F493027

General Info

Members Datasets Scaffolds Average Seq Length
1325 486 1325 183

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10027267|Ga0105245_100272674
Length 222
Sequence MADEKQEKAPRGDKGGDKDKRRGKSEASNEPKAKVITTVEVQAARFAGKYTKDVIPALVKQFGYKNPNEVPKLQKIVINMGLGAAVTNPKIVDAAVDELRAITGQKPVVTRAKKAIASFKLRQGIAIGAMVTLRKARMWEFLDRLVTLGLPRTRDFRGVSRKAFDGKGNYTLGLKEQIIFPEINYDRIDVIKGLNISFVTTARTDDEGRALLTHLGMPFRAP

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
145 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
149 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
234 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
247 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
251 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
265 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
266 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
267 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
273 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
277 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
291 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
292 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
299 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
300 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
301 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
302 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
308 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
309 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
310 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
311 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
312 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
313 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
314 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
315 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
316 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
317 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
320 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
321 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
322 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
323 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
324 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
325 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
347 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
348 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
349 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
350 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
356 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
357 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
358 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
359 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
372 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
377 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
382 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
391 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
410 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
411 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
412 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
413 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
416 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
417 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
418 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
419 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
429 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
430 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
431 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
432 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
433 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
434 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
435 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
436 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
439 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
440 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
441 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
442 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
446 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
447 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
448 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
449 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
450 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
451 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
452 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
453 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
456 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
457 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
486 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 4.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 1.28
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1039453 3300003163 Bacteria 2123
2 Ga0006758J48902_1012886 3300003300 Bacteria 2834
3 Ga0006758J48902_1013389 3300003300 Bacteria 1314
4 rootL2_10157317 3300003322 Bacteria 1205
5 rootL2_10194461 3300003322 Bacteria 1615
6 rootH1_10015553 3300003323 Bacteria 3043
7 rootH1_10085120 3300003323 Bacteria 1192
8 JGI25404J52841_10009653 3300003659 Bacteria 2066
9 Ga0032354_1058877 3300003693 Bacteria 1077
10 Ga0058859_11829127 3300004798 Bacteria 1752
11 Ga0065704_10091784 3300005289 Bacteria 2682
12 Ga0065704_10195761 3300005289 Bacteria 1127
13 Ga0065712_10091604 3300005290 Bacteria 2366
14 Ga0065715_10102075 3300005293 Bacteria 3147
15 Ga0065715_10143668 3300005293 Bacteria 1814
16 Ga0065715_10165959 3300005293 Bacteria 1586
17 Ga0065707_10027729 3300005295 Bacteria 1354
18 Ga0065707_10094039 3300005295 Bacteria 3532
19 Ga0065707_10132362 3300005295 Bacteria 1898
20 Ga0065707_10132436 3300005295 Bacteria 1897
21 Ga0070676_10255063 3300005328 Bacteria 1172
22 Ga0070683_100000033 3300005329 Bacteria 135305
23 Ga0070690_100115551 3300005330 Bacteria 1795
24 Ga0070690_100159739 3300005330 Bacteria 1543
25 Ga0070670_100002900 3300005331 Bacteria 14190
26 Ga0070670_100530543 3300005331 Bacteria 1049
27 Ga0068869_100009311 3300005334 Bacteria 6370
28 Ga0068869_100024219 3300005334 Unclassified 4203
29 Ga0068869_100027588 3300005334 Bacteria 3960
30 Ga0068869_100413594 3300005334 Bacteria 1111
31 Ga0070666_10102938 3300005335 Bacteria 1969
32 Ga0070666_10507546 3300005335 Bacteria 875
33 Ga0070680_100246401 3300005336 Bacteria 1511
34 Ga0070680_100766455 3300005336 Bacteria 831
35 Ga0070682_100155089 3300005337 Bacteria 1575
36 Ga0068868_100000632 3300005338 Bacteria 23664
37 Ga0068868_100045599 3300005338 Bacteria 3430
38 Ga0068868_100058678 3300005338 Bacteria 3042
39 Ga0068868_100235512 3300005338 Bacteria 1537
40 Ga0068868_100244098 3300005338 Bacteria 1510
41 Ga0068868_100695734 3300005338 Bacteria 909
42 Ga0068868_100968036 3300005338 Bacteria 777
43 Ga0070660_100019074 3300005339 Bacteria 5020
44 Ga0070660_100355169 3300005339 Bacteria 1207
45 Ga0070660_100436774 3300005339 Bacteria 1085
46 Ga0070689_100021710 3300005340 Bacteria 4785
47 Ga0070689_100124190 3300005340 Bacteria 2064
48 Ga0070689_100190030 3300005340 Bacteria 1672
49 Ga0070661_100010686 3300005344 Bacteria 6387
50 Ga0070661_100053245 3300005344 Unclassified 2961
51 Ga0070661_100418491 3300005344 Bacteria 1062
52 Ga0070692_10001104 3300005345 Bacteria 9415
53 Ga0070692_10004482 3300005345 Bacteria 5844
54 Ga0070668_100003120 3300005347 Bacteria 12241
55 Ga0070668_100120598 3300005347 Bacteria 2095
56 Ga0070668_100228205 3300005347 Bacteria 1538
57 Ga0070669_100017307 3300005353 Bacteria 5142
58 Ga0070669_100030647 3300005353 Bacteria 3882
59 Ga0070669_100097584 3300005353 Bacteria 2212
60 Ga0070675_100000007 3300005354 Bacteria 263394
61 Ga0070675_100036517 3300005354 Bacteria 3999
62 Ga0070671_100778352 3300005355 Bacteria 832
63 Ga0070674_100415638 3300005356 Unclassified 1102
64 Ga0070673_100034873 3300005364 Bacteria 3812
65 Ga0070673_100079521 3300005364 Unclassified 2655
66 Ga0070673_100207463 3300005364 Unclassified 1690
67 Ga0070673_100697288 3300005364 Bacteria 932
68 Ga0070673_100705998 3300005364 Bacteria 926
69 Ga0070688_100229472 3300005365 Bacteria 1312
70 Ga0070659_100010189 3300005366 Bacteria 6915
71 Ga0070659_100117793 3300005366 Bacteria 2148
72 Ga0070667_100045119 3300005367 Unclassified 3705
73 Ga0070667_100096799 3300005367 Bacteria 2545
74 Ga0070667_100191169 3300005367 Bacteria 1813
75 Ga0070667_100436951 3300005367 Bacteria 1195
76 Ga0070703_10000427 3300005406 Bacteria 17206
77 Ga0070703_10077638 3300005406 Bacteria 1123
78 Ga0070703_10248062 3300005406 Bacteria 721
79 Ga0070703_10349908 3300005406 Bacteria 630
80 Ga0070709_10009375 3300005434 Bacteria 5398
81 Ga0070709_10136421 3300005434 Bacteria 1681
82 Ga0070709_10471596 3300005434 Bacteria 949
83 Ga0070714_100004105 3300005435 Bacteria 10951
84 Ga0070714_100019115 3300005435 Bacteria 5577
85 Ga0070713_100009715 3300005436 Bacteria 6909
86 Ga0070713_100403549 3300005436 Bacteria 1277
87 Ga0070713_100447613 3300005436 Bacteria 1212
88 Ga0070713_101247721 3300005436 Bacteria 720
89 Ga0070713_101432516 3300005436 Bacteria 670
90 Ga0070710_10010725 3300005437 Bacteria 4505
91 Ga0070710_10029534 3300005437 Bacteria 2942
92 Ga0070710_10090324 3300005437 Bacteria 1805
93 Ga0070710_10666943 3300005437 Bacteria 731
94 Ga0070701_10003059 3300005438 Bacteria 6557
95 Ga0070701_10188587 3300005438 Bacteria 1212
96 Ga0070701_10500755 3300005438 Bacteria 789
97 Ga0070711_100033377 3300005439 Bacteria 3427
98 Ga0070711_100046997 3300005439 Bacteria 2944
99 Ga0070711_100294410 3300005439 Bacteria 1288
100 Ga0070711_100677303 3300005439 Bacteria 867
101 Ga0070711_100812563 3300005439 Bacteria 794
102 Ga0070705_100029752 3300005440 Bacteria 3008
103 Ga0070700_100079746 3300005441 Bacteria 2111
104 Ga0070700_100195828 3300005441 Bacteria 1416
105 Ga0070700_100278482 3300005441 Bacteria 1212
106 Ga0070700_100580821 3300005441 Bacteria 875
107 Ga0070700_100583576 3300005441 Bacteria 873
108 Ga0070694_100001132 3300005444 Bacteria 15284
109 Ga0070694_100004904 3300005444 Bacteria 8062
110 Ga0070694_100038571 3300005444 Unclassified 3175
111 Ga0070694_100093403 3300005444 Bacteria 2115
112 Ga0070708_100146203 3300005445 Bacteria 2196
113 Ga0070708_100337407 3300005445 Bacteria 1420
114 Ga0070708_100388002 3300005445 Bacteria 1317
115 Ga0070708_100516085 3300005445 Bacteria 1127
116 Ga0070708_101469904 3300005445 Bacteria 635
117 Ga0070663_100100368 3300005455 Bacteria 2159
118 Ga0070663_101290746 3300005455 Bacteria 644
119 Ga0070662_100138944 3300005457 Bacteria 1881
120 Ga0070662_100256012 3300005457 Unclassified 1409
121 Ga0070662_100575853 3300005457 Bacteria 945
122 Ga0070662_100679972 3300005457 Bacteria 870
123 Ga0070681_10047524 3300005458 Bacteria 4290
124 Ga0070681_10287200 3300005458 Bacteria 1555
125 Ga0070681_10303539 3300005458 Bacteria 1506
126 Ga0070681_10312633 3300005458 Bacteria 1480
127 Ga0068867_100022477 3300005459 Bacteria 4510
128 Ga0068867_100058565 3300005459 Bacteria 2855
129 Ga0068867_100068643 3300005459 Bacteria 2646
130 Ga0068867_100403028 3300005459 Bacteria 1154
131 Ga0068867_101249685 3300005459 Bacteria 684
132 Ga0070685_10027522 3300005466 Bacteria 3143
133 Ga0070685_10179176 3300005466 Bacteria 1363
134 Ga0070706_100005771 3300005467 Bacteria 11760
135 Ga0070706_100021749 3300005467 Bacteria 5905
136 Ga0070706_100160143 3300005467 Bacteria 2101
137 Ga0070706_100290494 3300005467 Bacteria 1526
138 Ga0070706_100308008 3300005467 Bacteria 1477
139 Ga0070706_100381803 3300005467 Bacteria 1312
140 Ga0070706_100394110 3300005467 Unclassified 1289
141 Ga0070707_100000343 3300005468 Bacteria 45816
142 Ga0070707_100006596 3300005468 Bacteria 10769
143 Ga0070707_100008651 3300005468 Bacteria 9448
144 Ga0070707_100012600 3300005468 Bacteria 7898
145 Ga0070707_100081504 3300005468 Bacteria 3124
146 Ga0070707_100296630 3300005468 Unclassified 1571
147 Ga0070707_101091800 3300005468 Bacteria 764
148 Ga0070707_101106659 3300005468 Bacteria 758
149 Ga0070707_101344140 3300005468 Bacteria 681
150 Ga0070698_100000084 3300005471 Bacteria 73239
151 Ga0070698_100013686 3300005471 Bacteria 8589
152 Ga0070698_100029263 3300005471 Bacteria 5716
153 Ga0070698_100039432 3300005471 Bacteria 4862
154 Ga0070698_100039505 3300005471 Bacteria 4857
155 Ga0070698_100064533 3300005471 Bacteria 3689
156 Ga0070698_100172142 3300005471 Bacteria 2106
157 Ga0070698_100495468 3300005471 Bacteria 1159
158 Ga0070698_100780400 3300005471 Bacteria 899
159 Ga0070699_100038276 3300005518 Bacteria 4152
160 Ga0070699_100077781 3300005518 Unclassified 2888
161 Ga0070699_100098833 3300005518 Bacteria 2557
162 Ga0070699_100124595 3300005518 Bacteria 2268
163 Ga0070699_100171924 3300005518 Unclassified 1920
164 Ga0070699_100242768 3300005518 Bacteria 1608
165 Ga0070679_100030062 3300005530 Bacteria 5361
166 Ga0070679_100153303 3300005530 Bacteria 2280
167 Ga0070684_100006540 3300005535 Bacteria 9022
168 Ga0070684_101085047 3300005535 Bacteria 752
169 Ga0070697_100002003 3300005536 Bacteria 15614
170 Ga0070697_100030441 3300005536 Bacteria 4336
171 Ga0070697_100183374 3300005536 Bacteria 1775
172 Ga0070697_100250256 3300005536 Bacteria 1515
173 Ga0070697_100365617 3300005536 Unclassified 1248
174 Ga0070697_100936537 3300005536 Bacteria 769
175 Ga0068853_100010446 3300005539 Bacteria 7515
176 Ga0068853_100016886 3300005539 Bacteria 6015
177 Ga0068853_100325030 3300005539 Bacteria 1427
178 Ga0068853_100330010 3300005539 Bacteria 1415
179 Ga0068853_100562825 3300005539 Bacteria 1081
180 Ga0070672_100057049 3300005543 Bacteria 3065
181 Ga0070686_100002184 3300005544 Bacteria 10801
182 Ga0070686_100038213 3300005544 Bacteria 2983
183 Ga0070686_100188740 3300005544 Bacteria 1470
184 Ga0070686_100276720 3300005544 Bacteria 1236
185 Ga0070695_100073003 3300005545 Bacteria 2251
186 Ga0070695_100104477 3300005545 Bacteria 1913
187 Ga0070695_100117228 3300005545 Bacteria 1817
188 Ga0070695_100136229 3300005545 Bacteria 1698
189 Ga0070695_100239366 3300005545 Bacteria 1316
190 Ga0070695_100408605 3300005545 Bacteria 1031
191 Ga0070695_100584665 3300005545 Bacteria 875
192 Ga0070696_100012751 3300005546 Bacteria 5644
193 Ga0070696_100033599 3300005546 Bacteria 3525
194 Ga0070696_100062295 3300005546 Bacteria 2610
195 Ga0070696_100498617 3300005546 Unclassified 968
196 Ga0070693_100042808 3300005547 Bacteria 2554
197 Ga0070693_100261023 3300005547 Bacteria 1152
198 Ga0070693_100312066 3300005547 Bacteria 1064
199 Ga0070665_100015455 3300005548 Bacteria 7667
200 Ga0070665_100039969 3300005548 Bacteria 4716
201 Ga0070665_100212960 3300005548 Bacteria 1933
202 Ga0070704_100058068 3300005549 Unclassified 2755
203 Ga0070704_100078530 3300005549 Bacteria 2422
204 Ga0070704_100139413 3300005549 Bacteria 1891
205 Ga0070704_100142767 3300005549 Unclassified 1872
206 Ga0070704_100158890 3300005549 Bacteria 1786
207 Ga0070704_100683494 3300005549 Unclassified 909
208 Ga0068855_100002256 3300005563 Bacteria 23806
209 Ga0068855_100021979 3300005563 Bacteria 7648
210 Ga0068855_100135013 3300005563 Bacteria 2815
211 Ga0068855_101171064 3300005563 Bacteria 800
212 Ga0070664_100005841 3300005564 Bacteria 9927
213 Ga0070664_100108268 3300005564 Unclassified 2423
214 Ga0070664_100361144 3300005564 Bacteria 1323
215 Ga0070664_100383001 3300005564 Bacteria 1284
216 Ga0068857_100084727 3300005577 Bacteria 2832
217 Ga0068857_100233814 3300005577 Bacteria 1681
218 Ga0068857_101166759 3300005577 Bacteria 745
219 Ga0068854_100831891 3300005578 Bacteria 807
220 Ga0068856_100040989 3300005614 Bacteria 4549
221 Ga0068856_100073064 3300005614 Bacteria 3396
222 Ga0070702_100076187 3300005615 Bacteria 1996
223 Ga0070702_100160357 3300005615 Bacteria 1453
224 Ga0068852_100384633 3300005616 Bacteria 1377
225 Ga0068852_100491550 3300005616 Bacteria 1221
226 Ga0068852_100719697 3300005616 Bacteria 1009
227 Ga0068859_100006061 3300005617 Bacteria 12276
228 Ga0068859_100020360 3300005617 Bacteria 6660
229 Ga0068859_100052938 3300005617 Bacteria 4082
230 Ga0068859_100117976 3300005617 Bacteria 2719
231 Ga0068859_100609037 3300005617 Bacteria 1185
232 Ga0068864_100000349 3300005618 Bacteria 40495
233 Ga0068864_100017558 3300005618 Bacteria 5965
234 Ga0068864_100018412 3300005618 Bacteria 5835
235 Ga0068864_100053223 3300005618 Bacteria 3491
236 Ga0068864_100155076 3300005618 Bacteria 2078
237 Ga0068864_100195967 3300005618 Bacteria 1853
238 Ga0068864_100494591 3300005618 Bacteria 1176
239 Ga0068866_10000684 3300005718 Bacteria 15437
240 Ga0068866_10781779 3300005718 Bacteria 662
241 Ga0068861_100069342 3300005719 Bacteria 2727
242 Ga0068861_100084086 3300005719 Bacteria 2498
243 Ga0068861_100283062 3300005719 Bacteria 1429
244 Ga0068861_100411943 3300005719 Bacteria 1202
245 Ga0068861_100862671 3300005719 Bacteria 854
246 Ga0068851_10045673 3300005834 Unclassified 2214
247 Ga0068851_10291239 3300005834 Bacteria 936
248 Ga0068870_10030357 3300005840 Bacteria 2731
249 Ga0068870_10277622 3300005840 Bacteria 1049
250 Ga0068863_100050660 3300005841 Bacteria 3935
251 Ga0068863_100104622 3300005841 Bacteria 2693
252 Ga0068863_100218686 3300005841 Bacteria 1835
253 Ga0068863_100282278 3300005841 Bacteria 1609
254 Ga0068863_100335315 3300005841 Bacteria 1471
255 Ga0068863_100525482 3300005841 Bacteria 1167
256 Ga0068863_100871902 3300005841 Bacteria 900
257 Ga0068863_101271023 3300005841 Bacteria 743
258 Ga0068863_101362902 3300005841 Bacteria 717
259 Ga0068863_101866298 3300005841 Bacteria 611
260 Ga0068858_100030046 3300005842 Bacteria 5045
261 Ga0068858_100043268 3300005842 Bacteria 4176
262 Ga0068858_100060954 3300005842 Bacteria 3487
263 Ga0068858_100129609 3300005842 Bacteria 2364
264 Ga0068858_100241418 3300005842 Unclassified 1714
265 Ga0068858_100466781 3300005842 Bacteria 1217
266 Ga0068858_100545114 3300005842 Bacteria 1123
267 Ga0068858_100660916 3300005842 Bacteria 1016
268 Ga0068858_100958323 3300005842 Bacteria 838
269 Ga0068860_100036229 3300005843 Bacteria 4728
270 Ga0068860_100108998 3300005843 Bacteria 2646
271 Ga0068860_100129513 3300005843 Bacteria 2421
272 Ga0068860_100138962 3300005843 Bacteria 2334
273 Ga0068860_100173905 3300005843 Bacteria 2081
274 Ga0068860_100227613 3300005843 Bacteria 1812
275 Ga0068860_100630527 3300005843 Bacteria 1079
276 Ga0068860_101059429 3300005843 Bacteria 830
277 Ga0068862_100003143 3300005844 Bacteria 14358
278 Ga0068862_100019818 3300005844 Bacteria 5616
279 Ga0068862_100063574 3300005844 Bacteria 3175
280 Ga0081455_10015866 3300005937 Bacteria 7294
281 Ga0081538_10000746 3300005981 Bacteria 35470
282 Ga0081540_1071335 3300005983 Unclassified 1605
283 Ga0081539_10004359 3300005985 Bacteria 15776
284 Ga0081539_10033236 3300005985 Bacteria 3145
285 Ga0081539_10048025 3300005985 Bacteria 2431
286 Ga0070717_10007950 3300006028 Bacteria 7898
287 Ga0070717_10451231 3300006028 Bacteria 1159
288 Ga0075364_10046502 3300006051 Bacteria 2826
289 Ga0070715_10000038 3300006163 Bacteria 67091
290 Ga0070716_100000006 3300006173 Bacteria 268067
291 Ga0070716_100105842 3300006173 Bacteria 1734
292 Ga0070716_100112969 3300006173 Bacteria 1687
293 Ga0070716_100137550 3300006173 Bacteria 1553
294 Ga0070716_100333897 3300006173 Bacteria 1067
295 Ga0070716_100466167 3300006173 Bacteria 924
296 Ga0070716_100803972 3300006173 Bacteria 728
297 Ga0070712_100018095 3300006175 Bacteria 4570
298 Ga0070712_100075018 3300006175 Bacteria 2431
299 Ga0070712_100841590 3300006175 Bacteria 789
300 Ga0075366_10018157 3300006195 Bacteria 4061
301 Ga0097621_100033934 3300006237 Bacteria 4068
302 Ga0097621_100148746 3300006237 Bacteria 2007
303 Ga0097621_100267095 3300006237 Bacteria 1502
304 Ga0097621_100314685 3300006237 Bacteria 1385
305 Ga0097621_100390168 3300006237 Bacteria 1245
306 Ga0097621_100537624 3300006237 Bacteria 1062
307 Ga0097621_100602095 3300006237 Bacteria 1004
308 Ga0075370_10103706 3300006353 Bacteria 1648
309 Ga0068871_100019563 3300006358 Bacteria 5171
310 Ga0068871_100193630 3300006358 Bacteria 1752
311 Ga0068871_100253749 3300006358 Bacteria 1532
312 Ga0068871_100425472 3300006358 Bacteria 1186
313 Ga0068871_100544580 3300006358 Bacteria 1050
314 Ga0068871_100600343 3300006358 Bacteria 1001
315 Ga0075428_100090316 3300006844 Bacteria 3341
316 Ga0075428_100594780 3300006844 Bacteria 1182
317 Ga0075428_101135833 3300006844 Bacteria 825
318 Ga0075430_100048234 3300006846 Bacteria 3595
319 Ga0075430_100289235 3300006846 Bacteria 1356
320 Ga0075431_100006546 3300006847 Bacteria 11573
321 Ga0075431_100012451 3300006847 Bacteria 8585
322 Ga0075431_100062412 3300006847 Bacteria 3845
323 Ga0075433_10117851 3300006852 Unclassified 2356
324 Ga0075433_10196766 3300006852 Bacteria 1793
325 Ga0075433_10218906 3300006852 Bacteria 1691
326 Ga0075433_10910508 3300006852 Bacteria 767
327 Ga0075434_100014841 3300006871 Bacteria 7452
328 Ga0075434_100108899 3300006871 Bacteria 2780
329 Ga0075434_100135556 3300006871 Bacteria 2481
330 Ga0075434_100147155 3300006871 Bacteria 2376
331 Ga0075434_100149590 3300006871 Bacteria 2355
332 Ga0075434_100311101 3300006871 Bacteria 1595
333 Ga0075434_100980111 3300006871 Bacteria 859
334 Ga0075434_101034042 3300006871 Bacteria 835
335 Ga0075429_100043278 3300006880 Bacteria 3918
336 Ga0075429_100053365 3300006880 Bacteria 3518
337 Ga0075429_100116740 3300006880 Bacteria 2333
338 Ga0075429_100192614 3300006880 Bacteria 1786
339 Ga0075429_100603236 3300006880 Bacteria 962
340 Ga0075429_100667185 3300006880 Bacteria 911
341 Ga0068865_100042984 3300006881 Bacteria 3085
342 Ga0068865_100113414 3300006881 Bacteria 2003
343 Ga0068865_100114113 3300006881 Bacteria 1998
344 Ga0068865_100349059 3300006881 Bacteria 1198
345 Ga0075436_100000017 3300006914 Bacteria 151066
346 Ga0075436_100098077 3300006914 Bacteria 2039
347 Ga0097620_100006061 3300006931 Bacteria 12276
348 Ga0097620_100020360 3300006931 Bacteria 6660
349 Ga0097620_100052942 3300006931 Bacteria 4082
350 Ga0097620_100117967 3300006931 Bacteria 2719
351 Ga0097620_100609021 3300006931 Bacteria 1185
352 Ga0075435_100006806 3300007076 Bacteria 8112
353 Ga0075435_100458777 3300007076 Bacteria 1099
354 Ga0075435_100773302 3300007076 Unclassified 836
355 Ga0075435_100943304 3300007076 Bacteria 753
356 Ga0099794_10157532 3300007265 Bacteria 1154
357 Ga0105251_10107438 3300009011 Bacteria 1273
358 Ga0105244_10011650 3300009036 Bacteria 5253
359 Ga0105244_10351770 3300009036 Bacteria 679
360 Ga0105240_10127569 3300009093 Bacteria 3055
361 Ga0105240_11218503 3300009093 Bacteria 796
362 Ga0111539_10000022 3300009094 Bacteria 240838
363 Ga0111539_10005702 3300009094 Bacteria 16116
364 Ga0111539_10047047 3300009094 Bacteria 5158
365 Ga0111539_12530333 3300009094 Bacteria 595
366 Ga0105245_10001507 3300009098 Bacteria 21079
367 Ga0105245_10027267 3300009098 Bacteria 5034
368 Ga0105245_10067426 3300009098 Bacteria 3241
369 Ga0105245_10133819 3300009098 Bacteria 2328
370 Ga0105245_10234129 3300009098 Bacteria 1778
371 Ga0105245_10344030 3300009098 Bacteria 1476
372 Ga0105245_10498453 3300009098 Bacteria 1234
373 Ga0105247_10142791 3300009101 Bacteria 1570
374 Ga0114129_10001417 3300009147 Bacteria 32326
375 Ga0114129_10023849 3300009147 Bacteria 8670
376 Ga0114129_10063914 3300009147 Bacteria 5136
377 Ga0114129_10237453 3300009147 Bacteria 2452
378 Ga0114129_10254600 3300009147 Bacteria 2356
379 Ga0114129_10425680 3300009147 Bacteria 1745
380 Ga0114129_11058774 3300009147 Bacteria 1018
381 Ga0114129_11194260 3300009147 Bacteria 948
382 Ga0114129_11504603 3300009147 Unclassified 827
383 Ga0105243_10000777 3300009148 Bacteria 30566
384 Ga0105243_10005446 3300009148 Bacteria 9931
385 Ga0105243_10063603 3300009148 Bacteria 2957
386 Ga0105243_10085454 3300009148 Bacteria 2586
387 Ga0105243_10207725 3300009148 Bacteria 1722
388 Ga0105243_10267171 3300009148 Bacteria 1534
389 Ga0105243_10293320 3300009148 Bacteria 1470
390 Ga0105243_10384782 3300009148 Unclassified 1299
391 Ga0105243_10436767 3300009148 Bacteria 1225
392 Ga0105243_10499500 3300009148 Bacteria 1152
393 Ga0105241_10017868 3300009174 Bacteria 5216
394 Ga0105241_10311812 3300009174 Bacteria 1354
395 Ga0105241_10409529 3300009174 Bacteria 1191
396 Ga0105241_10898177 3300009174 Bacteria 822
397 Ga0105242_10001940 3300009176 Bacteria 16279
398 Ga0105242_10003416 3300009176 Bacteria 12345
399 Ga0105242_10065108 3300009176 Bacteria 3006
400 Ga0105242_10092929 3300009176 Bacteria 2542
401 Ga0105242_10178219 3300009176 Bacteria 1873
402 Ga0105242_10376498 3300009176 Bacteria 1318
403 Ga0105242_10377915 3300009176 Bacteria 1316
404 Ga0105242_10377916 3300009176 Bacteria 1316
405 Ga0105242_10520208 3300009176 Bacteria 1135
406 Ga0105248_10004070 3300009177 Bacteria 16159
407 Ga0105248_10129876 3300009177 Bacteria 2842
408 Ga0105248_10138301 3300009177 Bacteria 2747
409 Ga0105248_10438568 3300009177 Bacteria 1471
410 Ga0105248_10611825 3300009177 Bacteria 1229
411 Ga0105248_10886601 3300009177 Bacteria 1007
412 Ga0105237_10047955 3300009545 Bacteria 4295
413 Ga0105237_10239542 3300009545 Bacteria 1815
414 Ga0105237_10284777 3300009545 Bacteria 1655
415 Ga0105237_10721327 3300009545 Bacteria 1003
416 Ga0105237_11443511 3300009545 Bacteria 694
417 Ga0105238_10000002 3300009551 Bacteria 772711
418 Ga0105238_10013909 3300009551 Bacteria 8139
419 Ga0105238_10094337 3300009551 Bacteria 2980
420 Ga0105238_10880654 3300009551 Bacteria 913
421 Ga0105249_10000118 3300009553 Bacteria 107887
422 Ga0105249_10007788 3300009553 Bacteria 9333
423 Ga0105249_10089304 3300009553 Bacteria 2880
424 Ga0105249_10121147 3300009553 Bacteria 2486
425 Ga0105249_10945772 3300009553 Bacteria 929
426 Ga0099796_10045790 3300010159 Bacteria 1499
427 Ga0105239_10034574 3300010375 Bacteria 5550
428 Ga0105239_10442356 3300010375 Bacteria 1474
429 Ga0105239_10592207 3300010375 Bacteria 1264
430 Ga0105246_10195568 3300011119 Bacteria 1568
431 Ga0105246_10552534 3300011119 Bacteria 987
432 Ga0105246_10653548 3300011119 Bacteria 916
433 Ga0105246_10894739 3300011119 Bacteria 796
434 Ga0105246_11139647 3300011119 Bacteria 714
435 Ga0157342_1004951 3300012507 Bacteria 1206
436 Ga0157373_10042642 3300013100 Bacteria 3243
437 Ga0157373_10173913 3300013100 Bacteria 1515
438 Ga0157373_10346517 3300013100 Bacteria 1059
439 Ga0157373_10350626 3300013100 Bacteria 1053
440 Ga0157371_10260026 3300013102 Bacteria 1251
441 Ga0157370_10223850 3300013104 Bacteria 1742
442 Ga0157370_10525608 3300013104 Bacteria 1086
443 Ga0157369_10001943 3300013105 Bacteria 24887
444 Ga0157369_10100872 3300013105 Bacteria 3077
445 Ga0157369_10179579 3300013105 Bacteria 2227
446 Ga0157369_10705100 3300013105 Bacteria 1039
447 Ga0157369_10972711 3300013105 Bacteria 869
448 Ga0157374_10000005 3300013296 Bacteria 646767
449 Ga0157374_10051849 3300013296 Bacteria 3819
450 Ga0157374_10318977 3300013296 Bacteria 1540
451 Ga0157378_10006521 3300013297 Bacteria 10202
452 Ga0157378_10009557 3300013297 Bacteria 8445
453 Ga0157378_10037124 3300013297 Bacteria 4314
454 Ga0157378_10037188 3300013297 Bacteria 4311
455 Ga0157378_10046862 3300013297 Bacteria 3842
456 Ga0157378_10061822 3300013297 Bacteria 3343
457 Ga0157378_10174597 3300013297 Bacteria 2018
458 Ga0157378_10229478 3300013297 Bacteria 1768
459 Ga0157378_10286085 3300013297 Bacteria 1591
460 Ga0157378_10291716 3300013297 Bacteria 1576
461 Ga0157378_10386132 3300013297 Bacteria 1376
462 Ga0157378_10951745 3300013297 Bacteria 891
463 Ga0157378_11200549 3300013297 Bacteria 798
464 Ga0157378_11749776 3300013297 Bacteria 669
465 Ga0163162_10000059 3300013306 Bacteria 107864
466 Ga0163162_10002962 3300013306 Bacteria 16203
467 Ga0163162_10042501 3300013306 Bacteria 4549
468 Ga0163162_10097255 3300013306 Bacteria 3032
469 Ga0163162_10171154 3300013306 Bacteria 2296
470 Ga0163162_10177522 3300013306 Bacteria 2255
471 Ga0163162_10432255 3300013306 Bacteria 1449
472 Ga0163162_10526900 3300013306 Bacteria 1311
473 Ga0163162_10749810 3300013306 Bacteria 1096
474 Ga0163162_10769470 3300013306 Bacteria 1081
475 Ga0163162_10853200 3300013306 Bacteria 1026
476 Ga0163162_11101503 3300013306 Bacteria 900
477 Ga0163162_11533232 3300013306 Bacteria 759
478 Ga0157372_10106460 3300013307 Bacteria 3207
479 Ga0157372_10229816 3300013307 Bacteria 2150
480 Ga0157372_11016823 3300013307 Bacteria 960
481 Ga0157375_10000055 3300013308 Bacteria 126704
482 Ga0157375_10001006 3300013308 Bacteria 24369
483 Ga0157375_10023497 3300013308 Bacteria 5690
484 Ga0157375_10071083 3300013308 Bacteria 3492
485 Ga0157375_10103709 3300013308 Bacteria 2931
486 Ga0157375_10150736 3300013308 Bacteria 2460
487 Ga0157375_10312790 3300013308 Bacteria 1735
488 Ga0157375_11166179 3300013308 Unclassified 903
489 Ga0163163_10007538 3300014325 Bacteria 9607
490 Ga0163163_10139116 3300014325 Bacteria 2470
491 Ga0163163_10139935 3300014325 Bacteria 2462
492 Ga0163163_10644357 3300014325 Bacteria 1123
493 Ga0163163_10753571 3300014325 Bacteria 1037
494 Ga0163163_10873696 3300014325 Bacteria 962
495 Ga0163163_11393216 3300014325 Bacteria 763
496 Ga0163163_11977087 3300014325 Bacteria 643
497 Ga0157380_10015819 3300014326 Bacteria 5550
498 Ga0157380_10034625 3300014326 Bacteria 3896
499 Ga0157380_10095902 3300014326 Bacteria 2458
500 Ga0157380_10425170 3300014326 Bacteria 1268
501 Ga0157380_11068164 3300014326 Bacteria 845
502 Ga0157377_10000001 3300014745 Bacteria 623098
503 Ga0157377_10031186 3300014745 Bacteria 2895
504 Ga0157379_10043447 3300014968 Bacteria 4012
505 Ga0157379_10083913 3300014968 Bacteria 2856
506 Ga0157379_10194166 3300014968 Bacteria 1835
507 Ga0157376_10000003 3300014969 Bacteria 568634
508 Ga0157376_10242205 3300014969 Bacteria 1681
509 Ga0157376_10264543 3300014969 Bacteria 1613
510 Ga0157376_10485347 3300014969 Bacteria 1211
511 Ga0157376_11034652 3300014969 Bacteria 845
512 Ga0157376_11069613 3300014969 Bacteria 832
513 Ga0163161_10019647 3300017792 Unclassified 4739
514 Ga0163161_10060636 3300017792 Bacteria 2753
515 Ga0163161_10239116 3300017792 Bacteria 1412
516 Ga0163161_10308965 3300017792 Unclassified 1247
517 Ga0163161_10358773 3300017792 Bacteria 1160
518 Ga0197907_10527097 3300020069 Bacteria 2979
519 Ga0197907_11331507 3300020069 Bacteria 2060
520 Ga0206349_1115449 3300020075 Bacteria 9518
521 Ga0206349_1228824 3300020075 Bacteria 2459
522 Ga0206351_10098839 3300020077 Bacteria 1971
523 Ga0206351_10905449 3300020077 Bacteria 1356
524 Ga0206352_10193538 3300020078 Bacteria 21551
525 Ga0206350_10234328 3300020080 Bacteria 18042
526 Ga0206350_10325577 3300020080 Bacteria 21530
527 Ga0206350_10574257 3300020080 Bacteria 3570
528 Ga0213873_10000553 3300021358 Bacteria 6058
529 Ga0213873_10005028 3300021358 Bacteria 2508
530 Ga0213873_10199168 3300021358 Bacteria 621
531 Ga0213874_10000313 3300021377 Bacteria 9595
532 Ga0213874_10048447 3300021377 Bacteria 1296
533 Ga0213876_10000009 3300021384 Bacteria 496136
534 Ga0213876_10000058 3300021384 Bacteria 134080
535 Ga0213876_10017136 3300021384 Bacteria 3825
536 Ga0213876_10019697 3300021384 Bacteria 3564
537 Ga0213876_10170647 3300021384 Bacteria 1157
538 Ga0213875_10010857 3300021388 Bacteria 4553
539 Ga0213875_10025282 3300021388 Bacteria 2829
540 Ga0213875_10165202 3300021388 Bacteria 1039
541 Ga0213871_10091176 3300021441 Bacteria 883
542 Ga0224712_10000482 3300022467 Bacteria 7993
543 Ga0224712_10010313 3300022467 Bacteria 2853
544 Ga0228598_1001060 3300024227 Bacteria 6056
545 Ga0209257_1056203 3300025304 Bacteria 1088
546 Ga0207656_10055538 3300025321 Unclassified 1724
547 Ga0207655_1074984 3300025728 Bacteria 1242
548 Ga0207653_10000033 3300025885 Bacteria 103535
549 Ga0207653_10076248 3300025885 Bacteria 1153
550 Ga0207653_10149279 3300025885 Bacteria 859
551 Ga0207682_10023804 3300025893 Bacteria 2422
552 Ga0207682_10028648 3300025893 Bacteria 2224
553 Ga0207692_10004608 3300025898 Bacteria 5467
554 Ga0207642_10022056 3300025899 Bacteria 2518
555 Ga0207642_10385765 3300025899 Bacteria 835
556 Ga0207710_10519746 3300025900 Bacteria 619
557 Ga0207688_10598914 3300025901 Bacteria 694
558 Ga0207688_10636511 3300025901 Bacteria 673
559 Ga0207685_10000051 3300025905 Bacteria 39503
560 Ga0207699_10008158 3300025906 Bacteria 5154
561 Ga0207699_10026834 3300025906 Bacteria 3180
562 Ga0207699_10072571 3300025906 Bacteria 2109
563 Ga0207699_10168267 3300025906 Bacteria 1464
564 Ga0207699_10268933 3300025906 Bacteria 1181
565 Ga0207699_10365446 3300025906 Bacteria 1021
566 Ga0207645_10359464 3300025907 Bacteria 975
567 Ga0207643_10017199 3300025908 Bacteria 3950
568 Ga0207643_10078505 3300025908 Bacteria 1910
569 Ga0207643_10485184 3300025908 Bacteria 789
570 Ga0207705_10146366 3300025909 Bacteria 1768
571 Ga0207684_10000431 3300025910 Bacteria 55647
572 Ga0207684_10029417 3300025910 Bacteria 4678
573 Ga0207684_10034076 3300025910 Bacteria 4328
574 Ga0207684_10068492 3300025910 Bacteria 3016
575 Ga0207684_10072862 3300025910 Bacteria 2917
576 Ga0207684_10135396 3300025910 Bacteria 2115
577 Ga0207684_10760785 3300025910 Bacteria 820
578 Ga0207684_11169296 3300025910 Unclassified 638
579 Ga0207654_10041690 3300025911 Bacteria 2594
580 Ga0207654_10450739 3300025911 Bacteria 902
581 Ga0207654_11008106 3300025911 Bacteria 606
582 Ga0207707_10018832 3300025912 Bacteria 6021
583 Ga0207707_10047405 3300025912 Bacteria 3742
584 Ga0207707_10075513 3300025912 Bacteria 2941
585 Ga0207707_10138344 3300025912 Bacteria 2129
586 Ga0207707_10170172 3300025912 Bacteria 1904
587 Ga0207707_10511053 3300025912 Bacteria 1024
588 Ga0207695_10091115 3300025913 Bacteria 3063
589 Ga0207695_10140217 3300025913 Bacteria 2367
590 Ga0207671_10060155 3300025914 Bacteria 2818
591 Ga0207671_10300698 3300025914 Bacteria 1268
592 Ga0207693_10008823 3300025915 Bacteria 8239
593 Ga0207693_10075253 3300025915 Bacteria 2644
594 Ga0207693_10104971 3300025915 Bacteria 2216
595 Ga0207693_10287522 3300025915 Bacteria 1288
596 Ga0207693_10530848 3300025915 Bacteria 918
597 Ga0207663_10056484 3300025916 Bacteria 2469
598 Ga0207663_10075460 3300025916 Bacteria 2188
599 Ga0207663_10096340 3300025916 Bacteria 1976
600 Ga0207663_10274480 3300025916 Bacteria 1250
601 Ga0207663_10314350 3300025916 Bacteria 1175
602 Ga0207663_10584903 3300025916 Bacteria 876
603 Ga0207660_10076991 3300025917 Bacteria 2440
604 Ga0207660_10137592 3300025917 Bacteria 1865
605 Ga0207660_10717401 3300025917 Bacteria 816
606 Ga0207662_10052948 3300025918 Bacteria 2417
607 Ga0207662_10164177 3300025918 Bacteria 1421
608 Ga0207657_10003364 3300025919 Bacteria 17093
609 Ga0207649_10129753 3300025920 Unclassified 1710
610 Ga0207652_10047930 3300025921 Bacteria 3651
611 Ga0207652_10096220 3300025921 Bacteria 2608
612 Ga0207652_10637704 3300025921 Bacteria 953
613 Ga0207646_10000630 3300025922 Bacteria 45810
614 Ga0207646_10000708 3300025922 Bacteria 43282
615 Ga0207646_10030710 3300025922 Bacteria 4869
616 Ga0207646_10080346 3300025922 Bacteria 2915
617 Ga0207646_10178348 3300025922 Bacteria 1918
618 Ga0207646_10383686 3300025922 Bacteria 1269
619 Ga0207646_10392368 3300025922 Unclassified 1254
620 Ga0207646_10468882 3300025922 Bacteria 1136
621 Ga0207646_10655207 3300025922 Bacteria 940
622 Ga0207646_10867299 3300025922 Bacteria 802
623 Ga0207681_10002895 3300025923 Bacteria 10852
624 Ga0207681_10018422 3300025923 Bacteria 4399
625 Ga0207681_10900674 3300025923 Bacteria 741
626 Ga0207694_10000001 3300025924 Bacteria 4078485
627 Ga0207694_10010354 3300025924 Bacteria 7030
628 Ga0207650_10001512 3300025925 Bacteria 16613
629 Ga0207659_10000036 3300025926 Bacteria 103327
630 Ga0207687_10000005 3300025927 Bacteria 770649
631 Ga0207687_10002330 3300025927 Bacteria 12928
632 Ga0207687_10149550 3300025927 Bacteria 1780
633 Ga0207687_10159467 3300025927 Bacteria 1730
634 Ga0207687_10241063 3300025927 Bacteria 1433
635 Ga0207687_10378226 3300025927 Bacteria 1159
636 Ga0207700_10017186 3300025928 Bacteria 4826
637 Ga0207700_10037637 3300025928 Bacteria 3505
638 Ga0207664_10011372 3300025929 Bacteria 6322
639 Ga0207664_10068004 3300025929 Bacteria 2860
640 Ga0207664_10867437 3300025929 Bacteria 811
641 Ga0207644_10000414 3300025931 Bacteria 27902
642 Ga0207644_10291825 3300025931 Bacteria 1312
643 Ga0207644_10481732 3300025931 Bacteria 1022
644 Ga0207690_10057507 3300025932 Unclassified 2627
645 Ga0207690_10120468 3300025932 Bacteria 1905
646 Ga0207706_10100663 3300025933 Bacteria 2542
647 Ga0207706_10122129 3300025933 Unclassified 2291
648 Ga0207706_10257235 3300025933 Bacteria 1524
649 Ga0207686_10000005 3300025934 Bacteria 260873
650 Ga0207686_10001337 3300025934 Bacteria 14036
651 Ga0207686_10004022 3300025934 Bacteria 7888
652 Ga0207686_10110303 3300025934 Bacteria 1854
653 Ga0207686_10119923 3300025934 Bacteria 1789
654 Ga0207686_10230913 3300025934 Bacteria 1341
655 Ga0207686_10450479 3300025934 Bacteria 990
656 Ga0207709_10000133 3300025935 Bacteria 108698
657 Ga0207709_10009706 3300025935 Bacteria 5303
658 Ga0207709_10326828 3300025935 Bacteria 1150
659 Ga0207709_10532146 3300025935 Bacteria 922
660 Ga0207670_10110917 3300025936 Bacteria 1977
661 Ga0207670_10285167 3300025936 Bacteria 1288
662 Ga0207669_10113601 3300025937 Bacteria 1821
663 Ga0207704_10004874 3300025938 Bacteria 6167
664 Ga0207704_10450541 3300025938 Bacteria 1027
665 Ga0207665_10000005 3300025939 Bacteria 194919
666 Ga0207665_10039267 3300025939 Bacteria 3155
667 Ga0207665_10077046 3300025939 Bacteria 2288
668 Ga0207665_10089277 3300025939 Bacteria 2134
669 Ga0207665_10105427 3300025939 Bacteria 1974
670 Ga0207691_10002644 3300025940 Bacteria 17504
671 Ga0207711_10004233 3300025941 Bacteria 12280
672 Ga0207711_10132896 3300025941 Bacteria 2233
673 Ga0207711_10306669 3300025941 Bacteria 1465
674 Ga0207711_10498167 3300025941 Unclassified 1135
675 Ga0207711_10560170 3300025941 Bacteria 1066
676 Ga0207689_10003268 3300025942 Bacteria 14863
677 Ga0207689_10009254 3300025942 Bacteria 8519
678 Ga0207689_10009503 3300025942 Bacteria 8397
679 Ga0207689_10010598 3300025942 Bacteria 7937
680 Ga0207689_10040739 3300025942 Bacteria 3844
681 Ga0207689_10070209 3300025942 Bacteria 2878
682 Ga0207689_10162913 3300025942 Bacteria 1837
683 Ga0207689_11012370 3300025942 Bacteria 701
684 Ga0207661_10000006 3300025944 Bacteria 537727
685 Ga0207661_11134445 3300025944 Bacteria 720
686 Ga0207679_10034524 3300025945 Bacteria 3569
687 Ga0207679_10158818 3300025945 Bacteria 1849
688 Ga0207679_10230992 3300025945 Bacteria 1562
689 Ga0207679_10534070 3300025945 Bacteria 1050
690 Ga0207667_10000612 3300025949 Bacteria 46149
691 Ga0207667_10114447 3300025949 Bacteria 2780
692 Ga0207667_10142564 3300025949 Bacteria 2467
693 Ga0207651_10008745 3300025960 Bacteria 5492
694 Ga0207651_10070128 3300025960 Unclassified 2478
695 Ga0207712_10000709 3300025961 Bacteria 25746
696 Ga0207712_10302180 3300025961 Bacteria 1314
697 Ga0207712_10633640 3300025961 Bacteria 928
698 Ga0207668_10004545 3300025972 Bacteria 8164
699 Ga0207668_10058291 3300025972 Bacteria 2699
700 Ga0207668_10475212 3300025972 Bacteria 1071
701 Ga0207668_10936671 3300025972 Bacteria 772
702 Ga0207640_10196065 3300025981 Bacteria 1526
703 Ga0207640_10995760 3300025981 Bacteria 737
704 Ga0207658_10124942 3300025986 Bacteria 2057
705 Ga0207658_10227130 3300025986 Bacteria 1574
706 Ga0207658_10254031 3300025986 Bacteria 1495
707 Ga0207658_10822208 3300025986 Bacteria 844
708 Ga0207677_10000101 3300026023 Bacteria 70739
709 Ga0207677_10000141 3300026023 Bacteria 59003
710 Ga0207677_10000772 3300026023 Bacteria 18388
711 Ga0207677_10016453 3300026023 Bacteria 4383
712 Ga0207677_10471864 3300026023 Bacteria 1079
713 Ga0207677_10928524 3300026023 Bacteria 786
714 Ga0207703_10019029 3300026035 Bacteria 5364
715 Ga0207703_10020588 3300026035 Bacteria 5160
716 Ga0207703_10032311 3300026035 Bacteria 4142
717 Ga0207703_10063129 3300026035 Bacteria 3036
718 Ga0207703_10064766 3300026035 Bacteria 3001
719 Ga0207703_10285132 3300026035 Bacteria 1501
720 Ga0207703_10446091 3300026035 Bacteria 1208
721 Ga0207703_10449254 3300026035 Bacteria 1204
722 Ga0207703_10685623 3300026035 Bacteria 974
723 Ga0207703_10710044 3300026035 Bacteria 956
724 Ga0207639_10000013 3300026041 Bacteria 293084
725 Ga0207639_10028396 3300026041 Bacteria 4084
726 Ga0207639_10220928 3300026041 Bacteria 1636
727 Ga0207639_10498747 3300026041 Bacteria 1112
728 Ga0207678_10212259 3300026067 Bacteria 1656
729 Ga0207678_10542233 3300026067 Bacteria 1017
730 Ga0207678_10620838 3300026067 Bacteria 948
731 Ga0207708_10116208 3300026075 Bacteria 2081
732 Ga0207708_10164164 3300026075 Bacteria 1755
733 Ga0207708_10476606 3300026075 Bacteria 1043
734 Ga0207708_10873482 3300026075 Bacteria 777
735 Ga0207702_10030901 3300026078 Bacteria 4463
736 Ga0207702_10040498 3300026078 Bacteria 3906
737 Ga0207641_10023693 3300026088 Bacteria 5058
738 Ga0207641_10085205 3300026088 Bacteria 2753
739 Ga0207641_10089316 3300026088 Bacteria 2693
740 Ga0207641_10335742 3300026088 Bacteria 1437
741 Ga0207641_10430922 3300026088 Bacteria 1271
742 Ga0207641_10563232 3300026088 Bacteria 1112
743 Ga0207641_11329213 3300026088 Bacteria 719
744 Ga0207648_10019210 3300026089 Bacteria 6167
745 Ga0207648_10281488 3300026089 Unclassified 1487
746 Ga0207648_10302052 3300026089 Bacteria 1436
747 Ga0207676_10000023 3300026095 Bacteria 266848
748 Ga0207676_10009610 3300026095 Bacteria 6885
749 Ga0207676_10049891 3300026095 Bacteria 3259
750 Ga0207676_10086376 3300026095 Bacteria 2563
751 Ga0207676_10098561 3300026095 Bacteria 2417
752 Ga0207676_10507545 3300026095 Bacteria 1146
753 Ga0207676_10749478 3300026095 Bacteria 949
754 Ga0207676_10760610 3300026095 Bacteria 943
755 Ga0207674_10013233 3300026116 Bacteria 9170
756 Ga0207674_10018433 3300026116 Bacteria 7586
757 Ga0207674_10040581 3300026116 Bacteria 4820
758 Ga0207674_10141748 3300026116 Bacteria 2363
759 Ga0207674_10193921 3300026116 Bacteria 1981
760 Ga0207674_10345588 3300026116 Bacteria 1438
761 Ga0207674_10677704 3300026116 Bacteria 995
762 Ga0207675_100001227 3300026118 Bacteria 25579
763 Ga0207675_100068381 3300026118 Bacteria 3320
764 Ga0207675_100109886 3300026118 Bacteria 2602
765 Ga0207675_100629670 3300026118 Bacteria 1078
766 Ga0207675_101408081 3300026118 Bacteria 718
767 Ga0207698_10977438 3300026142 Bacteria 856
768 Ga0207698_11300152 3300026142 Bacteria 742
769 Ga0209984_1004426 3300027424 Bacteria 1656
770 Ga0209995_1011397 3300027471 Bacteria 1446
771 Ga0209999_1004693 3300027543 Bacteria 2453
772 Ga0209970_1005891 3300027614 Bacteria 2014
773 Ga0209983_1000280 3300027665 Bacteria 10618
774 Ga0209971_1000384 3300027682 Bacteria 12081
775 Ga0209966_1013867 3300027695 Bacteria 1498
776 Ga0209966_1043285 3300027695 Bacteria 943
777 Ga0209998_10002827 3300027717 Bacteria 3904
778 Ga0209974_10004420 3300027876 Bacteria 5002
779 Ga0209974_10035385 3300027876 Bacteria 1659
780 Ga0207428_10000030 3300027907 Bacteria 240846
781 Ga0207428_10007215 3300027907 Bacteria 10162
782 Ga0207428_10073683 3300027907 Bacteria 2678
783 Ga0268266_10011799 3300028379 Bacteria 7574
784 Ga0268266_10043390 3300028379 Bacteria 3843
785 Ga0268266_10370969 3300028379 Bacteria 1348
786 Ga0268266_10758304 3300028379 Bacteria 937
787 Ga0268265_10009861 3300028380 Bacteria 6450
788 Ga0268265_10022343 3300028380 Bacteria 4443
789 Ga0268265_10136452 3300028380 Bacteria 2048
790 Ga0268265_10691586 3300028380 Bacteria 984
791 Ga0268264_10060239 3300028381 Bacteria 3181
792 Ga0268264_10079012 3300028381 Bacteria 2806
793 Ga0268264_10137708 3300028381 Bacteria 2173
794 Ga0268264_10144015 3300028381 Bacteria 2128
795 Ga0268264_10200084 3300028381 Bacteria 1827
796 Ga0268264_10201376 3300028381 Bacteria 1822
797 Ga0268264_10380109 3300028381 Bacteria 1352
798 Ga0268264_10722154 3300028381 Bacteria 991
799 Ga0265323_10034570 3300028653 Bacteria 1866
800 Ga0307515_10202150 3300028794 Bacteria 1859
801 Ga0265338_10036788 3300028800 Bacteria 4676
802 Ga0307511_10002513 3300030521 Bacteria 19146
803 Ga0265761_107552 3300030889 Bacteria 595
804 Ga0265330_10021074 3300031235 Bacteria 2978
805 Ga0265328_10162384 3300031239 Bacteria 843
806 Ga0265328_10188699 3300031239 Bacteria 781
807 Ga0265340_10031321 3300031247 Bacteria 2660
808 Ga0265339_10005033 3300031249 Bacteria 8891
809 Ga0265339_10141364 3300031249 Bacteria 1224
810 Ga0265327_10090986 3300031251 Bacteria 1488
811 Ga0265316_10008237 3300031344 Bacteria 9701
812 Ga0265316_10210287 3300031344 Bacteria 1439
813 Ga0307513_10016578 3300031456 Bacteria 8880
814 Ga0307513_10090959 3300031456 Bacteria 3111
815 Ga0307509_10363140 3300031507 Bacteria 1167
816 Ga0307408_100001928 3300031548 Bacteria 15077
817 Ga0307408_100038105 3300031548 Bacteria 3390
818 Ga0307408_100268050 3300031548 Bacteria 1416
819 Ga0307408_100867718 3300031548 Bacteria 824
820 Ga0307408_101036508 3300031548 Bacteria 758
821 Ga0265313_10004521 3300031595 Bacteria 10621
822 Ga0307508_10078439 3300031616 Bacteria 2883
823 Ga0316575_10004333 3300031665 Bacteria 4989
824 Ga0316575_10021116 3300031665 Bacteria 2503
825 Ga0316575_10025775 3300031665 Bacteria 2282
826 Ga0316579_10003044 3300031691 Bacteria 6456
827 Ga0316579_10078475 3300031691 Bacteria 1570
828 Ga0265314_10000003 3300031711 Bacteria 1653386
829 Ga0265314_10000833 3300031711 Bacteria 36549
830 Ga0265314_10009286 3300031711 Bacteria 8330
831 Ga0265314_10126045 3300031711 Bacteria 1604
832 Ga0265342_10064957 3300031712 Bacteria 2140
833 Ga0316576_10002450 3300031727 Bacteria 10558
834 Ga0316576_10003583 3300031727 Bacteria 9149
835 Ga0316576_10010549 3300031727 Bacteria 6008
836 Ga0316576_10046481 3300031727 Bacteria 3142
837 Ga0316576_10106373 3300031727 Bacteria 2100
838 Ga0316576_10238193 3300031727 Bacteria 1367
839 Ga0316578_10000551 3300031728 Bacteria 12895
840 Ga0316578_10058133 3300031728 Bacteria 2273
841 Ga0307405_10003109 3300031731 Bacteria 7539
842 Ga0307405_10040438 3300031731 Bacteria 2824
843 Ga0316577_10002746 3300031733 Bacteria 8764
844 Ga0316577_10074607 3300031733 Bacteria 1894
845 Ga0316577_10517461 3300031733 Bacteria 678
846 Ga0307413_10000449 3300031824 Bacteria 13415
847 Ga0307413_10000549 3300031824 Bacteria 12525
848 Ga0307413_10003502 3300031824 Bacteria 6617
849 Ga0307413_10362313 3300031824 Bacteria 1123
850 Ga0307410_10001120 3300031852 Bacteria 11726
851 Ga0307410_10003798 3300031852 Bacteria 7666
852 Ga0307410_10004470 3300031852 Bacteria 7237
853 Ga0307410_10170710 3300031852 Bacteria 1638
854 Ga0307406_10014432 3300031901 Bacteria 4546
855 Ga0307406_10082192 3300031901 Bacteria 2144
856 Ga0307406_10128816 3300031901 Bacteria 1773
857 Ga0307406_10157487 3300031901 Bacteria 1628
858 Ga0307406_10411940 3300031901 Bacteria 1074
859 Ga0307407_10001031 3300031903 Bacteria 9619
860 Ga0307407_10001139 3300031903 Bacteria 9316
861 Ga0307407_10015861 3300031903 Bacteria 3737
862 Ga0307407_10135498 3300031903 Bacteria 1581
863 Ga0307407_10946675 3300031903 Bacteria 663
864 Ga0307412_10009022 3300031911 Bacteria 5714
865 Ga0307412_10039792 3300031911 Bacteria 3038
866 Ga0307412_10072234 3300031911 Bacteria 2357
867 Ga0307412_10177862 3300031911 Bacteria 1597
868 Ga0307412_10280859 3300031911 Bacteria 1307
869 Ga0307412_10660458 3300031911 Bacteria 893
870 Ga0307409_100003195 3300031995 Bacteria 8813
871 Ga0307416_100016487 3300032002 Bacteria 5138
872 Ga0307416_100019290 3300032002 Bacteria 4830
873 Ga0307416_100035072 3300032002 Bacteria 3826
874 Ga0307416_100099664 3300032002 Bacteria 2524
875 Ga0307416_100246657 3300032002 Bacteria 1735
876 Ga0307416_100689644 3300032002 Bacteria 1110
877 Ga0307416_101171787 3300032002 Bacteria 874
878 Ga0307416_101768943 3300032002 Bacteria 722
879 Ga0307414_10019950 3300032004 Bacteria 4166
880 Ga0307414_10027746 3300032004 Bacteria 3663
881 Ga0307414_10034819 3300032004 Bacteria 3344
882 Ga0307414_10404202 3300032004 Bacteria 1187
883 Ga0307411_10234887 3300032005 Bacteria 1431
884 Ga0307415_100053963 3300032126 Bacteria 2741
885 Ga0307415_100276861 3300032126 Bacteria 1378
886 Ga0307415_100399278 3300032126 Bacteria 1173
887 Ga0316583_10015823 3300032133 Bacteria 2716
888 Ga0316583_10033936 3300032133 Bacteria 1810
889 Ga0316583_10118532 3300032133 Bacteria 922
890 Ga0316583_10188662 3300032133 Bacteria 716
891 Ga0316585_10001353 3300032137 Bacteria 6432
892 Ga0316585_10004948 3300032137 Bacteria 3744
893 Ga0316585_10057900 3300032137 Bacteria 1248
894 Ga0316580_10002359 3300032139 Bacteria 5179
895 Ga0316580_10026342 3300032139 Bacteria 1798
896 Ga0316593_10000033 3300032168 Bacteria 14603
897 Ga0316593_10000122 3300032168 Bacteria 10489
898 Ga0316593_10001783 3300032168 Bacteria 4897
899 Ga0316593_10002306 3300032168 Bacteria 4483
900 Ga0316593_10003721 3300032168 Bacteria 3827
901 Ga0316593_10010834 3300032168 Bacteria 2630
902 Ga0316588_1033653 3300033528 Bacteria 1209
903 Ga0316596_1022948 3300033541 Bacteria 1596
904 Ga0316596_1036298 3300033541 Bacteria 1288
905 Ga0373926_0002499 3300035083 Bacteria 5835
906 Ga0373934_0007545 3300035086 Bacteria 4038
907 Ga0373934_0008632 3300035086 Bacteria 3800
908 Ga0373934_0014666 3300035086 Bacteria 2970
909 Ga0373944_0000533 3300035089 Bacteria 8946
910 Ga0373944_0114041 3300035089 Bacteria 926
911 Ga0373949_0017759 3300035090 Bacteria 1607
912 Ga0373923_0000448 3300035111 Bacteria 9770
913 Ga0373936_0025334 3300035113 Bacteria 2319
914 Ga0373941_0062111 3300035115 Bacteria 1218
915 Ga0373945_0000882 3300035116 Bacteria 8855
916 Ga0373953_0008828 3300035117 Bacteria 3439
917 Ga0373953_0011305 3300035117 Bacteria 3130
918 Ga0373953_0069272 3300035117 Bacteria 1453
919 Ga0373954_0008600 3300035118 Bacteria 4488
920 Ga0373957_0017064 3300035120 Bacteria 2522
921 Ga0373943_0036947 3300035170 Bacteria 2342
922 Ga0373946_0014205 3300035171 Bacteria 3001
923 Ga0373946_0322848 3300035171 Bacteria 767
924 Ga0373955_0518973 3300035172 Bacteria 728
925 Ga0316574_0001004 3300035398 Bacteria 12720
926 Ga0316574_0003671 3300035398 Bacteria 7945
927 Ga0316574_0006441 3300035398 Bacteria 6347
928 Ga0316574_0050430 3300035398 Unclassified 2590
929 Ga0316574_0109331 3300035398 Bacteria 1772
930 Ga0316574_0173136 3300035398 Bacteria 1389
931 Ga0316574_0439226 3300035398 Bacteria 819
932 Ga0316574_0468942 3300035398 Bacteria 787
933 Ga0316574_0518551 3300035398 Bacteria 742
934 Ga0373924_0007336 3300035410 Bacteria 3978
935 Ga0373924_0015978 3300035410 Bacteria 2860
936 Ga0373924_0027067 3300035410 Bacteria 2279
937 Ga0373924_0316261 3300035410 Bacteria 694
938 Ga0373935_0280257 3300035692 Bacteria 1173
939 Ga0373927_0105317 3300035695 Bacteria 1836
940 Ga0373927_0199596 3300035695 Bacteria 1313
941 Ga0373927_0819978 3300035695 Bacteria 614
942 Ga0373933_0004782 3300035724 Bacteria 7402
943 Ga0373933_0383520 3300035724 Bacteria 915
944 Ga0373933_0665113 3300035724 Bacteria 685
945 Ga0373937_0036358 3300036401 Bacteria 4487
946 Ga0373937_0069217 3300036401 Bacteria 3253
947 Ga0373937_0288414 3300036401 Bacteria 1550
948 Ga0316582_0003224 3300036647 Bacteria 7940
949 Ga0316582_0005211 3300036647 Bacteria 6660
950 Ga0316582_0100542 3300036647 Bacteria 1915
951 Ga0316582_0176094 3300036647 Bacteria 1454
952 Ga0316582_0377240 3300036647 Bacteria 976
953 Ga0316584_0002208 3300036712 Bacteria 12192
954 Ga0316584_0045853 3300036712 Bacteria 3264
955 Ga0316584_0056894 3300036712 Bacteria 2927
956 Ga0316584_0566156 3300036712 Bacteria 792
957 Ga0373925_0045202 3300037068 Bacteria 3271
958 Ga0395900_0180156 3300037418 Bacteria 2148
959 Ga0395900_0395376 3300037418 Bacteria 1348
960 Ga0395905_0004072 3300037471 Bacteria 15323
961 Ga0395905_0092421 3300037471 Bacteria 2837
962 Ga0395905_0335843 3300037471 Bacteria 1402
963 Ga0395905_0506042 3300037471 Bacteria 1108
964 Ga0395905_0572848 3300037471 Bacteria 1030
965 Ga0395905_0617827 3300037471 Bacteria 986
966 Ga0395905_1168441 3300037471 Bacteria 673
967 Ga0316581_0010080 3300037588 Bacteria 2613
968 Ga0436364_0600523 3300037853 Bacteria 1439
969 Ga0436364_0623666 3300037853 Bacteria 660
970 Ga0436364_0754414 3300037853 Bacteria 624
971 Ga0436364_0863400 3300037853 Bacteria 962
972 Ga0436364_1316563 3300037853 Bacteria 5833
973 Ga0436364_1354648 3300037853 Bacteria 115417
974 Ga0395901_0000654 3300038443 Bacteria 39925
975 Ga0395901_0920942 3300038443 Bacteria 855
976 Ga0400484_14002 3300038725 Bacteria 7367
977 Ga0400490_30744 3300038726 Bacteria 133210
978 Ga0400488_22380 3300038741 Bacteria 1687
979 Ga0400483_035845 3300039062 Bacteria 4840
980 Ga0400483_155646 3300039062 Bacteria 1440
981 Ga0400483_281776 3300039062 Bacteria 7321
982 Ga0400489_27072 3300039093 Bacteria 2745
983 Ga0400489_86209 3300039093 Bacteria 8537
984 Ga0436365_0048919 3300039437 Bacteria 660
985 Ga0436365_0154164 3300039437 Bacteria 11061
986 Ga0436365_0332019 3300039437 Bacteria 1766
987 Ga0436365_0340116 3300039437 Bacteria 15753
988 Ga0436365_0382778 3300039437 Bacteria 2331
989 Ga0436365_0464141 3300039437 Bacteria 46759
990 Ga0436365_0647080 3300039437 Bacteria 807
991 Ga0436365_1001167 3300039437 Bacteria 1405
992 Ga0436365_1032223 3300039437 Bacteria 1137
993 Ga0436365_1253031 3300039437 Bacteria 47093
994 Ga0436360_0163442 3300039438 Bacteria 11133
995 Ga0436360_0328120 3300039438 Bacteria 768
996 Ga0436360_0591939 3300039438 Bacteria 730
997 Ga0436360_0923015 3300039438 Bacteria 4679
998 Ga0436363_0022136 3300039450 Bacteria 903
999 Ga0436363_0323271 3300039450 Bacteria 5181
1000 Ga0436363_0537550 3300039450 Bacteria 7384
1001 Ga0436363_0872043 3300039450 Bacteria 1357
1002 Ga0436362_0260637 3300039453 Bacteria 1148
1003 Ga0436362_0656010 3300039453 Bacteria 14220
1004 Ga0436362_0832964 3300039453 Bacteria 2955
1005 Ga0436362_1063276 3300039453 Bacteria 20265
1006 Ga0436362_1065558 3300039453 Bacteria 1124
1007 Ga0436362_1069013 3300039453 Bacteria 90804
1008 Ga0439439_0016465 3300041406 Bacteria 1811
1009 Ga0439439_0036614 3300041406 Bacteria 1263
1010 Ga0439466_0055003 3300041411 Bacteria 1295
1011 Ga0451795_0157516 3300041456 Bacteria 795
1012 Ga0451807_0333339 3300041486 Bacteria 1907
1013 Ga0451839_0378043 3300041496 Bacteria 1552
1014 Ga0451843_0181247 3300041509 Bacteria 1519
1015 Ga0451855_1923054 3300041511 Bacteria 1945
1016 Ga0439462_0023689 3300042015 Bacteria 1610
1017 Ga0450892_003270 3300042130 Unclassified 1339
1018 Ga0439446_0026364 3300042156 Unclassified 1665
1019 Ga0450893_0041135 3300042532 Bacteria 847
1020 Ga0451577_0000004 3300042876 Bacteria 816743
1021 Ga0451577_0000828 3300042876 Bacteria 46284
1022 Ga0451577_0006363 3300042876 Bacteria 11795
1023 Ga0451577_0269782 3300042876 Bacteria 1541
1024 Ga0451577_0649678 3300042876 Bacteria 956
1025 Ga0466972_0002629 3300044658 Bacteria 8898
1026 Ga0466972_0007079 3300044658 Bacteria 5631
1027 Ga0453683_0000002 3300044673 Bacteria 1244396
1028 Ga0453683_0492208 3300044673 Bacteria 795
1029 Ga0466965_0004970 3300044683 Bacteria 5954
1030 Ga0466965_0012715 3300044683 Bacteria 3964
1031 Ga0466963_0545387 3300044694 Bacteria 819
1032 Ga0466964_0082772 3300044706 Bacteria 1381
1033 Ga0453684_0000025 3300044712 Bacteria 818638
1034 Ga0453684_0003637 3300044712 Bacteria 34273
1035 Ga0453684_0005988 3300044712 Bacteria 23557
1036 Ga0453684_0020910 3300044712 Bacteria 9821
1037 Ga0453684_0032497 3300044712 Bacteria 7301
1038 Ga0453684_0055586 3300044712 Bacteria 5145
1039 Ga0453684_0140838 3300044712 Bacteria 2880
1040 Ga0453684_0494279 3300044712 Bacteria 1355
1041 Ga0466968_0002163 3300044735 Bacteria 7173
1042 Ga0466957_0006920 3300044842 Bacteria 6411
1043 Ga0466960_0002207 3300044901 Bacteria 7269
1044 Ga0466960_0017262 3300044901 Bacteria 3143
1045 Ga0451576_0005912 3300045051 Bacteria 15170
1046 Ga0451576_0032997 3300045051 Bacteria 5505
1047 Ga0451576_0073380 3300045051 Bacteria 3561
1048 Ga0451576_0089061 3300045051 Bacteria 3210
1049 Ga0451576_0453652 3300045051 Bacteria 1346
1050 Ga0451576_0718808 3300045051 Bacteria 1049
1051 Ga0466967_0044233 3300045976 Bacteria 3861
1052 Ga0466967_0126564 3300045976 Bacteria 2367
1053 Ga0495592_0136326 3300046454 Bacteria 1711
1054 Ga0495629_0502263 3300046459 Unclassified 818
1055 Ga0495629_0517482 3300046459 Bacteria 803
1056 Ga0495641_0076199 3300046461 Bacteria 1503
1057 Ga0495651_0043424 3300046462 Bacteria 3488
1058 Ga0495653_0062800 3300046463 Bacteria 2805
1059 Ga0495580_0057891 3300046472 Bacteria 2727
1060 Ga0495580_0303839 3300046472 Bacteria 1086
1061 Ga0495639_0003260 3300046475 Bacteria 7049
1062 Ga0495664_0017680 3300046477 Bacteria 4077
1063 Ga0495594_0008104 3300046499 Bacteria 5403
1064 Ga0495608_0003772 3300046511 Bacteria 10886
1065 Ga0495618_0194862 3300046514 Unclassified 1284
1066 Ga0495628_0032936 3300046516 Bacteria 4179
1067 Ga0495628_0058306 3300046516 Bacteria 3034
1068 Ga0495630_0013363 3300046517 Bacteria 5975
1069 Ga0495630_0218936 3300046517 Bacteria 1453
1070 Ga0495630_0286748 3300046517 Bacteria 1258
1071 Ga0495632_0019314 3300046519 Bacteria 3716
1072 Ga0495663_0001514 3300046525 Bacteria 7303
1073 Ga0495666_0007526 3300046526 Bacteria 5447
1074 Ga0495652_0205882 3300046529 Bacteria 1490
1075 Ga0495665_0004028 3300046531 Bacteria 7928
1076 Ga0495586_0006192 3300046535 Bacteria 6400
1077 Ga0495598_0000163 3300046537 Bacteria 11410
1078 Ga0495621_0015538 3300046539 Bacteria 2429
1079 Ga0495621_0020255 3300046539 Bacteria 2181
1080 Ga0495667_0003938 3300046559 Bacteria 9952
1081 Ga0495656_0295605 3300046615 Bacteria 829
1082 Ga0495656_0347301 3300046615 Bacteria 768
1083 Ga0495625_0016058 3300046660 Bacteria 5902
1084 Ga0495635_0004293 3300046663 Bacteria 9868
1085 Ga0495635_0052784 3300046663 Bacteria 2800
1086 Ga0495635_0140096 3300046663 Bacteria 1648
1087 Ga0495588_0032738 3300046674 Bacteria 2621
1088 Ga0495657_0217306 3300046675 Bacteria 1160
1089 Ga0495599_0058308 3300046678 Bacteria 2415
1090 Ga0495623_0326026 3300046679 Bacteria 842
1091 Ga0495646_0001927 3300046680 Bacteria 12478
1092 Ga0495658_0018132 3300046683 Bacteria 3653
1093 Ga0495613_0163119 3300046689 Bacteria 1584
1094 Ga0495624_0011751 3300046690 Bacteria 6011
1095 Ga0495624_0090865 3300046690 Bacteria 1884
1096 Ga0495670_0163925 3300046691 Bacteria 1168
1097 Ga0495600_0002535 3300046809 Bacteria 10511
1098 Ga0495600_0320799 3300046809 Bacteria 974
1099 Ga0495581_0022118 3300047315 Bacteria 3684
1100 Ga0495581_0048090 3300047315 Bacteria 2464
1101 Ga0495604_0121875 3300047317 Bacteria 1886
1102 Ga0495636_0001105 3300047318 Bacteria 10134
1103 Ga0495674_0100487 3300047319 Bacteria 2461
1104 Ga0495672_0006094 3300047320 Bacteria 9420
1105 Ga0495672_0077350 3300047320 Bacteria 1865
1106 Ga0495680_0028661 3300047322 Bacteria 4564
1107 Ga0495680_0367266 3300047322 Bacteria 999
1108 Ga0495680_0705676 3300047322 Unclassified 666
1109 Ga0495679_007316 3300047446 Bacteria 4617
1110 Ga0495684_0001009 3300047471 Bacteria 22928
1111 Ga0495684_0024903 3300047471 Bacteria 4603
1112 Ga0495684_0106866 3300047471 Bacteria 2114
1113 Ga0495684_0417907 3300047471 Bacteria 938
1114 Ga0495686_0000007 3300047472 Bacteria 732622
1115 Ga0495593_0016768 3300047673 Bacteria 4126
1116 Ga0495602_0017278 3300048088 Bacteria 7234
1117 Ga0495614_0003011 3300048089 Bacteria 7507
1118 Ga0495615_0001516 3300048090 Bacteria 3484
1119 Ga0495615_0207169 3300048090 Bacteria 607
1120 Ga0496100_0079592 3300048903 Bacteria 2209
1121 Ga0496101_0586164 3300048904 Bacteria 882
1122 Ga0496102_0497858 3300048905 Bacteria 1140
1123 Ga0496103_0019686 3300048906 Bacteria 4052
1124 Ga0496103_0246527 3300048906 Bacteria 1149
1125 Ga0496104_0275923 3300048907 Bacteria 1594
1126 Ga0496104_0300228 3300048907 Bacteria 1518
1127 Ga0496106_0004259 3300048909 Bacteria 10652
1128 Ga0496108_0067143 3300048911 Bacteria 3025
1129 Ga0496109_0001176 3300048912 Bacteria 21761
1130 Ga0496110_0209515 3300048913 Bacteria 1772
1131 Ga0496110_0933151 3300048913 Bacteria 774
1132 Ga0496112_0768175 3300048915 Bacteria 889
1133 Ga0496114_0313364 3300048917 Unclassified 1386
1134 Ga0496115_0425937 3300048918 Bacteria 1075
1135 Ga0496117_0277608 3300048920 Bacteria 899
1136 Ga0496118_0086097 3300048921 Bacteria 2185
1137 Ga0496121_0004571 3300048924 Bacteria 18454
1138 Ga0496121_0244620 3300048924 Bacteria 1248
1139 Ga0496124_0541390 3300048927 Bacteria 771
1140 Ga0501311_058651 3300049527 Bacteria 618
1141 Ga0501032_0317824 3300049569 Bacteria 1005
1142 Ga0501033_0340260 3300049570 Bacteria 1052
1143 Ga0501034_0050937 3300049571 Bacteria 4175
1144 Ga0501034_0105612 3300049571 Bacteria 2809
1145 Ga0501034_0608958 3300049571 Bacteria 997
1146 Ga0501036_0062381 3300049572 Bacteria 3157
1147 Ga0501036_0083767 3300049572 Bacteria 2696
1148 Ga0501037_0001918 3300049573 Bacteria 15085
1149 Ga0501038_0019238 3300049574 Bacteria 6159
1150 Ga0501038_0198598 3300049574 Bacteria 1611
1151 Ga0501039_0121032 3300049575 Bacteria 2051
1152 Ga0501040_0088966 3300049576 Bacteria 2145
1153 Ga0501040_0509060 3300049576 Bacteria 868
1154 Ga0501042_0818738 3300049578 Bacteria 678
1155 Ga0501046_0229489 3300049580 Bacteria 1372
1156 Ga0501047_0033218 3300049581 Bacteria 4980
1157 Ga0501047_0628769 3300049581 Bacteria 894
1158 Ga0501048_0017587 3300049582 Bacteria 5264
1159 Ga0501048_0075654 3300049582 Bacteria 2376
1160 Ga0501048_0362725 3300049582 Bacteria 1034
1161 Ga0501067_0064621 3300049583 Bacteria 2026
1162 Ga0501067_0129961 3300049583 Bacteria 1402
1163 Ga0501068_0078516 3300049584 Bacteria 2023
1164 Ga0501068_0657026 3300049584 Bacteria 685
1165 Ga0501071_0018420 3300049587 Bacteria 4834
1166 Ga0501071_0164909 3300049587 Bacteria 1657
1167 Ga0501071_0392541 3300049587 Bacteria 1059
1168 Ga0501072_0079503 3300049588 Bacteria 2597
1169 Ga0501072_0114164 3300049588 Bacteria 2150
1170 Ga0501073_0009833 3300049589 Bacteria 7039
1171 Ga0501073_0199830 3300049589 Bacteria 1382
1172 Ga0501074_0002140 3300049590 Bacteria 13659
1173 Ga0501075_0042052 3300049591 Bacteria 3426
1174 Ga0501075_0083880 3300049591 Bacteria 2413
1175 Ga0501075_0504443 3300049591 Bacteria 923
1176 Ga0501075_0551589 3300049591 Bacteria 880
1177 Ga0501076_0019380 3300049592 Bacteria 5201
1178 Ga0501076_0297910 3300049592 Bacteria 1322
1179 Ga0501077_0206050 3300049593 Bacteria 1250
1180 Ga0501206_017533 3300049653 Bacteria 1003
1181 Ga0501208_015304 3300049655 Bacteria 1176
1182 Ga0501221_048680 3300049704 Bacteria 949
1183 Ga0501225_0215129 3300049705 Bacteria 616
1184 Ga0501079_0039652 3300049741 Bacteria 3632
1185 Ga0501079_0971486 3300049741 Bacteria 669
1186 Ga0501080_0004016 3300049742 Bacteria 13028
1187 Ga0501080_0139067 3300049742 Bacteria 2246
1188 Ga0501080_0150585 3300049742 Bacteria 2151
1189 Ga0501080_0169697 3300049742 Bacteria 2013
1190 Ga0501080_0361261 3300049742 Bacteria 1310
1191 Ga0501080_0402220 3300049742 Bacteria 1232
1192 Ga0501081_0042874 3300049743 Bacteria 3102
1193 Ga0501081_0286507 3300049743 Bacteria 1207
1194 Ga0501081_1115911 3300049743 Bacteria 597
1195 Ga0501083_0071428 3300049744 Bacteria 2308
1196 Ga0501083_0208275 3300049744 Bacteria 1275
1197 Ga0501083_0232787 3300049744 Bacteria 1200
1198 Ga0501083_0521086 3300049744 Bacteria 774
1199 Ga0501035_1118227 3300049822 Bacteria 615
1200 Ga0501044_0007741 3300049823 Bacteria 11812
1201 Ga0501044_0144781 3300049823 Bacteria 2363
1202 Ga0501045_0054880 3300049824 Bacteria 2914
1203 Ga0501045_0091755 3300049824 Bacteria 2245
1204 Ga0501045_0093809 3300049824 Bacteria 2220
1205 Ga0501045_0417026 3300049824 Bacteria 999
1206 Ga0501045_0879131 3300049824 Bacteria 659
1207 nmdc:mga0k408_14443_c1 3300050493 Bacteria 4352
1208 nmdc:mga06z11_177784_c1 3300050494 Bacteria 1225
1209 nmdc:mga07m45_131724_c1 3300050496 Bacteria 1447
1210 nmdc:mga05p37_1055797_c1 3300050507 Bacteria 856
1211 nmdc:mga05p37_1157389_c1 3300050507 Bacteria 804
1212 nmdc:mga05p37_17014_c1 3300050507 Bacteria 8769
1213 nmdc:mga05p37_1701_c1 3300050507 Bacteria 25630
1214 nmdc:mga05p37_262169_c1 3300050507 Bacteria 2068
1215 nmdc:mga05p37_28557_c1 3300050507 Bacteria 6803
1216 nmdc:mga05p37_430068_c1 3300050507 Bacteria 1534
1217 nmdc:mga05p37_49078_c1 3300050507 Bacteria 5191
1218 nmdc:mga05p37_497302_c1 3300050507 Bacteria 1400
1219 nmdc:mga05p37_53231_c1 3300050507 Bacteria 4977
1220 nmdc:mga09592_296147_c1 3300050508 Bacteria 1403
1221 nmdc:mga09592_302628_c1 3300050508 Bacteria 1386
1222 nmdc:mga09592_400481_c1 3300050508 Bacteria 1186
1223 nmdc:mga09592_521261_c1 3300050508 Bacteria 1022
1224 nmdc:mga09592_598506_c1 3300050508 Bacteria 945
1225 nmdc:mga09592_634272_c1 3300050508 Bacteria 913
1226 nmdc:mga09592_88599_c1 3300050508 Bacteria 2643
1227 nmdc:mga0qj67_246174_c1 3300050509 Bacteria 1450
1228 nmdc:mga0qj67_30909_c1 3300050509 Bacteria 4170
1229 nmdc:mga06r32_14172_c1 3300050510 Bacteria 7230
1230 nmdc:mga06r32_15501_c1 3300050510 Bacteria 6920
1231 nmdc:mga06r32_367114_c1 3300050510 Bacteria 1423
1232 nmdc:mga06r32_5062_c1 3300050510 Bacteria 11871
1233 nmdc:mga08y16_175859_c1 3300050511 Bacteria 2223
1234 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
1235 nmdc:mga08y16_5130_c1 3300050511 Bacteria 13690
1236 nmdc:mga0n895_15345_c1 3300050512 Bacteria 6981
1237 nmdc:mga0n895_165230_c1 3300050512 Bacteria 2245
1238 nmdc:mga0n895_227259_c1 3300050512 Bacteria 1894
1239 nmdc:mga0n895_24370_c1 3300050512 Bacteria 5701
1240 nmdc:mga0n895_292027_c1 3300050512 Unclassified 1653
1241 nmdc:mga0n895_459873_c1 3300050512 Bacteria 1284
1242 nmdc:mga0n895_629021_c1 3300050512 Bacteria 1074
1243 nmdc:mga0n895_682568_c1 3300050512 Bacteria 1024
1244 nmdc:mga0n895_71961_c1 3300050512 Bacteria 3429
1245 nmdc:mga0n895_938046_c1 3300050512 Bacteria 849
1246 nmdc:mga0rr50_116_c1 3300050513 Bacteria 44002
1247 nmdc:mga0rr50_433462_c1 3300050513 Bacteria 1113
1248 nmdc:mga08x19_40_c1 3300050514 Bacteria 154170
1249 nmdc:mga08x19_87268_c1 3300050514 Bacteria 2055
1250 nmdc:mga0a205_1228_c1 3300050515 Bacteria 21495
1251 nmdc:mga0a205_234689_c1 3300050515 Bacteria 1716
1252 nmdc:mga0a205_245638_c1 3300050515 Bacteria 1670
1253 nmdc:mga0a205_27799_c1 3300050515 Bacteria 5403
1254 nmdc:mga0a205_35735_c1 3300050515 Bacteria 4312
1255 nmdc:mga0a205_410039_c1 3300050515 Bacteria 1218
1256 nmdc:mga0a205_478841_c1 3300050515 Unclassified 1103
1257 nmdc:mga0a205_8807_c1 3300050515 Bacteria 9192
1258 Ga0495601_0077447 3300053077 Bacteria 2129
1259 Ga0495601_0177031 3300053077 Bacteria 1394
1260 Ga0495601_0206776 3300053077 Bacteria 1282
1261 Ga0495612_0009262 3300053078 Bacteria 3995
1262 Ga0495612_0113656 3300053078 Bacteria 1161
1263 Ga0500635_0007996 3300053080 Bacteria 2885
1264 Ga0495655_0009219 3300053083 Bacteria 1905
1265 Ga0495595_0003797 3300053084 Bacteria 6011
1266 Ga0495619_0002703 3300053085 Bacteria 11595
1267 Ga0495619_0071086 3300053085 Bacteria 2328
1268 Ga0500643_005686 3300053087 Bacteria 5324
1269 Ga0500566_0106700 3300053094 Bacteria 1528
1270 Ga0500650_0081666 3300053098 Bacteria 1512
1271 Ga0500650_0156728 3300053098 Bacteria 1051
1272 Ga0500556_0000107 3300053104 Bacteria 74228
1273 Ga0500569_011302 3300053109 Bacteria 2128
1274 Ga0500614_033703 3300053123 Bacteria 1267
1275 Ga0500642_0000007 3300053130 Bacteria 294238
1276 Ga0500559_0013950 3300053136 Bacteria 3396
1277 Ga0500568_0002264 3300053139 Bacteria 11497
1278 Ga0500616_0000499 3300053153 Bacteria 50346
1279 Ga0500620_017136 3300053155 Bacteria 2085
1280 Ga0501084_0021102 3300054114 Bacteria 5432
1281 Ga0501084_0074131 3300054114 Bacteria 2850
1282 Ga0501084_0273530 3300054114 Bacteria 1426
1283 Ga0590071_111659 3300059421 Bacteria 694
1284 Ga0587084_009768 3300059477 Bacteria 1247
1285 Ga0587084_016481 3300059477 Bacteria 1055
1286 Ga0587093_006640 3300059478 Bacteria 1268
1287 Ga0587066_011018 3300059490 Bacteria 1318
1288 Ga0587070_011201 3300059491 Bacteria 1337
1289 Ga0587070_021744 3300059491 Bacteria 1086
1290 Ga0587073_0024911 3300059492 Bacteria 1186
1291 Ga0587080_004278 3300059503 Bacteria 1842
1292 Ga0587082_003869 3300059504 Bacteria 1834
1293 Ga0587082_051374 3300059504 Bacteria 787
1294 Ga0587083_0120053 3300059505 Bacteria 678
1295 Ga0587085_000796 3300059506 Bacteria 2596
1296 Ga0587085_008385 3300059506 Bacteria 1317
1297 Ga0587088_005875 3300059508 Bacteria 1633
1298 Ga0587088_011865 3300059508 Bacteria 1307
1299 Ga0587090_007706 3300059510 Bacteria 1422
1300 Ga0587091_013781 3300059511 Bacteria 1305
1301 Ga0587092_021364 3300059512 Bacteria 1004
1302 Ga0587094_000627 3300059513 Bacteria 2903
1303 Ga0587101_007952 3300059623 Bacteria 1267
1304 Ga0587109_006059 3300059624 Bacteria 1767
1305 Ga0587109_030000 3300059624 Unclassified 1026
1306 Ga0587117_002125 3300059627 Bacteria 1804
1307 Ga0587062_000749 3300059639 Bacteria 2480
1308 Ga0587068_003778 3300059641 Bacteria 1962
1309 Ga0587072_014285 3300059643 Bacteria 1336
1310 Ga0587072_014729 3300059643 Bacteria 1320
1311 Ga0587076_004008 3300059645 Bacteria 1807
1312 Ga0587100_002195 3300059648 Bacteria 1233
1313 Ga0587107_045475 3300059652 Bacteria 726
1314 Ga0587124_004632 3300059660 Bacteria 1069
1315 Ga0587124_004682 3300059660 Bacteria 1066
1316 Ga0587071_012931 3300060344 Bacteria 1431
1317 Ga0587111_0002564 3300060346 Bacteria 2447
1318 Ga0587111_0006696 3300060346 Bacteria 1840
1319 Ga0587111_0063471 3300060346 Bacteria 846
1320 Ga0501082_0010286 3300060353 Bacteria 8053
1321 Ga0501082_0075942 3300060353 Bacteria 2895
1322 Ga0501082_1494493 3300060353 Bacteria 590
1323 Ga0466962_0054472 3300061719 Bacteria 1911
1324 Ga0530510_0071285 3300061734 Bacteria 2522
1325 Ga0530510_0572320 3300061734 Bacteria 859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10009375 Ga0070709_100093756 178
2 3300005435 Ga0070714_100004105 Ga0070714_10000410513 178
3 3300005436 Ga0070713_100009715 Ga0070713_1000097159 178
4 3300005436 Ga0070713_100447613 Ga0070713_1004476132 178
5 3300005437 Ga0070710_10010725 Ga0070710_100107253 178
6 3300005437 Ga0070710_10029534 Ga0070710_100295343 178
7 3300005437 Ga0070710_10090324 Ga0070710_100903244 178
8 3300005439 Ga0070711_100033377 Ga0070711_1000333776 178
9 3300005439 Ga0070711_100812563 Ga0070711_1008125631 178
10 3300005471 Ga0070698_100039432 Ga0070698_1000394326 178
11 3300005536 Ga0070697_100250256 Ga0070697_1002502562 178
12 3300005564 Ga0070664_100361144 Ga0070664_1003611442 178
13 3300005577 Ga0068857_101166759 Ga0068857_1011667591 178
14 3300005616 Ga0068852_100719697 Ga0068852_1007196972 178
15 3300005618 Ga0068864_100494591 Ga0068864_1004945912 178
16 3300005841 Ga0068863_101362902 Ga0068863_1013629021 178
17 3300006175 Ga0070712_100018095 Ga0070712_1000180954 178
18 3300006175 Ga0070712_100075018 Ga0070712_1000750183 178
19 3300013306 Ga0163162_10769470 Ga0163162_107694703 178
20 3300021358 Ga0213873_10199168 Ga0213873_101991681 178
21 3300021441 Ga0213871_10091176 Ga0213871_100911762 178
22 3300025898 Ga0207692_10004608 Ga0207692_100046086 178
23 3300025906 Ga0207699_10026834 Ga0207699_100268345 178
24 3300025906 Ga0207699_10168267 Ga0207699_101682672 178
25 3300025915 Ga0207693_10008823 Ga0207693_1000882310 178
26 3300025915 Ga0207693_10075253 Ga0207693_100752536 178
27 3300025915 Ga0207693_10104971 Ga0207693_101049712 178
28 3300025916 Ga0207663_10056484 Ga0207663_100564842 178
29 3300025916 Ga0207663_10584903 Ga0207663_105849031 178
30 3300025928 Ga0207700_10017186 Ga0207700_100171866 178
31 3300025928 Ga0207700_10037637 Ga0207700_100376378 178
32 3300025929 Ga0207664_10068004 Ga0207664_100680043 178
33 3300025929 Ga0207664_10867437 Ga0207664_108674372 178
34 3300025939 Ga0207665_10089277 Ga0207665_100892776 178
35 3300026035 Ga0207703_10449254 Ga0207703_104492542 178
36 3300026116 Ga0207674_10345588 Ga0207674_103455882 178
37 3300028379 Ga0268266_10758304 Ga0268266_107583042 178
38 3300031595 Ga0265313_10004521 Ga0265313_1000452114 178
39 3300031711 Ga0265314_10126045 Ga0265314_101260453 178
40 3300035117 Ga0373953_0069272 Ga0373953_0069272_137_682 178
41 3300035410 Ga0373924_0027067 Ga0373924_0027067_79_624 178
42 3300035724 Ga0373933_0383520 Ga0373933_0383520_224_769 178
43 3300037853 Ga0436364_0623666 Ga0436364_0623666_62_637 178
44 3300037853 Ga0436364_0863400 Ga0436364_0863400_229_774 178
45 3300039437 Ga0436365_1001167 Ga0436365_1001167_24_590 178
46 3300039438 Ga0436360_0328120 Ga0436360_0328120_159_698 178
47 3300039438 Ga0436360_0923015 Ga0436360_0923015_2072_2617 178
48 3300039453 Ga0436362_0260637 Ga0436362_0260637_268_813 178
49 3300039453 Ga0436362_0832964 Ga0436362_0832964_236_781 178
50 3300042876 Ga0451577_0000828 Ga0451577_0000828_32994_33536 178
51 3300045976 Ga0466967_0126564 Ga0466967_0126564_473_1018 178
52 3300049571 Ga0501034_0050937 Ga0501034_0050937_963_1526 178
53 3300049581 Ga0501047_0628769 Ga0501047_0628769_25_564 178
54 3300049742 Ga0501080_0139067 Ga0501080_0139067_835_1377 178
55 3300049742 Ga0501080_0402220 Ga0501080_0402220_414_959 178
56 3300053077 Ga0495601_0206776 Ga0495601_0206776_337_882 178
57 3300053085 Ga0495619_0071086 Ga0495619_0071086_156_701 178
58 3300005289 Ga0065704_10091784 Ga0065704_100917842 179
59 3300005295 Ga0065707_10094039 Ga0065707_100940394 179
60 3300005330 Ga0070690_100115551 Ga0070690_1001155513 179
61 3300005330 Ga0070690_100159739 Ga0070690_1001597393 179
62 3300005334 Ga0068869_100024219 Ga0068869_1000242195 179
63 3300005335 Ga0070666_10102938 Ga0070666_101029383 179
64 3300005335 Ga0070666_10507546 Ga0070666_105075462 179
65 3300005336 Ga0070680_100246401 Ga0070680_1002464012 179
66 3300005336 Ga0070680_100766455 Ga0070680_1007664552 179
67 3300005337 Ga0070682_100155089 Ga0070682_1001550891 179
68 3300005338 Ga0068868_100045599 Ga0068868_1000455991 179
69 3300005338 Ga0068868_100058678 Ga0068868_1000586785 179
70 3300005338 Ga0068868_100244098 Ga0068868_1002440983 179
71 3300005338 Ga0068868_100968036 Ga0068868_1009680361 179
72 3300005339 Ga0070660_100019074 Ga0070660_1000190747 179
73 3300005339 Ga0070660_100355169 Ga0070660_1003551692 179
74 3300005340 Ga0070689_100021710 Ga0070689_1000217108 179
75 3300005340 Ga0070689_100190030 Ga0070689_1001900302 179
76 3300005344 Ga0070661_100053245 Ga0070661_1000532454 179
77 3300005354 Ga0070675_100036517 Ga0070675_1000365173 179
78 3300005355 Ga0070671_100778352 Ga0070671_1007783522 179
79 3300005356 Ga0070674_100415638 Ga0070674_1004156381 179
80 3300005365 Ga0070688_100229472 Ga0070688_1002294721 179
81 3300005366 Ga0070659_100010189 Ga0070659_1000101893 179
82 3300005367 Ga0070667_100045119 Ga0070667_1000451194 179
83 3300005367 Ga0070667_100096799 Ga0070667_1000967995 179
84 3300005367 Ga0070667_100191169 Ga0070667_1001911694 179
85 3300005367 Ga0070667_100436951 Ga0070667_1004369511 179
86 3300005406 Ga0070703_10000427 Ga0070703_1000042719 179
87 3300005406 Ga0070703_10077638 Ga0070703_100776383 179
88 3300005434 Ga0070709_10136421 Ga0070709_101364213 179
89 3300005434 Ga0070709_10471596 Ga0070709_104715962 179
90 3300005435 Ga0070714_100019115 Ga0070714_1000191152 179
91 3300005438 Ga0070701_10188587 Ga0070701_101885872 179
92 3300005441 Ga0070700_100278482 Ga0070700_1002784821 179
93 3300005444 Ga0070694_100001132 Ga0070694_10000113215 179
94 3300005444 Ga0070694_100038571 Ga0070694_1000385715 179
95 3300005445 Ga0070708_100388002 Ga0070708_1003880023 179
96 3300005445 Ga0070708_101469904 Ga0070708_1014699041 179
97 3300005458 Ga0070681_10047524 Ga0070681_100475246 179
98 3300005458 Ga0070681_10287200 Ga0070681_102872004 179
99 3300005458 Ga0070681_10312633 Ga0070681_103126332 179
100 3300005459 Ga0068867_100068643 Ga0068867_1000686434 179
101 3300005466 Ga0070685_10179176 Ga0070685_101791762 179
102 3300005467 Ga0070706_100308008 Ga0070706_1003080082 179
103 3300005467 Ga0070706_100394110 Ga0070706_1003941101 179
104 3300005468 Ga0070707_100008651 Ga0070707_10000865115 179
105 3300005468 Ga0070707_101106659 Ga0070707_1011066591 179
106 3300005468 Ga0070707_101344140 Ga0070707_1013441401 179
107 3300005471 Ga0070698_100000084 Ga0070698_10000008469 179
108 3300005471 Ga0070698_100029263 Ga0070698_1000292637 179
109 3300005518 Ga0070699_100171924 Ga0070699_1001719243 179
110 3300005530 Ga0070679_100030062 Ga0070679_1000300627 179
111 3300005530 Ga0070679_100153303 Ga0070679_1001533032 179
112 3300005535 Ga0070684_101085047 Ga0070684_1010850472 179
113 3300005536 Ga0070697_100030441 Ga0070697_1000304414 179
114 3300005536 Ga0070697_100936537 Ga0070697_1009365371 179
115 3300005539 Ga0068853_100016886 Ga0068853_1000168869 179
116 3300005539 Ga0068853_100325030 Ga0068853_1003250302 179
117 3300005539 Ga0068853_100330010 Ga0068853_1003300103 179
118 3300005539 Ga0068853_100562825 Ga0068853_1005628252 179
119 3300005544 Ga0070686_100188740 Ga0070686_1001887403 179
120 3300005545 Ga0070695_100104477 Ga0070695_1001044773 179
121 3300005545 Ga0070695_100239366 Ga0070695_1002393661 179
122 3300005545 Ga0070695_100408605 Ga0070695_1004086052 179
123 3300005545 Ga0070695_100584665 Ga0070695_1005846652 179
124 3300005546 Ga0070696_100062295 Ga0070696_1000622952 179
125 3300005547 Ga0070693_100042808 Ga0070693_1000428084 179
126 3300005547 Ga0070693_100312066 Ga0070693_1003120661 179
127 3300005548 Ga0070665_100015455 Ga0070665_10001545515 179
128 3300005548 Ga0070665_100039969 Ga0070665_1000399698 179
129 3300005549 Ga0070704_100058068 Ga0070704_1000580681 179
130 3300005549 Ga0070704_100142767 Ga0070704_1001427672 179
131 3300005549 Ga0070704_100158890 Ga0070704_1001588902 179
132 3300005563 Ga0068855_100002256 Ga0068855_1000022563 179
133 3300005563 Ga0068855_100135013 Ga0068855_1001350136 179
134 3300005563 Ga0068855_101171064 Ga0068855_1011710642 179
135 3300005564 Ga0070664_100108268 Ga0070664_1001082682 179
136 3300005577 Ga0068857_100084727 Ga0068857_1000847276 179
137 3300005577 Ga0068857_100233814 Ga0068857_1002338144 179
138 3300005614 Ga0068856_100073064 Ga0068856_1000730641 179
139 3300005615 Ga0070702_100076187 Ga0070702_1000761872 179
140 3300005615 Ga0070702_100160357 Ga0070702_1001603571 179
141 3300005616 Ga0068852_100491550 Ga0068852_1004915501 179
142 3300005617 Ga0068859_100006061 Ga0068859_10000606112 179
143 3300005617 Ga0068859_100117976 Ga0068859_1001179762 179
144 3300005618 Ga0068864_100017558 Ga0068864_1000175582 179
145 3300005618 Ga0068864_100018412 Ga0068864_1000184127 179
146 3300005618 Ga0068864_100053223 Ga0068864_1000532233 179
147 3300005718 Ga0068866_10000684 Ga0068866_100006844 179
148 3300005718 Ga0068866_10781779 Ga0068866_107817791 179
149 3300005719 Ga0068861_100069342 Ga0068861_1000693424 179
150 3300005834 Ga0068851_10045673 Ga0068851_100456734 179
151 3300005840 Ga0068870_10277622 Ga0068870_102776222 179
152 3300005841 Ga0068863_100050660 Ga0068863_1000506608 179
153 3300005841 Ga0068863_100104622 Ga0068863_1001046223 179
154 3300005841 Ga0068863_100335315 Ga0068863_1003353153 179
155 3300005842 Ga0068858_100030046 Ga0068858_1000300467 179
156 3300005842 Ga0068858_100060954 Ga0068858_1000609544 179
157 3300005842 Ga0068858_100129609 Ga0068858_1001296093 179
158 3300005842 Ga0068858_100241418 Ga0068858_1002414183 179
159 3300005842 Ga0068858_100466781 Ga0068858_1004667812 179
160 3300005842 Ga0068858_100660916 Ga0068858_1006609162 179
161 3300005843 Ga0068860_100036229 Ga0068860_1000362297 179
162 3300005843 Ga0068860_100138962 Ga0068860_1001389625 179
163 3300005843 Ga0068860_100173905 Ga0068860_1001739054 179
164 3300005843 Ga0068860_100227613 Ga0068860_1002276133 179
165 3300005843 Ga0068860_100630527 Ga0068860_1006305271 179
166 3300005844 Ga0068862_100019818 Ga0068862_1000198182 179
167 3300005985 Ga0081539_10048025 Ga0081539_100480253 179
168 3300006163 Ga0070715_10000038 Ga0070715_1000003864 179
169 3300006173 Ga0070716_100000006 Ga0070716_100000006240 179
170 3300006173 Ga0070716_100112969 Ga0070716_1001129692 179
171 3300006237 Ga0097621_100148746 Ga0097621_1001487461 179
172 3300006237 Ga0097621_100267095 Ga0097621_1002670952 179
173 3300006237 Ga0097621_100314685 Ga0097621_1003146851 179
174 3300006237 Ga0097621_100537624 Ga0097621_1005376242 179
175 3300006358 Ga0068871_100193630 Ga0068871_1001936304 179
176 3300006358 Ga0068871_100544580 Ga0068871_1005445801 179
177 3300006358 Ga0068871_100600343 Ga0068871_1006003432 179
178 3300006844 Ga0075428_100090316 Ga0075428_1000903164 179
179 3300006846 Ga0075430_100289235 Ga0075430_1002892352 179
180 3300006852 Ga0075433_10117851 Ga0075433_101178514 179
181 3300006871 Ga0075434_100108899 Ga0075434_1001088992 179
182 3300006880 Ga0075429_100053365 Ga0075429_1000533654 179
183 3300006881 Ga0068865_100113414 Ga0068865_1001134145 179
184 3300006914 Ga0075436_100000017 Ga0075436_10000001710 179
185 3300006931 Ga0097620_100006061 Ga0097620_10000606112 179
186 3300006931 Ga0097620_100117967 Ga0097620_1001179675 179
187 3300007076 Ga0075435_100006806 Ga0075435_10000680615 179
188 3300007076 Ga0075435_100773302 Ga0075435_1007733021 179
189 3300007265 Ga0099794_10157532 Ga0099794_101575322 179
190 3300009093 Ga0105240_11218503 Ga0105240_112185031 179
191 3300009094 Ga0111539_10005702 Ga0111539_1000570215 179
192 3300009098 Ga0105245_10234129 Ga0105245_102341294 179
193 3300009098 Ga0105245_10344030 Ga0105245_103440303 179
194 3300009101 Ga0105247_10142791 Ga0105247_101427912 179
195 3300009147 Ga0114129_10023849 Ga0114129_1002384914 179
196 3300009147 Ga0114129_11504603 Ga0114129_115046031 179
197 3300009148 Ga0105243_10000777 Ga0105243_1000077733 179
198 3300009148 Ga0105243_10085454 Ga0105243_100854542 179
199 3300009148 Ga0105243_10207725 Ga0105243_102077254 179
200 3300009174 Ga0105241_10017868 Ga0105241_100178683 179
201 3300009174 Ga0105241_10409529 Ga0105241_104095292 179
202 3300009174 Ga0105241_10898177 Ga0105241_108981772 179
203 3300009176 Ga0105242_10003416 Ga0105242_100034168 179
204 3300009176 Ga0105242_10065108 Ga0105242_100651086 179
205 3300009177 Ga0105248_10004070 Ga0105248_100040703 179
206 3300009177 Ga0105248_10138301 Ga0105248_101383014 179
207 3300009177 Ga0105248_10438568 Ga0105248_104385683 179
208 3300009177 Ga0105248_10611825 Ga0105248_106118252 179
209 3300009177 Ga0105248_10886601 Ga0105248_108866011 179
210 3300009545 Ga0105237_10047955 Ga0105237_1004795510 179
211 3300009545 Ga0105237_10284777 Ga0105237_102847773 179
212 3300009545 Ga0105237_10721327 Ga0105237_107213273 179
213 3300009551 Ga0105238_10013909 Ga0105238_100139099 179
214 3300009551 Ga0105238_10094337 Ga0105238_100943376 179
215 3300009551 Ga0105238_10880654 Ga0105238_108806541 179
216 3300009553 Ga0105249_10089304 Ga0105249_100893044 179
217 3300009553 Ga0105249_10945772 Ga0105249_109457722 179
218 3300010159 Ga0099796_10045790 Ga0099796_100457901 179
219 3300010375 Ga0105239_10034574 Ga0105239_100345748 179
220 3300010375 Ga0105239_10442356 Ga0105239_104423563 179
221 3300010375 Ga0105239_10592207 Ga0105239_105922073 179
222 3300013100 Ga0157373_10042642 Ga0157373_100426424 179
223 3300013100 Ga0157373_10173913 Ga0157373_101739132 179
224 3300013104 Ga0157370_10223850 Ga0157370_102238504 179
225 3300013104 Ga0157370_10525608 Ga0157370_105256082 179
226 3300013105 Ga0157369_10179579 Ga0157369_101795794 179
227 3300013105 Ga0157369_10705100 Ga0157369_107051002 179
228 3300013105 Ga0157369_10972711 Ga0157369_109727112 179
229 3300013297 Ga0157378_10006521 Ga0157378_1000652114 179
230 3300013297 Ga0157378_10037188 Ga0157378_100371882 179
231 3300013297 Ga0157378_10229478 Ga0157378_102294782 179
232 3300013297 Ga0157378_10286085 Ga0157378_102860853 179
233 3300013297 Ga0157378_10291716 Ga0157378_102917162 179
234 3300013297 Ga0157378_10386132 Ga0157378_103861322 179
235 3300013297 Ga0157378_11200549 Ga0157378_112005491 179
236 3300013306 Ga0163162_10002962 Ga0163162_1000296222 179
237 3300013306 Ga0163162_10171154 Ga0163162_101711541 179
238 3300013306 Ga0163162_10177522 Ga0163162_101775225 179
239 3300013306 Ga0163162_10432255 Ga0163162_104322551 179
240 3300013306 Ga0163162_10526900 Ga0163162_105269003 179
241 3300013307 Ga0157372_10106460 Ga0157372_101064607 179
242 3300013308 Ga0157375_10023497 Ga0157375_100234976 179
243 3300013308 Ga0157375_10103709 Ga0157375_101037094 179
244 3300014325 Ga0163163_10007538 Ga0163163_1000753812 179
245 3300014325 Ga0163163_10753571 Ga0163163_107535711 179
246 3300014326 Ga0157380_10095902 Ga0157380_100959021 179
247 3300014968 Ga0157379_10194166 Ga0157379_101941663 179
248 3300014969 Ga0157376_10242205 Ga0157376_102422054 179
249 3300014969 Ga0157376_11034652 Ga0157376_110346522 179
250 3300017792 Ga0163161_10019647 Ga0163161_100196472 179
251 3300017792 Ga0163161_10239116 Ga0163161_102391162 179
252 3300017792 Ga0163161_10358773 Ga0163161_103587733 179
253 3300025321 Ga0207656_10055538 Ga0207656_100555382 179
254 3300025885 Ga0207653_10000033 Ga0207653_1000003310 179
255 3300025885 Ga0207653_10076248 Ga0207653_100762481 179
256 3300025899 Ga0207642_10022056 Ga0207642_100220566 179
257 3300025900 Ga0207710_10519746 Ga0207710_105197461 179
258 3300025901 Ga0207688_10598914 Ga0207688_105989141 179
259 3300025905 Ga0207685_10000051 Ga0207685_1000005140 179
260 3300025906 Ga0207699_10008158 Ga0207699_100081589 179
261 3300025907 Ga0207645_10359464 Ga0207645_103594641 179
262 3300025910 Ga0207684_10029417 Ga0207684_100294175 179
263 3300025910 Ga0207684_11169296 Ga0207684_111692961 179
264 3300025911 Ga0207654_10041690 Ga0207654_100416902 179
265 3300025911 Ga0207654_10450739 Ga0207654_104507392 179
266 3300025911 Ga0207654_11008106 Ga0207654_110081061 179
267 3300025912 Ga0207707_10018832 Ga0207707_1001883211 179
268 3300025912 Ga0207707_10047405 Ga0207707_100474053 179
269 3300025912 Ga0207707_10075513 Ga0207707_100755136 179
270 3300025912 Ga0207707_10138344 Ga0207707_101383442 179
271 3300025913 Ga0207695_10140217 Ga0207695_101402174 179
272 3300025914 Ga0207671_10060155 Ga0207671_100601556 179
273 3300025914 Ga0207671_10300698 Ga0207671_103006983 179
274 3300025917 Ga0207660_10076991 Ga0207660_100769914 179
275 3300025918 Ga0207662_10164177 Ga0207662_101641772 179
276 3300025919 Ga0207657_10003364 Ga0207657_100033643 179
277 3300025920 Ga0207649_10129753 Ga0207649_101297533 179
278 3300025921 Ga0207652_10047930 Ga0207652_100479309 179
279 3300025921 Ga0207652_10096220 Ga0207652_100962203 179
280 3300025921 Ga0207652_10637704 Ga0207652_106377042 179
281 3300025922 Ga0207646_10655207 Ga0207646_106552071 179
282 3300025923 Ga0207681_10900674 Ga0207681_109006741 179
283 3300025924 Ga0207694_10010354 Ga0207694_1001035414 179
284 3300025927 Ga0207687_10149550 Ga0207687_101495501 179
285 3300025927 Ga0207687_10159467 Ga0207687_101594673 179
286 3300025929 Ga0207664_10011372 Ga0207664_100113724 179
287 3300025931 Ga0207644_10000414 Ga0207644_1000041415 179
288 3300025931 Ga0207644_10291825 Ga0207644_102918251 179
289 3300025932 Ga0207690_10057507 Ga0207690_100575073 179
290 3300025932 Ga0207690_10120468 Ga0207690_101204682 179
291 3300025934 Ga0207686_10000005 Ga0207686_1000000515 179
292 3300025934 Ga0207686_10004022 Ga0207686_1000402212 179
293 3300025935 Ga0207709_10000133 Ga0207709_1000013315 179
294 3300025936 Ga0207670_10110917 Ga0207670_101109171 179
295 3300025936 Ga0207670_10285167 Ga0207670_102851673 179
296 3300025939 Ga0207665_10000005 Ga0207665_10000005165 179
297 3300025939 Ga0207665_10039267 Ga0207665_100392676 179
298 3300025941 Ga0207711_10004233 Ga0207711_100042333 179
299 3300025941 Ga0207711_10132896 Ga0207711_101328964 179
300 3300025941 Ga0207711_10306669 Ga0207711_103066692 179
301 3300025941 Ga0207711_10498167 Ga0207711_104981672 179
302 3300025941 Ga0207711_10560170 Ga0207711_105601702 179
303 3300025942 Ga0207689_10003268 Ga0207689_1000326818 179
304 3300025942 Ga0207689_10070209 Ga0207689_100702094 179
305 3300025945 Ga0207679_10534070 Ga0207679_105340702 179
306 3300025949 Ga0207667_10114447 Ga0207667_101144474 179
307 3300025949 Ga0207667_10142564 Ga0207667_101425643 179
308 3300025960 Ga0207651_10008745 Ga0207651_100087454 179
309 3300025961 Ga0207712_10633640 Ga0207712_106336402 179
310 3300025981 Ga0207640_10995760 Ga0207640_109957601 179
311 3300025986 Ga0207658_10254031 Ga0207658_102540312 179
312 3300026023 Ga0207677_10016453 Ga0207677_100164534 179
313 3300026023 Ga0207677_10471864 Ga0207677_104718641 179
314 3300026035 Ga0207703_10019029 Ga0207703_100190299 179
315 3300026035 Ga0207703_10020588 Ga0207703_100205885 179
316 3300026035 Ga0207703_10063129 Ga0207703_100631296 179
317 3300026035 Ga0207703_10064766 Ga0207703_100647665 179
318 3300026035 Ga0207703_10285132 Ga0207703_102851323 179
319 3300026035 Ga0207703_10446091 Ga0207703_104460911 179
320 3300026041 Ga0207639_10028396 Ga0207639_100283963 179
321 3300026041 Ga0207639_10220928 Ga0207639_102209284 179
322 3300026041 Ga0207639_10498747 Ga0207639_104987472 179
323 3300026067 Ga0207678_10542233 Ga0207678_105422332 179
324 3300026067 Ga0207678_10620838 Ga0207678_106208382 179
325 3300026075 Ga0207708_10164164 Ga0207708_101641642 179
326 3300026078 Ga0207702_10030901 Ga0207702_1003090110 179
327 3300026088 Ga0207641_10023693 Ga0207641_100236936 179
328 3300026088 Ga0207641_10085205 Ga0207641_100852053 179
329 3300026088 Ga0207641_11329213 Ga0207641_113292131 179
330 3300026089 Ga0207648_10281488 Ga0207648_102814882 179
331 3300026089 Ga0207648_10302052 Ga0207648_103020521 179
332 3300026095 Ga0207676_10009610 Ga0207676_100096107 179
333 3300026095 Ga0207676_10049891 Ga0207676_100498912 179
334 3300026095 Ga0207676_10086376 Ga0207676_100863765 179
335 3300026095 Ga0207676_10749478 Ga0207676_107494782 179
336 3300026116 Ga0207674_10013233 Ga0207674_1001323316 179
337 3300026116 Ga0207674_10018433 Ga0207674_100184336 179
338 3300026116 Ga0207674_10040581 Ga0207674_100405812 179
339 3300026118 Ga0207675_100001227 Ga0207675_10000122728 179
340 3300026118 Ga0207675_100629670 Ga0207675_1006296701 179
341 3300026142 Ga0207698_11300152 Ga0207698_113001521 179
342 3300027876 Ga0209974_10035385 Ga0209974_100353852 179
343 3300027907 Ga0207428_10007215 Ga0207428_100072154 179
344 3300028379 Ga0268266_10011799 Ga0268266_100117993 179
345 3300028379 Ga0268266_10043390 Ga0268266_100433902 179
346 3300028379 Ga0268266_10370969 Ga0268266_103709691 179
347 3300028380 Ga0268265_10691586 Ga0268265_106915862 179
348 3300028381 Ga0268264_10060239 Ga0268264_100602395 179
349 3300028381 Ga0268264_10079012 Ga0268264_100790124 179
350 3300028381 Ga0268264_10137708 Ga0268264_101377083 179
351 3300028381 Ga0268264_10201376 Ga0268264_102013762 179
352 3300028381 Ga0268264_10722154 Ga0268264_107221542 179
353 3300028653 Ga0265323_10034570 Ga0265323_100345702 179
354 3300031239 Ga0265328_10162384 Ga0265328_101623842 179
355 3300031249 Ga0265339_10141364 Ga0265339_101413642 179
356 3300031344 Ga0265316_10210287 Ga0265316_102102874 179
357 3300031507 Ga0307509_10363140 Ga0307509_103631402 179
358 3300031548 Ga0307408_100001928 Ga0307408_10000192818 179
359 3300031548 Ga0307408_101036508 Ga0307408_1010365082 179
360 3300031665 Ga0316575_10004333 Ga0316575_100043336 179
361 3300031665 Ga0316575_10021116 Ga0316575_100211164 179
362 3300031665 Ga0316575_10025775 Ga0316575_100257754 179
363 3300031691 Ga0316579_10003044 Ga0316579_100030443 179
364 3300031691 Ga0316579_10078475 Ga0316579_100784753 179
365 3300031711 Ga0265314_10009286 Ga0265314_100092869 179
366 3300031712 Ga0265342_10064957 Ga0265342_100649573 179
367 3300031727 Ga0316576_10002450 Ga0316576_1000245015 179
368 3300031727 Ga0316576_10003583 Ga0316576_100035834 179
369 3300031727 Ga0316576_10010549 Ga0316576_100105495 179
370 3300031727 Ga0316576_10046481 Ga0316576_100464813 179
371 3300031727 Ga0316576_10106373 Ga0316576_101063732 179
372 3300031727 Ga0316576_10238193 Ga0316576_102381931 179
373 3300031728 Ga0316578_10000551 Ga0316578_1000055113 179
374 3300031728 Ga0316578_10058133 Ga0316578_100581332 179
375 3300031731 Ga0307405_10003109 Ga0307405_1000310912 179
376 3300031733 Ga0316577_10002746 Ga0316577_100027461 179
377 3300031733 Ga0316577_10074607 Ga0316577_100746073 179
378 3300031733 Ga0316577_10517461 Ga0316577_105174612 179
379 3300031824 Ga0307413_10000449 Ga0307413_1000044915 179
380 3300031824 Ga0307413_10000549 Ga0307413_1000054919 179
381 3300031824 Ga0307413_10362313 Ga0307413_103623131 179
382 3300031852 Ga0307410_10001120 Ga0307410_100011204 179
383 3300031852 Ga0307410_10003798 Ga0307410_100037986 179
384 3300031901 Ga0307406_10157487 Ga0307406_101574873 179
385 3300031901 Ga0307406_10411940 Ga0307406_104119402 179
386 3300031903 Ga0307407_10001031 Ga0307407_100010319 179
387 3300031903 Ga0307407_10001139 Ga0307407_100011397 179
388 3300031903 Ga0307407_10946675 Ga0307407_109466751 179
389 3300031911 Ga0307412_10072234 Ga0307412_100722343 179
390 3300031911 Ga0307412_10177862 Ga0307412_101778623 179
391 3300031911 Ga0307412_10280859 Ga0307412_102808592 179
392 3300031995 Ga0307409_100003195 Ga0307409_10000319511 179
393 3300032002 Ga0307416_100016487 Ga0307416_1000164874 179
394 3300032002 Ga0307416_100035072 Ga0307416_1000350726 179
395 3300032002 Ga0307416_100099664 Ga0307416_1000996643 179
396 3300032004 Ga0307414_10034819 Ga0307414_100348192 179
397 3300032004 Ga0307414_10404202 Ga0307414_104042022 179
398 3300032126 Ga0307415_100053963 Ga0307415_1000539634 179
399 3300032126 Ga0307415_100276861 Ga0307415_1002768612 179
400 3300032126 Ga0307415_100399278 Ga0307415_1003992783 179
401 3300032133 Ga0316583_10015823 Ga0316583_100158232 179
402 3300032133 Ga0316583_10033936 Ga0316583_100339364 179
403 3300032133 Ga0316583_10118532 Ga0316583_101185322 179
404 3300032133 Ga0316583_10188662 Ga0316583_101886621 179
405 3300032137 Ga0316585_10001353 Ga0316585_100013534 179
406 3300032137 Ga0316585_10004948 Ga0316585_100049482 179
407 3300032137 Ga0316585_10057900 Ga0316585_100579002 179
408 3300032139 Ga0316580_10002359 Ga0316580_100023599 179
409 3300032139 Ga0316580_10026342 Ga0316580_100263423 179
410 3300032168 Ga0316593_10000033 Ga0316593_1000003315 179
411 3300032168 Ga0316593_10000122 Ga0316593_1000012214 179
412 3300032168 Ga0316593_10001783 Ga0316593_100017838 179
413 3300032168 Ga0316593_10002306 Ga0316593_100023068 179
414 3300032168 Ga0316593_10003721 Ga0316593_100037215 179
415 3300033528 Ga0316588_1033653 Ga0316588_10336532 179
416 3300033541 Ga0316596_1022948 Ga0316596_10229482 179
417 3300033541 Ga0316596_1036298 Ga0316596_10362982 179
418 3300035398 Ga0316574_0003671 Ga0316574_0003671_6918_7460 179
419 3300035398 Ga0316574_0006441 Ga0316574_0006441_4470_5009 179
420 3300035398 Ga0316574_0050430 Ga0316574_0050430_589_1128 179
421 3300035398 Ga0316574_0173136 Ga0316574_0173136_223_762 179
422 3300035398 Ga0316574_0468942 Ga0316574_0468942_235_774 179
423 3300035398 Ga0316574_0518551 Ga0316574_0518551_24_566 179
424 3300036647 Ga0316582_0003224 Ga0316582_0003224_5887_6426 179
425 3300036647 Ga0316582_0005211 Ga0316582_0005211_5133_5672 179
426 3300036647 Ga0316582_0100542 Ga0316582_0100542_589_1128 179
427 3300036647 Ga0316582_0176094 Ga0316582_0176094_420_962 179
428 3300036647 Ga0316582_0377240 Ga0316582_0377240_267_809 179
429 3300036712 Ga0316584_0002208 Ga0316584_0002208_517_1059 179
430 3300036712 Ga0316584_0045853 Ga0316584_0045853_2300_2839 179
431 3300036712 Ga0316584_0056894 Ga0316584_0056894_826_1365 179
432 3300036712 Ga0316584_0566156 Ga0316584_0566156_174_713 179
433 3300037418 Ga0395900_0180156 Ga0395900_0180156_1166_1705 179
434 3300037471 Ga0395905_0506042 Ga0395905_0506042_227_766 179
435 3300037588 Ga0316581_0010080 Ga0316581_0010080_1544_2083 179
436 3300038443 Ga0395901_0920942 Ga0395901_0920942_252_800 179
437 3300038725 Ga0400484_14002 Ga0400484_14002_4488_5027 179
438 3300038726 Ga0400490_30744 Ga0400490_30744_19132_19671 179
439 3300038741 Ga0400488_22380 Ga0400488_22380_785_1324 179
440 3300039062 Ga0400483_035845 Ga0400483_035845_2433_2972 179
441 3300039062 Ga0400483_281776 Ga0400483_281776_6608_7147 179
442 3300039093 Ga0400489_27072 Ga0400489_27072_2076_2615 179
443 3300039093 Ga0400489_86209 Ga0400489_86209_2913_3452 179
444 3300039438 Ga0436360_0163442 Ga0436360_0163442_6003_6557 179
445 3300039450 Ga0436363_0872043 Ga0436363_0872043_419_958 179
446 3300041456 Ga0451795_0157516 Ga0451795_0157516_64_603 179
447 3300041486 Ga0451807_0333339 Ga0451807_0333339_153_692 179
448 3300042130 Ga0450892_003270 Ga0450892_003270_251_790 179
449 3300042876 Ga0451577_0000004 Ga0451577_0000004_566730_567269 179
450 3300044673 Ga0453683_0000002 Ga0453683_0000002_900229_900768 179
451 3300044673 Ga0453683_0492208 Ga0453683_0492208_146_685 179
452 3300044712 Ga0453684_0000025 Ga0453684_0000025_566758_567297 179
453 3300044712 Ga0453684_0003637 Ga0453684_0003637_5793_6332 179
454 3300044712 Ga0453684_0005988 Ga0453684_0005988_17311_17850 179
455 3300044712 Ga0453684_0032497 Ga0453684_0032497_6737_7276 179
456 3300044712 Ga0453684_0140838 Ga0453684_0140838_318_857 179
457 3300044712 Ga0453684_0494279 Ga0453684_0494279_87_626 179
458 3300045051 Ga0451576_0005912 Ga0451576_0005912_5819_6358 179
459 3300045051 Ga0451576_0089061 Ga0451576_0089061_1539_2078 179
460 3300045051 Ga0451576_0453652 Ga0451576_0453652_606_1145 179
461 3300046459 Ga0495629_0502263 Ga0495629_0502263_115_654 179
462 3300046514 Ga0495618_0194862 Ga0495618_0194862_85_624 179
463 3300046529 Ga0495652_0205882 Ga0495652_0205882_314_853 179
464 3300046537 Ga0495598_0000163 Ga0495598_0000163_675_1217 179
465 3300046539 Ga0495621_0020255 Ga0495621_0020255_1186_1725 179
466 3300046615 Ga0495656_0295605 Ga0495656_0295605_58_600 179
467 3300046663 Ga0495635_0140096 Ga0495635_0140096_1073_1612 179
468 3300046683 Ga0495658_0018132 Ga0495658_0018132_439_978 179
469 3300046691 Ga0495670_0163925 Ga0495670_0163925_205_744 179
470 3300046809 Ga0495600_0320799 Ga0495600_0320799_218_757 179
471 3300047318 Ga0495636_0001105 Ga0495636_0001105_1885_2427 179
472 3300047322 Ga0495680_0705676 Ga0495680_0705676_59_598 179
473 3300048090 Ga0495615_0001516 Ga0495615_0001516_2123_2665 179
474 3300048090 Ga0495615_0207169 Ga0495615_0207169_14_553 179
475 3300048911 Ga0496108_0067143 Ga0496108_0067143_2224_2763 179
476 3300048913 Ga0496110_0933151 Ga0496110_0933151_135_674 179
477 3300048915 Ga0496112_0768175 Ga0496112_0768175_186_725 179
478 3300048918 Ga0496115_0425937 Ga0496115_0425937_176_715 179
479 3300048920 Ga0496117_0277608 Ga0496117_0277608_137_727 179
480 3300048921 Ga0496118_0086097 Ga0496118_0086097_882_1472 179
481 3300048924 Ga0496121_0004571 Ga0496121_0004571_12758_13348 179
482 3300049704 Ga0501221_048680 Ga0501221_048680_299_838 179
483 3300049705 Ga0501225_0215129 Ga0501225_0215129_32_586 179
484 3300049823 Ga0501044_0144781 Ga0501044_0144781_470_1018 179
485 3300049824 Ga0501045_0879131 Ga0501045_0879131_98_643 179
486 3300050507 nmdc:mga05p37_17014_c1 nmdc:mga05p37_17014_c1_1990_2529 179
487 3300050509 nmdc:mga0qj67_246174_c1 nmdc:mga0qj67_246174_c1_771_1310 179
488 3300050510 nmdc:mga06r32_367114_c1 nmdc:mga06r32_367114_c1_494_1033 179
489 3300050511 nmdc:mga08y16_5130_c1 nmdc:mga08y16_5130_c1_5487_6026 179
490 3300050512 nmdc:mga0n895_292027_c1 nmdc:mga0n895_292027_c1_344_883 179
491 3300050512 nmdc:mga0n895_71961_c1 nmdc:mga0n895_71961_c1_168_707 179
492 3300050512 nmdc:mga0n895_938046_c1 nmdc:mga0n895_938046_c1_188_727 179
493 3300050513 nmdc:mga0rr50_116_c1 nmdc:mga0rr50_116_c1_7983_8522 179
494 3300050514 nmdc:mga08x19_40_c1 nmdc:mga08x19_40_c1_146795_147334 179
495 3300050515 nmdc:mga0a205_1228_c1 nmdc:mga0a205_1228_c1_17699_18238 179
496 3300050515 nmdc:mga0a205_35735_c1 nmdc:mga0a205_35735_c1_1057_1596 179
497 3300050515 nmdc:mga0a205_478841_c1 nmdc:mga0a205_478841_c1_123_662 179
498 3300053083 Ga0495655_0009219 Ga0495655_0009219_350_889 179
499 3300053094 Ga0500566_0106700 Ga0500566_0106700_482_1087 179
500 3300053109 Ga0500569_011302 Ga0500569_011302_107_697 179
501 3300053123 Ga0500614_033703 Ga0500614_033703_487_1077 179
502 3300053153 Ga0500616_0000499 Ga0500616_0000499_42719_43261 179
503 3300053155 Ga0500620_017136 Ga0500620_017136_1148_1753 179
504 3300059421 Ga0590071_111659 Ga0590071_111659_135_674 179
505 3300059490 Ga0587066_011018 Ga0587066_011018_310_852 179
506 3300059503 Ga0587080_004278 Ga0587080_004278_761_1303 179
507 3300059504 Ga0587082_051374 Ga0587082_051374_218_760 179
508 3300059508 Ga0587088_005875 Ga0587088_005875_899_1441 179
509 3300059643 Ga0587072_014285 Ga0587072_014285_758_1300 179
510 3300059660 Ga0587124_004632 Ga0587124_004632_270_812 179
511 3300060346 Ga0587111_0002564 Ga0587111_0002564_484_1023 179
512 3300060346 Ga0587111_0063471 Ga0587111_0063471_249_791 179
513 3300003322 rootL2_10194461 rootL2_101944612 180
514 3300005289 Ga0065704_10195761 Ga0065704_101957611 180
515 3300005290 Ga0065712_10091604 Ga0065712_100916044 180
516 3300005293 Ga0065715_10102075 Ga0065715_101020754 180
517 3300005293 Ga0065715_10143668 Ga0065715_101436683 180
518 3300005293 Ga0065715_10165959 Ga0065715_101659591 180
519 3300005295 Ga0065707_10027729 Ga0065707_100277291 180
520 3300005295 Ga0065707_10132362 Ga0065707_101323621 180
521 3300005328 Ga0070676_10255063 Ga0070676_102550633 180
522 3300005329 Ga0070683_100000033 Ga0070683_10000003387 180
523 3300005331 Ga0070670_100002900 Ga0070670_10000290011 180
524 3300005331 Ga0070670_100530543 Ga0070670_1005305432 180
525 3300005334 Ga0068869_100009311 Ga0068869_1000093115 180
526 3300005334 Ga0068869_100027588 Ga0068869_1000275885 180
527 3300005334 Ga0068869_100413594 Ga0068869_1004135941 180
528 3300005338 Ga0068868_100000632 Ga0068868_10000063215 180
529 3300005338 Ga0068868_100235512 Ga0068868_1002355121 180
530 3300005338 Ga0068868_100695734 Ga0068868_1006957342 180
531 3300005339 Ga0070660_100436774 Ga0070660_1004367741 180
532 3300005344 Ga0070661_100010686 Ga0070661_10001068612 180
533 3300005344 Ga0070661_100418491 Ga0070661_1004184913 180
534 3300005345 Ga0070692_10001104 Ga0070692_1000110414 180
535 3300005345 Ga0070692_10004482 Ga0070692_100044828 180
536 3300005347 Ga0070668_100003120 Ga0070668_10000312012 180
537 3300005347 Ga0070668_100120598 Ga0070668_1001205984 180
538 3300005347 Ga0070668_100228205 Ga0070668_1002282053 180
539 3300005353 Ga0070669_100017307 Ga0070669_1000173071 180
540 3300005353 Ga0070669_100030647 Ga0070669_1000306472 180
541 3300005353 Ga0070669_100097584 Ga0070669_1000975845 180
542 3300005354 Ga0070675_100000007 Ga0070675_100000007256 180
543 3300005364 Ga0070673_100034873 Ga0070673_1000348733 180
544 3300005364 Ga0070673_100079521 Ga0070673_1000795215 180
545 3300005364 Ga0070673_100207463 Ga0070673_1002074634 180
546 3300005364 Ga0070673_100697288 Ga0070673_1006972882 180
547 3300005364 Ga0070673_100705998 Ga0070673_1007059981 180
548 3300005366 Ga0070659_100117793 Ga0070659_1001177933 180
549 3300005406 Ga0070703_10248062 Ga0070703_102480621 180
550 3300005406 Ga0070703_10349908 Ga0070703_103499081 180
551 3300005436 Ga0070713_100403549 Ga0070713_1004035492 180
552 3300005436 Ga0070713_101432516 Ga0070713_1014325161 180
553 3300005437 Ga0070710_10666943 Ga0070710_106669431 180
554 3300005438 Ga0070701_10003059 Ga0070701_100030596 180
555 3300005438 Ga0070701_10500755 Ga0070701_105007551 180
556 3300005439 Ga0070711_100677303 Ga0070711_1006773032 180
557 3300005440 Ga0070705_100029752 Ga0070705_1000297521 180
558 3300005441 Ga0070700_100079746 Ga0070700_1000797464 180
559 3300005441 Ga0070700_100195828 Ga0070700_1001958282 180
560 3300005441 Ga0070700_100580821 Ga0070700_1005808212 180
561 3300005441 Ga0070700_100583576 Ga0070700_1005835761 180
562 3300005444 Ga0070694_100004904 Ga0070694_10000490415 180
563 3300005444 Ga0070694_100093403 Ga0070694_1000934035 180
564 3300005445 Ga0070708_100146203 Ga0070708_1001462034 180
565 3300005445 Ga0070708_100337407 Ga0070708_1003374072 180
566 3300005445 Ga0070708_100516085 Ga0070708_1005160852 180
567 3300005455 Ga0070663_100100368 Ga0070663_1001003681 180
568 3300005455 Ga0070663_101290746 Ga0070663_1012907461 180
569 3300005457 Ga0070662_100138944 Ga0070662_1001389444 180
570 3300005457 Ga0070662_100256012 Ga0070662_1002560122 180
571 3300005457 Ga0070662_100575853 Ga0070662_1005758532 180
572 3300005457 Ga0070662_100679972 Ga0070662_1006799722 180
573 3300005458 Ga0070681_10303539 Ga0070681_103035393 180
574 3300005459 Ga0068867_100058565 Ga0068867_1000585657 180
575 3300005459 Ga0068867_100403028 Ga0068867_1004030282 180
576 3300005459 Ga0068867_101249685 Ga0068867_1012496851 180
577 3300005466 Ga0070685_10027522 Ga0070685_100275227 180
578 3300005467 Ga0070706_100005771 Ga0070706_1000057715 180
579 3300005467 Ga0070706_100021749 Ga0070706_1000217498 180
580 3300005467 Ga0070706_100160143 Ga0070706_1001601435 180
581 3300005467 Ga0070706_100290494 Ga0070706_1002904942 180
582 3300005467 Ga0070706_100381803 Ga0070706_1003818031 180
583 3300005468 Ga0070707_100000343 Ga0070707_10000034314 180
584 3300005468 Ga0070707_100006596 Ga0070707_1000065969 180
585 3300005468 Ga0070707_100012600 Ga0070707_1000126004 180
586 3300005468 Ga0070707_100081504 Ga0070707_1000815043 180
587 3300005468 Ga0070707_100296630 Ga0070707_1002966302 180
588 3300005468 Ga0070707_101091800 Ga0070707_1010918002 180
589 3300005471 Ga0070698_100013686 Ga0070698_10001368615 180
590 3300005471 Ga0070698_100039505 Ga0070698_1000395058 180
591 3300005471 Ga0070698_100064533 Ga0070698_1000645332 180
592 3300005471 Ga0070698_100172142 Ga0070698_1001721423 180
593 3300005471 Ga0070698_100495468 Ga0070698_1004954682 180
594 3300005471 Ga0070698_100780400 Ga0070698_1007804001 180
595 3300005518 Ga0070699_100038276 Ga0070699_1000382768 180
596 3300005518 Ga0070699_100077781 Ga0070699_1000777811 180
597 3300005518 Ga0070699_100098833 Ga0070699_1000988336 180
598 3300005518 Ga0070699_100124595 Ga0070699_1001245956 180
599 3300005518 Ga0070699_100242768 Ga0070699_1002427682 180
600 3300005535 Ga0070684_100006540 Ga0070684_10000654014 180
601 3300005536 Ga0070697_100002003 Ga0070697_10000200320 180
602 3300005536 Ga0070697_100183374 Ga0070697_1001833741 180
603 3300005536 Ga0070697_100365617 Ga0070697_1003656173 180
604 3300005539 Ga0068853_100010446 Ga0068853_1000104467 180
605 3300005543 Ga0070672_100057049 Ga0070672_1000570497 180
606 3300005544 Ga0070686_100002184 Ga0070686_10000218412 180
607 3300005544 Ga0070686_100038213 Ga0070686_1000382135 180
608 3300005544 Ga0070686_100276720 Ga0070686_1002767201 180
609 3300005545 Ga0070695_100073003 Ga0070695_1000730032 180
610 3300005545 Ga0070695_100117228 Ga0070695_1001172283 180
611 3300005545 Ga0070695_100136229 Ga0070695_1001362294 180
612 3300005546 Ga0070696_100012751 Ga0070696_1000127514 180
613 3300005546 Ga0070696_100033599 Ga0070696_1000335994 180
614 3300005546 Ga0070696_100498617 Ga0070696_1004986171 180
615 3300005549 Ga0070704_100078530 Ga0070704_1000785302 180
616 3300005549 Ga0070704_100139413 Ga0070704_1001394132 180
617 3300005549 Ga0070704_100683494 Ga0070704_1006834941 180
618 3300005564 Ga0070664_100005841 Ga0070664_10000584112 180
619 3300005564 Ga0070664_100383001 Ga0070664_1003830013 180
620 3300005578 Ga0068854_100831891 Ga0068854_1008318912 180
621 3300005616 Ga0068852_100384633 Ga0068852_1003846332 180
622 3300005617 Ga0068859_100020360 Ga0068859_10002036012 180
623 3300005617 Ga0068859_100052938 Ga0068859_1000529384 180
624 3300005617 Ga0068859_100609037 Ga0068859_1006090371 180
625 3300005618 Ga0068864_100000349 Ga0068864_1000003499 180
626 3300005618 Ga0068864_100155076 Ga0068864_1001550765 180
627 3300005618 Ga0068864_100195967 Ga0068864_1001959672 180
628 3300005719 Ga0068861_100084086 Ga0068861_1000840863 180
629 3300005719 Ga0068861_100283062 Ga0068861_1002830624 180
630 3300005719 Ga0068861_100411943 Ga0068861_1004119432 180
631 3300005719 Ga0068861_100862671 Ga0068861_1008626711 180
632 3300005834 Ga0068851_10291239 Ga0068851_102912392 180
633 3300005840 Ga0068870_10030357 Ga0068870_100303575 180
634 3300005841 Ga0068863_100218686 Ga0068863_1002186862 180
635 3300005841 Ga0068863_100282278 Ga0068863_1002822784 180
636 3300005841 Ga0068863_101866298 Ga0068863_1018662981 180
637 3300005842 Ga0068858_100043268 Ga0068858_1000432684 180
638 3300005842 Ga0068858_100545114 Ga0068858_1005451143 180
639 3300005842 Ga0068858_100958323 Ga0068858_1009583231 180
640 3300005843 Ga0068860_100108998 Ga0068860_1001089986 180
641 3300005843 Ga0068860_101059429 Ga0068860_1010594292 180
642 3300005844 Ga0068862_100003143 Ga0068862_10000314314 180
643 3300005844 Ga0068862_100063574 Ga0068862_1000635744 180
644 3300005983 Ga0081540_1071335 Ga0081540_10713352 180
645 3300005985 Ga0081539_10004359 Ga0081539_1000435915 180
646 3300006028 Ga0070717_10007950 Ga0070717_1000795013 180
647 3300006028 Ga0070717_10451231 Ga0070717_104512312 180
648 3300006173 Ga0070716_100105842 Ga0070716_1001058424 180
649 3300006173 Ga0070716_100137550 Ga0070716_1001375502 180
650 3300006173 Ga0070716_100333897 Ga0070716_1003338971 180
651 3300006173 Ga0070716_100466167 Ga0070716_1004661672 180
652 3300006173 Ga0070716_100803972 Ga0070716_1008039721 180
653 3300006175 Ga0070712_100841590 Ga0070712_1008415902 180
654 3300006237 Ga0097621_100602095 Ga0097621_1006020952 180
655 3300006353 Ga0075370_10103706 Ga0075370_101037063 180
656 3300006358 Ga0068871_100253749 Ga0068871_1002537493 180
657 3300006358 Ga0068871_100425472 Ga0068871_1004254722 180
658 3300006844 Ga0075428_100594780 Ga0075428_1005947802 180
659 3300006844 Ga0075428_101135833 Ga0075428_1011358331 180
660 3300006846 Ga0075430_100048234 Ga0075430_1000482343 180
661 3300006847 Ga0075431_100006546 Ga0075431_10000654616 180
662 3300006847 Ga0075431_100012451 Ga0075431_10001245112 180
663 3300006847 Ga0075431_100062412 Ga0075431_1000624127 180
664 3300006852 Ga0075433_10196766 Ga0075433_101967663 180
665 3300006852 Ga0075433_10218906 Ga0075433_102189062 180
666 3300006852 Ga0075433_10910508 Ga0075433_109105082 180
667 3300006871 Ga0075434_100014841 Ga0075434_1000148414 180
668 3300006871 Ga0075434_100135556 Ga0075434_1001355564 180
669 3300006871 Ga0075434_100147155 Ga0075434_1001471555 180
670 3300006871 Ga0075434_100149590 Ga0075434_1001495905 180
671 3300006871 Ga0075434_100311101 Ga0075434_1003111012 180
672 3300006871 Ga0075434_100980111 Ga0075434_1009801112 180
673 3300006880 Ga0075429_100043278 Ga0075429_1000432788 180
674 3300006880 Ga0075429_100116740 Ga0075429_1001167402 180
675 3300006880 Ga0075429_100192614 Ga0075429_1001926141 180
676 3300006880 Ga0075429_100603236 Ga0075429_1006032362 180
677 3300006881 Ga0068865_100042984 Ga0068865_1000429846 180
678 3300006881 Ga0068865_100114113 Ga0068865_1001141134 180
679 3300006914 Ga0075436_100098077 Ga0075436_1000980773 180
680 3300006931 Ga0097620_100020360 Ga0097620_1000203604 180
681 3300006931 Ga0097620_100052942 Ga0097620_1000529424 180
682 3300006931 Ga0097620_100609021 Ga0097620_1006090211 180
683 3300007076 Ga0075435_100458777 Ga0075435_1004587772 180
684 3300007076 Ga0075435_100943304 Ga0075435_1009433041 180
685 3300009011 Ga0105251_10107438 Ga0105251_101074381 180
686 3300009036 Ga0105244_10011650 Ga0105244_100116503 180
687 3300009036 Ga0105244_10351770 Ga0105244_103517701 180
688 3300009093 Ga0105240_10127569 Ga0105240_101275694 180
689 3300009094 Ga0111539_10000022 Ga0111539_1000002262 180
690 3300009094 Ga0111539_10047047 Ga0111539_100470476 180
691 3300009094 Ga0111539_12530333 Ga0111539_125303331 180
692 3300009098 Ga0105245_10001507 Ga0105245_1000150724 180
693 3300009098 Ga0105245_10067426 Ga0105245_100674265 180
694 3300009098 Ga0105245_10133819 Ga0105245_101338196 180
695 3300009098 Ga0105245_10498453 Ga0105245_104984531 180
696 3300009147 Ga0114129_10001417 Ga0114129_1000141730 180
697 3300009147 Ga0114129_10063914 Ga0114129_100639149 180
698 3300009147 Ga0114129_10237453 Ga0114129_102374534 180
699 3300009147 Ga0114129_10254600 Ga0114129_102546003 180
700 3300009147 Ga0114129_10425680 Ga0114129_104256804 180
701 3300009147 Ga0114129_11058774 Ga0114129_110587742 180
702 3300009147 Ga0114129_11194260 Ga0114129_111942601 180
703 3300009148 Ga0105243_10005446 Ga0105243_1000544614 180
704 3300009148 Ga0105243_10063603 Ga0105243_100636033 180
705 3300009148 Ga0105243_10267171 Ga0105243_102671712 180
706 3300009148 Ga0105243_10293320 Ga0105243_102933202 180
707 3300009148 Ga0105243_10384782 Ga0105243_103847822 180
708 3300009148 Ga0105243_10436767 Ga0105243_104367672 180
709 3300009148 Ga0105243_10499500 Ga0105243_104995002 180
710 3300009174 Ga0105241_10311812 Ga0105241_103118122 180
711 3300009176 Ga0105242_10001940 Ga0105242_1000194016 180
712 3300009176 Ga0105242_10092929 Ga0105242_100929291 180
713 3300009176 Ga0105242_10376498 Ga0105242_103764982 180
714 3300009176 Ga0105242_10377915 Ga0105242_103779152 180
715 3300009176 Ga0105242_10377916 Ga0105242_103779162 180
716 3300009177 Ga0105248_10129876 Ga0105248_101298763 180
717 3300009545 Ga0105237_10239542 Ga0105237_102395423 180
718 3300009551 Ga0105238_10000002 Ga0105238_10000002514 180
719 3300009553 Ga0105249_10000118 Ga0105249_1000011815 180
720 3300009553 Ga0105249_10007788 Ga0105249_1000778816 180
721 3300009553 Ga0105249_10121147 Ga0105249_101211472 180
722 3300011119 Ga0105246_10195568 Ga0105246_101955682 180
723 3300011119 Ga0105246_10653548 Ga0105246_106535481 180
724 3300011119 Ga0105246_10894739 Ga0105246_108947392 180
725 3300011119 Ga0105246_11139647 Ga0105246_111396472 180
726 3300013100 Ga0157373_10346517 Ga0157373_103465171 180
727 3300013100 Ga0157373_10350626 Ga0157373_103506262 180
728 3300013102 Ga0157371_10260026 Ga0157371_102600262 180
729 3300013105 Ga0157369_10001943 Ga0157369_1000194323 180
730 3300013105 Ga0157369_10100872 Ga0157369_101008724 180
731 3300013296 Ga0157374_10000005 Ga0157374_10000005556 180
732 3300013296 Ga0157374_10051849 Ga0157374_100518496 180
733 3300013296 Ga0157374_10318977 Ga0157374_103189771 180
734 3300013297 Ga0157378_10009557 Ga0157378_100095572 180
735 3300013297 Ga0157378_10037124 Ga0157378_100371242 180
736 3300013297 Ga0157378_10046862 Ga0157378_100468628 180
737 3300013297 Ga0157378_10061822 Ga0157378_100618225 180
738 3300013297 Ga0157378_10174597 Ga0157378_101745973 180
739 3300013297 Ga0157378_10951745 Ga0157378_109517452 180
740 3300013297 Ga0157378_11749776 Ga0157378_117497761 180
741 3300013306 Ga0163162_10000059 Ga0163162_1000005995 180
742 3300013306 Ga0163162_10042501 Ga0163162_100425019 180
743 3300013306 Ga0163162_10097255 Ga0163162_100972554 180
744 3300013306 Ga0163162_10749810 Ga0163162_107498103 180
745 3300013306 Ga0163162_10853200 Ga0163162_108532001 180
746 3300013306 Ga0163162_11533232 Ga0163162_115332321 180
747 3300013307 Ga0157372_10229816 Ga0157372_102298164 180
748 3300013307 Ga0157372_11016823 Ga0157372_110168232 180
749 3300013308 Ga0157375_10000055 Ga0157375_1000005582 180
750 3300013308 Ga0157375_10001006 Ga0157375_1000100611 180
751 3300013308 Ga0157375_10071083 Ga0157375_100710837 180
752 3300013308 Ga0157375_10150736 Ga0157375_101507363 180
753 3300013308 Ga0157375_10312790 Ga0157375_103127903 180
754 3300013308 Ga0157375_11166179 Ga0157375_111661791 180
755 3300014325 Ga0163163_10139116 Ga0163163_101391164 180
756 3300014325 Ga0163163_10139935 Ga0163163_101399356 180
757 3300014325 Ga0163163_10644357 Ga0163163_106443572 180
758 3300014325 Ga0163163_11977087 Ga0163163_119770871 180
759 3300014326 Ga0157380_10015819 Ga0157380_100158197 180
760 3300014326 Ga0157380_10034625 Ga0157380_100346253 180
761 3300014326 Ga0157380_10425170 Ga0157380_104251701 180
762 3300014326 Ga0157380_11068164 Ga0157380_110681641 180
763 3300014745 Ga0157377_10000001 Ga0157377_1000000116 180
764 3300014745 Ga0157377_10031186 Ga0157377_100311863 180
765 3300014968 Ga0157379_10043447 Ga0157379_100434478 180
766 3300014968 Ga0157379_10083913 Ga0157379_100839132 180
767 3300014969 Ga0157376_10000003 Ga0157376_10000003248 180
768 3300014969 Ga0157376_10264543 Ga0157376_102645433 180
769 3300017792 Ga0163161_10308965 Ga0163161_103089651 180
770 3300020069 Ga0197907_10527097 Ga0197907_105270976 180
771 3300020069 Ga0197907_11331507 Ga0197907_113315074 180
772 3300020075 Ga0206349_1115449 Ga0206349_11154494 180
773 3300020075 Ga0206349_1228824 Ga0206349_12288244 180
774 3300020077 Ga0206351_10098839 Ga0206351_100988393 180
775 3300020077 Ga0206351_10905449 Ga0206351_109054492 180
776 3300020078 Ga0206352_10193538 Ga0206352_1019353815 180
777 3300020080 Ga0206350_10234328 Ga0206350_1023432815 180
778 3300020080 Ga0206350_10325577 Ga0206350_1032557721 180
779 3300020080 Ga0206350_10574257 Ga0206350_105742575 180
780 3300021358 Ga0213873_10000553 Ga0213873_1000055312 180
781 3300021358 Ga0213873_10005028 Ga0213873_100050284 180
782 3300021377 Ga0213874_10000313 Ga0213874_100003137 180
783 3300021377 Ga0213874_10048447 Ga0213874_100484473 180
784 3300021384 Ga0213876_10000009 Ga0213876_10000009228 180
785 3300021384 Ga0213876_10000058 Ga0213876_1000005891 180
786 3300021384 Ga0213876_10019697 Ga0213876_100196978 180
787 3300021384 Ga0213876_10170647 Ga0213876_101706472 180
788 3300021388 Ga0213875_10025282 Ga0213875_100252827 180
789 3300021388 Ga0213875_10165202 Ga0213875_101652021 180
790 3300022467 Ga0224712_10000482 Ga0224712_1000048212 180
791 3300022467 Ga0224712_10010313 Ga0224712_100103132 180
792 3300025728 Ga0207655_1074984 Ga0207655_10749841 180
793 3300025885 Ga0207653_10149279 Ga0207653_101492792 180
794 3300025893 Ga0207682_10023804 Ga0207682_100238047 180
795 3300025893 Ga0207682_10028648 Ga0207682_100286485 180
796 3300025901 Ga0207688_10636511 Ga0207688_106365111 180
797 3300025906 Ga0207699_10072571 Ga0207699_100725715 180
798 3300025906 Ga0207699_10365446 Ga0207699_103654462 180
799 3300025908 Ga0207643_10017199 Ga0207643_100171995 180
800 3300025908 Ga0207643_10078505 Ga0207643_100785053 180
801 3300025908 Ga0207643_10485184 Ga0207643_104851841 180
802 3300025909 Ga0207705_10146366 Ga0207705_101463663 180
803 3300025910 Ga0207684_10000431 Ga0207684_1000043153 180
804 3300025910 Ga0207684_10034076 Ga0207684_100340768 180
805 3300025910 Ga0207684_10068492 Ga0207684_100684925 180
806 3300025910 Ga0207684_10072862 Ga0207684_100728623 180
807 3300025910 Ga0207684_10135396 Ga0207684_101353961 180
808 3300025910 Ga0207684_10760785 Ga0207684_107607851 180
809 3300025912 Ga0207707_10170172 Ga0207707_101701725 180
810 3300025912 Ga0207707_10511053 Ga0207707_105110533 180
811 3300025913 Ga0207695_10091115 Ga0207695_100911154 180
812 3300025915 Ga0207693_10287522 Ga0207693_102875222 180
813 3300025915 Ga0207693_10530848 Ga0207693_105308482 180
814 3300025916 Ga0207663_10075460 Ga0207663_100754603 180
815 3300025916 Ga0207663_10274480 Ga0207663_102744802 180
816 3300025916 Ga0207663_10314350 Ga0207663_103143502 180
817 3300025917 Ga0207660_10137592 Ga0207660_101375923 180
818 3300025917 Ga0207660_10717401 Ga0207660_107174011 180
819 3300025918 Ga0207662_10052948 Ga0207662_100529481 180
820 3300025922 Ga0207646_10000630 Ga0207646_1000063015 180
821 3300025922 Ga0207646_10000708 Ga0207646_100007082 180
822 3300025922 Ga0207646_10030710 Ga0207646_100307102 180
823 3300025922 Ga0207646_10080346 Ga0207646_100803467 180
824 3300025922 Ga0207646_10178348 Ga0207646_101783483 180
825 3300025922 Ga0207646_10383686 Ga0207646_103836862 180
826 3300025922 Ga0207646_10392368 Ga0207646_103923682 180
827 3300025922 Ga0207646_10867299 Ga0207646_108672992 180
828 3300025923 Ga0207681_10002895 Ga0207681_1000289510 180
829 3300025923 Ga0207681_10018422 Ga0207681_100184221 180
830 3300025924 Ga0207694_10000001 Ga0207694_10000001513 180
831 3300025925 Ga0207650_10001512 Ga0207650_1000151215 180
832 3300025926 Ga0207659_10000036 Ga0207659_1000003649 180
833 3300025927 Ga0207687_10000005 Ga0207687_10000005422 180
834 3300025927 Ga0207687_10002330 Ga0207687_1000233017 180
835 3300025927 Ga0207687_10241063 Ga0207687_102410632 180
836 3300025933 Ga0207706_10100663 Ga0207706_101006631 180
837 3300025933 Ga0207706_10122129 Ga0207706_101221294 180
838 3300025933 Ga0207706_10257235 Ga0207706_102572352 180
839 3300025934 Ga0207686_10001337 Ga0207686_1000133713 180
840 3300025934 Ga0207686_10110303 Ga0207686_101103032 180
841 3300025934 Ga0207686_10230913 Ga0207686_102309131 180
842 3300025935 Ga0207709_10009706 Ga0207709_100097066 180
843 3300025935 Ga0207709_10326828 Ga0207709_103268282 180
844 3300025935 Ga0207709_10532146 Ga0207709_105321462 180
845 3300025937 Ga0207669_10113601 Ga0207669_101136014 180
846 3300025938 Ga0207704_10004874 Ga0207704_100048749 180
847 3300025938 Ga0207704_10450541 Ga0207704_104505411 180
848 3300025939 Ga0207665_10077046 Ga0207665_100770466 180
849 3300025939 Ga0207665_10105427 Ga0207665_101054274 180
850 3300025940 Ga0207691_10002644 Ga0207691_1000264420 180
851 3300025942 Ga0207689_10009254 Ga0207689_1000925414 180
852 3300025942 Ga0207689_10009503 Ga0207689_100095036 180
853 3300025942 Ga0207689_10010598 Ga0207689_1001059810 180
854 3300025942 Ga0207689_10040739 Ga0207689_100407393 180
855 3300025942 Ga0207689_10162913 Ga0207689_101629132 180
856 3300025942 Ga0207689_11012370 Ga0207689_110123701 180
857 3300025944 Ga0207661_10000006 Ga0207661_10000006454 180
858 3300025944 Ga0207661_11134445 Ga0207661_111344452 180
859 3300025945 Ga0207679_10034524 Ga0207679_100345242 180
860 3300025945 Ga0207679_10158818 Ga0207679_101588181 180
861 3300025945 Ga0207679_10230992 Ga0207679_102309924 180
862 3300025960 Ga0207651_10070128 Ga0207651_100701282 180
863 3300025961 Ga0207712_10000709 Ga0207712_1000070912 180
864 3300025961 Ga0207712_10302180 Ga0207712_103021802 180
865 3300025972 Ga0207668_10004545 Ga0207668_1000454512 180
866 3300025972 Ga0207668_10058291 Ga0207668_100582912 180
867 3300025972 Ga0207668_10475212 Ga0207668_104752122 180
868 3300025972 Ga0207668_10936671 Ga0207668_109366711 180
869 3300025981 Ga0207640_10196065 Ga0207640_101960653 180
870 3300025986 Ga0207658_10124942 Ga0207658_101249422 180
871 3300025986 Ga0207658_10227130 Ga0207658_102271303 180
872 3300026023 Ga0207677_10000101 Ga0207677_1000010162 180
873 3300026023 Ga0207677_10000141 Ga0207677_1000014144 180
874 3300026023 Ga0207677_10928524 Ga0207677_109285241 180
875 3300026035 Ga0207703_10032311 Ga0207703_100323114 180
876 3300026035 Ga0207703_10685623 Ga0207703_106856232 180
877 3300026035 Ga0207703_10710044 Ga0207703_107100442 180
878 3300026041 Ga0207639_10000013 Ga0207639_1000001333 180
879 3300026067 Ga0207678_10212259 Ga0207678_102122591 180
880 3300026075 Ga0207708_10116208 Ga0207708_101162082 180
881 3300026075 Ga0207708_10476606 Ga0207708_104766061 180
882 3300026075 Ga0207708_10873482 Ga0207708_108734822 180
883 3300026088 Ga0207641_10089316 Ga0207641_100893163 180
884 3300026088 Ga0207641_10335742 Ga0207641_103357423 180
885 3300026095 Ga0207676_10000023 Ga0207676_10000023169 180
886 3300026095 Ga0207676_10098561 Ga0207676_100985614 180
887 3300026095 Ga0207676_10507545 Ga0207676_105075452 180
888 3300026095 Ga0207676_10760610 Ga0207676_107606101 180
889 3300026116 Ga0207674_10141748 Ga0207674_101417485 180
890 3300026116 Ga0207674_10193921 Ga0207674_101939212 180
891 3300026116 Ga0207674_10677704 Ga0207674_106777041 180
892 3300026118 Ga0207675_100068381 Ga0207675_1000683813 180
893 3300026118 Ga0207675_100109886 Ga0207675_1001098864 180
894 3300026118 Ga0207675_101408081 Ga0207675_1014080811 180
895 3300026142 Ga0207698_10977438 Ga0207698_109774382 180
896 3300027424 Ga0209984_1004426 Ga0209984_10044263 180
897 3300027471 Ga0209995_1011397 Ga0209995_10113973 180
898 3300027543 Ga0209999_1004693 Ga0209999_10046932 180
899 3300027614 Ga0209970_1005891 Ga0209970_10058913 180
900 3300027665 Ga0209983_1000280 Ga0209983_100028015 180
901 3300027682 Ga0209971_1000384 Ga0209971_10003844 180
902 3300027695 Ga0209966_1013867 Ga0209966_10138674 180
903 3300027695 Ga0209966_1043285 Ga0209966_10432852 180
904 3300027717 Ga0209998_10002827 Ga0209998_100028271 180
905 3300027876 Ga0209974_10004420 Ga0209974_100044206 180
906 3300027907 Ga0207428_10000030 Ga0207428_1000003062 180
907 3300027907 Ga0207428_10073683 Ga0207428_100736834 180
908 3300028380 Ga0268265_10009861 Ga0268265_100098613 180
909 3300028380 Ga0268265_10022343 Ga0268265_100223435 180
910 3300028380 Ga0268265_10136452 Ga0268265_101364521 180
911 3300028381 Ga0268264_10144015 Ga0268264_101440153 180
912 3300028381 Ga0268264_10200084 Ga0268264_102000842 180
913 3300028381 Ga0268264_10380109 Ga0268264_103801092 180
914 3300028800 Ga0265338_10036788 Ga0265338_1003678810 180
915 3300030521 Ga0307511_10002513 Ga0307511_1000251328 180
916 3300030889 Ga0265761_107552 Ga0265761_1075521 180
917 3300031235 Ga0265330_10021074 Ga0265330_100210744 180
918 3300031247 Ga0265340_10031321 Ga0265340_100313213 180
919 3300031251 Ga0265327_10090986 Ga0265327_100909861 180
920 3300031456 Ga0307513_10016578 Ga0307513_100165787 180
921 3300031548 Ga0307408_100268050 Ga0307408_1002680502 180
922 3300031548 Ga0307408_100867718 Ga0307408_1008677182 180
923 3300031711 Ga0265314_10000833 Ga0265314_1000083334 180
924 3300031901 Ga0307406_10128816 Ga0307406_101288163 180
925 3300031911 Ga0307412_10660458 Ga0307412_106604581 180
926 3300032002 Ga0307416_100246657 Ga0307416_1002466574 180
927 3300032002 Ga0307416_101171787 Ga0307416_1011717871 180
928 3300032002 Ga0307416_101768943 Ga0307416_1017689431 180
929 3300035086 Ga0373934_0007545 Ga0373934_0007545_703_1248 180
930 3300035089 Ga0373944_0114041 Ga0373944_0114041_48_590 180
931 3300035090 Ga0373949_0017759 Ga0373949_0017759_711_1268 180
932 3300035115 Ga0373941_0062111 Ga0373941_0062111_94_645 180
933 3300035117 Ga0373953_0008828 Ga0373953_0008828_59_604 180
934 3300035118 Ga0373954_0008600 Ga0373954_0008600_326_871 180
935 3300035120 Ga0373957_0017064 Ga0373957_0017064_1228_1773 180
936 3300035171 Ga0373946_0322848 Ga0373946_0322848_31_573 180
937 3300035172 Ga0373955_0518973 Ga0373955_0518973_38_583 180
938 3300035410 Ga0373924_0316261 Ga0373924_0316261_104_646 180
939 3300035695 Ga0373927_0819978 Ga0373927_0819978_58_600 180
940 3300035724 Ga0373933_0665113 Ga0373933_0665113_88_630 180
941 3300036401 Ga0373937_0036358 Ga0373937_0036358_334_879 180
942 3300037418 Ga0395900_0395376 Ga0395900_0395376_788_1330 180
943 3300037471 Ga0395905_0004072 Ga0395905_0004072_1024_1566 180
944 3300037471 Ga0395905_0335843 Ga0395905_0335843_264_806 180
945 3300037471 Ga0395905_0617827 Ga0395905_0617827_114_656 180
946 3300037471 Ga0395905_1168441 Ga0395905_1168441_89_631 180
947 3300037853 Ga0436364_0600523 Ga0436364_0600523_883_1425 180
948 3300037853 Ga0436364_0754414 Ga0436364_0754414_58_600 180
949 3300037853 Ga0436364_1316563 Ga0436364_1316563_1601_2143 180
950 3300039062 Ga0400483_155646 Ga0400483_155646_110_652 180
951 3300039437 Ga0436365_0048919 Ga0436365_0048919_87_629 180
952 3300039437 Ga0436365_0154164 Ga0436365_0154164_2688_3230 180
953 3300039437 Ga0436365_0332019 Ga0436365_0332019_1028_1570 180
954 3300039437 Ga0436365_0340116 Ga0436365_0340116_586_1128 180
955 3300039437 Ga0436365_0382778 Ga0436365_0382778_1034_1576 180
956 3300039437 Ga0436365_0464141 Ga0436365_0464141_42842_43387 180
957 3300039437 Ga0436365_0647080 Ga0436365_0647080_222_764 180
958 3300039437 Ga0436365_1032223 Ga0436365_1032223_338_880 180
959 3300039438 Ga0436360_0591939 Ga0436360_0591939_108_674 180
960 3300039450 Ga0436363_0537550 Ga0436363_0537550_5678_6220 180
961 3300039453 Ga0436362_0656010 Ga0436362_0656010_5155_5697 180
962 3300039453 Ga0436362_1063276 Ga0436362_1063276_12527_13069 180
963 3300039453 Ga0436362_1065558 Ga0436362_1065558_437_979 180
964 3300039453 Ga0436362_1069013 Ga0436362_1069013_86268_86813 180
965 3300041406 Ga0439439_0016465 Ga0439439_0016465_279_821 180
966 3300041406 Ga0439439_0036614 Ga0439439_0036614_153_695 180
967 3300041496 Ga0451839_0378043 Ga0451839_0378043_365_910 180
968 3300041509 Ga0451843_0181247 Ga0451843_0181247_172_738 180
969 3300042015 Ga0439462_0023689 Ga0439462_0023689_558_1100 180
970 3300042156 Ga0439446_0026364 Ga0439446_0026364_648_1190 180
971 3300042532 Ga0450893_0041135 Ga0450893_0041135_44_595 180
972 3300042876 Ga0451577_0269782 Ga0451577_0269782_475_1017 180
973 3300042876 Ga0451577_0649678 Ga0451577_0649678_342_899 180
974 3300044658 Ga0466972_0002629 Ga0466972_0002629_6487_7029 180
975 3300044683 Ga0466965_0004970 Ga0466965_0004970_1136_1678 180
976 3300044694 Ga0466963_0545387 Ga0466963_0545387_153_695 180
977 3300044706 Ga0466964_0082772 Ga0466964_0082772_523_1068 180
978 3300044735 Ga0466968_0002163 Ga0466968_0002163_4727_5269 180
979 3300044842 Ga0466957_0006920 Ga0466957_0006920_4082_4624 180
980 3300044901 Ga0466960_0002207 Ga0466960_0002207_2330_2872 180
981 3300045051 Ga0451576_0032997 Ga0451576_0032997_421_978 180
982 3300045051 Ga0451576_0718808 Ga0451576_0718808_54_596 180
983 3300046459 Ga0495629_0517482 Ga0495629_0517482_85_630 180
984 3300046472 Ga0495580_0057891 Ga0495580_0057891_1786_2328 180
985 3300046472 Ga0495580_0303839 Ga0495580_0303839_97_639 180
986 3300046519 Ga0495632_0019314 Ga0495632_0019314_1396_1941 180
987 3300046539 Ga0495621_0015538 Ga0495621_0015538_469_1011 180
988 3300046675 Ga0495657_0217306 Ga0495657_0217306_193_735 180
989 3300047320 Ga0495672_0006094 Ga0495672_0006094_2792_3337 180
990 3300047320 Ga0495672_0077350 Ga0495672_0077350_476_1018 180
991 3300047322 Ga0495680_0367266 Ga0495680_0367266_423_968 180
992 3300047446 Ga0495679_007316 Ga0495679_007316_1942_2487 180
993 3300047471 Ga0495684_0024903 Ga0495684_0024903_1381_1926 180
994 3300048088 Ga0495602_0017278 Ga0495602_0017278_3808_4350 180
995 3300048903 Ga0496100_0079592 Ga0496100_0079592_644_1186 180
996 3300048904 Ga0496101_0586164 Ga0496101_0586164_231_773 180
997 3300048905 Ga0496102_0497858 Ga0496102_0497858_173_730 180
998 3300048906 Ga0496103_0019686 Ga0496103_0019686_2832_3389 180
999 3300048907 Ga0496104_0275923 Ga0496104_0275923_521_1105 180
1000 3300048907 Ga0496104_0300228 Ga0496104_0300228_174_719 180
1001 3300048909 Ga0496106_0004259 Ga0496106_0004259_2125_2667 180
1002 3300048912 Ga0496109_0001176 Ga0496109_0001176_14763_15305 180
1003 3300048913 Ga0496110_0209515 Ga0496110_0209515_1113_1670 180
1004 3300048917 Ga0496114_0313364 Ga0496114_0313364_537_1079 180
1005 3300049527 Ga0501311_058651 Ga0501311_058651_12_554 180
1006 3300049569 Ga0501032_0317824 Ga0501032_0317824_73_615 180
1007 3300049571 Ga0501034_0105612 Ga0501034_0105612_1811_2353 180
1008 3300049572 Ga0501036_0083767 Ga0501036_0083767_349_891 180
1009 3300049573 Ga0501037_0001918 Ga0501037_0001918_8709_9251 180
1010 3300049574 Ga0501038_0019238 Ga0501038_0019238_3360_3902 180
1011 3300049574 Ga0501038_0198598 Ga0501038_0198598_366_923 180
1012 3300049576 Ga0501040_0088966 Ga0501040_0088966_1291_1848 180
1013 3300049576 Ga0501040_0509060 Ga0501040_0509060_237_779 180
1014 3300049581 Ga0501047_0033218 Ga0501047_0033218_3635_4177 180
1015 3300049582 Ga0501048_0075654 Ga0501048_0075654_1261_1803 180
1016 3300049583 Ga0501067_0064621 Ga0501067_0064621_1371_1913 180
1017 3300049587 Ga0501071_0392541 Ga0501071_0392541_404_946 180
1018 3300049588 Ga0501072_0079503 Ga0501072_0079503_1491_2048 180
1019 3300049589 Ga0501073_0009833 Ga0501073_0009833_658_1200 180
1020 3300049591 Ga0501075_0042052 Ga0501075_0042052_1390_1932 180
1021 3300049592 Ga0501076_0019380 Ga0501076_0019380_4181_4738 180
1022 3300049741 Ga0501079_0039652 Ga0501079_0039652_1823_2380 180
1023 3300049741 Ga0501079_0971486 Ga0501079_0971486_70_612 180
1024 3300049742 Ga0501080_0004016 Ga0501080_0004016_9319_9861 180
1025 3300049742 Ga0501080_0150585 Ga0501080_0150585_1518_2060 180
1026 3300049742 Ga0501080_0169697 Ga0501080_0169697_28_585 180
1027 3300049742 Ga0501080_0361261 Ga0501080_0361261_400_945 180
1028 3300049743 Ga0501081_0042874 Ga0501081_0042874_2045_2602 180
1029 3300049743 Ga0501081_1115911 Ga0501081_1115911_43_585 180
1030 3300049744 Ga0501083_0521086 Ga0501083_0521086_175_717 180
1031 3300049823 Ga0501044_0007741 Ga0501044_0007741_8769_9311 180
1032 3300049824 Ga0501045_0054880 Ga0501045_0054880_57_599 180
1033 3300049824 Ga0501045_0093809 Ga0501045_0093809_1206_1763 180
1034 3300050494 nmdc:mga06z11_177784_c1 nmdc:mga06z11_177784_c1_584_1126 180
1035 3300050507 nmdc:mga05p37_1055797_c1 nmdc:mga05p37_1055797_c1_243_800 180
1036 3300050507 nmdc:mga05p37_1157389_c1 nmdc:mga05p37_1157389_c1_246_791 180
1037 3300050507 nmdc:mga05p37_1701_c1 nmdc:mga05p37_1701_c1_21632_22186 180
1038 3300050507 nmdc:mga05p37_262169_c1 nmdc:mga05p37_262169_c1_513_1055 180
1039 3300050507 nmdc:mga05p37_28557_c1 nmdc:mga05p37_28557_c1_283_840 180
1040 3300050507 nmdc:mga05p37_430068_c1 nmdc:mga05p37_430068_c1_853_1395 180
1041 3300050507 nmdc:mga05p37_49078_c1 nmdc:mga05p37_49078_c1_2004_2546 180
1042 3300050507 nmdc:mga05p37_53231_c1 nmdc:mga05p37_53231_c1_513_1058 180
1043 3300050508 nmdc:mga09592_296147_c1 nmdc:mga09592_296147_c1_668_1210 180
1044 3300050508 nmdc:mga09592_302628_c1 nmdc:mga09592_302628_c1_753_1295 180
1045 3300050508 nmdc:mga09592_400481_c1 nmdc:mga09592_400481_c1_25_567 180
1046 3300050508 nmdc:mga09592_634272_c1 nmdc:mga09592_634272_c1_152_697 180
1047 3300050508 nmdc:mga09592_88599_c1 nmdc:mga09592_88599_c1_1013_1555 180
1048 3300050509 nmdc:mga0qj67_30909_c1 nmdc:mga0qj67_30909_c1_639_1181 180
1049 3300050510 nmdc:mga06r32_14172_c1 nmdc:mga06r32_14172_c1_5036_5578 180
1050 3300050510 nmdc:mga06r32_15501_c1 nmdc:mga06r32_15501_c1_3224_3766 180
1051 3300050510 nmdc:mga06r32_5062_c1 nmdc:mga06r32_5062_c1_5000_5542 180
1052 3300050511 nmdc:mga08y16_175859_c1 nmdc:mga08y16_175859_c1_602_1144 180
1053 3300050511 nmdc:mga08y16_24_c1 nmdc:mga08y16_24_c1_60658_61200 180
1054 3300050512 nmdc:mga0n895_15345_c1 nmdc:mga0n895_15345_c1_5153_5710 180
1055 3300050512 nmdc:mga0n895_165230_c1 nmdc:mga0n895_165230_c1_899_1441 180
1056 3300050512 nmdc:mga0n895_227259_c1 nmdc:mga0n895_227259_c1_674_1216 180
1057 3300050512 nmdc:mga0n895_24370_c1 nmdc:mga0n895_24370_c1_3515_4060 180
1058 3300050512 nmdc:mga0n895_459873_c1 nmdc:mga0n895_459873_c1_136_678 180
1059 3300050512 nmdc:mga0n895_629021_c1 nmdc:mga0n895_629021_c1_359_901 180
1060 3300050512 nmdc:mga0n895_682568_c1 nmdc:mga0n895_682568_c1_136_690 180
1061 3300050513 nmdc:mga0rr50_433462_c1 nmdc:mga0rr50_433462_c1_278_832 180
1062 3300050514 nmdc:mga08x19_87268_c1 nmdc:mga08x19_87268_c1_1059_1613 180
1063 3300050515 nmdc:mga0a205_234689_c1 nmdc:mga0a205_234689_c1_879_1421 180
1064 3300050515 nmdc:mga0a205_245638_c1 nmdc:mga0a205_245638_c1_1045_1587 180
1065 3300050515 nmdc:mga0a205_27799_c1 nmdc:mga0a205_27799_c1_738_1280 180
1066 3300050515 nmdc:mga0a205_410039_c1 nmdc:mga0a205_410039_c1_512_1066 180
1067 3300050515 nmdc:mga0a205_8807_c1 nmdc:mga0a205_8807_c1_3733_4290 180
1068 3300053078 Ga0495612_0113656 Ga0495612_0113656_287_829 180
1069 3300053139 Ga0500568_0002264 Ga0500568_0002264_670_1212 180
1070 3300054114 Ga0501084_0074131 Ga0501084_0074131_430_972 180
1071 3300059477 Ga0587084_009768 Ga0587084_009768_531_1073 180
1072 3300059477 Ga0587084_016481 Ga0587084_016481_222_764 180
1073 3300059478 Ga0587093_006640 Ga0587093_006640_533_1075 180
1074 3300059491 Ga0587070_011201 Ga0587070_011201_780_1322 180
1075 3300059492 Ga0587073_0024911 Ga0587073_0024911_158_700 180
1076 3300059504 Ga0587082_003869 Ga0587082_003869_487_1029 180
1077 3300059506 Ga0587085_000796 Ga0587085_000796_276_818 180
1078 3300059508 Ga0587088_011865 Ga0587088_011865_559_1101 180
1079 3300059510 Ga0587090_007706 Ga0587090_007706_356_898 180
1080 3300059511 Ga0587091_013781 Ga0587091_013781_590_1132 180
1081 3300059513 Ga0587094_000627 Ga0587094_000627_1866_2408 180
1082 3300059623 Ga0587101_007952 Ga0587101_007952_549_1091 180
1083 3300059624 Ga0587109_006059 Ga0587109_006059_717_1259 180
1084 3300059624 Ga0587109_030000 Ga0587109_030000_300_848 180
1085 3300059627 Ga0587117_002125 Ga0587117_002125_752_1294 180
1086 3300059639 Ga0587062_000749 Ga0587062_000749_289_831 180
1087 3300059641 Ga0587068_003778 Ga0587068_003778_561_1103 180
1088 3300059643 Ga0587072_014729 Ga0587072_014729_134_676 180
1089 3300059645 Ga0587076_004008 Ga0587076_004008_793_1335 180
1090 3300059648 Ga0587100_002195 Ga0587100_002195_521_1063 180
1091 3300060344 Ga0587071_012931 Ga0587071_012931_531_1073 180
1092 3300060346 Ga0587111_0006696 Ga0587111_0006696_773_1315 180
1093 3300060353 Ga0501082_1494493 Ga0501082_1494493_20_562 180
1094 3300061734 Ga0530510_0572320 Ga0530510_0572320_99_641 180
1095 3300005436 Ga0070713_101247721 Ga0070713_1012477211 181
1096 3300005439 Ga0070711_100046997 Ga0070711_1000469975 181
1097 3300005439 Ga0070711_100294410 Ga0070711_1002944103 181
1098 3300006871 Ga0075434_101034042 Ga0075434_1010340422 181
1099 3300024227 Ga0228598_1001060 Ga0228598_10010604 181
1100 3300025304 Ga0209257_1056203 Ga0209257_10562033 181
1101 3300025916 Ga0207663_10096340 Ga0207663_100963402 181
1102 3300031239 Ga0265328_10188699 Ga0265328_101886991 181
1103 3300031548 Ga0307408_100038105 Ga0307408_1000381053 181
1104 3300031731 Ga0307405_10040438 Ga0307405_100404386 181
1105 3300031824 Ga0307413_10003502 Ga0307413_100035027 181
1106 3300031852 Ga0307410_10004470 Ga0307410_100044705 181
1107 3300031901 Ga0307406_10082192 Ga0307406_100821922 181
1108 3300031903 Ga0307407_10015861 Ga0307407_100158614 181
1109 3300031911 Ga0307412_10009022 Ga0307412_1000902210 181
1110 3300032002 Ga0307416_100019290 Ga0307416_1000192904 181
1111 3300032004 Ga0307414_10019950 Ga0307414_100199504 181
1112 3300032004 Ga0307414_10027746 Ga0307414_100277464 181
1113 3300032005 Ga0307411_10234887 Ga0307411_102348874 181
1114 3300032168 Ga0316593_10010834 Ga0316593_100108343 181
1115 3300035086 Ga0373934_0014666 Ga0373934_0014666_1730_2503 181
1116 3300035170 Ga0373943_0036947 Ga0373943_0036947_691_1464 181
1117 3300035171 Ga0373946_0014205 Ga0373946_0014205_529_1302 181
1118 3300035410 Ga0373924_0015978 Ga0373924_0015978_1401_2174 181
1119 3300035695 Ga0373927_0199596 Ga0373927_0199596_399_1172 181
1120 3300035724 Ga0373933_0004782 Ga0373933_0004782_4634_5407 181
1121 3300036401 Ga0373937_0069217 Ga0373937_0069217_779_1552 181
1122 3300037471 Ga0395905_0572848 Ga0395905_0572848_330_905 181
1123 3300041411 Ga0439466_0055003 Ga0439466_0055003_166_744 181
1124 3300041511 Ga0451855_1923054 Ga0451855_1923054_1007_1552 181
1125 3300042876 Ga0451577_0006363 Ga0451577_0006363_4005_4553 181
1126 3300044712 Ga0453684_0055586 Ga0453684_0055586_3950_4498 181
1127 3300046516 Ga0495628_0058306 Ga0495628_0058306_1038_1811 181
1128 3300046517 Ga0495630_0218936 Ga0495630_0218936_13_786 181
1129 3300046660 Ga0495625_0016058 Ga0495625_0016058_3124_3699 181
1130 3300046663 Ga0495635_0052784 Ga0495635_0052784_1498_2271 181
1131 3300046689 Ga0495613_0163119 Ga0495613_0163119_237_1010 181
1132 3300046690 Ga0495624_0090865 Ga0495624_0090865_456_1229 181
1133 3300047315 Ga0495581_0048090 Ga0495581_0048090_1154_1927 181
1134 3300047322 Ga0495680_0028661 Ga0495680_0028661_2339_3112 181
1135 3300047471 Ga0495684_0106866 Ga0495684_0106866_1075_1848 181
1136 3300049593 Ga0501077_0206050 Ga0501077_0206050_310_879 181
1137 3300049653 Ga0501206_017533 Ga0501206_017533_111_686 181
1138 3300049655 Ga0501208_015304 Ga0501208_015304_578_1153 181
1139 3300049822 Ga0501035_1118227 Ga0501035_1118227_12_587 181
1140 3300050496 nmdc:mga07m45_131724_c1 nmdc:mga07m45_131724_c1_548_1123 181
1141 3300050507 nmdc:mga05p37_497302_c1 nmdc:mga05p37_497302_c1_414_986 181
1142 3300053077 Ga0495601_0177031 Ga0495601_0177031_111_884 181
1143 3300053087 Ga0500643_005686 Ga0500643_005686_4333_4908 181
1144 3300053098 Ga0500650_0081666 Ga0500650_0081666_383_958 181
1145 3300053104 Ga0500556_0000107 Ga0500556_0000107_6779_7354 181
1146 3300053130 Ga0500642_0000007 Ga0500642_0000007_285461_286036 181
1147 3300059491 Ga0587070_021744 Ga0587070_021744_351_911 181
1148 3300059505 Ga0587083_0120053 Ga0587083_0120053_49_597 181
1149 3300059506 Ga0587085_008385 Ga0587085_008385_607_1167 181
1150 3300059512 Ga0587092_021364 Ga0587092_021364_325_885 181
1151 3300059660 Ga0587124_004682 Ga0587124_004682_156_716 181
1152 3300005981 Ga0081538_10000746 Ga0081538_1000074615 182
1153 3300011119 Ga0105246_10552534 Ga0105246_105525342 182
1154 3300012507 Ga0157342_1004951 Ga0157342_10049512 182
1155 3300013306 Ga0163162_11101503 Ga0163162_111015032 182
1156 3300014969 Ga0157376_10485347 Ga0157376_104853472 182
1157 3300021388 Ga0213875_10010857 Ga0213875_100108576 182
1158 3300031852 Ga0307410_10170710 Ga0307410_101707102 182
1159 3300031901 Ga0307406_10014432 Ga0307406_100144322 182
1160 3300031903 Ga0307407_10135498 Ga0307407_101354982 182
1161 3300031911 Ga0307412_10039792 Ga0307412_100397927 182
1162 3300035398 Ga0316574_0001004 Ga0316574_0001004_2319_2867 182
1163 3300037853 Ga0436364_1354648 Ga0436364_1354648_48840_49409 182
1164 3300044658 Ga0466972_0007079 Ga0466972_0007079_926_1495 182
1165 3300044683 Ga0466965_0012715 Ga0466965_0012715_976_1545 182
1166 3300044712 Ga0453684_0020910 Ga0453684_0020910_2928_3635 182
1167 3300044901 Ga0466960_0017262 Ga0466960_0017262_820_1389 182
1168 3300045976 Ga0466967_0044233 Ga0466967_0044233_1015_1584 182
1169 3300046615 Ga0495656_0347301 Ga0495656_0347301_51_629 182
1170 3300061719 Ga0466962_0054472 Ga0466962_0054472_839_1408 182
1171 3300005937 Ga0081455_10015866 Ga0081455_1001586614 183
1172 3300005985 Ga0081539_10033236 Ga0081539_100332363 183
1173 3300006880 Ga0075429_100667185 Ga0075429_1006671852 183
1174 3300017792 Ga0163161_10060636 Ga0163161_100606362 183
1175 3300035398 Ga0316574_0109331 Ga0316574_0109331_508_1059 183
1176 3300035398 Ga0316574_0439226 Ga0316574_0439226_208_759 183
1177 3300038443 Ga0395901_0000654 Ga0395901_0000654_33206_33757 183
1178 3300046517 Ga0495630_0286748 Ga0495630_0286748_306_923 183
1179 3300047472 Ga0495686_0000007 Ga0495686_0000007_329040_329594 183
1180 3300049571 Ga0501034_0608958 Ga0501034_0608958_434_985 183
1181 3300049744 Ga0501083_0232787 Ga0501083_0232787_500_1051 183
1182 3300050508 nmdc:mga09592_521261_c1 nmdc:mga09592_521261_c1_408_971 183
1183 3300050508 nmdc:mga09592_598506_c1 nmdc:mga09592_598506_c1_120_671 183
1184 3300059652 Ga0587107_045475 Ga0587107_045475_116_685 183
1185 3300005340 Ga0070689_100124190 Ga0070689_1001241906 184
1186 3300005548 Ga0070665_100212960 Ga0070665_1002129602 184
1187 3300006051 Ga0075364_10046502 Ga0075364_100465024 184
1188 3300014325 Ga0163163_10873696 Ga0163163_108736961 184
1189 3300025931 Ga0207644_10481732 Ga0207644_104817321 184
1190 3300028794 Ga0307515_10202150 Ga0307515_102021503 184
1191 3300049570 Ga0501033_0340260 Ga0501033_0340260_363_920 184
1192 3300049572 Ga0501036_0062381 Ga0501036_0062381_934_1491 184
1193 3300049575 Ga0501039_0121032 Ga0501039_0121032_255_812 184
1194 3300049578 Ga0501042_0818738 Ga0501042_0818738_23_577 184
1195 3300049580 Ga0501046_0229489 Ga0501046_0229489_171_728 184
1196 3300049582 Ga0501048_0017587 Ga0501048_0017587_3404_3961 184
1197 3300049582 Ga0501048_0362725 Ga0501048_0362725_207_764 184
1198 3300049584 Ga0501068_0657026 Ga0501068_0657026_43_600 184
1199 3300049587 Ga0501071_0164909 Ga0501071_0164909_73_630 184
1200 3300049588 Ga0501072_0114164 Ga0501072_0114164_1187_1744 184
1201 3300049591 Ga0501075_0083880 Ga0501075_0083880_768_1325 184
1202 3300049591 Ga0501075_0504443 Ga0501075_0504443_148_708 184
1203 3300049591 Ga0501075_0551589 Ga0501075_0551589_228_785 184
1204 3300049592 Ga0501076_0297910 Ga0501076_0297910_287_844 184
1205 3300049743 Ga0501081_0286507 Ga0501081_0286507_378_935 184
1206 3300049744 Ga0501083_0208275 Ga0501083_0208275_102_659 184
1207 3300049824 Ga0501045_0091755 Ga0501045_0091755_70_627 184
1208 3300049824 Ga0501045_0417026 Ga0501045_0417026_197_757 184
1209 3300053136 Ga0500559_0013950 Ga0500559_0013950_1966_2523 184
1210 3300054114 Ga0501084_0273530 Ga0501084_0273530_282_839 184
1211 3300060353 Ga0501082_0075942 Ga0501082_0075942_1702_2259 184
1212 3300061734 Ga0530510_0071285 Ga0530510_0071285_1155_1712 184
1213 3300003163 Ga0006759J45824_1039453 Ga0006759J45824_10394536 185
1214 3300003300 Ga0006758J48902_1012886 Ga0006758J48902_10128867 185
1215 3300003300 Ga0006758J48902_1013389 Ga0006758J48902_10133892 185
1216 3300003322 rootL2_10157317 rootL2_101573172 185
1217 3300003323 rootH1_10015553 rootH1_100155534 185
1218 3300003323 rootH1_10085120 rootH1_100851203 185
1219 3300003659 JGI25404J52841_10009653 JGI25404J52841_100096533 185
1220 3300003693 Ga0032354_1058877 Ga0032354_10588773 185
1221 3300004798 Ga0058859_11829127 Ga0058859_118291273 185
1222 3300005295 Ga0065707_10132436 Ga0065707_101324362 185
1223 3300005459 Ga0068867_100022477 Ga0068867_1000224779 185
1224 3300005547 Ga0070693_100261023 Ga0070693_1002610232 185
1225 3300005563 Ga0068855_100021979 Ga0068855_10002197912 185
1226 3300005614 Ga0068856_100040989 Ga0068856_1000409898 185
1227 3300005841 Ga0068863_100525482 Ga0068863_1005254822 185
1228 3300005841 Ga0068863_100871902 Ga0068863_1008719022 185
1229 3300005841 Ga0068863_101271023 Ga0068863_1012710231 185
1230 3300005843 Ga0068860_100129513 Ga0068860_1001295133 185
1231 3300006195 Ga0075366_10018157 Ga0075366_100181578 185
1232 3300006237 Ga0097621_100033934 Ga0097621_1000339346 185
1233 3300006237 Ga0097621_100390168 Ga0097621_1003901682 185
1234 3300006358 Ga0068871_100019563 Ga0068871_1000195633 185
1235 3300006881 Ga0068865_100349059 Ga0068865_1003490592 185
1236 3300009098 Ga0105245_10027267 Ga0105245_100272674 185
1237 3300009176 Ga0105242_10178219 Ga0105242_101782194 185
1238 3300009176 Ga0105242_10520208 Ga0105242_105202082 185
1239 3300009545 Ga0105237_11443511 Ga0105237_114435111 185
1240 3300014325 Ga0163163_11393216 Ga0163163_113932162 185
1241 3300014969 Ga0157376_11069613 Ga0157376_110696132 185
1242 3300021384 Ga0213876_10017136 Ga0213876_100171365 185
1243 3300025899 Ga0207642_10385765 Ga0207642_103857651 185
1244 3300025906 Ga0207699_10268933 Ga0207699_102689332 185
1245 3300025922 Ga0207646_10468882 Ga0207646_104688823 185
1246 3300025927 Ga0207687_10378226 Ga0207687_103782262 185
1247 3300025934 Ga0207686_10119923 Ga0207686_101199233 185
1248 3300025934 Ga0207686_10450479 Ga0207686_104504792 185
1249 3300025949 Ga0207667_10000612 Ga0207667_1000061236 185
1250 3300025986 Ga0207658_10822208 Ga0207658_108222082 185
1251 3300026023 Ga0207677_10000772 Ga0207677_100007724 185
1252 3300026078 Ga0207702_10040498 Ga0207702_100404988 185
1253 3300026088 Ga0207641_10430922 Ga0207641_104309223 185
1254 3300026088 Ga0207641_10563232 Ga0207641_105632323 185
1255 3300026089 Ga0207648_10019210 Ga0207648_100192109 185
1256 3300031249 Ga0265339_10005033 Ga0265339_1000503314 185
1257 3300031344 Ga0265316_10008237 Ga0265316_100082378 185
1258 3300031456 Ga0307513_10090959 Ga0307513_100909595 185
1259 3300031616 Ga0307508_10078439 Ga0307508_100784396 185
1260 3300031711 Ga0265314_10000003 Ga0265314_100000031185 185
1261 3300032002 Ga0307416_100689644 Ga0307416_1006896443 185
1262 3300035083 Ga0373926_0002499 Ga0373926_0002499_2233_2922 185
1263 3300035086 Ga0373934_0008632 Ga0373934_0008632_1095_1766 185
1264 3300035089 Ga0373944_0000533 Ga0373944_0000533_8136_8825 185
1265 3300035111 Ga0373923_0000448 Ga0373923_0000448_4024_4713 185
1266 3300035113 Ga0373936_0025334 Ga0373936_0025334_201_890 185
1267 3300035116 Ga0373945_0000882 Ga0373945_0000882_5015_5704 185
1268 3300035117 Ga0373953_0011305 Ga0373953_0011305_2318_3007 185
1269 3300035410 Ga0373924_0007336 Ga0373924_0007336_2221_2910 185
1270 3300035692 Ga0373935_0280257 Ga0373935_0280257_283_972 185
1271 3300035695 Ga0373927_0105317 Ga0373927_0105317_453_1142 185
1272 3300036401 Ga0373937_0288414 Ga0373937_0288414_188_877 185
1273 3300037068 Ga0373925_0045202 Ga0373925_0045202_1323_2087 185
1274 3300037471 Ga0395905_0092421 Ga0395905_0092421_2130_2786 185
1275 3300039437 Ga0436365_1253031 Ga0436365_1253031_37098_37811 185
1276 3300039450 Ga0436363_0022136 Ga0436363_0022136_137_808 185
1277 3300039450 Ga0436363_0323271 Ga0436363_0323271_306_1019 185
1278 3300045051 Ga0451576_0073380 Ga0451576_0073380_674_1411 185
1279 3300046454 Ga0495592_0136326 Ga0495592_0136326_35_724 185
1280 3300046461 Ga0495641_0076199 Ga0495641_0076199_646_1335 185
1281 3300046462 Ga0495651_0043424 Ga0495651_0043424_1430_2119 185
1282 3300046463 Ga0495653_0062800 Ga0495653_0062800_687_1376 185
1283 3300046475 Ga0495639_0003260 Ga0495639_0003260_4931_5620 185
1284 3300046477 Ga0495664_0017680 Ga0495664_0017680_200_889 185
1285 3300046499 Ga0495594_0008104 Ga0495594_0008104_1633_2322 185
1286 3300046511 Ga0495608_0003772 Ga0495608_0003772_2451_3140 185
1287 3300046516 Ga0495628_0032936 Ga0495628_0032936_197_886 185
1288 3300046517 Ga0495630_0013363 Ga0495630_0013363_202_891 185
1289 3300046525 Ga0495663_0001514 Ga0495663_0001514_1750_2439 185
1290 3300046526 Ga0495666_0007526 Ga0495666_0007526_2232_2921 185
1291 3300046531 Ga0495665_0004028 Ga0495665_0004028_202_891 185
1292 3300046535 Ga0495586_0006192 Ga0495586_0006192_3776_4465 185
1293 3300046559 Ga0495667_0003938 Ga0495667_0003938_1420_2109 185
1294 3300046663 Ga0495635_0004293 Ga0495635_0004293_1929_2618 185
1295 3300046674 Ga0495588_0032738 Ga0495588_0032738_695_1384 185
1296 3300046678 Ga0495599_0058308 Ga0495599_0058308_1693_2382 185
1297 3300046679 Ga0495623_0326026 Ga0495623_0326026_78_767 185
1298 3300046680 Ga0495646_0001927 Ga0495646_0001927_4263_4952 185
1299 3300046690 Ga0495624_0011751 Ga0495624_0011751_5282_5971 185
1300 3300046809 Ga0495600_0002535 Ga0495600_0002535_3457_4146 185
1301 3300047315 Ga0495581_0022118 Ga0495581_0022118_1693_2382 185
1302 3300047317 Ga0495604_0121875 Ga0495604_0121875_997_1686 185
1303 3300047319 Ga0495674_0100487 Ga0495674_0100487_1572_2261 185
1304 3300047471 Ga0495684_0001009 Ga0495684_0001009_5460_6149 185
1305 3300047471 Ga0495684_0417907 Ga0495684_0417907_50_721 185
1306 3300047673 Ga0495593_0016768 Ga0495593_0016768_1958_2647 185
1307 3300048089 Ga0495614_0003011 Ga0495614_0003011_3551_4240 185
1308 3300048906 Ga0496103_0246527 Ga0496103_0246527_444_1100 185
1309 3300048924 Ga0496121_0244620 Ga0496121_0244620_143_844 185
1310 3300048927 Ga0496124_0541390 Ga0496124_0541390_70_717 185
1311 3300049583 Ga0501067_0129961 Ga0501067_0129961_618_1175 185
1312 3300049584 Ga0501068_0078516 Ga0501068_0078516_1061_1621 185
1313 3300049587 Ga0501071_0018420 Ga0501071_0018420_1114_1674 185
1314 3300049589 Ga0501073_0199830 Ga0501073_0199830_348_905 185
1315 3300049590 Ga0501074_0002140 Ga0501074_0002140_7490_8047 185
1316 3300049744 Ga0501083_0071428 Ga0501083_0071428_1367_1924 185
1317 3300050493 nmdc:mga0k408_14443_c1 nmdc:mga0k408_14443_c1_3031_3591 185
1318 3300053077 Ga0495601_0077447 Ga0495601_0077447_476_1165 185
1319 3300053078 Ga0495612_0009262 Ga0495612_0009262_34_723 185
1320 3300053080 Ga0500635_0007996 Ga0500635_0007996_1887_2495 185
1321 3300053084 Ga0495595_0003797 Ga0495595_0003797_3225_3914 185
1322 3300053085 Ga0495619_0002703 Ga0495619_0002703_7250_7939 185
1323 3300053098 Ga0500650_0156728 Ga0500650_0156728_333_896 185
1324 3300054114 Ga0501084_0021102 Ga0501084_0021102_79_636 185
1325 3300060353 Ga0501082_0010286 Ga0501082_0010286_624_1184 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

66

122

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

126

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a63-assembly1.cif.gz_J cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9794 9 182
7azo-assembly1.cif.gz_L5A 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 0.9785 10 185
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9774 9 183
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9768 9 184
8crx-assembly1.cif.gz_f cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.9761 4 185
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9752 9 184 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9645 9 184 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9297 28 183 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9269 28 185 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9105 28 183 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A2V9LY30-F1-model_v4 Large ribosomal subunit protein uL5 0.9974 7 185 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q88XX4-F1-model_v4 Large ribosomal subunit protein uL5 (50S ribosomal protein L5) 0.9972 8 185 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1FQA2-F1-model_v4 Large ribosomal subunit protein uL5 0.9969 12 185 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2V9MCD7-F1-model_v4 Large ribosomal subunit protein uL5 0.9967 9 185 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2N3AXD5-F1-model_v4 Large ribosomal subunit protein uL5 0.9967 20 185 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
78.02 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map