_1000609544 | 179 |
| 157 | 3300005842 | Ga0068858_100129609 | Ga0068858_1001296093 | 179 |
| 158 | 3300005842 | Ga0068858_100241418 | Ga0068858_1002414183 | 179 |
| 159 | 3300005842 | Ga0068858_100466781 | Ga0068858_1004667812 | 179 |
| 160 | 3300005842 | Ga0068858_100660916 | Ga0068858_1006609162 | 179 |
| 161 | 3300005843 | Ga0068860_100036229 | Ga0068860_1000362297 | 179 |
| 162 | 3300005843 | Ga0068860_100138962 | Ga0068860_1001389625 | 179 |
| 163 | 3300005843 | Ga0068860_100173905 | Ga0068860_1001739054 | 179 |
| 164 | 3300005843 | Ga0068860_100227613 | Ga0068860_1002276133 | 179 |
| 165 | 3300005843 | Ga0068860_100630527 | Ga0068860_1006305271 | 179 |
| 166 | 3300005844 | Ga0068862_100019818 | Ga0068862_1000198182 | 179 |
| 167 | 3300005985 | Ga0081539_10048025 | Ga0081539_100480253 | 179 |
| 168 | 3300006163 | Ga0070715_10000038 | Ga0070715_1000003864 | 179 |
| 169 | 3300006173 | Ga0070716_100000006 | Ga0070716_100000006240 | 179 |
| 170 | 3300006173 | Ga0070716_100112969 | Ga0070716_1001129692 | 179 |
| 171 | 3300006237 | Ga0097621_100148746 | Ga0097621_1001487461 | 179 |
| 172 | 3300006237 | Ga0097621_100267095 | Ga0097621_1002670952 | 179 |
| 173 | 3300006237 | Ga0097621_100314685 | Ga0097621_1003146851 | 179 |
| 174 | 3300006237 | Ga0097621_100537624 | Ga0097621_1005376242 | 179 |
| 175 | 3300006358 | Ga0068871_100193630 | Ga0068871_1001936304 | 179 |
| 176 | 3300006358 | Ga0068871_100544580 | Ga0068871_1005445801 | 179 |
| 177 | 3300006358 | Ga0068871_100600343 | Ga0068871_1006003432 | 179 |
| 178 | 3300006844 | Ga0075428_100090316 | Ga0075428_1000903164 | 179 |
| 179 | 3300006846 | Ga0075430_100289235 | Ga0075430_1002892352 | 179 |
| 180 | 3300006852 | Ga0075433_10117851 | Ga0075433_101178514 | 179 |
| 181 | 3300006871 | Ga0075434_100108899 | Ga0075434_1001088992 | 179 |
| 182 | 3300006880 | Ga0075429_100053365 | Ga0075429_1000533654 | 179 |
| 183 | 3300006881 | Ga0068865_100113414 | Ga0068865_1001134145 | 179 |
| 184 | 3300006914 | Ga0075436_100000017 | Ga0075436_10000001710 | 179 |
| 185 | 3300006931 | Ga0097620_100006061 | Ga0097620_10000606112 | 179 |
| 186 | 3300006931 | Ga0097620_100117967 | Ga0097620_1001179675 | 179 |
| 187 | 3300007076 | Ga0075435_100006806 | Ga0075435_10000680615 | 179 |
| 188 | 3300007076 | Ga0075435_100773302 | Ga0075435_1007733021 | 179 |
| 189 | 3300007265 | Ga0099794_10157532 | Ga0099794_101575322 | 179 |
| 190 | 3300009093 | Ga0105240_11218503 | Ga0105240_112185031 | 179 |
| 191 | 3300009094 | Ga0111539_10005702 | Ga0111539_1000570215 | 179 |
| 192 | 3300009098 | Ga0105245_10234129 | Ga0105245_102341294 | 179 |
| 193 | 3300009098 | Ga0105245_10344030 | Ga0105245_103440303 | 179 |
| 194 | 3300009101 | Ga0105247_10142791 | Ga0105247_101427912 | 179 |
| 195 | 3300009147 | Ga0114129_10023849 | Ga0114129_1002384914 | 179 |
| 196 | 3300009147 | Ga0114129_11504603 | Ga0114129_115046031 | 179 |
| 197 | 3300009148 | Ga0105243_10000777 | Ga0105243_1000077733 | 179 |
| 198 | 3300009148 | Ga0105243_10085454 | Ga0105243_100854542 | 179 |
| 199 | 3300009148 | Ga0105243_10207725 | Ga0105243_102077254 | 179 |
| 200 | 3300009174 | Ga0105241_10017868 | Ga0105241_100178683 | 179 |
| 201 | 3300009174 | Ga0105241_10409529 | Ga0105241_104095292 | 179 |
| 202 | 3300009174 | Ga0105241_10898177 | Ga0105241_108981772 | 179 |
| 203 | 3300009176 | Ga0105242_10003416 | Ga0105242_100034168 | 179 |
| 204 | 3300009176 | Ga0105242_10065108 | Ga0105242_100651086 | 179 |
| 205 | 3300009177 | Ga0105248_10004070 | Ga0105248_100040703 | 179 |
| 206 | 3300009177 | Ga0105248_10138301 | Ga0105248_101383014 | 179 |
| 207 | 3300009177 | Ga0105248_10438568 | Ga0105248_104385683 | 179 |
| 208 | 3300009177 | Ga0105248_10611825 | Ga0105248_106118252 | 179 |
| 209 | 3300009177 | Ga0105248_10886601 | Ga0105248_108866011 | 179 |
| 210 | 3300009545 | Ga0105237_10047955 | Ga0105237_1004795510 | 179 |
| 211 | 3300009545 | Ga0105237_10284777 | Ga0105237_102847773 | 179 |
| 212 | 3300009545 | Ga0105237_10721327 | Ga0105237_107213273 | 179 |
| 213 | 3300009551 | Ga0105238_10013909 | Ga0105238_100139099 | 179 |
| 214 | 3300009551 | Ga0105238_10094337 | Ga0105238_100943376 | 179 |
| 215 | 3300009551 | Ga0105238_10880654 | Ga0105238_108806541 | 179 |
| 216 | 3300009553 | Ga0105249_10089304 | Ga0105249_100893044 | 179 |
| 217 | 3300009553 | Ga0105249_10945772 | Ga0105249_109457722 | 179 |
| 218 | 3300010159 | Ga0099796_10045790 | Ga0099796_100457901 | 179 |
| 219 | 3300010375 | Ga0105239_10034574 | Ga0105239_100345748 | 179 |
| 220 | 3300010375 | Ga0105239_10442356 | Ga0105239_104423563 | 179 |
| 221 | 3300010375 | Ga0105239_10592207 | Ga0105239_105922073 | 179 |
| 222 | 3300013100 | Ga0157373_10042642 | Ga0157373_100426424 | 179 |
| 223 | 3300013100 | Ga0157373_10173913 | Ga0157373_101739132 | 179 |
| 224 | 3300013104 | Ga0157370_10223850 | Ga0157370_102238504 | 179 |
| 225 | 3300013104 | Ga0157370_10525608 | Ga0157370_105256082 | 179 |
| 226 | 3300013105 | Ga0157369_10179579 | Ga0157369_101795794 | 179 |
| 227 | 3300013105 | Ga0157369_10705100 | Ga0157369_107051002 | 179 |
| 228 | 3300013105 | Ga0157369_10972711 | Ga0157369_109727112 | 179 |
| 229 | 3300013297 | Ga0157378_10006521 | Ga0157378_1000652114 | 179 |
| 230 | 3300013297 | Ga0157378_10037188 | Ga0157378_100371882 | 179 |
| 231 | 3300013297 | Ga0157378_10229478 | Ga0157378_102294782 | 179 |
| 232 | 3300013297 | Ga0157378_10286085 | Ga0157378_102860853 | 179 |
| 233 | 3300013297 | Ga0157378_10291716 | Ga0157378_102917162 | 179 |
| 234 | 3300013297 | Ga0157378_10386132 | Ga0157378_103861322 | 179 |
| 235 | 3300013297 | Ga0157378_11200549 | Ga0157378_112005491 | 179 |
| 236 | 3300013306 | Ga0163162_10002962 | Ga0163162_1000296222 | 179 |
| 237 | 3300013306 | Ga0163162_10171154 | Ga0163162_101711541 | 179 |
| 238 | 3300013306 | Ga0163162_10177522 | Ga0163162_101775225 | 179 |
| 239 | 3300013306 | Ga0163162_10432255 | Ga0163162_104322551 | 179 |
| 240 | 3300013306 | Ga0163162_10526900 | Ga0163162_105269003 | 179 |
| 241 | 3300013307 | Ga0157372_10106460 | Ga0157372_101064607 | 179 |
| 242 | 3300013308 | Ga0157375_10023497 | Ga0157375_100234976 | 179 |
| 243 | 3300013308 | Ga0157375_10103709 | Ga0157375_101037094 | 179 |
| 244 | 3300014325 | Ga0163163_10007538 | Ga0163163_1000753812 | 179 |
| 245 | 3300014325 | Ga0163163_10753571 | Ga0163163_107535711 | 179 |
| 246 | 3300014326 | Ga0157380_10095902 | Ga0157380_100959021 | 179 |
| 247 | 3300014968 | Ga0157379_10194166 | Ga0157379_101941663 | 179 |
| 248 | 3300014969 | Ga0157376_10242205 | Ga0157376_102422054 | 179 |
| 249 | 3300014969 | Ga0157376_11034652 | Ga0157376_110346522 | 179 |
| 250 | 3300017792 | Ga0163161_10019647 | Ga0163161_100196472 | 179 |
| 251 | 3300017792 | Ga0163161_10239116 | Ga0163161_102391162 | 179 |
| 252 | 3300017792 | Ga0163161_10358773 | Ga0163161_103587733 | 179 |
| 253 | 3300025321 | Ga0207656_10055538 | Ga0207656_100555382 | 179 |
| 254 | 3300025885 | Ga0207653_10000033 | Ga0207653_1000003310 | 179 |
| 255 | 3300025885 | Ga0207653_10076248 | Ga0207653_100762481 | 179 |
| 256 | 3300025899 | Ga0207642_10022056 | Ga0207642_100220566 | 179 |
| 257 | 3300025900 | Ga0207710_10519746 | Ga0207710_105197461 | 179 |
| 258 | 3300025901 | Ga0207688_10598914 | Ga0207688_105989141 | 179 |
| 259 | 3300025905 | Ga0207685_10000051 | Ga0207685_1000005140 | 179 |
| 260 | 3300025906 | Ga0207699_10008158 | Ga0207699_100081589 | 179 |
| 261 | 3300025907 | Ga0207645_10359464 | Ga0207645_103594641 | 179 |
| 262 | 3300025910 | Ga0207684_10029417 | Ga0207684_100294175 | 179 |
| 263 | 3300025910 | Ga0207684_11169296 | Ga0207684_111692961 | 179 |
| 264 | 3300025911 | Ga0207654_10041690 | Ga0207654_100416902 | 179 |
| 265 | 3300025911 | Ga0207654_10450739 | Ga0207654_104507392 | 179 |
| 266 | 3300025911 | Ga0207654_11008106 | Ga0207654_110081061 | 179 |
| 267 | 3300025912 | Ga0207707_10018832 | Ga0207707_1001883211 | 179 |
| 268 | 3300025912 | Ga0207707_10047405 | Ga0207707_100474053 | 179 |
| 269 | 3300025912 | Ga0207707_10075513 | Ga0207707_100755136 | 179 |
| 270 | 3300025912 | Ga0207707_10138344 | Ga0207707_101383442 | 179 |
| 271 | 3300025913 | Ga0207695_10140217 | Ga0207695_101402174 | 179 |
| 272 | 3300025914 | Ga0207671_10060155 | Ga0207671_100601556 | 179 |
| 273 | 3300025914 | Ga0207671_10300698 | Ga0207671_103006983 | 179 |
| 274 | 3300025917 | Ga0207660_10076991 | Ga0207660_100769914 | 179 |
| 275 | 3300025918 | Ga0207662_10164177 | Ga0207662_101641772 | 179 |
| 276 | 3300025919 | Ga0207657_10003364 | Ga0207657_100033643 | 179 |
| 277 | 3300025920 | Ga0207649_10129753 | Ga0207649_101297533 | 179 |
| 278 | 3300025921 | Ga0207652_10047930 | Ga0207652_100479309 | 179 |
| 279 | 3300025921 | Ga0207652_10096220 | Ga0207652_100962203 | 179 |
| 280 | 3300025921 | Ga0207652_10637704 | Ga0207652_106377042 | 179 |
| 281 | 3300025922 | Ga0207646_10655207 | Ga0207646_106552071 | 179 |
| 282 | 3300025923 | Ga0207681_10900674 | Ga0207681_109006741 | 179 |
| 283 | 3300025924 | Ga0207694_10010354 | Ga0207694_1001035414 | 179 |
| 284 | 3300025927 | Ga0207687_10149550 | Ga0207687_101495501 | 179 |
| 285 | 3300025927 | Ga0207687_10159467 | Ga0207687_101594673 | 179 |
| 286 | 3300025929 | Ga0207664_10011372 | Ga0207664_100113724 | 179 |
| 287 | 3300025931 | Ga0207644_10000414 | Ga0207644_1000041415 | 179 |
| 288 | 3300025931 | Ga0207644_10291825 | Ga0207644_102918251 | 179 |
| 289 | 3300025932 | Ga0207690_10057507 | Ga0207690_100575073 | 179 |
| 290 | 3300025932 | Ga0207690_10120468 | Ga0207690_101204682 | 179 |
| 291 | 3300025934 | Ga0207686_10000005 | Ga0207686_1000000515 | 179 |
| 292 | 3300025934 | Ga0207686_10004022 | Ga0207686_1000402212 | 179 |
| 293 | 3300025935 | Ga0207709_10000133 | Ga0207709_1000013315 | 179 |
| 294 | 3300025936 | Ga0207670_10110917 | Ga0207670_101109171 | 179 |
| 295 | 3300025936 | Ga0207670_10285167 | Ga0207670_102851673 | 179 |
| 296 | 3300025939 | Ga0207665_10000005 | Ga0207665_10000005165 | 179 |
| 297 | 3300025939 | Ga0207665_10039267 | Ga0207665_100392676 | 179 |
| 298 | 3300025941 | Ga0207711_10004233 | Ga0207711_100042333 | 179 |
| 299 | 3300025941 | Ga0207711_10132896 | Ga0207711_101328964 | 179 |
| 300 | 3300025941 | Ga0207711_10306669 | Ga0207711_103066692 | 179 |
| 301 | 3300025941 | Ga0207711_10498167 | Ga0207711_104981672 | 179 |
| 302 | 3300025941 | Ga0207711_10560170 | Ga0207711_105601702 | 179 |
| 303 | 3300025942 | Ga0207689_10003268 | Ga0207689_1000326818 | 179 |
| 304 | 3300025942 | Ga0207689_10070209 | Ga0207689_100702094 | 179 |
| 305 | 3300025945 | Ga0207679_10534070 | Ga0207679_105340702 | 179 |
| 306 | 3300025949 | Ga0207667_10114447 | Ga0207667_101144474 | 179 |
| 307 | 3300025949 | Ga0207667_10142564 | Ga0207667_101425643 | 179 |
| 308 | 3300025960 | Ga0207651_10008745 | Ga0207651_100087454 | 179 |
| 309 | 3300025961 | Ga0207712_10633640 | Ga0207712_106336402 | 179 |
| 310 | 3300025981 | Ga0207640_10995760 | Ga0207640_109957601 | 179 |
| 311 | 3300025986 | Ga0207658_10254031 | Ga0207658_102540312 | 179 |
| 312 | 3300026023 | Ga0207677_10016453 | Ga0207677_100164534 | 179 |
| 313 | 3300026023 | Ga0207677_10471864 | Ga0207677_104718641 | 179 |
| 314 | 3300026035 | Ga0207703_10019029 | Ga0207703_100190299 | 179 |
| 315 | 3300026035 | Ga0207703_10020588 | Ga0207703_100205885 | 179 |
| 316 | 3300026035 | Ga0207703_10063129 | Ga0207703_100631296 | 179 |
| 317 | 3300026035 | Ga0207703_10064766 | Ga0207703_100647665 | 179 |
| 318 | 3300026035 | Ga0207703_10285132 | Ga0207703_102851323 | 179 |
| 319 | 3300026035 | Ga0207703_10446091 | Ga0207703_104460911 | 179 |
| 320 | 3300026041 | Ga0207639_10028396 | Ga0207639_100283963 | 179 |
| 321 | 3300026041 | Ga0207639_10220928 | Ga0207639_102209284 | 179 |
| 322 | 3300026041 | Ga0207639_10498747 | Ga0207639_104987472 | 179 |
| 323 | 3300026067 | Ga0207678_10542233 | Ga0207678_105422332 | 179 |
| 324 | 3300026067 | Ga0207678_10620838 | Ga0207678_106208382 | 179 |
| 325 | 3300026075 | Ga0207708_10164164 | Ga0207708_101641642 | 179 |
| 326 | 3300026078 | Ga0207702_10030901 | Ga0207702_1003090110 | 179 |
| 327 | 3300026088 | Ga0207641_10023693 | Ga0207641_100236936 | 179 |
| 328 | 3300026088 | Ga0207641_10085205 | Ga0207641_100852053 | 179 |
| 329 | 3300026088 | Ga0207641_11329213 | Ga0207641_113292131 | 179 |
| 330 | 3300026089 | Ga0207648_10281488 | Ga0207648_102814882 | 179 |
| 331 | 3300026089 | Ga0207648_10302052 | Ga0207648_103020521 | 179 |
| 332 | 3300026095 | Ga0207676_10009610 | Ga0207676_100096107 | 179 |
| 333 | 3300026095 | Ga0207676_10049891 | Ga0207676_100498912 | 179 |
| 334 | 3300026095 | Ga0207676_10086376 | Ga0207676_100863765 | 179 |
| 335 | 3300026095 | Ga0207676_10749478 | Ga0207676_107494782 | 179 |
| 336 | 3300026116 | Ga0207674_10013233 | Ga0207674_1001323316 | 179 |
| 337 | 3300026116 | Ga0207674_10018433 | Ga0207674_100184336 | 179 |
| 338 | 3300026116 | Ga0207674_10040581 | Ga0207674_100405812 | 179 |
| 339 | 3300026118 | Ga0207675_100001227 | Ga0207675_10000122728 | 179 |
| 340 | 3300026118 | Ga0207675_100629670 | Ga0207675_1006296701 | 179 |
| 341 | 3300026142 | Ga0207698_11300152 | Ga0207698_113001521 | 179 |
| 342 | 3300027876 | Ga0209974_10035385 | Ga0209974_100353852 | 179 |
| 343 | 3300027907 | Ga0207428_10007215 | Ga0207428_100072154 | 179 |
| 344 | 3300028379 | Ga0268266_10011799 | Ga0268266_100117993 | 179 |
| 345 | 3300028379 | Ga0268266_10043390 | Ga0268266_100433902 | 179 |
| 346 | 3300028379 | Ga0268266_10370969 | Ga0268266_103709691 | 179 |
| 347 | 3300028380 | Ga0268265_10691586 | Ga0268265_106915862 | 179 |
| 348 | 3300028381 | Ga0268264_10060239 | Ga0268264_100602395 | 179 |
| 349 | 3300028381 | Ga0268264_10079012 | Ga0268264_100790124 | 179 |
| 350 | 3300028381 | Ga0268264_10137708 | Ga0268264_101377083 | 179 |
| 351 | 3300028381 | Ga0268264_10201376 | Ga0268264_102013762 | 179 |
| 352 | 3300028381 | Ga0268264_10722154 | Ga0268264_107221542 | 179 |
| 353 | 3300028653 | Ga0265323_10034570 | Ga0265323_100345702 | 179 |
| 354 | 3300031239 | Ga0265328_10162384 | Ga0265328_101623842 | 179 |
| 355 | 3300031249 | Ga0265339_10141364 | Ga0265339_101413642 | 179 |
| 356 | 3300031344 | Ga0265316_10210287 | Ga0265316_102102874 | 179 |
| 357 | 3300031507 | Ga0307509_10363140 | Ga0307509_103631402 | 179 |
| 358 | 3300031548 | Ga0307408_100001928 | Ga0307408_10000192818 | 179 |
| 359 | 3300031548 | Ga0307408_101036508 | Ga0307408_1010365082 | 179 |
| 360 | 3300031665 | Ga0316575_10004333 | Ga0316575_100043336 | 179 |
| 361 | 3300031665 | Ga0316575_10021116 | Ga0316575_100211164 | 179 |
| 362 | 3300031665 | Ga0316575_10025775 | Ga0316575_100257754 | 179 |
| 363 | 3300031691 | Ga0316579_10003044 | Ga0316579_100030443 | 179 |
| 364 | 3300031691 | Ga0316579_10078475 | Ga0316579_100784753 | 179 |
| 365 | 3300031711 | Ga0265314_10009286 | Ga0265314_100092869 | 179 |
| 366 | 3300031712 | Ga0265342_10064957 | Ga0265342_100649573 | 179 |
| 367 | 3300031727 | Ga0316576_10002450 | Ga0316576_1000245015 | 179 |
| 368 | 3300031727 | Ga0316576_10003583 | Ga0316576_100035834 | 179 |
| 369 | 3300031727 | Ga0316576_10010549 | Ga0316576_100105495 | 179 |
| 370 | 3300031727 | Ga0316576_10046481 | Ga0316576_100464813 | 179 |
| 371 | 3300031727 | Ga0316576_10106373 | Ga0316576_101063732 | 179 |
| 372 | 3300031727 | Ga0316576_10238193 | Ga0316576_102381931 | 179 |
| 373 | 3300031728 | Ga0316578_10000551 | Ga0316578_1000055113 | 179 |
| 374 | 3300031728 | Ga0316578_10058133 | Ga0316578_100581332 | 179 |
| 375 | 3300031731 | Ga0307405_10003109 | Ga0307405_1000310912 | 179 |
| 376 | 3300031733 | Ga0316577_10002746 | Ga0316577_100027461 | 179 |
| 377 | 3300031733 | Ga0316577_10074607 | Ga0316577_100746073 | 179 |
| 378 | 3300031733 | Ga0316577_10517461 | Ga0316577_105174612 | 179 |
| 379 | 3300031824 | Ga0307413_10000449 | Ga0307413_1000044915 | 179 |
| 380 | 3300031824 | Ga0307413_10000549 | Ga0307413_1000054919 | 179 |
| 381 | 3300031824 | Ga0307413_10362313 | Ga0307413_103623131 | 179 |
| 382 | 3300031852 | Ga0307410_10001120 | Ga0307410_100011204 | 179 |
| 383 | 3300031852 | Ga0307410_10003798 | Ga0307410_100037986 | 179 |
| 384 | 3300031901 | Ga0307406_10157487 | Ga0307406_101574873 | 179 |
| 385 | 3300031901 | Ga0307406_10411940 | Ga0307406_104119402 | 179 |
| 386 | 3300031903 | Ga0307407_10001031 | Ga0307407_100010319 | 179 |
| 387 | 3300031903 | Ga0307407_10001139 | Ga0307407_100011397 | 179 |
| 388 | 3300031903 | Ga0307407_10946675 | Ga0307407_109466751 | 179 |
| 389 | 3300031911 | Ga0307412_10072234 | Ga0307412_100722343 | 179 |
| 390 | 3300031911 | Ga0307412_10177862 | Ga0307412_101778623 | 179 |
| 391 | 3300031911 | Ga0307412_10280859 | Ga0307412_102808592 | 179 |
| 392 | 3300031995 | Ga0307409_100003195 | Ga0307409_10000319511 | 179 |
| 393 | 3300032002 | Ga0307416_100016487 | Ga0307416_1000164874 | 179 |
| 394 | 3300032002 | Ga0307416_100035072 | Ga0307416_1000350726 | 179 |
| 395 | 3300032002 | Ga0307416_100099664 | Ga0307416_1000996643 | 179 |
| 396 | 3300032004 | Ga0307414_10034819 | Ga0307414_100348192 | 179 |
| 397 | 3300032004 | Ga0307414_10404202 | Ga0307414_104042022 | 179 |
| 398 | 3300032126 | Ga0307415_100053963 | Ga0307415_1000539634 | 179 |
| 399 | 3300032126 | Ga0307415_100276861 | Ga0307415_1002768612 | 179 |
| 400 | 3300032126 | Ga0307415_100399278 | Ga0307415_1003992783 | 179 |
| 401 | 3300032133 | Ga0316583_10015823 | Ga0316583_100158232 | 179 |
| 402 | 3300032133 | Ga0316583_10033936 | Ga0316583_100339364 | 179 |
| 403 | 3300032133 | Ga0316583_10118532 | Ga0316583_101185322 | 179 |
| 404 | 3300032133 | Ga0316583_10188662 | Ga0316583_101886621 | 179 |
| 405 | 3300032137 | Ga0316585_10001353 | Ga0316585_100013534 | 179 |
| 406 | 3300032137 | Ga0316585_10004948 | Ga0316585_100049482 | 179 |
| 407 | 3300032137 | Ga0316585_10057900 | Ga0316585_100579002 | 179 |
| 408 | 3300032139 | Ga0316580_10002359 | Ga0316580_100023599 | 179 |
| 409 | 3300032139 | Ga0316580_10026342 | Ga0316580_100263423 | 179 |
| 410 | 3300032168 | Ga0316593_10000033 | Ga0316593_1000003315 | 179 |
| 411 | 3300032168 | Ga0316593_10000122 | Ga0316593_1000012214 | 179 |
| 412 | 3300032168 | Ga0316593_10001783 | Ga0316593_100017838 | 179 |
| 413 | 3300032168 | Ga0316593_10002306 | Ga0316593_100023068 | 179 |
| 414 | 3300032168 | Ga0316593_10003721 | Ga0316593_100037215 | 179 |
| 415 | 3300033528 | Ga0316588_1033653 | Ga0316588_10336532 | 179 |
| 416 | 3300033541 | Ga0316596_1022948 | Ga0316596_10229482 | 179 |
| 417 | 3300033541 | Ga0316596_1036298 | Ga0316596_10362982 | 179 |
| 418 | 3300035398 | Ga0316574_0003671 | Ga0316574_0003671_6918_7460 | 179 |
| 419 | 3300035398 | Ga0316574_0006441 | Ga0316574_0006441_4470_5009 | 179 |
| 420 | 3300035398 | Ga0316574_0050430 | Ga0316574_0050430_589_1128 | 179 |
| 421 | 3300035398 | Ga0316574_0173136 | Ga0316574_0173136_223_762 | 179 |
| 422 | 3300035398 | Ga0316574_0468942 | Ga0316574_0468942_235_774 | 179 |
| 423 | 3300035398 | Ga0316574_0518551 | Ga0316574_0518551_24_566 | 179 |
| 424 | 3300036647 | Ga0316582_0003224 | Ga0316582_0003224_5887_6426 | 179 |
| 425 | 3300036647 | Ga0316582_0005211 | Ga0316582_0005211_5133_5672 | 179 |
| 426 | 3300036647 | Ga0316582_0100542 | Ga0316582_0100542_589_1128 | 179 |
| 427 | 3300036647 | Ga0316582_0176094 | Ga0316582_0176094_420_962 | 179 |
| 428 | 3300036647 | Ga0316582_0377240 | Ga0316582_0377240_267_809 | 179 |
| 429 | 3300036712 | Ga0316584_0002208 | Ga0316584_0002208_517_1059 | 179 |
| 430 | 3300036712 | Ga0316584_0045853 | Ga0316584_0045853_2300_2839 | 179 |
| 431 | 3300036712 | Ga0316584_0056894 | Ga0316584_0056894_826_1365 | 179 |
| 432 | 3300036712 | Ga0316584_0566156 | Ga0316584_0566156_174_713 | 179 |
| 433 | 3300037418 | Ga0395900_0180156 | Ga0395900_0180156_1166_1705 | 179 |
| 434 | 3300037471 | Ga0395905_0506042 | Ga0395905_0506042_227_766 | 179 |
| 435 | 3300037588 | Ga0316581_0010080 | Ga0316581_0010080_1544_2083 | 179 |
| 436 | 3300038443 | Ga0395901_0920942 | Ga0395901_0920942_252_800 | 179 |
| 437 | 3300038725 | Ga0400484_14002 | Ga0400484_14002_4488_5027 | 179 |
| 438 | 3300038726 | Ga0400490_30744 | Ga0400490_30744_19132_19671 | 179 |
| 439 | 3300038741 | Ga0400488_22380 | Ga0400488_22380_785_1324 | 179 |
| 440 | 3300039062 | Ga0400483_035845 | Ga0400483_035845_2433_2972 | 179 |
| 441 | 3300039062 | Ga0400483_281776 | Ga0400483_281776_6608_7147 | 179 |
| 442 | 3300039093 | Ga0400489_27072 | Ga0400489_27072_2076_2615 | 179 |
| 443 | 3300039093 | Ga0400489_86209 | Ga0400489_86209_2913_3452 | 179 |
| 444 | 3300039438 | Ga0436360_0163442 | Ga0436360_0163442_6003_6557 | 179 |
| 445 | 3300039450 | Ga0436363_0872043 | Ga0436363_0872043_419_958 | 179 |
| 446 | 3300041456 | Ga0451795_0157516 | Ga0451795_0157516_64_603 | 179 |
| 447 | 3300041486 | Ga0451807_0333339 | Ga0451807_0333339_153_692 | 179 |
| 448 | 3300042130 | Ga0450892_003270 | Ga0450892_003270_251_790 | 179 |
| 449 | 3300042876 | Ga0451577_0000004 | Ga0451577_0000004_566730_567269 | 179 |
| 450 | 3300044673 | Ga0453683_0000002 | Ga0453683_0000002_900229_900768 | 179 |
| 451 | 3300044673 | Ga0453683_0492208 | Ga0453683_0492208_146_685 | 179 |
| 452 | 3300044712 | Ga0453684_0000025 | Ga0453684_0000025_566758_567297 | 179 |
| 453 | 3300044712 | Ga0453684_0003637 | Ga0453684_0003637_5793_6332 | 179 |
| 454 | 3300044712 | Ga0453684_0005988 | Ga0453684_0005988_17311_17850 | 179 |
| 455 | 3300044712 | Ga0453684_0032497 | Ga0453684_0032497_6737_7276 | 179 |
| 456 | 3300044712 | Ga0453684_0140838 | Ga0453684_0140838_318_857 | 179 |
| 457 | 3300044712 | Ga0453684_0494279 | Ga0453684_0494279_87_626 | 179 |
| 458 | 3300045051 | Ga0451576_0005912 | Ga0451576_0005912_5819_6358 | 179 |
| 459 | 3300045051 | Ga0451576_0089061 | Ga0451576_0089061_1539_2078 | 179 |
| 460 | 3300045051 | Ga0451576_0453652 | Ga0451576_0453652_606_1145 | 179 |
| 461 | 3300046459 | Ga0495629_0502263 | Ga0495629_0502263_115_654 | 179 |
| 462 | 3300046514 | Ga0495618_0194862 | Ga0495618_0194862_85_624 | 179 |
| 463 | 3300046529 | Ga0495652_0205882 | Ga0495652_0205882_314_853 | 179 |
| 464 | 3300046537 | Ga0495598_0000163 | Ga0495598_0000163_675_1217 | 179 |
| 465 | 3300046539 | Ga0495621_0020255 | Ga0495621_0020255_1186_1725 | 179 |
| 466 | 3300046615 | Ga0495656_0295605 | Ga0495656_0295605_58_600 | 179 |
| 467 | 3300046663 | Ga0495635_0140096 | Ga0495635_0140096_1073_1612 | 179 |
| 468 | 3300046683 | Ga0495658_0018132 | Ga0495658_0018132_439_978 | 179 |
| 469 | 3300046691 | Ga0495670_0163925 | Ga0495670_0163925_205_744 | 179 |
| 470 | 3300046809 | Ga0495600_0320799 | Ga0495600_0320799_218_757 | 179 |
| 471 | 3300047318 | Ga0495636_0001105 | Ga0495636_0001105_1885_2427 | 179 |
| 472 | 3300047322 | Ga0495680_0705676 | Ga0495680_0705676_59_598 | 179 |
| 473 | 3300048090 | Ga0495615_0001516 | Ga0495615_0001516_2123_2665 | 179 |
| 474 | 3300048090 | Ga0495615_0207169 | Ga0495615_0207169_14_553 | 179 |
| 475 | 3300048911 | Ga0496108_0067143 | Ga0496108_0067143_2224_2763 | 179 |
| 476 | 3300048913 | Ga0496110_0933151 | Ga0496110_0933151_135_674 | 179 |
| 477 | 3300048915 | Ga0496112_0768175 | Ga0496112_0768175_186_725 | 179 |
| 478 | 3300048918 | Ga0496115_0425937 | Ga0496115_0425937_176_715 | 179 |
| 479 | 3300048920 | Ga0496117_0277608 | Ga0496117_0277608_137_727 | 179 |
| 480 | 3300048921 | Ga0496118_0086097 | Ga0496118_0086097_882_1472 | 179 |
| 481 | 3300048924 | Ga0496121_0004571 | Ga0496121_0004571_12758_13348 | 179 |
| 482 | 3300049704 | Ga0501221_048680 | Ga0501221_048680_299_838 | 179 |
| 483 | 3300049705 | Ga0501225_0215129 | Ga0501225_0215129_32_586 | 179 |
| 484 | 3300049823 | Ga0501044_0144781 | Ga0501044_0144781_470_1018 | 179 |
| 485 | 3300049824 | Ga0501045_0879131 | Ga0501045_0879131_98_643 | 179 |
| 486 | 3300050507 | nmdc:mga05p37_17014_c1 | nmdc:mga05p37_17014_c1_1990_2529 | 179 |
| 487 | 3300050509 | nmdc:mga0qj67_246174_c1 | nmdc:mga0qj67_246174_c1_771_1310 | 179 |
| 488 | 3300050510 | nmdc:mga06r32_367114_c1 | nmdc:mga06r32_367114_c1_494_1033 | 179 |
| 489 | 3300050511 | nmdc:mga08y16_5130_c1 | nmdc:mga08y16_5130_c1_5487_6026 | 179 |
| 490 | 3300050512 | nmdc:mga0n895_292027_c1 | nmdc:mga0n895_292027_c1_344_883 | 179 |
| 491 | 3300050512 | nmdc:mga0n895_71961_c1 | nmdc:mga0n895_71961_c1_168_707 | 179 |
| 492 | 3300050512 | nmdc:mga0n895_938046_c1 | nmdc:mga0n895_938046_c1_188_727 | 179 |
| 493 | 3300050513 | nmdc:mga0rr50_116_c1 | nmdc:mga0rr50_116_c1_7983_8522 | 179 |
| 494 | 3300050514 | nmdc:mga08x19_40_c1 | nmdc:mga08x19_40_c1_146795_147334 | 179 |
| 495 | 3300050515 | nmdc:mga0a205_1228_c1 | nmdc:mga0a205_1228_c1_17699_18238 | 179 |
| 496 | 3300050515 | nmdc:mga0a205_35735_c1 | nmdc:mga0a205_35735_c1_1057_1596 | 179 |
| 497 | 3300050515 | nmdc:mga0a205_478841_c1 | nmdc:mga0a205_478841_c1_123_662 | 179 |
| 498 | 3300053083 | Ga0495655_0009219 | Ga0495655_0009219_350_889 | 179 |
| 499 | 3300053094 | Ga0500566_0106700 | Ga0500566_0106700_482_1087 | 179 |
| 500 | 3300053109 | Ga0500569_011302 | Ga0500569_011302_107_697 | 179 |
| 501 | 3300053123 | Ga0500614_033703 | Ga0500614_033703_487_1077 | 179 |
| 502 | 3300053153 | Ga0500616_0000499 | Ga0500616_0000499_42719_43261 | 179 |
| 503 | 3300053155 | Ga0500620_017136 | Ga0500620_017136_1148_1753 | 179 |
| 504 | 3300059421 | Ga0590071_111659 | Ga0590071_111659_135_674 | 179 |
| 505 | 3300059490 | Ga0587066_011018 | Ga0587066_011018_310_852 | 179 |
| 506 | 3300059503 | Ga0587080_004278 | Ga0587080_004278_761_1303 | 179 |
| 507 | 3300059504 | Ga0587082_051374 | Ga0587082_051374_218_760 | 179 |
| 508 | 3300059508 | Ga0587088_005875 | Ga0587088_005875_899_1441 | 179 |
| 509 | 3300059643 | Ga0587072_014285 | Ga0587072_014285_758_1300 | 179 |
| 510 | 3300059660 | Ga0587124_004632 | Ga0587124_004632_270_812 | 179 |
| 511 | 3300060346 | Ga0587111_0002564 | Ga0587111_0002564_484_1023 | 179 |
| 512 | 3300060346 | Ga0587111_0063471 | Ga0587111_0063471_249_791 | 179 |
| 513 | 3300003322 | rootL2_10194461 | rootL2_101944612 | 180 |
| 514 | 3300005289 | Ga0065704_10195761 | Ga0065704_101957611 | 180 |
| 515 | 3300005290 | Ga0065712_10091604 | Ga0065712_100916044 | 180 |
| 516 | 3300005293 | Ga0065715_10102075 | Ga0065715_101020754 | 180 |
| 517 | 3300005293 | Ga0065715_10143668 | Ga0065715_101436683 | 180 |
| 518 | 3300005293 | Ga0065715_10165959 | Ga0065715_101659591 | 180 |
| 519 | 3300005295 | Ga0065707_10027729 | Ga0065707_100277291 | 180 |
| 520 | 3300005295 | Ga0065707_10132362 | Ga0065707_101323621 | 180 |
| 521 | 3300005328 | Ga0070676_10255063 | Ga0070676_102550633 | 180 |
| 522 | 3300005329 | Ga0070683_100000033 | Ga0070683_10000003387 | 180 |
| 523 | 3300005331 | Ga0070670_100002900 | Ga0070670_10000290011 | 180 |
| 524 | 3300005331 | Ga0070670_100530543 | Ga0070670_1005305432 | 180 |
| 525 | 3300005334 | Ga0068869_100009311 | Ga0068869_1000093115 | 180 |
| 526 | 3300005334 | Ga0068869_100027588 | Ga0068869_1000275885 | 180 |
| 527 | 3300005334 | Ga0068869_100413594 | Ga0068869_1004135941 | 180 |
| 528 | 3300005338 | Ga0068868_100000632 | Ga0068868_10000063215 | 180 |
| 529 | 3300005338 | Ga0068868_100235512 | Ga0068868_1002355121 | 180 |
| 530 | 3300005338 | Ga0068868_100695734 | Ga0068868_1006957342 | 180 |
| 531 | 3300005339 | Ga0070660_100436774 | Ga0070660_1004367741 | 180 |
| 532 | 3300005344 | Ga0070661_100010686 | Ga0070661_10001068612 | 180 |
| 533 | 3300005344 | Ga0070661_100418491 | Ga0070661_1004184913 | 180 |
| 534 | 3300005345 | Ga0070692_10001104 | Ga0070692_1000110414 | 180 |
| 535 | 3300005345 | Ga0070692_10004482 | Ga0070692_100044828 | 180 |
| 536 | 3300005347 | Ga0070668_100003120 | Ga0070668_10000312012 | 180 |
| 537 | 3300005347 | Ga0070668_100120598 | Ga0070668_1001205984 | 180 |
| 538 | 3300005347 | Ga0070668_100228205 | Ga0070668_1002282053 | 180 |
| 539 | 3300005353 | Ga0070669_100017307 | Ga0070669_1000173071 | 180 |
| 540 | 3300005353 | Ga0070669_100030647 | Ga0070669_1000306472 | 180 |
| 541 | 3300005353 | Ga0070669_100097584 | Ga0070669_1000975845 | 180 |
| 542 | 3300005354 | Ga0070675_100000007 | Ga0070675_100000007256 | 180 |
| 543 | 3300005364 | Ga0070673_100034873 | Ga0070673_1000348733 | 180 |
| 544 | 3300005364 | Ga0070673_100079521 | Ga0070673_1000795215 | 180 |
| 545 | 3300005364 | Ga0070673_100207463 | Ga0070673_1002074634 | 180 |
| 546 | 3300005364 | Ga0070673_100697288 | Ga0070673_1006972882 | 180 |
| 547 | 3300005364 | Ga0070673_100705998 | Ga0070673_1007059981 | 180 |
| 548 | 3300005366 | Ga0070659_100117793 | Ga0070659_1001177933 | 180 |
| 549 | 3300005406 | Ga0070703_10248062 | Ga0070703_102480621 | 180 |
| 550 | 3300005406 | Ga0070703_10349908 | Ga0070703_103499081 | 180 |
| 551 | 3300005436 | Ga0070713_100403549 | Ga0070713_1004035492 | 180 |
| 552 | 3300005436 | Ga0070713_101432516 | Ga0070713_1014325161 | 180 |
| 553 | 3300005437 | Ga0070710_10666943 | Ga0070710_106669431 | 180 |
| 554 | 3300005438 | Ga0070701_10003059 | Ga0070701_100030596 | 180 |
| 555 | 3300005438 | Ga0070701_10500755 | Ga0070701_105007551 | 180 |
| 556 | 3300005439 | Ga0070711_100677303 | Ga0070711_1006773032 | 180 |
| 557 | 3300005440 | Ga0070705_100029752 | Ga0070705_1000297521 | 180 |
| 558 | 3300005441 | Ga0070700_100079746 | Ga0070700_1000797464 | 180 |
| 559 | 3300005441 | Ga0070700_100195828 | Ga0070700_1001958282 | 180 |
| 560 | 3300005441 | Ga0070700_100580821 | Ga0070700_1005808212 | 180 |
| 561 | 3300005441 | Ga0070700_100583576 | Ga0070700_1005835761 | 180 |
| 562 | 3300005444 | Ga0070694_100004904 | Ga0070694_10000490415 | 180 |
| 563 | 3300005444 | Ga0070694_100093403 | Ga0070694_1000934035 | 180 |
| 564 | 3300005445 | Ga0070708_100146203 | Ga0070708_1001462034 | 180 |
| 565 | 3300005445 | Ga0070708_100337407 | Ga0070708_1003374072 | 180 |
| 566 | 3300005445 | Ga0070708_100516085 | Ga0070708_1005160852 | 180 |
| 567 | 3300005455 | Ga0070663_100100368 | Ga0070663_1001003681 | 180 |
| 568 | 3300005455 | Ga0070663_101290746 | Ga0070663_1012907461 | 180 |
| 569 | 3300005457 | Ga0070662_100138944 | Ga0070662_1001389444 | 180 |
| 570 | 3300005457 | Ga0070662_100256012 | Ga0070662_1002560122 | 180 |
| 571 | 3300005457 | Ga0070662_100575853 | Ga0070662_1005758532 | 180 |
| 572 | 3300005457 | Ga0070662_100679972 | Ga0070662_1006799722 | 180 |
| 573 | 3300005458 | Ga0070681_10303539 | Ga0070681_103035393 | 180 |
| 574 | 3300005459 | Ga0068867_100058565 | Ga0068867_1000585657 | 180 |
| 575 | 3300005459 | Ga0068867_100403028 | Ga0068867_1004030282 | 180 |
| 576 | 3300005459 | Ga0068867_101249685 | Ga0068867_1012496851 | 180 |
| 577 | 3300005466 | Ga0070685_10027522 | Ga0070685_100275227 | 180 |
| 578 | 3300005467 | Ga0070706_100005771 | Ga0070706_1000057715 | 180 |
| 579 | 3300005467 | Ga0070706_100021749 | Ga0070706_1000217498 | 180 |
| 580 | 3300005467 | Ga0070706_100160143 | Ga0070706_1001601435 | 180 |
| 581 | 3300005467 | Ga0070706_100290494 | Ga0070706_1002904942 | 180 |
| 582 | 3300005467 | Ga0070706_100381803 | Ga0070706_1003818031 | 180 |
| 583 | 3300005468 | Ga0070707_100000343 | Ga0070707_10000034314 | 180 |
| 584 | 3300005468 | Ga0070707_100006596 | Ga0070707_1000065969 | 180 |
| 585 | 3300005468 | Ga0070707_100012600 | Ga0070707_1000126004 | 180 |
| 586 | 3300005468 | Ga0070707_100081504 | Ga0070707_1000815043 | 180 |
| 587 | 3300005468 | Ga0070707_100296630 | Ga0070707_1002966302 | 180 |
| 588 | 3300005468 | Ga0070707_101091800 | Ga0070707_1010918002 | 180 |
| 589 | 3300005471 | Ga0070698_100013686 | Ga0070698_10001368615 | 180 |
| 590 | 3300005471 | Ga0070698_100039505 | Ga0070698_1000395058 | 180 |
| 591 | 3300005471 | Ga0070698_100064533 | Ga0070698_1000645332 | 180 |
| 592 | 3300005471 | Ga0070698_100172142 | Ga0070698_1001721423 | 180 |
| 593 | 3300005471 | Ga0070698_100495468 | Ga0070698_1004954682 | 180 |
| 594 | 3300005471 | Ga0070698_100780400 | Ga0070698_1007804001 | 180 |
| 595 | 3300005518 | Ga0070699_100038276 | Ga0070699_1000382768 | 180 |
| 596 | 3300005518 | Ga0070699_100077781 | Ga0070699_1000777811 | 180 |
| 597 | 3300005518 | Ga0070699_100098833 | Ga0070699_1000988336 | 180 |
| 598 | 3300005518 | Ga0070699_100124595 | Ga0070699_1001245956 | 180 |
| 599 | 3300005518 | Ga0070699_100242768 | Ga0070699_1002427682 | 180 |
| 600 | 3300005535 | Ga0070684_100006540 | Ga0070684_10000654014 | 180 |
| 601 | 3300005536 | Ga0070697_100002003 | Ga0070697_10000200320 | 180 |
| 602 | 3300005536 | Ga0070697_100183374 | Ga0070697_1001833741 | 180 |
| 603 | 3300005536 | Ga0070697_100365617 | Ga0070697_1003656173 | 180 |
| 604 | 3300005539 | Ga0068853_100010446 | Ga0068853_1000104467 | 180 |
| 605 | 3300005543 | Ga0070672_100057049 | Ga0070672_1000570497 | 180 |
| 606 | 3300005544 | Ga0070686_100002184 | Ga0070686_10000218412 | 180 |
| 607 | 3300005544 | Ga0070686_100038213 | Ga0070686_1000382135 | 180 |
| 608 | 3300005544 | Ga0070686_100276720 | Ga0070686_1002767201 | 180 |
| 609 | 3300005545 | Ga0070695_100073003 | Ga0070695_1000730032 | 180 |
| 610 | 3300005545 | Ga0070695_100117228 | Ga0070695_1001172283 | 180 |
| 611 | 3300005545 | Ga0070695_100136229 | Ga0070695_1001362294 | 180 |
| 612 | 3300005546 | Ga0070696_100012751 | Ga0070696_1000127514 | 180 |
| 613 | 3300005546 | Ga0070696_100033599 | Ga0070696_1000335994 | 180 |
| 614 | 3300005546 | Ga0070696_100498617 | Ga0070696_1004986171 | 180 |
| 615 | 3300005549 | Ga0070704_100078530 | Ga0070704_1000785302 | 180 |
| 616 | 3300005549 | Ga0070704_100139413 | Ga0070704_1001394132 | 180 |
| 617 | 3300005549 | Ga0070704_100683494 | Ga0070704_1006834941 | 180 |
| 618 | 3300005564 | Ga0070664_100005841 | Ga0070664_10000584112 | 180 |
| 619 | 3300005564 | Ga0070664_100383001 | Ga0070664_1003830013 | 180 |
| 620 | 3300005578 | Ga0068854_100831891 | Ga0068854_1008318912 | 180 |
| 621 | 3300005616 | Ga0068852_100384633 | Ga0068852_1003846332 | 180 |
| 622 | 3300005617 | Ga0068859_100020360 | Ga0068859_10002036012 | 180 |
| 623 | 3300005617 | Ga0068859_100052938 | Ga0068859_1000529384 | 180 |
| 624 | 3300005617 | Ga0068859_100609037 | Ga0068859_1006090371 | 180 |
| 625 | 3300005618 | Ga0068864_100000349 | Ga0068864_1000003499 | 180 |
| 626 | 3300005618 | Ga0068864_100155076 | Ga0068864_1001550765 | 180 |
| 627 | 3300005618 | Ga0068864_100195967 | Ga0068864_1001959672 | 180 |
| 628 | 3300005719 | Ga0068861_100084086 | Ga0068861_1000840863 | 180 |
| 629 | 3300005719 | Ga0068861_100283062 | Ga0068861_1002830624 | 180 |
| 630 | 3300005719 | Ga0068861_100411943 | Ga0068861_1004119432 | 180 |
| 631 | 3300005719 | Ga0068861_100862671 | Ga0068861_1008626711 | 180 |
| 632 | 3300005834 | Ga0068851_10291239 | Ga0068851_102912392 | 180 |
| 633 | 3300005840 | Ga0068870_10030357 | Ga0068870_100303575 | 180 |
| 634 | 3300005841 | Ga0068863_100218686 | Ga0068863_1002186862 | 180 |
| 635 | 3300005841 | Ga0068863_100282278 | Ga0068863_1002822784 | 180 |
| 636 | 3300005841 | Ga0068863_101866298 | Ga0068863_1018662981 | 180 |
| 637 | 3300005842 | Ga0068858_100043268 | Ga0068858_1000432684 | 180 |
| 638 | 3300005842 | Ga0068858_100545114 | Ga0068858_1005451143 | 180 |
| 639 | 3300005842 | Ga0068858_100958323 | Ga0068858_1009583231 | 180 |
| 640 | 3300005843 | Ga0068860_100108998 | Ga0068860_1001089986 | 180 |
| 641 | 3300005843 | Ga0068860_101059429 | Ga0068860_1010594292 | 180 |
| 642 | 3300005844 | Ga0068862_100003143 | Ga0068862_10000314314 | 180 |
| 643 | 3300005844 | Ga0068862_100063574 | Ga0068862_1000635744 | 180 |
| 644 | 3300005983 | Ga0081540_1071335 | Ga0081540_10713352 | 180 |
| 645 | 3300005985 | Ga0081539_10004359 | Ga0081539_1000435915 | 180 |
| 646 | 3300006028 | Ga0070717_10007950 | Ga0070717_1000795013 | 180 |
| 647 | 3300006028 | Ga0070717_10451231 | Ga0070717_104512312 | 180 |
| 648 | 3300006173 | Ga0070716_100105842 | Ga0070716_1001058424 | 180 |
| 649 | 3300006173 | Ga0070716_100137550 | Ga0070716_1001375502 | 180 |
| 650 | 3300006173 | Ga0070716_100333897 | Ga0070716_1003338971 | 180 |
| 651 | 3300006173 | Ga0070716_100466167 | Ga0070716_1004661672 | 180 |
| 652 | 3300006173 | Ga0070716_100803972 | Ga0070716_1008039721 | 180 |
| 653 | 3300006175 | Ga0070712_100841590 | Ga0070712_1008415902 | 180 |
| 654 | 3300006237 | Ga0097621_100602095 | Ga0097621_1006020952 | 180 |
| 655 | 3300006353 | Ga0075370_10103706 | Ga0075370_101037063 | 180 |
| 656 | 3300006358 | Ga0068871_100253749 | Ga0068871_1002537493 | 180 |
| 657 | 3300006358 | Ga0068871_100425472 | Ga0068871_1004254722 | 180 |
| 658 | 3300006844 | Ga0075428_100594780 | Ga0075428_1005947802 | 180 |
| 659 | 3300006844 | Ga0075428_101135833 | Ga0075428_1011358331 | 180 |
| 660 | 3300006846 | Ga0075430_100048234 | Ga0075430_1000482343 | 180 |
| 661 | 3300006847 | Ga0075431_100006546 | Ga0075431_10000654616 | 180 |
| 662 | 3300006847 | Ga0075431_100012451 | Ga0075431_10001245112 | 180 |
| 663 | 3300006847 | Ga0075431_100062412 | Ga0075431_1000624127 | 180 |
| 664 | 3300006852 | Ga0075433_10196766 | Ga0075433_101967663 | 180 |
| 665 | 3300006852 | Ga0075433_10218906 | Ga0075433_102189062 | 180 |
| 666 | 3300006852 | Ga0075433_10910508 | Ga0075433_109105082 | 180 |
| 667 | 3300006871 | Ga0075434_100014841 | Ga0075434_1000148414 | 180 |
| 668 | 3300006871 | Ga0075434_100135556 | Ga0075434_1001355564 | 180 |
| 669 | 3300006871 | Ga0075434_100147155 | Ga0075434_1001471555 | 180 |
| 670 | 3300006871 | Ga0075434_100149590 | Ga0075434_1001495905 | 180 |
| 671 | 3300006871 | Ga0075434_100311101 | Ga0075434_1003111012 | 180 |
| 672 | 3300006871 | Ga0075434_100980111 | Ga0075434_1009801112 | 180 |
| 673 | 3300006880 | Ga0075429_100043278 | Ga0075429_1000432788 | 180 |
| 674 | 3300006880 | Ga0075429_100116740 | Ga0075429_1001167402 | 180 |
| 675 | 3300006880 | Ga0075429_100192614 | Ga0075429_1001926141 | 180 |
| 676 | 3300006880 | Ga0075429_100603236 | Ga0075429_1006032362 | 180 |
| 677 | 3300006881 | Ga0068865_100042984 | Ga0068865_1000429846 | 180 |
| 678 | 3300006881 | Ga0068865_100114113 | Ga0068865_1001141134 | 180 |
| 679 | 3300006914 | Ga0075436_100098077 | Ga0075436_1000980773 | 180 |
| 680 | 3300006931 | Ga0097620_100020360 | Ga0097620_1000203604 | 180 |
| 681 | 3300006931 | Ga0097620_100052942 | Ga0097620_1000529424 | 180 |
| 682 | 3300006931 | Ga0097620_100609021 | Ga0097620_1006090211 | 180 |
| 683 | 3300007076 | Ga0075435_100458777 | Ga0075435_1004587772 | 180 |
| 684 | 3300007076 | Ga0075435_100943304 | Ga0075435_1009433041 | 180 |
| 685 | 3300009011 | Ga0105251_10107438 | Ga0105251_101074381 | 180 |
| 686 | 3300009036 | Ga0105244_10011650 | Ga0105244_100116503 | 180 |
| 687 | 3300009036 | Ga0105244_10351770 | Ga0105244_103517701 | 180 |
| 688 | 3300009093 | Ga0105240_10127569 | Ga0105240_101275694 | 180 |
| 689 | 3300009094 | Ga0111539_10000022 | Ga0111539_1000002262 | 180 |
| 690 | 3300009094 | Ga0111539_10047047 | Ga0111539_100470476 | 180 |
| 691 | 3300009094 | Ga0111539_12530333 | Ga0111539_125303331 | 180 |
| 692 | 3300009098 | Ga0105245_10001507 | Ga0105245_1000150724 | 180 |
| 693 | 3300009098 | Ga0105245_10067426 | Ga0105245_100674265 | 180 |
| 694 | 3300009098 | Ga0105245_10133819 | Ga0105245_101338196 | 180 |
| 695 | 3300009098 | Ga0105245_10498453 | Ga0105245_104984531 | 180 |
| 696 | 3300009147 | Ga0114129_10001417 | Ga0114129_1000141730 | 180 |
| 697 | 3300009147 | Ga0114129_10063914 | Ga0114129_100639149 | 180 |
| 698 | 3300009147 | Ga0114129_10237453 | Ga0114129_102374534 | 180 |
| 699 | 3300009147 | Ga0114129_10254600 | Ga0114129_102546003 | 180 |
| 700 | 3300009147 | Ga0114129_10425680 | Ga0114129_104256804 | 180 |
| 701 | 3300009147 | Ga0114129_11058774 | Ga0114129_110587742 | 180 |
| 702 | 3300009147 | Ga0114129_11194260 | Ga0114129_111942601 | 180 |
| 703 | 3300009148 | Ga0105243_10005446 | Ga0105243_1000544614 | 180 |
| 704 | 3300009148 | Ga0105243_10063603 | Ga0105243_100636033 | 180 |
| 705 | 3300009148 | Ga0105243_10267171 | Ga0105243_102671712 | 180 |
| 706 | 3300009148 | Ga0105243_10293320 | Ga0105243_102933202 | 180 |
| 707 | 3300009148 | Ga0105243_10384782 | Ga0105243_103847822 | 180 |
| 708 | 3300009148 | Ga0105243_10436767 | Ga0105243_104367672 | 180 |
| 709 | 3300009148 | Ga0105243_10499500 | Ga0105243_104995002 | 180 |
| 710 | 3300009174 | Ga0105241_10311812 | Ga0105241_103118122 | 180 |
| 711 | 3300009176 | Ga0105242_10001940 | Ga0105242_1000194016 | 180 |
| 712 | 3300009176 | Ga0105242_10092929 | Ga0105242_100929291 | 180 |
| 713 | 3300009176 | Ga0105242_10376498 | Ga0105242_103764982 | 180 |
| 714 | 3300009176 | Ga0105242_10377915 | Ga0105242_103779152 | 180 |
| 715 | 3300009176 | Ga0105242_10377916 | Ga0105242_103779162 | 180 |
| 716 | 3300009177 | Ga0105248_10129876 | Ga0105248_101298763 | 180 |
| 717 | 3300009545 | Ga0105237_10239542 | Ga0105237_102395423 | 180 |
| 718 | 3300009551 | Ga0105238_10000002 | Ga0105238_10000002514 | 180 |
| 719 | 3300009553 | Ga0105249_10000118 | Ga0105249_1000011815 | 180 |
| 720 | 3300009553 | Ga0105249_10007788 | Ga0105249_1000778816 | 180 |
| 721 | 3300009553 | Ga0105249_10121147 | Ga0105249_101211472 | 180 |
| 722 | 3300011119 | Ga0105246_10195568 | Ga0105246_101955682 | 180 |
| 723 | 3300011119 | Ga0105246_10653548 | Ga0105246_106535481 | 180 |
| 724 | 3300011119 | Ga0105246_10894739 | Ga0105246_108947392 | 180 |
| 725 | 3300011119 | Ga0105246_11139647 | Ga0105246_111396472 | 180 |
| 726 | 3300013100 | Ga0157373_10346517 | Ga0157373_103465171 | 180 |
| 727 | 3300013100 | Ga0157373_10350626 | Ga0157373_103506262 | 180 |
| 728 | 3300013102 | Ga0157371_10260026 | Ga0157371_102600262 | 180 |
| 729 | 3300013105 | Ga0157369_10001943 | Ga0157369_1000194323 | 180 |
| 730 | 3300013105 | Ga0157369_10100872 | Ga0157369_101008724 | 180 |
| 731 | 3300013296 | Ga0157374_10000005 | Ga0157374_10000005556 | 180 |
| 732 | 3300013296 | Ga0157374_10051849 | Ga0157374_100518496 | 180 |
| 733 | 3300013296 | Ga0157374_10318977 | Ga0157374_103189771 | 180 |
| 734 | 3300013297 | Ga0157378_10009557 | Ga0157378_100095572 | 180 |
| 735 | 3300013297 | Ga0157378_10037124 | Ga0157378_100371242 | 180 |
| 736 | 3300013297 | Ga0157378_10046862 | Ga0157378_100468628 | 180 |
| 737 | 3300013297 | Ga0157378_10061822 | Ga0157378_100618225 | 180 |
| 738 | 3300013297 | Ga0157378_10174597 | Ga0157378_101745973 | 180 |
| 739 | 3300013297 | Ga0157378_10951745 | Ga0157378_109517452 | 180 |
| 740 | 3300013297 | Ga0157378_11749776 | Ga0157378_117497761 | 180 |
| 741 | 3300013306 | Ga0163162_10000059 | Ga0163162_1000005995 | 180 |
| 742 | 3300013306 | Ga0163162_10042501 | Ga0163162_100425019 | 180 |
| 743 | 3300013306 | Ga0163162_10097255 | Ga0163162_100972554 | 180 |
| 744 | 3300013306 | Ga0163162_10749810 | Ga0163162_107498103 | 180 |
| 745 | 3300013306 | Ga0163162_10853200 | Ga0163162_108532001 | 180 |
| 746 | 3300013306 | Ga0163162_11533232 | Ga0163162_115332321 | 180 |
| 747 | 3300013307 | Ga0157372_10229816 | Ga0157372_102298164 | 180 |
| 748 | 3300013307 | Ga0157372_11016823 | Ga0157372_110168232 | 180 |
| 749 | 3300013308 | Ga0157375_10000055 | Ga0157375_1000005582 | 180 |
| 750 | 3300013308 | Ga0157375_10001006 | Ga0157375_1000100611 | 180 |
| 751 | 3300013308 | Ga0157375_10071083 | Ga0157375_100710837 | 180 |
| 752 | 3300013308 | Ga0157375_10150736 | Ga0157375_101507363 | 180 |
| 753 | 3300013308 | Ga0157375_10312790 | Ga0157375_103127903 | 180 |
| 754 | 3300013308 | Ga0157375_11166179 | Ga0157375_111661791 | 180 |
| 755 | 3300014325 | Ga0163163_10139116 | Ga0163163_101391164 | 180 |
| 756 | 3300014325 | Ga0163163_10139935 | Ga0163163_101399356 | 180 |
| 757 | 3300014325 | Ga0163163_10644357 | Ga0163163_106443572 | 180 |
| 758 | 3300014325 | Ga0163163_11977087 | Ga0163163_119770871 | 180 |
| 759 | 3300014326 | Ga0157380_10015819 | Ga0157380_100158197 | 180 |
| 760 | 3300014326 | Ga0157380_10034625 | Ga0157380_100346253 | 180 |
| 761 | 3300014326 | Ga0157380_10425170 | Ga0157380_104251701 | 180 |
| 762 | 3300014326 | Ga0157380_11068164 | Ga0157380_110681641 | 180 |
| 763 | 3300014745 | Ga0157377_10000001 | Ga0157377_1000000116 | 180 |
| 764 | 3300014745 | Ga0157377_10031186 | Ga0157377_100311863 | 180 |
| 765 | 3300014968 | Ga0157379_10043447 | Ga0157379_100434478 | 180 |
| 766 | 3300014968 | Ga0157379_10083913 | Ga0157379_100839132 | 180 |
| 767 | 3300014969 | Ga0157376_10000003 | Ga0157376_10000003248 | 180 |
| 768 | 3300014969 | Ga0157376_10264543 | Ga0157376_102645433 | 180 |
| 769 | 3300017792 | Ga0163161_10308965 | Ga0163161_103089651 | 180 |
| 770 | 3300020069 | Ga0197907_10527097 | Ga0197907_105270976 | 180 |
| 771 | 3300020069 | Ga0197907_11331507 | Ga0197907_113315074 | 180 |
| 772 | 3300020075 | Ga0206349_1115449 | Ga0206349_11154494 | 180 |
| 773 | 3300020075 | Ga0206349_1228824 | Ga0206349_12288244 | 180 |
| 774 | 3300020077 | Ga0206351_10098839 | Ga0206351_100988393 | 180 |
| 775 | 3300020077 | Ga0206351_10905449 | Ga0206351_109054492 | 180 |
| 776 | 3300020078 | Ga0206352_10193538 | Ga0206352_1019353815 | 180 |
| 777 | 3300020080 | Ga0206350_10234328 | Ga0206350_1023432815 | 180 |
| 778 | 3300020080 | Ga0206350_10325577 | Ga0206350_1032557721 | 180 |
| 779 | 3300020080 | Ga0206350_10574257 | Ga0206350_105742575 | 180 |
| 780 | 3300021358 | Ga0213873_10000553 | Ga0213873_1000055312 | 180 |
| 781 | 3300021358 | Ga0213873_10005028 | Ga0213873_100050284 | 180 |
| 782 | 3300021377 | Ga0213874_10000313 | Ga0213874_100003137 | 180 |
| 783 | 3300021377 | Ga0213874_10048447 | Ga0213874_100484473 | 180 |
| 784 | 3300021384 | Ga0213876_10000009 | Ga0213876_10000009228 | 180 |
| 785 | 3300021384 | Ga0213876_10000058 | Ga0213876_1000005891 | 180 |
| 786 | 3300021384 | Ga0213876_10019697 | Ga0213876_100196978 | 180 |
| 787 | 3300021384 | Ga0213876_10170647 | Ga0213876_101706472 | 180 |
| 788 | 3300021388 | Ga0213875_10025282 | Ga0213875_100252827 | 180 |
| 789 | 3300021388 | Ga0213875_10165202 | Ga0213875_101652021 | 180 |
| 790 | 3300022467 | Ga0224712_10000482 | Ga0224712_1000048212 | 180 |
| 791 | 3300022467 | Ga0224712_10010313 | Ga0224712_100103132 | 180 |
| 792 | 3300025728 | Ga0207655_1074984 | Ga0207655_10749841 | 180 |
| 793 | 3300025885 | Ga0207653_10149279 | Ga0207653_101492792 | 180 |
| 794 | 3300025893 | Ga0207682_10023804 | Ga0207682_100238047 | 180 |
| 795 | 3300025893 | Ga0207682_10028648 | Ga0207682_100286485 | 180 |
| 796 | 3300025901 | Ga0207688_10636511 | Ga0207688_106365111 | 180 |
| 797 | 3300025906 | Ga0207699_10072571 | Ga0207699_100725715 | 180 |
| 798 | 3300025906 | Ga0207699_10365446 | Ga0207699_103654462 | 180 |
| 799 | 3300025908 | Ga0207643_10017199 | Ga0207643_100171995 | 180 |
| 800 | 3300025908 | Ga0207643_10078505 | Ga0207643_100785053 | 180 |
| 801 | 3300025908 | Ga0207643_10485184 | Ga0207643_104851841 | 180 |
| 802 | 3300025909 | Ga0207705_10146366 | Ga0207705_101463663 | 180 |
| 803 | 3300025910 | Ga0207684_10000431 | Ga0207684_1000043153 | 180 |
| 804 | 3300025910 | Ga0207684_10034076 | Ga0207684_100340768 | 180 |
| 805 | 3300025910 | Ga0207684_10068492 | Ga0207684_100684925 | 180 |
| 806 | 3300025910 | Ga0207684_10072862 | Ga0207684_100728623 | 180 |
| 807 | 3300025910 | Ga0207684_10135396 | Ga0207684_101353961 | 180 |
| 808 | 3300025910 | Ga0207684_10760785 | Ga0207684_107607851 | 180 |
| 809 | 3300025912 | Ga0207707_10170172 | Ga0207707_101701725 | 180 |
| 810 | 3300025912 | Ga0207707_10511053 | Ga0207707_105110533 | 180 |
| 811 | 3300025913 | Ga0207695_10091115 | Ga0207695_100911154 | 180 |
| 812 | 3300025915 | Ga0207693_10287522 | Ga0207693_102875222 | 180 |
| 813 | 3300025915 | Ga0207693_10530848 | Ga0207693_105308482 | 180 |
| 814 | 3300025916 | Ga0207663_10075460 | Ga0207663_100754603 | 180 |
| 815 | 3300025916 | Ga0207663_10274480 | Ga0207663_102744802 | 180 |
| 816 | 3300025916 | Ga0207663_10314350 | Ga0207663_103143502 | 180 |
| 817 | 3300025917 | Ga0207660_10137592 | Ga0207660_101375923 | 180 |
| 818 | 3300025917 | Ga0207660_10717401 | Ga0207660_107174011 | 180 |
| 819 | 3300025918 | Ga0207662_10052948 | Ga0207662_100529481 | 180 |
| 820 | 3300025922 | Ga0207646_10000630 | Ga0207646_1000063015 | 180 |
| 821 | 3300025922 | Ga0207646_10000708 | Ga0207646_100007082 | 180 |
| 822 | 3300025922 | Ga0207646_10030710 | Ga0207646_100307102 | 180 |
| 823 | 3300025922 | Ga0207646_10080346 | Ga0207646_100803467 | 180 |
| 824 | 3300025922 | Ga0207646_10178348 | Ga0207646_101783483 | 180 |
| 825 | 3300025922 | Ga0207646_10383686 | Ga0207646_103836862 | 180 |
| 826 | 3300025922 | Ga0207646_10392368 | Ga0207646_103923682 | 180 |
| 827 | 3300025922 | Ga0207646_10867299 | Ga0207646_108672992 | 180 |
| 828 | 3300025923 | Ga0207681_10002895 | Ga0207681_1000289510 | 180 |
| 829 | 3300025923 | Ga0207681_10018422 | Ga0207681_100184221 | 180 |
| 830 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001513 | 180 |
| 831 | 3300025925 | Ga0207650_10001512 | Ga0207650_1000151215 | 180 |
| 832 | 3300025926 | Ga0207659_10000036 | Ga0207659_1000003649 | 180 |
| 833 | 3300025927 | Ga0207687_10000005 | Ga0207687_10000005422 | 180 |
| 834 | 3300025927 | Ga0207687_10002330 | Ga0207687_1000233017 | 180 |
| 835 | 3300025927 | Ga0207687_10241063 | Ga0207687_102410632 | 180 |
| 836 | 3300025933 | Ga0207706_10100663 | Ga0207706_101006631 | 180 |
| 837 | 3300025933 | Ga0207706_10122129 | Ga0207706_101221294 | 180 |
| 838 | 3300025933 | Ga0207706_10257235 | Ga0207706_102572352 | 180 |
| 839 | 3300025934 | Ga0207686_10001337 | Ga0207686_1000133713 | 180 |
| 840 | 3300025934 | Ga0207686_10110303 | Ga0207686_101103032 | 180 |
| 841 | 3300025934 | Ga0207686_10230913 | Ga0207686_102309131 | 180 |
| 842 | 3300025935 | Ga0207709_10009706 | Ga0207709_100097066 | 180 |
| 843 | 3300025935 | Ga0207709_10326828 | Ga0207709_103268282 | 180 |
| 844 | 3300025935 | Ga0207709_10532146 | Ga0207709_105321462 | 180 |
| 845 | 3300025937 | Ga0207669_10113601 | Ga0207669_101136014 | 180 |
| 846 | 3300025938 | Ga0207704_10004874 | Ga0207704_100048749 | 180 |
| 847 | 3300025938 | Ga0207704_10450541 | Ga0207704_104505411 | 180 |
| 848 | 3300025939 | Ga0207665_10077046 | Ga0207665_100770466 | 180 |
| 849 | 3300025939 | Ga0207665_10105427 | Ga0207665_101054274 | 180 |
| 850 | 3300025940 | Ga0207691_10002644 | Ga0207691_1000264420 | 180 |
| 851 | 3300025942 | Ga0207689_10009254 | Ga0207689_1000925414 | 180 |
| 852 | 3300025942 | Ga0207689_10009503 | Ga0207689_100095036 | 180 |
| 853 | 3300025942 | Ga0207689_10010598 | Ga0207689_1001059810 | 180 |
| 854 | 3300025942 | Ga0207689_10040739 | Ga0207689_100407393 | 180 |
| 855 | 3300025942 | Ga0207689_10162913 | Ga0207689_101629132 | 180 |
| 856 | 3300025942 | Ga0207689_11012370 | Ga0207689_110123701 | 180 |
| 857 | 3300025944 | Ga0207661_10000006 | Ga0207661_10000006454 | 180 |
| 858 | 3300025944 | Ga0207661_11134445 | Ga0207661_111344452 | 180 |
| 859 | 3300025945 | Ga0207679_10034524 | Ga0207679_100345242 | 180 |
| 860 | 3300025945 | Ga0207679_10158818 | Ga0207679_101588181 | 180 |
| 861 | 3300025945 | Ga0207679_10230992 | Ga0207679_102309924 | 180 |
| 862 | 3300025960 | Ga0207651_10070128 | Ga0207651_100701282 | 180 |
| 863 | 3300025961 | Ga0207712_10000709 | Ga0207712_1000070912 | 180 |
| 864 | 3300025961 | Ga0207712_10302180 | Ga0207712_103021802 | 180 |
| 865 | 3300025972 | Ga0207668_10004545 | Ga0207668_1000454512 | 180 |
| 866 | 3300025972 | Ga0207668_10058291 | Ga0207668_100582912 | 180 |
| 867 | 3300025972 | Ga0207668_10475212 | Ga0207668_104752122 | 180 |
| 868 | 3300025972 | Ga0207668_10936671 | Ga0207668_109366711 | 180 |
| 869 | 3300025981 | Ga0207640_10196065 | Ga0207640_101960653 | 180 |
| 870 | 3300025986 | Ga0207658_10124942 | Ga0207658_101249422 | 180 |
| 871 | 3300025986 | Ga0207658_10227130 | Ga0207658_102271303 | 180 |
| 872 | 3300026023 | Ga0207677_10000101 | Ga0207677_1000010162 | 180 |
| 873 | 3300026023 | Ga0207677_10000141 | Ga0207677_1000014144 | 180 |
| 874 | 3300026023 | Ga0207677_10928524 | Ga0207677_109285241 | 180 |
| 875 | 3300026035 | Ga0207703_10032311 | Ga0207703_100323114 | 180 |
| 876 | 3300026035 | Ga0207703_10685623 | Ga0207703_106856232 | 180 |
| 877 | 3300026035 | Ga0207703_10710044 | Ga0207703_107100442 | 180 |
| 878 | 3300026041 | Ga0207639_10000013 | Ga0207639_1000001333 | 180 |
| 879 | 3300026067 | Ga0207678_10212259 | Ga0207678_102122591 | 180 |
| 880 | 3300026075 | Ga0207708_10116208 | Ga0207708_101162082 | 180 |
| 881 | 3300026075 | Ga0207708_10476606 | Ga0207708_104766061 | 180 |
| 882 | 3300026075 | Ga0207708_10873482 | Ga0207708_108734822 | 180 |
| 883 | 3300026088 | Ga0207641_10089316 | Ga0207641_100893163 | 180 |
| 884 | 3300026088 | Ga0207641_10335742 | Ga0207641_103357423 | 180 |
| 885 | 3300026095 | Ga0207676_10000023 | Ga0207676_10000023169 | 180 |
| 886 | 3300026095 | Ga0207676_10098561 | Ga0207676_100985614 | 180 |
| 887 | 3300026095 | Ga0207676_10507545 | Ga0207676_105075452 | 180 |
| 888 | 3300026095 | Ga0207676_10760610 | Ga0207676_107606101 | 180 |
| 889 | 3300026116 | Ga0207674_10141748 | Ga0207674_101417485 | 180 |
| 890 | 3300026116 | Ga0207674_10193921 | Ga0207674_101939212 | 180 |
| 891 | 3300026116 | Ga0207674_10677704 | Ga0207674_106777041 | 180 |
| 892 | 3300026118 | Ga0207675_100068381 | Ga0207675_1000683813 | 180 |
| 893 | 3300026118 | Ga0207675_100109886 | Ga0207675_1001098864 | 180 |
| 894 | 3300026118 | Ga0207675_101408081 | Ga0207675_1014080811 | 180 |
| 895 | 3300026142 | Ga0207698_10977438 | Ga0207698_109774382 | 180 |
| 896 | 3300027424 | Ga0209984_1004426 | Ga0209984_10044263 | 180 |
| 897 | 3300027471 | Ga0209995_1011397 | Ga0209995_10113973 | 180 |
| 898 | 3300027543 | Ga0209999_1004693 | Ga0209999_10046932 | 180 |
| 899 | 3300027614 | Ga0209970_1005891 | Ga0209970_10058913 | 180 |
| 900 | 3300027665 | Ga0209983_1000280 | Ga0209983_100028015 | 180 |
| 901 | 3300027682 | Ga0209971_1000384 | Ga0209971_10003844 | 180 |
| 902 | 3300027695 | Ga0209966_1013867 | Ga0209966_10138674 | 180 |
| 903 | 3300027695 | Ga0209966_1043285 | Ga0209966_10432852 | 180 |
| 904 | 3300027717 | Ga0209998_10002827 | Ga0209998_100028271 | 180 |
| 905 | 3300027876 | Ga0209974_10004420 | Ga0209974_100044206 | 180 |
| 906 | 3300027907 | Ga0207428_10000030 | Ga0207428_1000003062 | 180 |
| 907 | 3300027907 | Ga0207428_10073683 | Ga0207428_100736834 | 180 |
| 908 | 3300028380 | Ga0268265_10009861 | Ga0268265_100098613 | 180 |
| 909 | 3300028380 | Ga0268265_10022343 | Ga0268265_100223435 | 180 |
| 910 | 3300028380 | Ga0268265_10136452 | Ga0268265_101364521 | 180 |
| 911 | 3300028381 | Ga0268264_10144015 | Ga0268264_101440153 | 180 |
| 912 | 3300028381 | Ga0268264_10200084 | Ga0268264_102000842 | 180 |
| 913 | 3300028381 | Ga0268264_10380109 | Ga0268264_103801092 | 180 |
| 914 | 3300028800 | Ga0265338_10036788 | Ga0265338_1003678810 | 180 |
| 915 | 3300030521 | Ga0307511_10002513 | Ga0307511_1000251328 | 180 |
| 916 | 3300030889 | Ga0265761_107552 | Ga0265761_1075521 | 180 |
| 917 | 3300031235 | Ga0265330_10021074 | Ga0265330_100210744 | 180 |
| 918 | 3300031247 | Ga0265340_10031321 | Ga0265340_100313213 | 180 |
| 919 | 3300031251 | Ga0265327_10090986 | Ga0265327_100909861 | 180 |
| 920 | 3300031456 | Ga0307513_10016578 | Ga0307513_100165787 | 180 |
| 921 | 3300031548 | Ga0307408_100268050 | Ga0307408_1002680502 | 180 |
| 922 | 3300031548 | Ga0307408_100867718 | Ga0307408_1008677182 | 180 |
| 923 | 3300031711 | Ga0265314_10000833 | Ga0265314_1000083334 | 180 |
| 924 | 3300031901 | Ga0307406_10128816 | Ga0307406_101288163 | 180 |
| 925 | 3300031911 | Ga0307412_10660458 | Ga0307412_106604581 | 180 |
| 926 | 3300032002 | Ga0307416_100246657 | Ga0307416_1002466574 | 180 |
| 927 | 3300032002 | Ga0307416_101171787 | Ga0307416_1011717871 | 180 |
| 928 | 3300032002 | Ga0307416_101768943 | Ga0307416_1017689431 | 180 |
| 929 | 3300035086 | Ga0373934_0007545 | Ga0373934_0007545_703_1248 | 180 |
| 930 | 3300035089 | Ga0373944_0114041 | Ga0373944_0114041_48_590 | 180 |
| 931 | 3300035090 | Ga0373949_0017759 | Ga0373949_0017759_711_1268 | 180 |
| 932 | 3300035115 | Ga0373941_0062111 | Ga0373941_0062111_94_645 | 180 |
| 933 | 3300035117 | Ga0373953_0008828 | Ga0373953_0008828_59_604 | 180 |
| 934 | 3300035118 | Ga0373954_0008600 | Ga0373954_0008600_326_871 | 180 |
| 935 | 3300035120 | Ga0373957_0017064 | Ga0373957_0017064_1228_1773 | 180 |
| 936 | 3300035171 | Ga0373946_0322848 | Ga0373946_0322848_31_573 | 180 |
| 937 | 3300035172 | Ga0373955_0518973 | Ga0373955_0518973_38_583 | 180 |
| 938 | 3300035410 | Ga0373924_0316261 | Ga0373924_0316261_104_646 | 180 |
| 939 | 3300035695 | Ga0373927_0819978 | Ga0373927_0819978_58_600 | 180 |
| 940 | 3300035724 | Ga0373933_0665113 | Ga0373933_0665113_88_630 | 180 |
| 941 | 3300036401 | Ga0373937_0036358 | Ga0373937_0036358_334_879 | 180 |
| 942 | 3300037418 | Ga0395900_0395376 | Ga0395900_0395376_788_1330 | 180 |
| 943 | 3300037471 | Ga0395905_0004072 | Ga0395905_0004072_1024_1566 | 180 |
| 944 | 3300037471 | Ga0395905_0335843 | Ga0395905_0335843_264_806 | 180 |
| 945 | 3300037471 | Ga0395905_0617827 | Ga0395905_0617827_114_656 | 180 |
| 946 | 3300037471 | Ga0395905_1168441 | Ga0395905_1168441_89_631 | 180 |
| 947 | 3300037853 | Ga0436364_0600523 | Ga0436364_0600523_883_1425 | 180 |
| 948 | 3300037853 | Ga0436364_0754414 | Ga0436364_0754414_58_600 | 180 |
| 949 | 3300037853 | Ga0436364_1316563 | Ga0436364_1316563_1601_2143 | 180 |
| 950 | 3300039062 | Ga0400483_155646 | Ga0400483_155646_110_652 | 180 |
| 951 | 3300039437 | Ga0436365_0048919 | Ga0436365_0048919_87_629 | 180 |
| 952 | 3300039437 | Ga0436365_0154164 | Ga0436365_0154164_2688_3230 | 180 |
| 953 | 3300039437 | Ga0436365_0332019 | Ga0436365_0332019_1028_1570 | 180 |
| 954 | 3300039437 | Ga0436365_0340116 | Ga0436365_0340116_586_1128 | 180 |
| 955 | 3300039437 | Ga0436365_0382778 | Ga0436365_0382778_1034_1576 | 180 |
| 956 | 3300039437 | Ga0436365_0464141 | Ga0436365_0464141_42842_43387 | 180 |
| 957 | 3300039437 | Ga0436365_0647080 | Ga0436365_0647080_222_764 | 180 |
| 958 | 3300039437 | Ga0436365_1032223 | Ga0436365_1032223_338_880 | 180 |
| 959 | 3300039438 | Ga0436360_0591939 | Ga0436360_0591939_108_674 | 180 |
| 960 | 3300039450 | Ga0436363_0537550 | Ga0436363_0537550_5678_6220 | 180 |
| 961 | 3300039453 | Ga0436362_0656010 | Ga0436362_0656010_5155_5697 | 180 |
| 962 | 3300039453 | Ga0436362_1063276 | Ga0436362_1063276_12527_13069 | 180 |
| 963 | 3300039453 | Ga0436362_1065558 | Ga0436362_1065558_437_979 | 180 |
| 964 | 3300039453 | Ga0436362_1069013 | Ga0436362_1069013_86268_86813 | 180 |
| 965 | 3300041406 | Ga0439439_0016465 | Ga0439439_0016465_279_821 | 180 |
| 966 | 3300041406 | Ga0439439_0036614 | Ga0439439_0036614_153_695 | 180 |
| 967 | 3300041496 | Ga0451839_0378043 | Ga0451839_0378043_365_910 | 180 |
| 968 | 3300041509 | Ga0451843_0181247 | Ga0451843_0181247_172_738 | 180 |
| 969 | 3300042015 | Ga0439462_0023689 | Ga0439462_0023689_558_1100 | 180 |
| 970 | 3300042156 | Ga0439446_0026364 | Ga0439446_0026364_648_1190 | 180 |
| 971 | 3300042532 | Ga0450893_0041135 | Ga0450893_0041135_44_595 | 180 |
| 972 | 3300042876 | Ga0451577_0269782 | Ga0451577_0269782_475_1017 | 180 |
| 973 | 3300042876 | Ga0451577_0649678 | Ga0451577_0649678_342_899 | 180 |
| 974 | 3300044658 | Ga0466972_0002629 | Ga0466972_0002629_6487_7029 | 180 |
| 975 | 3300044683 | Ga0466965_0004970 | Ga0466965_0004970_1136_1678 | 180 |
| 976 | 3300044694 | Ga0466963_0545387 | Ga0466963_0545387_153_695 | 180 |
| 977 | 3300044706 | Ga0466964_0082772 | Ga0466964_0082772_523_1068 | 180 |
| 978 | 3300044735 | Ga0466968_0002163 | Ga0466968_0002163_4727_5269 | 180 |
| 979 | 3300044842 | Ga0466957_0006920 | Ga0466957_0006920_4082_4624 | 180 |
| 980 | 3300044901 | Ga0466960_0002207 | Ga0466960_0002207_2330_2872 | 180 |
| 981 | 3300045051 | Ga0451576_0032997 | Ga0451576_0032997_421_978 | 180 |
| 982 | 3300045051 | Ga0451576_0718808 | Ga0451576_0718808_54_596 | 180 |
| 983 | 3300046459 | Ga0495629_0517482 | Ga0495629_0517482_85_630 | 180 |
| 984 | 3300046472 | Ga0495580_0057891 | Ga0495580_0057891_1786_2328 | 180 |
| 985 | 3300046472 | Ga0495580_0303839 | Ga0495580_0303839_97_639 | 180 |
| 986 | 3300046519 | Ga0495632_0019314 | Ga0495632_0019314_1396_1941 | 180 |
| 987 | 3300046539 | Ga0495621_0015538 | Ga0495621_0015538_469_1011 | 180 |
| 988 | 3300046675 | Ga0495657_0217306 | Ga0495657_0217306_193_735 | 180 |
| 989 | 3300047320 | Ga0495672_0006094 | Ga0495672_0006094_2792_3337 | 180 |
| 990 | 3300047320 | Ga0495672_0077350 | Ga0495672_0077350_476_1018 | 180 |
| 991 | 3300047322 | Ga0495680_0367266 | Ga0495680_0367266_423_968 | 180 |
| 992 | 3300047446 | Ga0495679_007316 | Ga0495679_007316_1942_2487 | 180 |
| 993 | 3300047471 | Ga0495684_0024903 | Ga0495684_0024903_1381_1926 | 180 |
| 994 | 3300048088 | Ga0495602_0017278 | Ga0495602_0017278_3808_4350 | 180 |
| 995 | 3300048903 | Ga0496100_0079592 | Ga0496100_0079592_644_1186 | 180 |
| 996 | 3300048904 | Ga0496101_0586164 | Ga0496101_0586164_231_773 | 180 |
| 997 | 3300048905 | Ga0496102_0497858 | Ga0496102_0497858_173_730 | 180 |
| 998 | 3300048906 | Ga0496103_0019686 | Ga0496103_0019686_2832_3389 | 180 |
| 999 | 3300048907 | Ga0496104_0275923 | Ga0496104_0275923_521_1105 | 180 |
| 1000 | 3300048907 | Ga0496104_0300228 | Ga0496104_0300228_174_719 | 180 |
| 1001 | 3300048909 | Ga0496106_0004259 | Ga0496106_0004259_2125_2667 | 180 |
| 1002 | 3300048912 | Ga0496109_0001176 | Ga0496109_0001176_14763_15305 | 180 |
| 1003 | 3300048913 | Ga0496110_0209515 | Ga0496110_0209515_1113_1670 | 180 |
| 1004 | 3300048917 | Ga0496114_0313364 | Ga0496114_0313364_537_1079 | 180 |
| 1005 | 3300049527 | Ga0501311_058651 | Ga0501311_058651_12_554 | 180 |
| 1006 | 3300049569 | Ga0501032_0317824 | Ga0501032_0317824_73_615 | 180 |
| 1007 | 3300049571 | Ga0501034_0105612 | Ga0501034_0105612_1811_2353 | 180 |
| 1008 | 3300049572 | Ga0501036_0083767 | Ga0501036_0083767_349_891 | 180 |
| 1009 | 3300049573 | Ga0501037_0001918 | Ga0501037_0001918_8709_9251 | 180 |
| 1010 | 3300049574 | Ga0501038_0019238 | Ga0501038_0019238_3360_3902 | 180 |
| 1011 | 3300049574 | Ga0501038_0198598 | Ga0501038_0198598_366_923 | 180 |
| 1012 | 3300049576 | Ga0501040_0088966 | Ga0501040_0088966_1291_1848 | 180 |
| 1013 | 3300049576 | Ga0501040_0509060 | Ga0501040_0509060_237_779 | 180 |
| 1014 | 3300049581 | Ga0501047_0033218 | Ga0501047_0033218_3635_4177 | 180 |
| 1015 | 3300049582 | Ga0501048_0075654 | Ga0501048_0075654_1261_1803 | 180 |
| 1016 | 3300049583 | Ga0501067_0064621 | Ga0501067_0064621_1371_1913 | 180 |
| 1017 | 3300049587 | Ga0501071_0392541 | Ga0501071_0392541_404_946 | 180 |
| 1018 | 3300049588 | Ga0501072_0079503 | Ga0501072_0079503_1491_2048 | 180 |
| 1019 | 3300049589 | Ga0501073_0009833 | Ga0501073_0009833_658_1200 | 180 |
| 1020 | 3300049591 | Ga0501075_0042052 | Ga0501075_0042052_1390_1932 | 180 |
| 1021 | 3300049592 | Ga0501076_0019380 | Ga0501076_0019380_4181_4738 | 180 |
| 1022 | 3300049741 | Ga0501079_0039652 | Ga0501079_0039652_1823_2380 | 180 |
| 1023 | 3300049741 | Ga0501079_0971486 | Ga0501079_0971486_70_612 | 180 |
| 1024 | 3300049742 | Ga0501080_0004016 | Ga0501080_0004016_9319_9861 | 180 |
| 1025 | 3300049742 | Ga0501080_0150585 | Ga0501080_0150585_1518_2060 | 180 |
| 1026 | 3300049742 | Ga0501080_0169697 | Ga0501080_0169697_28_585 | 180 |
| 1027 | 3300049742 | Ga0501080_0361261 | Ga0501080_0361261_400_945 | 180 |
| 1028 | 3300049743 | Ga0501081_0042874 | Ga0501081_0042874_2045_2602 | 180 |
| 1029 | 3300049743 | Ga0501081_1115911 | Ga0501081_1115911_43_585 | 180 |
| 1030 | 3300049744 | Ga0501083_0521086 | Ga0501083_0521086_175_717 | 180 |
| 1031 | 3300049823 | Ga0501044_0007741 | Ga0501044_0007741_8769_9311 | 180 |
| 1032 | 3300049824 | Ga0501045_0054880 | Ga0501045_0054880_57_599 | 180 |
| 1033 | 3300049824 | Ga0501045_0093809 | Ga0501045_0093809_1206_1763 | 180 |
| 1034 | 3300050494 | nmdc:mga06z11_177784_c1 | nmdc:mga06z11_177784_c1_584_1126 | 180 |
| 1035 | 3300050507 | nmdc:mga05p37_1055797_c1 | nmdc:mga05p37_1055797_c1_243_800 | 180 |
| 1036 | 3300050507 | nmdc:mga05p37_1157389_c1 | nmdc:mga05p37_1157389_c1_246_791 | 180 |
| 1037 | 3300050507 | nmdc:mga05p37_1701_c1 | nmdc:mga05p37_1701_c1_21632_22186 | 180 |
| 1038 | 3300050507 | nmdc:mga05p37_262169_c1 | nmdc:mga05p37_262169_c1_513_1055 | 180 |
| 1039 | 3300050507 | nmdc:mga05p37_28557_c1 | nmdc:mga05p37_28557_c1_283_840 | 180 |
| 1040 | 3300050507 | nmdc:mga05p37_430068_c1 | nmdc:mga05p37_430068_c1_853_1395 | 180 |
| 1041 | 3300050507 | nmdc:mga05p37_49078_c1 | nmdc:mga05p37_49078_c1_2004_2546 | 180 |
| 1042 | 3300050507 | nmdc:mga05p37_53231_c1 | nmdc:mga05p37_53231_c1_513_1058 | 180 |
| 1043 | 3300050508 | nmdc:mga09592_296147_c1 | nmdc:mga09592_296147_c1_668_1210 | 180 |
| 1044 | 3300050508 | nmdc:mga09592_302628_c1 | nmdc:mga09592_302628_c1_753_1295 | 180 |
| 1045 | 3300050508 | nmdc:mga09592_400481_c1 | nmdc:mga09592_400481_c1_25_567 | 180 |
| 1046 | 3300050508 | nmdc:mga09592_634272_c1 | nmdc:mga09592_634272_c1_152_697 | 180 |
| 1047 | 3300050508 | nmdc:mga09592_88599_c1 | nmdc:mga09592_88599_c1_1013_1555 | 180 |
| 1048 | 3300050509 | nmdc:mga0qj67_30909_c1 | nmdc:mga0qj67_30909_c1_639_1181 | 180 |
| 1049 | 3300050510 | nmdc:mga06r32_14172_c1 | nmdc:mga06r32_14172_c1_5036_5578 | 180 |
| 1050 | 3300050510 | nmdc:mga06r32_15501_c1 | nmdc:mga06r32_15501_c1_3224_3766 | 180 |
| 1051 | 3300050510 | nmdc:mga06r32_5062_c1 | nmdc:mga06r32_5062_c1_5000_5542 | 180 |
| 1052 | 3300050511 | nmdc:mga08y16_175859_c1 | nmdc:mga08y16_175859_c1_602_1144 | 180 |
| 1053 | 3300050511 | nmdc:mga08y16_24_c1 | nmdc:mga08y16_24_c1_60658_61200 | 180 |
| 1054 | 3300050512 | nmdc:mga0n895_15345_c1 | nmdc:mga0n895_15345_c1_5153_5710 | 180 |
| 1055 | 3300050512 | nmdc:mga0n895_165230_c1 | nmdc:mga0n895_165230_c1_899_1441 | 180 |
| 1056 | 3300050512 | nmdc:mga0n895_227259_c1 | nmdc:mga0n895_227259_c1_674_1216 | 180 |
| 1057 | 3300050512 | nmdc:mga0n895_24370_c1 | nmdc:mga0n895_24370_c1_3515_4060 | 180 |
| 1058 | 3300050512 | nmdc:mga0n895_459873_c1 | nmdc:mga0n895_459873_c1_136_678 | 180 |
| 1059 | 3300050512 | nmdc:mga0n895_629021_c1 | nmdc:mga0n895_629021_c1_359_901 | 180 |
| 1060 | 3300050512 | nmdc:mga0n895_682568_c1 | nmdc:mga0n895_682568_c1_136_690 | 180 |
| 1061 | 3300050513 | nmdc:mga0rr50_433462_c1 | nmdc:mga0rr50_433462_c1_278_832 | 180 |
| 1062 | 3300050514 | nmdc:mga08x19_87268_c1 | nmdc:mga08x19_87268_c1_1059_1613 | 180 |
| 1063 | 3300050515 | nmdc:mga0a205_234689_c1 | nmdc:mga0a205_234689_c1_879_1421 | 180 |
| 1064 | 3300050515 | nmdc:mga0a205_245638_c1 | nmdc:mga0a205_245638_c1_1045_1587 | 180 |
| 1065 | 3300050515 | nmdc:mga0a205_27799_c1 | nmdc:mga0a205_27799_c1_738_1280 | 180 |
| 1066 | 3300050515 | nmdc:mga0a205_410039_c1 | nmdc:mga0a205_410039_c1_512_1066 | 180 |
| 1067 | 3300050515 | nmdc:mga0a205_8807_c1 | nmdc:mga0a205_8807_c1_3733_4290 | 180 |
| 1068 | 3300053078 | Ga0495612_0113656 | Ga0495612_0113656_287_829 | 180 |
| 1069 | 3300053139 | Ga0500568_0002264 | Ga0500568_0002264_670_1212 | 180 |
| 1070 | 3300054114 | Ga0501084_0074131 | Ga0501084_0074131_430_972 | 180 |
| 1071 | 3300059477 | Ga0587084_009768 | Ga0587084_009768_531_1073 | 180 |
| 1072 | 3300059477 | Ga0587084_016481 | Ga0587084_016481_222_764 | 180 |
| 1073 | 3300059478 | Ga0587093_006640 | Ga0587093_006640_533_1075 | 180 |
| 1074 | 3300059491 | Ga0587070_011201 | Ga0587070_011201_780_1322 | 180 |
| 1075 | 3300059492 | Ga0587073_0024911 | Ga0587073_0024911_158_700 | 180 |
| 1076 | 3300059504 | Ga0587082_003869 | Ga0587082_003869_487_1029 | 180 |
| 1077 | 3300059506 | Ga0587085_000796 | Ga0587085_000796_276_818 | 180 |
| 1078 | 3300059508 | Ga0587088_011865 | Ga0587088_011865_559_1101 | 180 |
| 1079 | 3300059510 | Ga0587090_007706 | Ga0587090_007706_356_898 | 180 |
| 1080 | 3300059511 | Ga0587091_013781 | Ga0587091_013781_590_1132 | 180 |
| 1081 | 3300059513 | Ga0587094_000627 | Ga0587094_000627_1866_2408 | 180 |
| 1082 | 3300059623 | Ga0587101_007952 | Ga0587101_007952_549_1091 | 180 |
| 1083 | 3300059624 | Ga0587109_006059 | Ga0587109_006059_717_1259 | 180 |
| 1084 | 3300059624 | Ga0587109_030000 | Ga0587109_030000_300_848 | 180 |
| 1085 | 3300059627 | Ga0587117_002125 | Ga0587117_002125_752_1294 | 180 |
| 1086 | 3300059639 | Ga0587062_000749 | Ga0587062_000749_289_831 | 180 |
| 1087 | 3300059641 | Ga0587068_003778 | Ga0587068_003778_561_1103 | 180 |
| 1088 | 3300059643 | Ga0587072_014729 | Ga0587072_014729_134_676 | 180 |
| 1089 | 3300059645 | Ga0587076_004008 | Ga0587076_004008_793_1335 | 180 |
| 1090 | 3300059648 | Ga0587100_002195 | Ga0587100_002195_521_1063 | 180 |
| 1091 | 3300060344 | Ga0587071_012931 | Ga0587071_012931_531_1073 | 180 |
| 1092 | 3300060346 | Ga0587111_0006696 | Ga0587111_0006696_773_1315 | 180 |
| 1093 | 3300060353 | Ga0501082_1494493 | Ga0501082_1494493_20_562 | 180 |
| 1094 | 3300061734 | Ga0530510_0572320 | Ga0530510_0572320_99_641 | 180 |
| 1095 | 3300005436 | Ga0070713_101247721 | Ga0070713_1012477211 | 181 |
| 1096 | 3300005439 | Ga0070711_100046997 | Ga0070711_1000469975 | 181 |
| 1097 | 3300005439 | Ga0070711_100294410 | Ga0070711_1002944103 | 181 |
| 1098 | 3300006871 | Ga0075434_101034042 | Ga0075434_1010340422 | 181 |
| 1099 | 3300024227 | Ga0228598_1001060 | Ga0228598_10010604 | 181 |
| 1100 | 3300025304 | Ga0209257_1056203 | Ga0209257_10562033 | 181 |
| 1101 | 3300025916 | Ga0207663_10096340 | Ga0207663_100963402 | 181 |
| 1102 | 3300031239 | Ga0265328_10188699 | Ga0265328_101886991 | 181 |
| 1103 | 3300031548 | Ga0307408_100038105 | Ga0307408_1000381053 | 181 |
| 1104 | 3300031731 | Ga0307405_10040438 | Ga0307405_100404386 | 181 |
| 1105 | 3300031824 | Ga0307413_10003502 | Ga0307413_100035027 | 181 |
| 1106 | 3300031852 | Ga0307410_10004470 | Ga0307410_100044705 | 181 |
| 1107 | 3300031901 | Ga0307406_10082192 | Ga0307406_100821922 | 181 |
| 1108 | 3300031903 | Ga0307407_10015861 | Ga0307407_100158614 | 181 |
| 1109 | 3300031911 | Ga0307412_10009022 | Ga0307412_1000902210 | 181 |
| 1110 | 3300032002 | Ga0307416_100019290 | Ga0307416_1000192904 | 181 |
| 1111 | 3300032004 | Ga0307414_10019950 | Ga0307414_100199504 | 181 |
| 1112 | 3300032004 | Ga0307414_10027746 | Ga0307414_100277464 | 181 |
| 1113 | 3300032005 | Ga0307411_10234887 | Ga0307411_102348874 | 181 |
| 1114 | 3300032168 | Ga0316593_10010834 | Ga0316593_100108343 | 181 |
| 1115 | 3300035086 | Ga0373934_0014666 | Ga0373934_0014666_1730_2503 | 181 |
| 1116 | 3300035170 | Ga0373943_0036947 | Ga0373943_0036947_691_1464 | 181 |
| 1117 | 3300035171 | Ga0373946_0014205 | Ga0373946_0014205_529_1302 | 181 |
| 1118 | 3300035410 | Ga0373924_0015978 | Ga0373924_0015978_1401_2174 | 181 |
| 1119 | 3300035695 | Ga0373927_0199596 | Ga0373927_0199596_399_1172 | 181 |
| 1120 | 3300035724 | Ga0373933_0004782 | Ga0373933_0004782_4634_5407 | 181 |
| 1121 | 3300036401 | Ga0373937_0069217 | Ga0373937_0069217_779_1552 | 181 |
| 1122 | 3300037471 | Ga0395905_0572848 | Ga0395905_0572848_330_905 | 181 |
| 1123 | 3300041411 | Ga0439466_0055003 | Ga0439466_0055003_166_744 | 181 |
| 1124 | 3300041511 | Ga0451855_1923054 | Ga0451855_1923054_1007_1552 | 181 |
| 1125 | 3300042876 | Ga0451577_0006363 | Ga0451577_0006363_4005_4553 | 181 |
| 1126 | 3300044712 | Ga0453684_0055586 | Ga0453684_0055586_3950_4498 | 181 |
| 1127 | 3300046516 | Ga0495628_0058306 | Ga0495628_0058306_1038_1811 | 181 |
| 1128 | 3300046517 | Ga0495630_0218936 | Ga0495630_0218936_13_786 | 181 |
| 1129 | 3300046660 | Ga0495625_0016058 | Ga0495625_0016058_3124_3699 | 181 |
| 1130 | 3300046663 | Ga0495635_0052784 | Ga0495635_0052784_1498_2271 | 181 |
| 1131 | 3300046689 | Ga0495613_0163119 | Ga0495613_0163119_237_1010 | 181 |
| 1132 | 3300046690 | Ga0495624_0090865 | Ga0495624_0090865_456_1229 | 181 |
| 1133 | 3300047315 | Ga0495581_0048090 | Ga0495581_0048090_1154_1927 | 181 |
| 1134 | 3300047322 | Ga0495680_0028661 | Ga0495680_0028661_2339_3112 | 181 |
| 1135 | 3300047471 | Ga0495684_0106866 | Ga0495684_0106866_1075_1848 | 181 |
| 1136 | 3300049593 | Ga0501077_0206050 | Ga0501077_0206050_310_879 | 181 |
| 1137 | 3300049653 | Ga0501206_017533 | Ga0501206_017533_111_686 | 181 |
| 1138 | 3300049655 | Ga0501208_015304 | Ga0501208_015304_578_1153 | 181 |
| 1139 | 3300049822 | Ga0501035_1118227 | Ga0501035_1118227_12_587 | 181 |
| 1140 | 3300050496 | nmdc:mga07m45_131724_c1 | nmdc:mga07m45_131724_c1_548_1123 | 181 |
| 1141 | 3300050507 | nmdc:mga05p37_497302_c1 | nmdc:mga05p37_497302_c1_414_986 | 181 |
| 1142 | 3300053077 | Ga0495601_0177031 | Ga0495601_0177031_111_884 | 181 |
| 1143 | 3300053087 | Ga0500643_005686 | Ga0500643_005686_4333_4908 | 181 |
| 1144 | 3300053098 | Ga0500650_0081666 | Ga0500650_0081666_383_958 | 181 |
| 1145 | 3300053104 | Ga0500556_0000107 | Ga0500556_0000107_6779_7354 | 181 |
| 1146 | 3300053130 | Ga0500642_0000007 | Ga0500642_0000007_285461_286036 | 181 |
| 1147 | 3300059491 | Ga0587070_021744 | Ga0587070_021744_351_911 | 181 |
| 1148 | 3300059505 | Ga0587083_0120053 | Ga0587083_0120053_49_597 | 181 |
| 1149 | 3300059506 | Ga0587085_008385 | Ga0587085_008385_607_1167 | 181 |
| 1150 | 3300059512 | Ga0587092_021364 | Ga0587092_021364_325_885 | 181 |
| 1151 | 3300059660 | Ga0587124_004682 | Ga0587124_004682_156_716 | 181 |
| 1152 | 3300005981 | Ga0081538_10000746 | Ga0081538_1000074615 | 182 |
| 1153 | 3300011119 | Ga0105246_10552534 | Ga0105246_105525342 | 182 |
| 1154 | 3300012507 | Ga0157342_1004951 | Ga0157342_10049512 | 182 |
| 1155 | 3300013306 | Ga0163162_11101503 | Ga0163162_111015032 | 182 |
| 1156 | 3300014969 | Ga0157376_10485347 | Ga0157376_104853472 | 182 |
| 1157 | 3300021388 | Ga0213875_10010857 | Ga0213875_100108576 | 182 |
| 1158 | 3300031852 | Ga0307410_10170710 | Ga0307410_101707102 | 182 |
| 1159 | 3300031901 | Ga0307406_10014432 | Ga0307406_100144322 | 182 |
| 1160 | 3300031903 | Ga0307407_10135498 | Ga0307407_101354982 | 182 |
| 1161 | 3300031911 | Ga0307412_10039792 | Ga0307412_100397927 | 182 |
| 1162 | 3300035398 | Ga0316574_0001004 | Ga0316574_0001004_2319_2867 | 182 |
| 1163 | 3300037853 | Ga0436364_1354648 | Ga0436364_1354648_48840_49409 | 182 |
| 1164 | 3300044658 | Ga0466972_0007079 | Ga0466972_0007079_926_1495 | 182 |
| 1165 | 3300044683 | Ga0466965_0012715 | Ga0466965_0012715_976_1545 | 182 |
| 1166 | 3300044712 | Ga0453684_0020910 | Ga0453684_0020910_2928_3635 | 182 |
| 1167 | 3300044901 | Ga0466960_0017262 | Ga0466960_0017262_820_1389 | 182 |
| 1168 | 3300045976 | Ga0466967_0044233 | Ga0466967_0044233_1015_1584 | 182 |
| 1169 | 3300046615 | Ga0495656_0347301 | Ga0495656_0347301_51_629 | 182 |
| 1170 | 3300061719 | Ga0466962_0054472 | Ga0466962_0054472_839_1408 | 182 |
| 1171 | 3300005937 | Ga0081455_10015866 | Ga0081455_1001586614 | 183 |
| 1172 | 3300005985 | Ga0081539_10033236 | Ga0081539_100332363 | 183 |
| 1173 | 3300006880 | Ga0075429_100667185 | Ga0075429_1006671852 | 183 |
| 1174 | 3300017792 | Ga0163161_10060636 | Ga0163161_100606362 | 183 |
| 1175 | 3300035398 | Ga0316574_0109331 | Ga0316574_0109331_508_1059 | 183 |
| 1176 | 3300035398 | Ga0316574_0439226 | Ga0316574_0439226_208_759 | 183 |
| 1177 | 3300038443 | Ga0395901_0000654 | Ga0395901_0000654_33206_33757 | 183 |
| 1178 | 3300046517 | Ga0495630_0286748 | Ga0495630_0286748_306_923 | 183 |
| 1179 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_329040_329594 | 183 |
| 1180 | 3300049571 | Ga0501034_0608958 | Ga0501034_0608958_434_985 | 183 |
| 1181 | 3300049744 | Ga0501083_0232787 | Ga0501083_0232787_500_1051 | 183 |
| 1182 | 3300050508 | nmdc:mga09592_521261_c1 | nmdc:mga09592_521261_c1_408_971 | 183 |
| 1183 | 3300050508 | nmdc:mga09592_598506_c1 | nmdc:mga09592_598506_c1_120_671 | 183 |
| 1184 | 3300059652 | Ga0587107_045475 | Ga0587107_045475_116_685 | 183 |
| 1185 | 3300005340 | Ga0070689_100124190 | Ga0070689_1001241906 | 184 |
| 1186 | 3300005548 | Ga0070665_100212960 | Ga0070665_1002129602 | 184 |
| 1187 | 3300006051 | Ga0075364_10046502 | Ga0075364_100465024 | 184 |
| 1188 | 3300014325 | Ga0163163_10873696 | Ga0163163_108736961 | 184 |
| 1189 | 3300025931 | Ga0207644_10481732 | Ga0207644_104817321 | 184 |
| 1190 | 3300028794 | Ga0307515_10202150 | Ga0307515_102021503 | 184 |
| 1191 | 3300049570 | Ga0501033_0340260 | Ga0501033_0340260_363_920 | 184 |
| 1192 | 3300049572 | Ga0501036_0062381 | Ga0501036_0062381_934_1491 | 184 |
| 1193 | 3300049575 | Ga0501039_0121032 | Ga0501039_0121032_255_812 | 184 |
| 1194 | 3300049578 | Ga0501042_0818738 | Ga0501042_0818738_23_577 | 184 |
| 1195 | 3300049580 | Ga0501046_0229489 | Ga0501046_0229489_171_728 | 184 |
| 1196 | 3300049582 | Ga0501048_0017587 | Ga0501048_0017587_3404_3961 | 184 |
| 1197 | 3300049582 | Ga0501048_0362725 | Ga0501048_0362725_207_764 | 184 |
| 1198 | 3300049584 | Ga0501068_0657026 | Ga0501068_0657026_43_600 | 184 |
| 1199 | 3300049587 | Ga0501071_0164909 | Ga0501071_0164909_73_630 | 184 |
| 1200 | 3300049588 | Ga0501072_0114164 | Ga0501072_0114164_1187_1744 | 184 |
| 1201 | 3300049591 | Ga0501075_0083880 | Ga0501075_0083880_768_1325 | 184 |
| 1202 | 3300049591 | Ga0501075_0504443 | Ga0501075_0504443_148_708 | 184 |
| 1203 | 3300049591 | Ga0501075_0551589 | Ga0501075_0551589_228_785 | 184 |
| 1204 | 3300049592 | Ga0501076_0297910 | Ga0501076_0297910_287_844 | 184 |
| 1205 | 3300049743 | Ga0501081_0286507 | Ga0501081_0286507_378_935 | 184 |
| 1206 | 3300049744 | Ga0501083_0208275 | Ga0501083_0208275_102_659 | 184 |
| 1207 | 3300049824 | Ga0501045_0091755 | Ga0501045_0091755_70_627 | 184 |
| 1208 | 3300049824 | Ga0501045_0417026 | Ga0501045_0417026_197_757 | 184 |
| 1209 | 3300053136 | Ga0500559_0013950 | Ga0500559_0013950_1966_2523 | 184 |
| 1210 | 3300054114 | Ga0501084_0273530 | Ga0501084_0273530_282_839 | 184 |
| 1211 | 3300060353 | Ga0501082_0075942 | Ga0501082_0075942_1702_2259 | 184 |
| 1212 | 3300061734 | Ga0530510_0071285 | Ga0530510_0071285_1155_1712 | 184 |
| 1213 | 3300003163 | Ga0006759J45824_1039453 | Ga0006759J45824_10394536 | 185 |
| 1214 | 3300003300 | Ga0006758J48902_1012886 | Ga0006758J48902_10128867 | 185 |
| 1215 | 3300003300 | Ga0006758J48902_1013389 | Ga0006758J48902_10133892 | 185 |
| 1216 | 3300003322 | rootL2_10157317 | rootL2_101573172 | 185 |
| 1217 | 3300003323 | rootH1_10015553 | rootH1_100155534 | 185 |
| 1218 | 3300003323 | rootH1_10085120 | rootH1_100851203 | 185 |
| 1219 | 3300003659 | JGI25404J52841_10009653 | JGI25404J52841_100096533 | 185 |
| 1220 | 3300003693 | Ga0032354_1058877 | Ga0032354_10588773 | 185 |
| 1221 | 3300004798 | Ga0058859_11829127 | Ga0058859_118291273 | 185 |
| 1222 | 3300005295 | Ga0065707_10132436 | Ga0065707_101324362 | 185 |
| 1223 | 3300005459 | Ga0068867_100022477 | Ga0068867_1000224779 | 185 |
| 1224 | 3300005547 | Ga0070693_100261023 | Ga0070693_1002610232 | 185 |
| 1225 | 3300005563 | Ga0068855_100021979 | Ga0068855_10002197912 | 185 |
| 1226 | 3300005614 | Ga0068856_100040989 | Ga0068856_1000409898 | 185 |
| 1227 | 3300005841 | Ga0068863_100525482 | Ga0068863_1005254822 | 185 |
| 1228 | 3300005841 | Ga0068863_100871902 | Ga0068863_1008719022 | 185 |
| 1229 | 3300005841 | Ga0068863_101271023 | Ga0068863_1012710231 | 185 |
| 1230 | 3300005843 | Ga0068860_100129513 | Ga0068860_1001295133 | 185 |
| 1231 | 3300006195 | Ga0075366_10018157 | Ga0075366_100181578 | 185 |
| 1232 | 3300006237 | Ga0097621_100033934 | Ga0097621_1000339346 | 185 |
| 1233 | 3300006237 | Ga0097621_100390168 | Ga0097621_1003901682 | 185 |
| 1234 | 3300006358 | Ga0068871_100019563 | Ga0068871_1000195633 | 185 |
| 1235 | 3300006881 | Ga0068865_100349059 | Ga0068865_1003490592 | 185 |
| 1236 | 3300009098 | Ga0105245_10027267 | Ga0105245_100272674 | 185 |
| 1237 | 3300009176 | Ga0105242_10178219 | Ga0105242_101782194 | 185 |
| 1238 | 3300009176 | Ga0105242_10520208 | Ga0105242_105202082 | 185 |
| 1239 | 3300009545 | Ga0105237_11443511 | Ga0105237_114435111 | 185 |
| 1240 | 3300014325 | Ga0163163_11393216 | Ga0163163_113932162 | 185 |
| 1241 | 3300014969 | Ga0157376_11069613 | Ga0157376_110696132 | 185 |
| 1242 | 3300021384 | Ga0213876_10017136 | Ga0213876_100171365 | 185 |
| 1243 | 3300025899 | Ga0207642_10385765 | Ga0207642_103857651 | 185 |
| 1244 | 3300025906 | Ga0207699_10268933 | Ga0207699_102689332 | 185 |
| 1245 | 3300025922 | Ga0207646_10468882 | Ga0207646_104688823 | 185 |
| 1246 | 3300025927 | Ga0207687_10378226 | Ga0207687_103782262 | 185 |
| 1247 | 3300025934 | Ga0207686_10119923 | Ga0207686_101199233 | 185 |
| 1248 | 3300025934 | Ga0207686_10450479 | Ga0207686_104504792 | 185 |
| 1249 | 3300025949 | Ga0207667_10000612 | Ga0207667_1000061236 | 185 |
| 1250 | 3300025986 | Ga0207658_10822208 | Ga0207658_108222082 | 185 |
| 1251 | 3300026023 | Ga0207677_10000772 | Ga0207677_100007724 | 185 |
| 1252 | 3300026078 | Ga0207702_10040498 | Ga0207702_100404988 | 185 |
| 1253 | 3300026088 | Ga0207641_10430922 | Ga0207641_104309223 | 185 |
| 1254 | 3300026088 | Ga0207641_10563232 | Ga0207641_105632323 | 185 |
| 1255 | 3300026089 | Ga0207648_10019210 | Ga0207648_100192109 | 185 |
| 1256 | 3300031249 | Ga0265339_10005033 | Ga0265339_1000503314 | 185 |
| 1257 | 3300031344 | Ga0265316_10008237 | Ga0265316_100082378 | 185 |
| 1258 | 3300031456 | Ga0307513_10090959 | Ga0307513_100909595 | 185 |
| 1259 | 3300031616 | Ga0307508_10078439 | Ga0307508_100784396 | 185 |
| 1260 | 3300031711 | Ga0265314_10000003 | Ga0265314_100000031185 | 185 |
| 1261 | 3300032002 | Ga0307416_100689644 | Ga0307416_1006896443 | 185 |
| 1262 | 3300035083 | Ga0373926_0002499 | Ga0373926_0002499_2233_2922 | 185 |
| 1263 | 3300035086 | Ga0373934_0008632 | Ga0373934_0008632_1095_1766 | 185 |
| 1264 | 3300035089 | Ga0373944_0000533 | Ga0373944_0000533_8136_8825 | 185 |
| 1265 | 3300035111 | Ga0373923_0000448 | Ga0373923_0000448_4024_4713 | 185 |
| 1266 | 3300035113 | Ga0373936_0025334 | Ga0373936_0025334_201_890 | 185 |
| 1267 | 3300035116 | Ga0373945_0000882 | Ga0373945_0000882_5015_5704 | 185 |
| 1268 | 3300035117 | Ga0373953_0011305 | Ga0373953_0011305_2318_3007 | 185 |
| 1269 | 3300035410 | Ga0373924_0007336 | Ga0373924_0007336_2221_2910 | 185 |
| 1270 | 3300035692 | Ga0373935_0280257 | Ga0373935_0280257_283_972 | 185 |
| 1271 | 3300035695 | Ga0373927_0105317 | Ga0373927_0105317_453_1142 | 185 |
| 1272 | 3300036401 | Ga0373937_0288414 | Ga0373937_0288414_188_877 | 185 |
| 1273 | 3300037068 | Ga0373925_0045202 | Ga0373925_0045202_1323_2087 | 185 |
| 1274 | 3300037471 | Ga0395905_0092421 | Ga0395905_0092421_2130_2786 | 185 |
| 1275 | 3300039437 | Ga0436365_1253031 | Ga0436365_1253031_37098_37811 | 185 |
| 1276 | 3300039450 | Ga0436363_0022136 | Ga0436363_0022136_137_808 | 185 |
| 1277 | 3300039450 | Ga0436363_0323271 | Ga0436363_0323271_306_1019 | 185 |
| 1278 | 3300045051 | Ga0451576_0073380 | Ga0451576_0073380_674_1411 | 185 |
| 1279 | 3300046454 | Ga0495592_0136326 | Ga0495592_0136326_35_724 | 185 |
| 1280 | 3300046461 | Ga0495641_0076199 | Ga0495641_0076199_646_1335 | 185 |
| 1281 | 3300046462 | Ga0495651_0043424 | Ga0495651_0043424_1430_2119 | 185 |
| 1282 | 3300046463 | Ga0495653_0062800 | Ga0495653_0062800_687_1376 | 185 |
| 1283 | 3300046475 | Ga0495639_0003260 | Ga0495639_0003260_4931_5620 | 185 |
| 1284 | 3300046477 | Ga0495664_0017680 | Ga0495664_0017680_200_889 | 185 |
| 1285 | 3300046499 | Ga0495594_0008104 | Ga0495594_0008104_1633_2322 | 185 |
| 1286 | 3300046511 | Ga0495608_0003772 | Ga0495608_0003772_2451_3140 | 185 |
| 1287 | 3300046516 | Ga0495628_0032936 | Ga0495628_0032936_197_886 | 185 |
| 1288 | 3300046517 | Ga0495630_0013363 | Ga0495630_0013363_202_891 | 185 |
| 1289 | 3300046525 | Ga0495663_0001514 | Ga0495663_0001514_1750_2439 | 185 |
| 1290 | 3300046526 | Ga0495666_0007526 | Ga0495666_0007526_2232_2921 | 185 |
| 1291 | 3300046531 | Ga0495665_0004028 | Ga0495665_0004028_202_891 | 185 |
| 1292 | 3300046535 | Ga0495586_0006192 | Ga0495586_0006192_3776_4465 | 185 |
| 1293 | 3300046559 | Ga0495667_0003938 | Ga0495667_0003938_1420_2109 | 185 |
| 1294 | 3300046663 | Ga0495635_0004293 | Ga0495635_0004293_1929_2618 | 185 |
| 1295 | 3300046674 | Ga0495588_0032738 | Ga0495588_0032738_695_1384 | 185 |
| 1296 | 3300046678 | Ga0495599_0058308 | Ga0495599_0058308_1693_2382 | 185 |
| 1297 | 3300046679 | Ga0495623_0326026 | Ga0495623_0326026_78_767 | 185 |
| 1298 | 3300046680 | Ga0495646_0001927 | Ga0495646_0001927_4263_4952 | 185 |
| 1299 | 3300046690 | Ga0495624_0011751 | Ga0495624_0011751_5282_5971 | 185 |
| 1300 | 3300046809 | Ga0495600_0002535 | Ga0495600_0002535_3457_4146 | 185 |
| 1301 | 3300047315 | Ga0495581_0022118 | Ga0495581_0022118_1693_2382 | 185 |
| 1302 | 3300047317 | Ga0495604_0121875 | Ga0495604_0121875_997_1686 | 185 |
| 1303 | 3300047319 | Ga0495674_0100487 | Ga0495674_0100487_1572_2261 | 185 |
| 1304 | 3300047471 | Ga0495684_0001009 | Ga0495684_0001009_5460_6149 | 185 |
| 1305 | 3300047471 | Ga0495684_0417907 | Ga0495684_0417907_50_721 | 185 |
| 1306 | 3300047673 | Ga0495593_0016768 | Ga0495593_0016768_1958_2647 | 185 |
| 1307 | 3300048089 | Ga0495614_0003011 | Ga0495614_0003011_3551_4240 | 185 |
| 1308 | 3300048906 | Ga0496103_0246527 | Ga0496103_0246527_444_1100 | 185 |
| 1309 | 3300048924 | Ga0496121_0244620 | Ga0496121_0244620_143_844 | 185 |
| 1310 | 3300048927 | Ga0496124_0541390 | Ga0496124_0541390_70_717 | 185 |
| 1311 | 3300049583 | Ga0501067_0129961 | Ga0501067_0129961_618_1175 | 185 |
| 1312 | 3300049584 | Ga0501068_0078516 | Ga0501068_0078516_1061_1621 | 185 |
| 1313 | 3300049587 | Ga0501071_0018420 | Ga0501071_0018420_1114_1674 | 185 |
| 1314 | 3300049589 | Ga0501073_0199830 | Ga0501073_0199830_348_905 | 185 |
| 1315 | 3300049590 | Ga0501074_0002140 | Ga0501074_0002140_7490_8047 | 185 |
| 1316 | 3300049744 | Ga0501083_0071428 | Ga0501083_0071428_1367_1924 | 185 |
| 1317 | 3300050493 | nmdc:mga0k408_14443_c1 | nmdc:mga0k408_14443_c1_3031_3591 | 185 |
| 1318 | 3300053077 | Ga0495601_0077447 | Ga0495601_0077447_476_1165 | 185 |
| 1319 | 3300053078 | Ga0495612_0009262 | Ga0495612_0009262_34_723 | 185 |
| 1320 | 3300053080 | Ga0500635_0007996 | Ga0500635_0007996_1887_2495 | 185 |
| 1321 | 3300053084 | Ga0495595_0003797 | Ga0495595_0003797_3225_3914 | 185 |
| 1322 | 3300053085 | Ga0495619_0002703 | Ga0495619_0002703_7250_7939 | 185 |
| 1323 | 3300053098 | Ga0500650_0156728 | Ga0500650_0156728_333_896 | 185 |
| 1324 | 3300054114 | Ga0501084_0021102 | Ga0501084_0021102_79_636 | 185 |
| 1325 | 3300060353 | Ga0501082_0010286 | Ga0501082_0010286_624_1184 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a63-assembly1.cif.gz_J | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9794 | 9 | 182 |
| 7azo-assembly1.cif.gz_L5A | 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 | 0.9785 | 10 | 185 |
| 8ceu-assembly1.cif.gz_f | retapamulin and capreomycin bound to the 50s subunit | 0.9774 | 9 | 183 |
| 5ns4-assembly2.cif.gz_B | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9768 | 9 | 184 |
| 8crx-assembly1.cif.gz_f | cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound | 0.9761 | 4 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9752 | 9 | 184 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9645 | 9 | 184 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9297 | 28 | 183 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9269 | 28 | 185 | 3.30.1440.10 |
| af_O14337_108_278_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9105 | 28 | 183 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9LY30-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9974 | 7 | 185 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q88XX4-F1-model_v4 | Large ribosomal subunit protein uL5 (50S ribosomal protein L5) | 0.9972 | 8 | 185 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G1FQA2-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9969 | 12 | 185 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2V9MCD7-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9967 | 9 | 185 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2N3AXD5-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9967 | 20 | 185 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar